BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15354_g1_i1 len=796 path=[2087:0-795]

Length=796
                                                                      Score     E

gb|AAW78869.1|  polyphenol oxidase                                      276   8e-85   Ipomoea batatas [batate]
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    271   6e-83   Ipomoea batatas [batate]
dbj|BAA92317.1|  polyphenol oxidase I                                   271   6e-83   Ipomoea batatas [batate]
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    244   3e-75   
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    246   2e-74   Ipomoea batatas [batate]
emb|CAC83609.1|  catechol oxidase                                       240   8e-72   Ipomoea batatas [batate]
emb|CDP06093.1|  unnamed protein product                                205   6e-58   
emb|CDO99592.1|  unnamed protein product                                204   1e-57   
gb|ACH69544.1|  catechol oxidase 39kDa isozyme                          191   3e-57   Ipomoea batatas [batate]
gb|ACH69543.1|  catechol oxidase 39kDa isozyme                          191   6e-57   Ipomoea batatas [batate]
emb|CAC83610.1|  catechol oxidase                                       201   7e-57   Ipomoea batatas [batate]
emb|CAC29040.1|  catechol oxidase                                       200   8e-57   Ipomoea batatas [batate]
gb|AAW65103.1|  polyphenol oxidase                                      202   1e-56   Prunus salicina var. cordata
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    200   7e-56   
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                199   8e-56   
gb|ABS88291.1|  polyphenol oxidase                                      198   4e-55   Pyrus x bretschneideri [bai li]
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       197   5e-55   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                197   5e-55   
gb|AFL03159.1|  polyphenol oxidase                                      197   6e-55   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             197   9e-55   
ref|XP_010100572.1|  Polyphenol oxidase                                 190   1e-54   
gb|ACM43505.1|  polyphenoloxidase                                       196   2e-54   Camellia nitidissima
gb|AEL95440.1|  polyphenol oxidase                                      196   2e-54   
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    196   2e-54   
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        196   2e-54   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    195   5e-54   
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             194   7e-54   Populus trichocarpa [western balsam poplar]
gb|AAU12257.1|  polyphenol oxidase                                      194   8e-54   Populus trichocarpa x Populus deltoides
gb|AEY78528.1|  polyphenol oxidase                                      194   9e-54   
gb|AEG78292.1|  polyphenol oxidase                                      194   9e-54   
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    194   1e-53   
dbj|BAB64530.1|  polyphenol oxidase                                     194   1e-53   Pyrus pyrifolia [sha li]
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    193   3e-53   
gb|ADC92563.1|  polyphenol oxidase                                      192   4e-53   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       192   6e-53   Taraxacum officinale [dandelion]
dbj|BAA21676.1|  polyphenol oxidase                                     191   8e-53   Malus domestica [apple tree]
gb|AEE61322.1|  polyphenol oxidase I                                    191   1e-52   
gb|AEQ30073.1|  polyphenol oxidase                                      191   2e-52   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    190   3e-52   
gb|ADP89908.1|  polyphenol oxidase                                      187   5e-52   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    188   1e-51   
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 187   4e-51   
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    187   4e-51   
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 187   4e-51   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    186   8e-51   
gb|AHC98007.1|  PPO                                                     186   1e-50   
dbj|BAM15849.1|  hypothetical protein                                   186   1e-50   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             186   1e-50   
gb|ABX09994.1|  chloroplast polyphenol oxidase                          186   1e-50   Taraxacum officinale [dandelion]
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    185   1e-50   
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    185   1e-50   
ref|XP_010100571.1|  Polyphenol oxidase                                 184   2e-50   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   184   3e-50   
gb|AGU01537.1|  polyphenol oxidase                                      184   6e-50   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    183   1e-49   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    183   1e-49   
gb|AHF20575.1|  polyphenol oxidase                                      182   1e-49   
gb|AHH92831.1|  polyphenol oxidase                                      182   2e-49   
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    182   2e-49   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    182   2e-49   Vitis vinifera
dbj|BAO79386.1|  polyphenol_oxidase                                     182   2e-49   
emb|CBI25830.3|  unnamed protein product                                180   3e-49   
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    181   4e-49   
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  181   4e-49   
ref|XP_010100570.1|  Polyphenol oxidase                                 181   6e-49   
gb|ABI96932.1|  putative polyphenol oxidase                             178   8e-49   Fallugia paradoxa
gb|ABI96945.1|  putative polyphenol oxidase                             178   8e-49   Prunus mexicana [Mexican plum]
gb|ABI96926.1|  putative polyphenol oxidase                             178   9e-49   Cercocarpus betuloides
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    180   1e-48   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         180   1e-48   
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    180   2e-48   
gb|AII22006.1|  polyphenol oxidase-4                                    179   2e-48   
gb|ABI96929.1|  putative polyphenol oxidase                             177   2e-48   Chamaebatiaria millefolium
emb|CAN62983.1|  hypothetical protein VITISV_035472                     180   2e-48   Vitis vinifera
gb|AII22007.1|  polyphenol oxidase-5                                    179   2e-48   
gb|ADI44162.1|  polyphenol oxidase 1                                    179   3e-48   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    179   3e-48   
gb|ABI96930.1|  putative polyphenol oxidase                             177   3e-48   Crataegus monogyna
gb|ABI96927.1|  putative polyphenol oxidase                             176   4e-48   Chaenomeles speciosa [boke]
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    178   6e-48   
gb|ABI96928.1|  putative polyphenol oxidase                             176   6e-48   Chamaebatia foliolosa
gb|ABI96944.1|  putative polyphenol oxidase                             176   7e-48   Prunus dulcis [sweet almond]
gb|ADI44161.1|  polyphenol oxidase 2                                    178   8e-48   
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    177   9e-48   
gb|ABI96939.1|  putative polyphenol oxidase                             175   1e-47   Neillia thyrsiflora
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    177   1e-47   
gb|ACN86310.1|  polyphenol oxidase                                      177   1e-47   Juglans regia
gb|ABI96925.1|  putative polyphenol oxidase                             175   1e-47   Adenostoma fasciculatum [chamise]
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    177   1e-47   
gb|ABI96948.1|  putative polyphenol oxidase                             174   2e-47   Sorbus californica
gb|ABI96951.1|  putative polyphenol oxidase                             174   2e-47   Vauquelinia californica
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    177   3e-47   
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    176   3e-47   
gb|ABI96934.1|  putative polyphenol oxidase                             174   3e-47   Gillenia trifoliata [Bowman's root]
gb|ABI96943.1|  putative polyphenol oxidase                             174   3e-47   Prinsepia sinensis
gb|AFC36521.1|  polyphenol oxidase                                      176   3e-47   
gb|ABI96941.1|  putative polyphenol oxidase                             174   4e-47   Physocarpus capitatus
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    176   4e-47   
gb|ABI96938.1|  putative polyphenol oxidase                             174   5e-47   Lyonothamnus floribundus
gb|ABI96940.1|  putative polyphenol oxidase                             174   5e-47   Oemleria cerasiformis [Oregon plum]
ref|XP_010100574.1|  Polyphenol oxidase                                 176   5e-47   
gb|ABI96931.1|  putative polyphenol oxidase                             173   6e-47   Exochorda racemosa
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    175   7e-47   Ricinus communis
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    175   8e-47   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    175   8e-47   
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    175   8e-47   
gb|ABI96937.1|  putative polyphenol oxidase                             173   9e-47   Kageneckia oblonga
gb|ABI96935.1|  putative polyphenol oxidase                             172   1e-46   Heteromeles arbutifolia
gb|AGC54425.1|  polyphenol oxidase 1                                    175   1e-46   
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    174   1e-46   
gb|AAO16865.1|  polyphenol oxidase                                      174   2e-46   Ananas comosus
gb|ABI96950.1|  putative polyphenol oxidase                             172   2e-46   Spiraea densiflora
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             174   2e-46   
gb|KCW45575.1|  hypothetical protein EUGRSUZ_L00688                     166   2e-46   
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    174   2e-46   
gb|ABI96949.1|  putative polyphenol oxidase                             171   3e-46   Spiraea cantoniensis
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    173   3e-46   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    172   4e-46   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    173   4e-46   
gb|ABI96946.1|  putative polyphenol oxidase                             171   4e-46   Pyrus communis subsp. caucasica
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    172   4e-46   
gb|ABI96936.1|  putative polyphenol oxidase                             171   5e-46   Holodiscus microphyllus
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             172   8e-46   
gb|ABI96933.1|  putative polyphenol oxidase                             170   9e-46   Gillenia stipulata [American-ipecac]
gb|AAO16863.1|  polyphenol oxidase                                      172   9e-46   Ananas comosus
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            172   1e-45   Ananas comosus
gb|ADR78836.1|  polyphenol oxidase                                      172   1e-45   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    171   3e-45   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    171   3e-45   
gb|ACJ04909.1|  polyphenol oxidase                                      170   4e-45   
dbj|BAA21677.1|  polyphenol oxidase                                     170   4e-45   Malus domestica [apple tree]
gb|AII22011.1|  polyphenol oxidase-9                                    170   5e-45   
ref|XP_007025707.1|  Larreatricin hydroxylase isoform 2                 167   6e-45   
gb|ADF59059.2|  polyphenol oxidase V                                    169   1e-44   
gb|AAV65113.1|  polyphenol oidase                                       164   1e-44   Camellia sinensis [black tea]
ref|XP_010647100.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    168   2e-44   
dbj|BAM15848.1|  hypothetical protein                                   168   2e-44   
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    168   2e-44   
gb|ABY84850.1|  polyphenol oxidase                                      167   3e-44   Cydonia oblonga [wen po]
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 168   3e-44   
gb|AEY79826.1|  polyphenol oxidase                                      167   4e-44   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     167   6e-44   Vitis vinifera
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    166   1e-43   
gb|ABR57235.1|  polyphenol oxidase                                      166   1e-43   Camellia sinensis [black tea]
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     166   1e-43   
ref|XP_010100568.1|  Polyphenol oxidase                                 166   2e-43   
ref|XP_010100566.1|  Polyphenol oxidase                                 166   2e-43   
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    166   2e-43   
gb|AAT75166.1|  polyphenol oxidase                                      165   2e-43   Camellia sinensis [black tea]
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg                165   3e-43   
gb|ACR82078.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
gb|AAK13244.1|  polyphenol oxidase                                      165   3e-43   Trifolium pratense [peavine clover]
gb|ABF19602.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis var. assamica [Assam tea]
gb|ABR57236.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    165   3e-43   
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    165   3e-43   Vicia faba [broad bean]
gb|ACN38060.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
gb|ABR10907.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
gb|ACJ04908.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
gb|ACF17425.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
gb|ABR24120.1|  polyphenol oxidase                                      165   3e-43   Camellia sinensis [black tea]
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    165   3e-43   
gb|AEM45936.1|  polyphenol oxidase                                      164   4e-43   
gb|AEM45935.1|  polyphenol oxidase                                      164   5e-43   
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                164   5e-43   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    164   6e-43   
gb|ABA62017.1|  polyphenol oxidase                                      164   6e-43   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    164   7e-43   
ref|XP_003593517.1|  Polyphenol oxidase A1                              164   7e-43   
gb|AEY79825.1|  polyphenol oxidase                                      164   7e-43   
dbj|BAH36895.1|  polyphenol oxidase                                     164   7e-43   Triticum aestivum [Canadian hard winter wheat]
gb|AEM45931.1|  polyphenol oxidase                                      164   8e-43   
gb|ACH69546.1|  catechol oxidase 40kDa isozyme                          154   9e-43   Ipomoea batatas [batate]
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    163   1e-42   
gb|AEM45934.1|  polyphenol oxidase                                      163   1e-42   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    163   2e-42   
gb|ABI96942.1|  putative polyphenol oxidase                             161   2e-42   Dasiphora fruticosa
gb|ACM09905.1|  polyphenol oxidase 1/4                                  162   2e-42   Trifolium pratense [peavine clover]
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             162   3e-42   
gb|ABM68051.1|  polyphenol oxidase                                      162   3e-42   Trifolium pratense [peavine clover]
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    162   3e-42   
gb|AEM45933.1|  polyphenol oxidase                                      162   3e-42   
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    162   3e-42   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    162   4e-42   
gb|ABF19601.1|  polyphenol oxidase                                      162   4e-42   Camellia ptilophylla
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    162   4e-42   
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    161   5e-42   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    161   6e-42   
gb|ACB12082.1|  polyphenol oxidase                                      161   7e-42   Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|ACB12083.1|  polyphenol oxidase                                      161   8e-42   Triticum monococcum [einkorn wheat]
gb|ADF59058.2|  polyphenol oxidase IV                                   160   1e-41   
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             160   1e-41   Populus trichocarpa [western balsam poplar]
gb|ADG85002.1|  polyphenol oxidase                                      160   1e-41   
gb|AAU12256.1|  polyphenol oxidase                                      160   2e-41   Populus trichocarpa x Populus deltoides
gb|ACB12085.1|  polyphenol oxidase                                      155   2e-41   Triticum turgidum subsp. durum
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             160   2e-41   
ref|XP_003593515.1|  Polyphenol oxidase                                 160   3e-41   
gb|AFH00996.1|  polyphenol oxidase II                                   159   3e-41   
gb|ABI96947.1|  putative polyphenol oxidase                             158   3e-41   Rhodotypos scandens [jetbead]
gb|ACB12087.1|  truncated polyphenol oxidase                            158   3e-41   Aegilops tauschii
ref|XP_004171214.1|  PREDICTED: polyphenol oxidase, chloroplastic...    154   3e-41   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    159   4e-41   
gb|AII22009.1|  polyphenol oxidase-7                                    159   4e-41   
dbj|BAO79387.1|  polyphenol_oxidase                                     159   4e-41   
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             159   4e-41   
dbj|BAH36897.1|  polyphenol oxidase                                     159   4e-41   Triticum aestivum [Canadian hard winter wheat]
gb|ABK62803.1|  polyphenol oxidase                                      159   5e-41   Triticum aestivum [Canadian hard winter wheat]
gb|ACB12086.1|  polyphenol oxidase                                      159   5e-41   Aegilops tauschii
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    159   5e-41   
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    159   5e-41   
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       159   5e-41   Populus trichocarpa x Populus deltoides
gb|AED02598.1|  polyphenol oxidase                                      159   5e-41   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    159   6e-41   
dbj|BAK03848.1|  predicted protein                                      158   7e-41   
dbj|BAJ10872.1|  polyphenol oxidase                                     158   7e-41   
gb|AAK13242.1|  polyphenol oxidase                                      158   8e-41   Trifolium pratense [peavine clover]
gb|AAP33165.1|  polyphenol oxidase                                      158   9e-41   Medicago sativa [alfalfa]
gb|EYU34167.1|  hypothetical protein MIMGU_mgv1a026988mg                151   1e-40   
gb|AES87890.2|  polyphenoloxidase                                       157   1e-40   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    157   1e-40   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    154   2e-40   
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             157   2e-40   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             157   2e-40   
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    156   3e-40   Antirrhinum majus [garden snapdragon]
gb|AAS00454.1|  polyphenol oxidase                                      156   3e-40   Triticum aestivum [Canadian hard winter wheat]
gb|AHX26182.1|  polyphenol oxidase                                      156   4e-40   
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             156   4e-40   
ref|XP_010100567.1|  Polyphenol oxidase                                 156   5e-40   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             156   5e-40   
gb|EMT30149.1|  hypothetical protein F775_52610                         153   5e-40   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    155   6e-40   
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             155   6e-40   
gb|ACB12084.1|  polyphenol oxidase                                      155   6e-40   Triticum dicoccoides [wild emmer wheat]
gb|ABK62802.1|  polyphenol oxidase                                      155   6e-40   Triticum aestivum [Canadian hard winter wheat]
gb|ABK62801.1|  polyphenol oxidase                                      155   7e-40   Triticum aestivum [Canadian hard winter wheat]
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       155   7e-40   
gb|AII22005.1|  polyphenol oxidase-3                                    155   8e-40   
dbj|BAA08234.1|  polyphenol oxidase                                     155   9e-40   Phytolacca americana [common pokeberry]
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                155   9e-40   
ref|XP_008356047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    151   1e-39   
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             155   1e-39   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                155   1e-39   
gb|AAK13243.1|  polyphenol oxidase                                      155   1e-39   Trifolium pratense [peavine clover]
gb|ABK62804.1|  polyphenol oxidase                                      154   1e-39   Triticum aestivum [Canadian hard winter wheat]
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                154   2e-39   Malus domestica [apple tree]
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    154   2e-39   
gb|ACP28057.1|  polyphenol oxidase                                      150   2e-39   Populus simonii x Populus nigra
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    154   2e-39   
gb|ACB12081.1|  polyphenol oxidase                                      154   2e-39   Triticum urartu
gb|AII22008.1|  polyphenol oxidase-6                                    154   2e-39   
gb|AEY79824.1|  polyphenol oxidase                                      154   2e-39   
gb|AII22010.1|  polyphenol oxidase-8                                    154   3e-39   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    154   3e-39   
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    154   3e-39   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    154   3e-39   
gb|EEE61719.1|  hypothetical protein OsJ_16224                          149   4e-39   Oryza sativa Japonica Group [Japonica rice]
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      153   5e-39   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    153   5e-39   
ref|XP_011014566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    150   5e-39   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                153   5e-39   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    153   5e-39   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                153   6e-39   
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             152   7e-39   
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    152   1e-38   
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    152   1e-38   
ref|XP_007025703.1|  Larreatricin hydroxylase                           152   1e-38   
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    152   1e-38   
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    152   1e-38   Larrea tridentata
gb|EMS66787.1|  Polyphenol oxidase A1, chloroplastic                    143   1e-38   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          151   1e-38   Sorghum bicolor [broomcorn]
gb|AAC28935.1|  polyphenol oxidase precursor                            151   2e-38   Prunus armeniaca
gb|AAW58109.2|  polyphenol oxidase                                      151   2e-38   Prunus salicina var. cordata
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             151   2e-38   
gb|ABM68052.1|  polyphenol oxidase                                      151   2e-38   Trifolium pratense [peavine clover]
gb|AES87883.2|  polyphenoloxidase                                       150   2e-38   
ref|XP_003605686.1|  Polyphenol oxidase                                 150   2e-38   
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    151   3e-38   
gb|ABN13632.1|  polyphenol oxidase                                      151   3e-38   Doritis pulcherrima x Phalaenopsis hybrid cultivar
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    150   5e-38   
gb|ABG23046.1|  polyphenol oxidase                                      150   5e-38   
gb|ABG23065.1|  polyphenol oxidase                                      150   5e-38   
gb|ABG23091.1|  polyphenol oxidase                                      150   6e-38   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    150   6e-38   
gb|ABG23096.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23066.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23057.1|  polyphenol oxidase                                      150   6e-38   
gb|ACS15330.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23097.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23077.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23059.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23062.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23092.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23042.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23072.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23070.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23067.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23073.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23087.1|  polyphenol oxidase                                      150   6e-38   
gb|ABG23090.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23061.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23075.1|  polyphenol oxidase                                      150   7e-38   
emb|CAH66802.1|  H0215F08.13                                            150   7e-38   
gb|ABG23085.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23045.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23084.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23083.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23047.1|  polyphenol oxidase                                      150   7e-38   
ref|NP_001053932.1|  Os04g0624500                                       150   7e-38   
gb|ABG23098.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23060.1|  polyphenol oxidase                                      150   7e-38   
gb|ABG23086.1|  polyphenol oxidase                                      150   7e-38   
emb|CAE03510.2|  OSJNBa0053K19.18                                       149   7e-38   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          149   7e-38   
gb|EEC78048.1|  hypothetical protein OsI_17489                          149   7e-38   
gb|ABG23093.1|  polyphenol oxidase                                      149   8e-38   
dbj|BAH36896.1|  polyphenol oxidase                                     149   8e-38   
gb|ACS15326.1|  polyphenol oxidase                                      149   9e-38   
gb|ACS15337.1|  polyphenol oxidase                                      149   9e-38   
gb|ACS15319.1|  polyphenol oxidase                                      149   9e-38   
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            148   2e-37   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    148   2e-37   
gb|AHX26181.1|  polyphenol oxidase                                      147   5e-37   
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          147   5e-37   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    147   7e-37   
dbj|BAM15846.1|  hypothetical protein                                   147   8e-37   
gb|AHX26180.1|  polyphenol oxidase                                      146   9e-37   
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     146   1e-36   
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    146   1e-36   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    145   2e-36   
gb|ABG23081.1|  polyphenol oxidase                                      145   2e-36   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    145   3e-36   
ref|XP_006370123.1|  hypothetical protein POPTR_0001s39900g             143   3e-36   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    145   4e-36   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    145   4e-36   
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    144   6e-36   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    144   7e-36   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    144   1e-35   
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    144   1e-35   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                144   1e-35   
ref|XP_007214683.1|  hypothetical protein PRUPE_ppa022943mg             143   1e-35   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    143   2e-35   
emb|CAA73103.1|  polyphenol oxidase                                     142   2e-35   
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    142   4e-35   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    142   4e-35   
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    142   4e-35   
dbj|BAJ10871.1|  polyphenol oxidase                                     142   4e-35   
gb|AAA02877.1|  propolyphenol oxidase                                   141   8e-35   
gb|EPS59410.1|  polyphenoloxidase                                       140   1e-34   
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    140   1e-34   
dbj|BAP82256.1|  polyphenol oxidase                                     140   1e-34   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    140   1e-34
gb|AGC55012.1|  polyphenoloxidase                                       140   1e-34   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             140   1e-34   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    140   1e-34   
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       140   2e-34   
ref|NP_001053930.2|  Os04g0624300                                       134   2e-34   
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    139   3e-34   
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     139   3e-34   
gb|AAB22610.1|  polyphenoloxidase                                       139   4e-34   
dbj|BAA08235.1|  polyphenol oxidase                                     138   5e-34   
dbj|BAP82255.1|  polyphenol oxidase                                     139   5e-34   
dbj|BAP82257.1|  polyphenol oxidase                                     139   5e-34   
dbj|BAP82254.1|  polyphenol oxidase                                     139   6e-34   
dbj|BAP82258.1|  polyphenol oxidase                                     139   6e-34   
gb|AGK83468.1|  polyphenol oxidase                                      138   8e-34   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                138   9e-34   
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    138   1e-33   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    138   1e-33   
ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    137   1e-33   
ref|XP_010100565.1|  Polyphenol oxidase                                 137   1e-33   
gb|AEO00529.1|  polyphenol oxidase                                      137   2e-33   
emb|CAE03506.2|  OSJNBa0053K19.14                                       134   2e-33   
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    137   3e-33   
gb|EEC78047.1|  hypothetical protein OsI_17486                          135   5e-33   
emb|CAH66801.1|  H0215F08.12                                            135   6e-33   
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    135   6e-33   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    135   1e-32   
gb|EAZ13806.1|  hypothetical protein OsJ_03732                          132   1e-32   
ref|NP_001044496.2|  Os01g0793100                                       132   1e-32   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    134   2e-32   
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    134   2e-32   
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...    134   3e-32   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             134   4e-32   
gb|EEC71623.1|  hypothetical protein OsI_04042                          132   6e-32   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    132   9e-32   
gb|AAA85122.1|  polyphenol oxidase                                      132   2e-31   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             131   2e-31   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    131   2e-31   
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    131   3e-31   
gb|AFW59500.1|  putative polyphenol oxidase family protein              130   6e-31   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                130   6e-31   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    130   7e-31   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             129   1e-30   
gb|AGK88243.1|  polyphenol oxidase                                      129   2e-30   
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     128   3e-30   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    128   4e-30   
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    127   7e-30   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    127   7e-30   
gb|ACJ70698.1|  polyphenol oxidase                                      126   1e-29   
emb|CDP06099.1|  unnamed protein product                                125   4e-29   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    125   5e-29   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    125   7e-29   
ref|XP_010110268.1|  Polyphenol oxidase A1                              123   1e-28   
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...    123   3e-28   
ref|XP_007025704.1|  Larreatricin hydroxylase                           121   7e-28   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    122   8e-28   
gb|AHN09736.1|  aurone synthase                                         122   8e-28   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                120   2e-27   
emb|CDP06098.1|  unnamed protein product                                120   2e-27   
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                120   3e-27   
gb|AGT28746.1|  aurone synthase                                         120   4e-27   
gb|AGT28745.1|  aurone synthase                                         119   5e-27   
ref|XP_010647099.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   8e-27   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             119   8e-27   
dbj|BAP82261.1|  polyphenol oxidase                                     113   9e-27   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     118   1e-26   
gb|EPS57764.1|  polyphenol oxidase                                      117   1e-26   
gb|AFS28698.1|  putative polyphenol oxidase                             117   1e-26   
gb|AFS28697.1|  putative polyphenol oxidase                             117   1e-26   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          118   2e-26   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    116   2e-26   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    117   3e-26   
gb|ACR61398.1|  polyphenol oxidase                                      117   3e-26   
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             117   3e-26   
gb|ACR61399.1|  polyphenol oxidase                                      116   4e-26   
gb|AAA85121.1|  polyphenol oxidase                                      117   4e-26   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          117   5e-26   
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             116   5e-26   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    116   6e-26   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             116   8e-26   
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                116   8e-26   
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          115   9e-26   
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    115   1e-25   
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...    115   1e-25   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          115   2e-25   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             115   2e-25   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                115   2e-25   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          115   2e-25   
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             115   2e-25   
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...    114   2e-25   
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)             115   2e-25   
emb|CAG25739.1|  polyphenol oxidase A                                   110   3e-25   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    114   4e-25   
ref|NP_001172601.1|  Os01g0793300                                       111   5e-25   
gb|AET08954.1|  polyphenol oxidase                                      108   5e-25   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             113   6e-25   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                113   6e-25   
gb|AFH00998.1|  polyphenol oxidase III                                  113   8e-25   
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508             113   8e-25   
ref|XP_009388016.1|  PREDICTED: polyphenol oxidase, chloroplastic...    113   8e-25   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    113   8e-25   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             113   9e-25   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       112   1e-24   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             112   1e-24   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       112   2e-24   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          112   2e-24   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    111   2e-24   
gb|AAQ15282.1|  polyphenol oxidase                                      105   2e-24   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             112   2e-24   
ref|XP_009388330.1|  PREDICTED: polyphenol oxidase, chloroplastic...    111   2e-24   
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    112   3e-24   
dbj|BAB89047.1|  putative polyphenol oxidase                            111   3e-24   
ref|NP_001149552.1|  polyphenol oxidase II                              110   3e-24   
ref|XP_007033808.1|  Uncharacterized protein TCM_019921                 110   4e-24   
gb|KHN07289.1|  Polyphenol oxidase A1, chloroplastic                    110   4e-24   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    110   6e-24   
ref|XP_009388018.1|  PREDICTED: polyphenol oxidase, chloroplastic...    110   6e-24   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    110   9e-24   
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like                109   1e-23   
ref|XP_008446638.1|  PREDICTED: polyphenol oxidase, chloroplastic...    109   1e-23   
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    109   2e-23   
ref|XP_004146643.1|  PREDICTED: aureusidin synthase-like                105   3e-23   
gb|ACU23847.1|  unknown                                                 105   3e-23   
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    108   4e-23   
emb|CAN76259.1|  hypothetical protein VITISV_001925                     108   6e-23   
ref|XP_006583805.1|  PREDICTED: polyphenol oxidase II, chloroplas...    107   7e-23   
gb|KGN64652.1|  hypothetical protein Csa_1G073110                       105   9e-23   
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   1e-22   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    107   1e-22   
emb|CDM84541.1|  unnamed protein product                                106   1e-22   
emb|CCE45701.1|  polyphenol oxidase precursor (chloroplast)             107   2e-22   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                    106   2e-22   
ref|XP_002982245.1|  hypothetical protein SELMODRAFT_116300             106   2e-22   
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850          106   3e-22   
ref|XP_002990878.1|  hypothetical protein SELMODRAFT_429255             105   3e-22   
gb|ACN78382.1|  polyphenol oxidase                                      104   4e-22   
ref|XP_002969567.1|  hypothetical protein SELMODRAFT_170754             105   4e-22   
ref|XP_006646401.1|  PREDICTED: polyphenol oxidase, chloroplastic...    105   6e-22   
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like                105   7e-22   
ref|XP_004170850.1|  PREDICTED: polyphenol oxidase, chloroplastic...    103   1e-21   
dbj|BAM15845.1|  hypothetical protein                                   104   1e-21   
ref|XP_004146641.1|  PREDICTED: polyphenol oxidase, chloroplastic...    103   1e-21   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    103   2e-21   
gb|AFW87458.1|  putative polyphenol oxidase family protein              103   2e-21   
dbj|BAJ90144.1|  predicted protein                                      103   2e-21   
ref|NP_001147867.1|  polyphenol oxidase precursor                       103   2e-21   
gb|ABE96885.1|  polyphenol oxidase                                      102   3e-21   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          102   3e-21   
emb|CCD61125.1|  polyphenol oxidase precursor (chloroplast)             103   3e-21   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    102   4e-21   



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   276 bits (706),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 171/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  176  MASLT-SPCTPTA-TTPKSFSSAANLSTPLSKPSQ-HLISSKRNRHFKISCNAAGDGGGD  346
            MAS T SPCT  A  TPKS +S+A +S+PL KPSQ H+ ++KR  HFK+SCNA     GD
Sbjct  1    MASFTTSPCTSAAPKTPKSLASSATISSPLPKPSQIHIATAKRTHHFKVSCNAPN---GD  57

Query  347  SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCP  526
            SQ KLDRRDVLLGLGGL GA+SL++NPLAFA PI APEI+KC VPP DLPP A+VD+CCP
Sbjct  58   SQPKLDRRDVLLGLGGLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDSCCP  117

Query  527  PVATNVINYKLPAVT--TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            P+ATNVI  K+P  +   M++RPA H MDK+ IAKF KA+ LMK LPADDPRNFYQQALV
Sbjct  118  PLATNVIPSKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALV  177

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  178  HCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  209



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 172/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  176  MASLT-SPCTPTA-TTPKSFSSAANLSTPLSKPSQ-HLISSKRNRHFKISCNAAGDGGGD  346
            MAS T SPCT  A  TPKS SS+A +S+PL KPSQ H+ ++KR  HFK+SCNA     GD
Sbjct  1    MASFTTSPCTSAAPKTPKSLSSSATISSPLPKPSQIHIATAKRTHHFKVSCNAPN---GD  57

Query  347  SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCP  526
            SQ KLDRRDVLLGLGGL GA+SL++NPLAFA PI APEI+KC VPP DLPP A+VDNCCP
Sbjct  58   SQPKLDRRDVLLGLGGLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCP  117

Query  527  PVATNVINYKLPAVT--TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            P+ATNVI YK+P  +   M++RPA H MDK+ IAKF KA+ LMK LPADDPRNFYQQALV
Sbjct  118  PLATNVIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALV  177

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  178  HCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  209



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 172/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  176  MASLT-SPCTPTA-TTPKSFSSAANLSTPLSKPSQ-HLISSKRNRHFKISCNAAGDGGGD  346
            MAS T SPCT  A  TPKS SS+A +S+PL KPSQ H+ ++KR  HFK+SCNA     GD
Sbjct  1    MASFTTSPCTSAAPKTPKSLSSSATISSPLPKPSQIHIATAKRTHHFKVSCNAPN---GD  57

Query  347  SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCP  526
            SQ KLDRRDVLLGLGGL GA+SL++NPLAFA PI APEI+KC VPP DLPP A+VDNCCP
Sbjct  58   SQPKLDRRDVLLGLGGLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCP  117

Query  527  PVATNVINYKLPAVT--TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            P+ATNVI YK+P  +   M++RPA H MDK+ IAKF KA+ LMK LPADDPRNFYQQALV
Sbjct  118  PLATNVIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALV  177

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  178  HCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  209



>pdb|1BT1|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT1|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT2|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT2|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT3|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BUG|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
 pdb|1BUG|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
Length=345

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  440  APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAI  619
            APIQAPEI+KC VPPADLPPGAVVDNCCPPVA+N+++YKLPAVTTM+VRPAAHTMDKDAI
Sbjct  1    APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKLPAVTTMKVRPAAHTMDKDAI  60

Query  620  AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            AKFAKAVELMKALPADDPRNFYQQALVHCAYCNG YDQVNFPDQEIQVHNSWLFFPFHR
Sbjct  61   AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  119



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  440  APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAI  619
            APIQAPEI+KC VPPADLPPGAVVDNCCPPVA+N+++YKLPAVTTM+VRPAAHTMDKDAI
Sbjct  1    APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKLPAVTTMKVRPAAHTMDKDAI  60

Query  620  AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            AKFAKAVELMKALPADDPRNFYQQALVHCAYCNG YDQVNFPDQEIQVHNSWLFFPFHR
Sbjct  61   AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  119



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  440  APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAI  619
            APIQAPEI+KC VPPADLPPGAVVDNCCPPVA+N+++YK+P VTTM+VRPAAHTMDKDAI
Sbjct  1    APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKIPVVTTMKVRPAAHTMDKDAI  60

Query  620  AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            AKFA+AV+LM+ALP DDPRNFYQQALVHCAYCNG YDQVNFPDQEIQVHNSWLFFPFHR
Sbjct  61   AKFARAVDLMRALPGDDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  119



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 149/211 (71%), Gaps = 11/211 (5%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRN-RHFKISCNAAGDGGGDS  349
            MASL+   TP  ++    S++   S P S KPSQ  +S+KRN R F +SC    +   + 
Sbjct  1    MASLS---TPLQSSTAYSSTSTLSSCPFSTKPSQFYLSAKRNYRQFTVSCK--NNESHEQ  55

Query  350  QSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVV-DNCCP  526
               LDRRDVLLGLGGLYGAS+L+ NP A AAPI APEI+KC  PPADLPPGAVV DNCCP
Sbjct  56   VDNLDRRDVLLGLGGLYGASNLIINPFAMAAPIAAPEISKCG-PPADLPPGAVVTDNCCP  114

Query  527  PVATNVINYKLPAVTTM-RVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVH  703
            PV   VI+YKLP    + R RPAAH + KD I K  KAVELMKALPADDPRNF QQA VH
Sbjct  115  PVPGKVIDYKLPPPPKVNRFRPAAHLVKKDYIEKLNKAVELMKALPADDPRNFTQQANVH  174

Query  704  CAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            CAYCNGAY Q    DQEI VH SWLFFPFHR
Sbjct  175  CAYCNGAYVQPG-SDQEISVHYSWLFFPFHR  204



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 140/189 (74%), Gaps = 8/189 (4%)
 Frame = +2

Query  233  SAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASS  412
            S+ + S  L+K      + KRN HFK+SC A      + +    RR+VL+GLGGLYGA+S
Sbjct  17   SSLHYSPFLAKTFHISTTKKRNHHFKVSCQAT-----NGERNASRRNVLIGLGGLYGAAS  71

Query  413  LVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRP  589
            L ++P A AAPIQAP+++KC   PADLP GA   NCCPP AT ++++KLPA   T+RVRP
Sbjct  72   LAADPFALAAPIQAPDVSKCG--PADLPSGATPTNCCPPPATTIVDFKLPAPSNTLRVRP  129

Query  590  AAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHN  769
            AAH +D+  IAKF +AV+LMKALP DDPR+F QQA VHCAYC+GAYDQV FP+ E+QVHN
Sbjct  130  AAHLVDEAYIAKFQRAVQLMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPNLELQVHN  189

Query  770  SWLFFPFHR  796
            SWLF PFHR
Sbjct  190  SWLFLPFHR  198



>gb|ACH69544.1| catechol oxidase 39kDa isozyme [Ipomoea batatas]
Length=152

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPPVA+N+I+YKLPAVTTM+VRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV
Sbjct  1    CPPVASNIIDYKLPAVTTMKVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  60

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNG YDQVNFPDQEIQVHNSWLFFPFHR
Sbjct  61   HCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  92



>gb|ACH69543.1| catechol oxidase 39kDa isozyme [Ipomoea batatas]
 gb|ACH69545.1| catechol oxidase 39kDa isozyme [Ipomoea batatas]
Length=152

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPPVA+N+++YKLPAVTTM+VRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV
Sbjct  1    CPPVASNIVDYKLPAVTTMKVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  60

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNG YDQVNFPDQEIQVHNSWLFFPFHR
Sbjct  61   HCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  92



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = +2

Query  443  PIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVT--TMRVRPAAHTMDKDA  616
            PI APEI+KC VPP DLPP A+VDNCCPP+ATNVI YK+P  +   M++RPA H MDK+ 
Sbjct  2    PIHAPEISKCVVPPKDLPPDAIVDNCCPPLATNVIPYKVPKTSPSAMKIRPAIHRMDKEY  61

Query  617  IAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            IAKF KA+ LMK LPADDPRNFYQQALVHCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  62   IAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  121



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = +2

Query  443  PIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVT--TMRVRPAAHTMDKDA  616
            PI APEI+KC VPP DLPP A+VDNCCPP+ATNVI YK+P  +   M++RPA H MDK+ 
Sbjct  2    PIHAPEISKCVVPPKDLPPDAIVDNCCPPLATNVIPYKVPRTSPSAMKIRPAIHRMDKEY  61

Query  617  IAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            IAKF KA+ LMK LPADDPRNFYQQALVHCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  62   IAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  121



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 14/212 (7%)
 Frame = +2

Query  176  MASLTSPCT--PTATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAG-DGGG  343
            MASL+SP     T+T P S F+  ++  + LSKP       KR+   ++SC A   D   
Sbjct  1    MASLSSPLAIPTTSTKPLSPFTQNSSQVSLLSKP-------KRSFSPRVSCKAKNSDNQN  53

Query  344  D-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNC  520
            D +Q+KLDRR+VLLGLGGLYG + L ++P AFA P+  P+++KC    ADLP GA   NC
Sbjct  54   DQAQTKLDRRNVLLGLGGLYGVAGLGTDPFAFAKPVNPPDLSKCGA--ADLPTGATPTNC  111

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPP+AT +I++KLPA   +RVRPAAH +D+  I K++KA+ELMKALP DDPR+F QQA V
Sbjct  112  CPPLATKIIDFKLPAPGKLRVRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANV  171

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAYDQ  FPD E+Q+HNSWLFFPFHR
Sbjct  172  HCAYCDGAYDQAGFPDLELQIHNSWLFFPFHR  203



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 154/220 (70%), Gaps = 17/220 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHF--KISCNA-------  325
            MASL SP   T  TP S S+A+    P + + SQ  I  KR      K+SC A       
Sbjct  1    MASL-SPLNHTLLTPASSSNASTSLCPFNQRRSQVPIVGKRRYRMVRKVSCEATDGEKKP  59

Query  326  --AGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
              +G+  G S  +LDRR+VL+GLGGLYGA+ L ++ LAF API  P+++KC    A+LP 
Sbjct  60   TRSGNEEG-SLGRLDRRNVLIGLGGLYGATGLGADRLAFGAPIMPPDLSKCGA--ANLPA  116

Query  500  GAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
            GA   NCCPP ++ ++++KLP+ +  MRVRPAAH +D++ IAK++KA+ LMKALPADDPR
Sbjct  117  GAKPTNCCPPASSEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPR  176

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            NF QQA VHCAYC+GAYDQ+ FPD E+QVHNSWLFFPFHR
Sbjct  177  NFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFPFHR  216



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 132/180 (73%), Gaps = 4/180 (2%)
 Frame = +2

Query  263  KPSQHLISSKRNRHFKISCNA-AGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFA  439
            KP       K+NR  K+SC +   D    +  K DRR+VL+GLGGLYGA++L ++P +FA
Sbjct  26   KPRHFPTIRKQNRCPKVSCKSPDNDQESAAPGKFDRRNVLIGLGGLYGATTLAASPFSFA  85

Query  440  APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDA  616
            API AP+I KC   PADLPPGA   NCCPP    +I++K P   TTMRVRPAAH  D+  
Sbjct  86   APISAPDITKCG--PADLPPGAAPTNCCPPPTAKIIDFKFPPPSTTMRVRPAAHLADEAY  143

Query  617  IAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            IAKF KAVELM+ALP DDPR+F QQA VHCAYC+GAYDQV FP+ E+QVHNSWLFFPFHR
Sbjct  144  IAKFNKAVELMRALPEDDPRSFKQQASVHCAYCDGAYDQVGFPNLELQVHNSWLFFPFHR  203



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKP-SQHLISSKRNRHF--KISCNAAGDGGGD-SQ  352
            +TS   P  T P   + A    +P S+  SQ  + +K  R F  K+SC A  +   D +Q
Sbjct  1    MTSLSPPVVTNPTVPNPATKPFSPFSQNNSQVSLLTKPKRSFARKVSCKATNNDQNDQAQ  60

Query  353  SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            SKLDRR+VLLGLGGLYG + + ++P AFA PI  P+++KC    ADLPPGA   NCCPP 
Sbjct  61   SKLDRRNVLLGLGGLYGVAGMGTDPFAFAKPIAPPDVSKCG--SADLPPGAEATNCCPPP  118

Query  533  ATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAY  712
            AT +I++KLPA   +R+RP AH +DK    KF KA+ELMKALP DDPR+F QQA VHCAY
Sbjct  119  ATKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAY  178

Query  713  CNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            C+GAYDQ  FP+ E+QVH+SWLFFPFHR
Sbjct  179  CDGAYDQAGFPELELQVHDSWLFFPFHR  206



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 150/212 (71%), Gaps = 14/212 (7%)
 Frame = +2

Query  176  MASLTSPCT--PTATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAG-DGGG  343
            MASL+ P     T+T P S F+  ++  + LSKP       KR+   ++SC A   D   
Sbjct  1    MASLSPPLAVPTTSTKPLSPFTQNSSQVSLLSKP-------KRSFSPRVSCKAKNSDNQN  53

Query  344  D-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNC  520
            D +Q+KLDRR+VLLGLGGLYG + L ++P AFA P+  P+++KC    ADLP GA   NC
Sbjct  54   DQAQTKLDRRNVLLGLGGLYGVAGLGTDPFAFAKPVTPPDLSKCGA--ADLPTGATPTNC  111

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPP AT +I++KLPA   +RVRPAAH +D+  I K++KA+ELMKALP DDPR+F QQA V
Sbjct  112  CPPPATKIIDFKLPAPGKLRVRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANV  171

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAYDQ  FPD E+Q+HNSWLFFPFHR
Sbjct  172  HCAYCDGAYDQAGFPDLELQIHNSWLFFPFHR  203



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = +2

Query  248  STPLSKPSQHL--ISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVS  421
            S+PL     H+  I    +RH  ISC +  +   +   K DRRDVL+GLGGLYGA++L +
Sbjct  21   SSPLLVKPTHIPTIRKPSHRHI-ISCKSTNNHDQEPAGKFDRRDVLIGLGGLYGATTLSA  79

Query  422  NPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAH  598
            +P AFAAPI AP++ KC   PADLP GA   NCCPP    +++YK P   TTMRVRPAAH
Sbjct  80   SPFAFAAPISAPDVTKCG--PADLPQGAAPTNCCPPPTATIVDYKFPPPSTTMRVRPAAH  137

Query  599  TMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWL  778
              DK  +AKF +A+ELM+ALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWL
Sbjct  138  LADKAYVAKFNRAMELMRALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPNLELQVHNSWL  197

Query  779  FFPFHR  796
            FFPFHR
Sbjct  198  FFPFHR  203



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 145/207 (70%), Gaps = 12/207 (6%)
 Frame = +2

Query  185  LTSPCTPT-ATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQS  355
            +T+P  P  AT P S FS   +  + L+KP       KR+   K+SC A  +   D +QS
Sbjct  9    VTNPTVPNPATKPFSPFSQNNSQVSLLTKP-------KRSFARKVSCKATNNDQNDQAQS  61

Query  356  KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVA  535
            KLDRR+VLLGLGGLYG + + ++P AFA PI  P+++KC    ADLPPGA   NCCPP A
Sbjct  62   KLDRRNVLLGLGGLYGVAGMGTDPFAFAKPIAPPDVSKCG--SADLPPGAEATNCCPPPA  119

Query  536  TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
            T +I++KLPA   +R+RP AH +DK    KF KA+ELMKALP DDPR+F QQA VHCAYC
Sbjct  120  TKIIDFKLPAPAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYC  179

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +GAYDQ  FP+ E+QVH+SWLFFPFHR
Sbjct  180  DGAYDQAGFPELELQVHDSWLFFPFHR  206



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 150/212 (71%), Gaps = 14/212 (7%)
 Frame = +2

Query  176  MASLTSP--CTPTATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAG-DGGG  343
            MASL+ P     T+T P S F+  ++  + LSKP       KR+   ++SC A   D   
Sbjct  1    MASLSPPPAIPTTSTKPLSPFTQNSSQVSLLSKP-------KRSFSPRVSCKAKNSDNQN  53

Query  344  D-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNC  520
            D +Q+KLDRR+VLLGLGGLYG + L ++P AFA P+  P+++KC    ADLP GA   NC
Sbjct  54   DQAQTKLDRRNVLLGLGGLYGVAGLGTDPFAFAKPVNPPDLSKCGA--ADLPTGATPTNC  111

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPP AT +I++KLPA   +R+RPAAH +D+  I K++KA+ELMKALP DDPR+F QQA V
Sbjct  112  CPPPATKIIDFKLPAPGKLRIRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANV  171

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAYDQ  FPD E+Q+HNSWLFFPFHR
Sbjct  172  HCAYCDGAYDQAGFPDLELQIHNSWLFFPFHR  203



>ref|XP_010100572.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82815.1| Polyphenol oxidase [Morus notabilis]
Length=333

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +2

Query  281  ISSKRNRHFKISCNAAGDGGGDSQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAP  457
            I + R +   ISC  +G+       K+DRR+ ++   G     + L S PLAFA P+  P
Sbjct  34   IPNLRKQRKPISCKGSGEHDQSPIGKVDRRNMLIGLGGLYGTVAGLGSEPLAFANPVAPP  93

Query  458  EIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKA  637
            +++KC   PAD PPGA+  NCCPPV+T V +Y+LP+VT +RVRP AH +D++ IAK+++A
Sbjct  94   DLSKCG--PADFPPGAIPTNCCPPVST-VQDYQLPSVTKLRVRPPAHAVDEEYIAKYSRA  150

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VELMKALP  DPR+F QQA +HCAYCNG+YDQV FP+ E+Q+H+SWLFFPFHR
Sbjct  151  VELMKALPDSDPRSFTQQADIHCAYCNGSYDQVGFPNLELQIHSSWLFFPFHR  203



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 14/194 (7%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGDSQS----------KLDRRDVllglgg  394
            S+P  K +  + + + +RH FKISC +  +   +  +          KLDRR+VLLGLGG
Sbjct  22   SSPFFKKTLQIPTLRNHRHSFKISCKSTDNDNQNPNTTSKNEETFLGKLDRRNVLLGLGG  81

Query  395  lygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT  574
               A+++++NPLAFAAP+ AP++AKC    ADLP GA   NCCPP AT +I++K P   +
Sbjct  82   YS-AATILANPLAFAAPVTAPDLAKCGA--ADLPAGAKPTNCCPPKATKIIDFKFPQSNS  138

Query  575  MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQE  754
            MRVRPAAH  D + IAKF+KA+ LMKALP DDPR+F QQA VHCAYC+GAY QV FP+ +
Sbjct  139  MRVRPAAHLADAEYIAKFSKALALMKALPEDDPRSFKQQANVHCAYCDGAYHQVGFPELD  198

Query  755  IQVHNSWLFFPFHR  796
            +QVHNSWLFFPFHR
Sbjct  199  LQVHNSWLFFPFHR  212



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 10/182 (5%)
 Frame = +2

Query  263  KPSQHLISSKRNRHF--KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAF  436
            K SQ  +  KRN  +  ++SC A  D   DSQ+   RRD+L+GLGGLYGA+SL S+P AF
Sbjct  25   KTSQLSLIKKRNHRYTPRVSCRATND---DSQNPTTRRDILIGLGGLYGATSL-SDPFAF  80

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV-ATNVINYKLPAVTT-MRVRPAAHTMDK  610
            AAP+ AP+I+KC    ADLP G    NCCPPV +T ++++K P+    +RVRPAAH  DK
Sbjct  81   AAPVSAPDISKCSR--ADLPTGVNETNCCPPVPSTKILDFKRPSSNAPLRVRPAAHLADK  138

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            D IAK++KA+ELMKALP DDPR+F QQA VHCAYCNGAYDQV FP+ +IQVHNSWLFFPF
Sbjct  139  DYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLFFPF  198

Query  791  HR  796
            HR
Sbjct  199  HR  200



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = +2

Query  248  STPLSKPSQH------LISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygA  406
            + PLS  SQ+      L   KR+   K+SC A  +   D +QSKLDRR+VLLGLGGLYG 
Sbjct  19   TKPLSPFSQNNSQVSLLTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLGLGGLYGV  78

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVR  586
            + + ++P AFA PI  P+++KC   PADLP GAV  NCCPP +T +I++KLPA   +R+R
Sbjct  79   AGMGTDPFAFAKPIAPPDVSKCG--PADLPQGAVPTNCCPPPSTKIIDFKLPAPAKLRIR  136

Query  587  PAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVH  766
            P AH +D+    K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQV FP+ E+Q+H
Sbjct  137  PPAHAVDQAYRDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPELELQIH  196

Query  767  NSWLFFPFHR  796
            NSWLFFPFHR
Sbjct  197  NSWLFFPFHR  206



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +2

Query  278  LISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQA  454
            L   KR+   K+SC A  +   D +QSKLDRR+VLLGLGG+YG + + ++P AFA PI  
Sbjct  35   LTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLGLGGIYGVAGMGTDPFAFAKPIAP  94

Query  455  PEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAK  634
            P+++KC    ADLPPGA   NCCPP AT +I++KLPA   +R+RP AH +D+    KF K
Sbjct  95   PDVSKCG--SADLPPGAEATNCCPPPATKIIDFKLPAPAKLRIRPPAHAVDQAYRDKFYK  152

Query  635  AVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            A+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFFPFHR
Sbjct  153  AMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHR  206



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 138/184 (75%), Gaps = 10/184 (5%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHF--KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL  430
             +K SQ  +  KRN  +  ++SC A  D   DSQ+   RRD+L+GLGGLYGA+SL S+P 
Sbjct  23   FAKTSQLSLIKKRNHRYTPRVSCRATND---DSQNPTTRRDILIGLGGLYGATSL-SDPF  78

Query  431  AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV-ATNVINYKLPAVTT-MRVRPAAHTM  604
            AFAAP+ AP+I+KC    ADLP G    NCCPPV +T ++++K P+    +RVRPAAH  
Sbjct  79   AFAAPVSAPDISKCSR--ADLPTGVNETNCCPPVPSTKILDFKRPSSNAPLRVRPAAHLA  136

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            +KD IAK++KA+ELMKALP DDPR+F QQA VHCAYCNGAYDQV FP+ +IQVHNSWLFF
Sbjct  137  NKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLFF  196

Query  785  PFHR  796
            PFHR
Sbjct  197  PFHR  200



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 135/182 (74%), Gaps = 10/182 (5%)
 Frame = +2

Query  263  KPSQHLISSKRNRHF--KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAF  436
            K SQ  +  KRN  +  + SC A  D   DSQ+   RRD+L+GLGGLYGA+SL S+P AF
Sbjct  25   KTSQLSLIKKRNHRYTPRFSCRATND---DSQNPTTRRDLLIGLGGLYGATSL-SDPFAF  80

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV-ATNVINYKLPAVTT-MRVRPAAHTMDK  610
            AAP+ AP+I+KC    ADLP GA   NCCPPV +T ++++K P     +RVRPAAH  DK
Sbjct  81   AAPVSAPDISKCGR--ADLPTGANETNCCPPVPSTKILDFKRPPSNAPLRVRPAAHLADK  138

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            D IAK+ KA+ELMKALP DDPR+F QQA VHCAYCNGAYDQV FP+ EIQVHNSWLFFPF
Sbjct  139  DYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLFFPF  198

Query  791  HR  796
            HR
Sbjct  199  HR  200



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 135/182 (74%), Gaps = 10/182 (5%)
 Frame = +2

Query  263  KPSQHLISSKRNRHF--KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAF  436
            K SQ  +  KRN  +  + SC A  D   DSQ+   RRD+L+GLGGLYGA+SL S+P AF
Sbjct  25   KTSQLSLIKKRNHRYTPRFSCRATND---DSQNPTTRRDLLIGLGGLYGATSL-SDPFAF  80

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV-ATNVINYKLPAVTT-MRVRPAAHTMDK  610
            AAP+ AP+I+KC    ADLP GA   NCCPPV +T ++++K P     +RVRPAAH  DK
Sbjct  81   AAPVSAPDISKCGR--ADLPTGANETNCCPPVPSTKILDFKRPPSNAPLRVRPAAHLADK  138

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            D IAK+ KA+ELMKALP DDPR+F QQA VHCAYCNGAYDQV FP+ EIQVHNSWLFFPF
Sbjct  139  DYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLFFPF  198

Query  791  HR  796
            HR
Sbjct  199  HR  200



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 15/197 (8%)
 Frame = +2

Query  245  LSTPLSKPSQHLISSKRNRHF--KISCNAA-GD---------GGGDSQSKLDRRDVllgl  388
             S    KPSQH I  KR ++F  +IS  A  GD          G  S +K DRRDVL+GL
Sbjct  24   FSPSFRKPSQHSIVKKRKQYFVPRISYKATNGDEHYPKFSSNDGQTSLNKFDRRDVLVGL  83

Query  389  gglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKL-PA  565
            GG  G +SL S+P A AAP+ AP++AKC    A+LP GA   NCCPP +  ++ +KL P+
Sbjct  84   GGFCGFASLSSDPFAVAAPVSAPDLAKCG--KANLPAGAKQTNCCPPTSKKILGFKLHPS  141

Query  566  VTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFP  745
               +R+RPAAH +D   IAK+++A+ELMKALPADDPR F QQA VHCAYC+GAYDQ+ FP
Sbjct  142  NAPLRIRPAAHLVDDAYIAKYSRAIELMKALPADDPRGFMQQANVHCAYCDGAYDQIGFP  201

Query  746  DQEIQVHNSWLFFPFHR  796
            + E+QVHNSWLFFPFHR
Sbjct  202  NLELQVHNSWLFFPFHR  218



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 11/198 (6%)
 Frame = +2

Query  209  ATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVll  382
            AT P S FS   +  + L+KP       KR+   K+SC A  +   D +QSKLDRR+VLL
Sbjct  18   ATKPFSPFSQNNSQVSLLTKP-------KRSFARKVSCKATNNDQNDQAQSKLDRRNVLL  70

Query  383  glgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLP  562
            GLGGLYG + + ++P AFA PI  P+++KC    ADLP GA   NCCPP AT +I++KLP
Sbjct  71   GLGGLYGVAGMGTDPFAFAKPIAPPDVSKCG--SADLPQGAEATNCCPPPATKIIDFKLP  128

Query  563  AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNF  742
            A   +R+RP AH +DK    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  F
Sbjct  129  APAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGF  188

Query  743  PDQEIQVHNSWLFFPFHR  796
            P+ E+QVHNSWLFFPFHR
Sbjct  189  PELELQVHNSWLFFPFHR  206



>ref|XP_008779317.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 19/220 (9%)
 Frame = +2

Query  176  MASLTSPCTPT---ATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGD----  334
            MA+L  P   T   +T+P SF+ + +   P   PS    S K + H +ISC A  +    
Sbjct  1    MANLLKPNASTFSLSTSPNSFACSFHRQRPRVPPS----SKKSHLHPRISCKARDEHEKP  56

Query  335  ----GGGDSQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
                    S  KLDRRD ++   G    A+ L  N  A   PI+AP+I+KC   PADLP 
Sbjct  57   MHTSEATGSSGKLDRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDISKCG--PADLPS  114

Query  500  GAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
            GA+  +CCPP  + +I++KLP  +  +R+RPAAH +D + +AK+AKAVELMKALPADDPR
Sbjct  115  GAIPTDCCPPFTSKIIDFKLPPRSDPLRIRPAAHLVDSEYLAKYAKAVELMKALPADDPR  174

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            NF QQA VHCAYC+G+YDQ+ FPD EIQVH+SW+FFP+HR
Sbjct  175  NFTQQANVHCAYCDGSYDQIGFPDIEIQVHDSWIFFPWHR  214



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 11/198 (6%)
 Frame = +2

Query  209  ATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVll  382
            AT P S FS   +  + L+KP       KR+   K+SC A  +   D +QSKLDRR+VLL
Sbjct  18   ATKPFSPFSQNNSQVSLLTKP-------KRSFARKVSCKATNNDQNDQAQSKLDRRNVLL  70

Query  383  glgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLP  562
            GLGGLYG + + ++P AFA PI  P+++KC    ADLP GA   NCCPP AT +I++KLP
Sbjct  71   GLGGLYGVAGMGTDPFAFAKPIAPPDVSKCG--SADLPQGAEATNCCPPPATKIIDFKLP  128

Query  563  AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNF  742
            A   +R+RP AH +DK    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  F
Sbjct  129  APAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGF  188

Query  743  PDQEIQVHNSWLFFPFHR  796
            P+ E+QVHNSWLFFPFHR
Sbjct  189  PELELQVHNSWLFFPFHR  206



>ref|XP_008778193.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 142/219 (65%), Gaps = 17/219 (8%)
 Frame = +2

Query  176  MASLTSPCTPTA---TTPKSFSSAANLS---TPLSKPSQHL---ISSK-RNRHFKISCNA  325
            MA+L  P   T+   T+P SF+ +        PLS    HL   IS K R+ H K    +
Sbjct  1    MANLLKPNASTSSLSTSPNSFACSFYRQRPRVPLSSKKSHLDPRISCKARDEHEKPMHTS  60

Query  326  AGDGGGDSQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPG  502
               G   S  KLDRRD ++   G    A+ L  N  A   PI+AP+I+KC   PADLP G
Sbjct  61   EATG---SLGKLDRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDISKCG--PADLPSG  115

Query  503  AVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRN  679
            A+  +CCPP  + +I++KLP  +  +R+RPAAH +D + +AK+AKAVELMKALPADDPRN
Sbjct  116  AIPTDCCPPFTSKIIDFKLPPRSDPLRIRPAAHLVDSEYLAKYAKAVELMKALPADDPRN  175

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F QQA VHCAYC+G+YDQ+ FPD EIQVHNSW+FFP+HR
Sbjct  176  FTQQANVHCAYCDGSYDQIGFPDIEIQVHNSWIFFPWHR  214



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 151/220 (69%), Gaps = 17/220 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHF--KISCNA-------  325
            MASL SP   T  TP S S+A+    P + + SQ  I  KR      K+SC A       
Sbjct  1    MASL-SPLNHTLLTPASSSNASTSLCPFNQRRSQVPIVGKRRYRMVRKVSCEATDGEKKP  59

Query  326  --AGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
              +G+  G S  +LDRR+VL+GLGGLYGA+ L +  LAF API  P+++KC    A+LP 
Sbjct  60   TRSGNEEG-SLGRLDRRNVLIGLGGLYGATGLCAGRLAFGAPIMPPDLSKCGA--ANLPA  116

Query  500  GAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
            GA   N CPP ++ ++++KLP+ +  MRVRPAAH +D++ IAK++KA+ LMKALPADDPR
Sbjct  117  GAKPTNRCPPASSEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPR  176

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            NF QQA VHCAYC+GAYDQ+ FPD E+QVHNSWLFF FHR
Sbjct  177  NFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFSFHR  216



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 128/170 (75%), Gaps = 6/170 (4%)
 Frame = +2

Query  296  NRHFKISCNAAGDGGGDSQS-KLDRRDVllglgglygAS-SLVSNPLAFAAPIQAPEIAK  469
            +RH  +SC    D      S K+DRR++LLGLGGLYGA+ +  SNPLAFA PI AP++ K
Sbjct  43   HRH-AVSCKTQNDDQHHENSGKVDRRNMLLGLGGLYGAAATFGSNPLAFADPIMAPDLTK  101

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIAKFAKAVEL  646
            C   PADLP GAV  NCCPP   N+I++KLP   T +RVRPAAH  +KD IAKF KA+EL
Sbjct  102  CG--PADLPQGAVATNCCPPFTKNIIDFKLPPPSTNLRVRPAAHLANKDYIAKFNKAIEL  159

Query  647  MKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            MKALP DDPR+F QQA VHCAYC+GAYDQV FPD ++QVHNSWLF PFHR
Sbjct  160  MKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLDLQVHNSWLFLPFHR  209



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 145/215 (67%), Gaps = 17/215 (8%)
 Frame = +2

Query  176  MASLTSPC--TPTATTPKS-----FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGD  334
            M SL+ P   TPTA  P +     FS   +  + L+KP       KR+   ++SCNA  +
Sbjct  1    MTSLSPPVVTTPTAPNPDTKPLSPFSQNNSQVSLLTKP-------KRSLGREVSCNATNN  53

Query  335  GGGD-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVV  511
               D +QSKLDRR+VLLGLGGLYG + +V++P  F   I  P+++KC   P DLP GAV 
Sbjct  54   DQFDQAQSKLDRRNVLLGLGGLYGVAGMVTDPRGFGKSIAPPDVSKCG--PGDLPQGAVP  111

Query  512  DNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
             NCCPP +T +I++KLPA   +R+RP AH +D+    K+ KA+ELMKALP DD R+F QQ
Sbjct  112  TNCCPPPSTKIIDFKLPAPANLRIRPPAHAVDQAYRDKYYKAMELMKALPDDDSRSFKQQ  171

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
              VHCAYC+GAYDQV FP+ E+Q+HNSWLFFPFHR
Sbjct  172  GAVHCAYCDGAYDQVGFPELELQLHNSWLFFPFHR  206



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 138/198 (70%), Gaps = 11/198 (6%)
 Frame = +2

Query  209  ATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVll  382
            AT P S FS   +  + L+KP       KR+   K+SC A  +   D +QSKLDRR+VLL
Sbjct  18   ATKPFSPFSQNNSQVSLLTKP-------KRSFARKVSCKATNNDQNDQAQSKLDRRNVLL  70

Query  383  glgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLP  562
            GLGGLYG + + ++P AFA PI  P+++KC    ADLP GA   NCCPP AT +I++KLP
Sbjct  71   GLGGLYGVAGMGTDPFAFAKPIAPPDVSKCG--SADLPQGAEATNCCPPPATKIIDFKLP  128

Query  563  AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNF  742
            A   +R+RP AH +DK    KF KA+ LMKALP DDPR+F QQA VHCAYC+GAYDQ  F
Sbjct  129  APAKLRIRPPAHAVDKAYRDKFYKAMGLMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGF  188

Query  743  PDQEIQVHNSWLFFPFHR  796
            P+ E+QVHNSWLFFPFHR
Sbjct  189  PELELQVHNSWLFFPFHR  206



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +2

Query  281  ISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPE  460
            ++S  + H + S N +   G  +  K+DRR+VLLGLGGLYG ++L S+PL+FAAP+ AP+
Sbjct  44   VTSNNSDHLRKSPNTSSKDGELTPKKVDRREVLLGLGGLYGVTTLSSDPLSFAAPVSAPD  103

Query  461  IAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKA  637
            +++C    ADLP GA   NCCPP +  +I++KLP   + +R+RPAAH  D + IAK+ KA
Sbjct  104  LSRCG--KADLPAGAKPTNCCPPKSNKIIDFKLPPSNSPLRIRPAAHLADNEYIAKYYKA  161

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VELMKALPADDPRNF QQA VHCAYC+GAYDQ+ FP+ ++QV NSWLFFPFHR
Sbjct  162  VELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLDLQVRNSWLFFPFHR  214



>ref|XP_011082866.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=580

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 144/212 (68%), Gaps = 7/212 (3%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAAGDGGGDSQ  352
            MA+ T  C P + T  + +S  + S P S KPSQ L  S+R+  F++SCN   +    + 
Sbjct  1    MAAQTMACLPYSCTVLTTNSRPS-SKPFSPKPSQLLTDSRRSHRFQVSCNGGINQNPSAD  59

Query  353  SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPP  529
              +DRR++LLGLGGLYGA++LVS+  A+AAPI+ PE   C V   D+    ++D NCCPP
Sbjct  60   GTVDRRNLLLGLGGLYGAANLVSDSQAYAAPIEPPEFKNCGVA-RDVQTNDILDVNCCPP  118

Query  530  VATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDP---RNFYQQALV  700
            V   +I+YKLP VT  R+RPAAH + K+ +AKF +A+  MKAL  DDP   R F QQA +
Sbjct  119  VTDKIIDYKLPPVTNWRIRPAAHRVSKEYLAKFEEAIRRMKALDKDDPTDPRGFMQQANI  178

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNGA+DQV F D ++QVHNSWLFFPFHR
Sbjct  179  HCAYCNGAHDQVGFKDLDLQVHNSWLFFPFHR  210



>gb|ADP89908.1| polyphenol oxidase [Nelumbo nucifera]
Length=500

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = +2

Query  347  SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCP  526
            S  +LDRR+VL+GLGGLYGA+ L ++ LAF API  P+++KC    A+LP GA   NCCP
Sbjct  15   SLGRLDRRNVLIGLGGLYGATGLGADRLAFGAPIMPPDLSKCGA--ANLPAGAKPTNCCP  72

Query  527  PVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVH  703
            P ++ ++++KLP+ +  MRVRPAAH +D++ IAK++KA+ LMKALPADDPRNF QQA VH
Sbjct  73   PASSEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPRNFTQQANVH  132

Query  704  CAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            CAYC+GAYDQ+ FPD E+QVHNSWLFFPFHR
Sbjct  133  CAYCDGAYDQIGFPDLELQVHNSWLFFPFHR  163



>ref|XP_011083298.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 141/212 (67%), Gaps = 8/212 (4%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAAGDGGGDSQ  352
            MASL S CT  A  P   ++ +  S P S KPS  L  + R   F++SC    +    + 
Sbjct  1    MASLQSLCTVVAPNPGHRTATS--SKPFSAKPSHFLTHASRRHRFQVSCKGVANQEPTAD  58

Query  353  SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPP  529
             K+DRR++LLGL GLYGA++LVS+P A+AAPI+APE   C     D+  G ++D NCCP 
Sbjct  59   GKVDRRNMLLGLSGLYGAANLVSDPQAYAAPIEAPEFKACG-EARDVATGDLLDVNCCPL  117

Query  530  VATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDP---RNFYQQALV  700
             +  +I+YKLP V  MR+RPAAH + K+ +AKF +A+  MKAL  DDP   R F QQA +
Sbjct  118  PSDKIIDYKLPPVNKMRIRPAAHKVTKEYLAKFEEAIRRMKALDKDDPTDPRGFMQQANI  177

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNGA+DQV + + +IQVHNSWLFFPFHR
Sbjct  178  HCAYCNGAHDQVGYKNLDIQVHNSWLFFPFHR  209



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 150/244 (61%), Gaps = 28/244 (11%)
 Frame = +2

Query  110  LRGFFHYI*RDAKQSGLVTRRPMASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISS  289
            ++GF  +I        + +  P +S TS   PT+         + LS  L+KP  + I  
Sbjct  1    MQGFSIFITIAPLSETMASLFPSSSTTSNTIPTSIASSFLPRTSQLS--LAKPKPNFIPK  58

Query  290  KRNRHFKISCNAAGDGGGDSQ--------------SKLDRRDVllglgglygASSLVSNP  427
                   +SC A     GD                +K DRRDVL+GLGGLYGA+SL  + 
Sbjct  59   V------VSCKATN---GDQNPTPSSKNTEKSFLLNKFDRRDVLIGLGGLYGAASLSQDQ  109

Query  428  LAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTM  604
             + AAPI APE+ KC    A+LP GA   NCCPPV+  ++++K P+  + +RVRPAAH +
Sbjct  110  FSLAAPISAPELEKCG--NAELPEGADPTNCCPPVSRKILDFKPPSSNSPLRVRPAAHLV  167

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D   IAK+++A+ELMKALPADDPRNF QQA VHCAYC+GAYDQV FPD E+QVHNSWLFF
Sbjct  168  DDAYIAKYSRAIELMKALPADDPRNFMQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFF  227

Query  785  PFHR  796
            PFHR
Sbjct  228  PFHR  231



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +2

Query  299  RHFKISCNAAGDGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAK  469
            R   ISC A  +   +     +K DRR+VL+GLGG YGA  L S+P A A PI AP++ K
Sbjct  51   RRSTISCKAPSNDDSEQNPLSAKFDRRNVLIGLGGFYGAVGLRSDPFALADPISAPDLTK  110

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVEL  646
            C    ADLP GA   NCCPP  T ++++KLP+  + +RVRPAAH  DKD IAK+AKA+EL
Sbjct  111  CG--KADLPAGAKATNCCPPPTTKILDFKLPSSNSPLRVRPAAHLADKDYIAKYAKAIEL  168

Query  647  MKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            MKALPADDPR+F QQA VHCAYC+GA+ QV FP+ E+QVHNSWLFFPFHR
Sbjct  169  MKALPADDPRSFMQQANVHCAYCDGAHHQVGFPNLELQVHNSWLFFPFHR  218



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 151/224 (67%), Gaps = 26/224 (12%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHF---KISCNAAGDGGGD  346
            MASL  P + TAT   S  S    ++ L K SQ  I+ KR R+F    +SC A     GD
Sbjct  1    MASLLPPSS-TATNGASPISVT--TSFLPKTSQLCIAGKRRRNFVSRAVSCKATN---GD  54

Query  347  -------------SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPA  487
                         S +K DRRDVL+GLGGLYGA+SL + PLAFAAP+  P++ KC    A
Sbjct  55   QNPSPSTKNVEECSLNKFDRRDVLVGLGGLYGATSL-NGPLAFAAPVSPPDVTKCG--KA  111

Query  488  DLPPGAVVDNCCPPVATNVINYKL-PAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
            DLP GA   NCCPP +T ++++KL P+ +  R+RPA H +DK+ +AKF++A+ELMKALP 
Sbjct  112  DLPAGAKPVNCCPPPSTKILDFKLRPSNSPPRIRPAVHLVDKEYLAKFSRALELMKALPE  171

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F QQA VHCAYC+GAY Q+ FPD ++QVHNSWLFFPFHR
Sbjct  172  DDPRSFTQQANVHCAYCDGAYHQIGFPDLDLQVHNSWLFFPFHR  215



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 125/189 (66%), Gaps = 13/189 (7%)
 Frame = +2

Query  263  KPSQHLISSKRNRHFKISCNAAGDGGGD---------SQSKLDRRD-VllglgglygASS  412
            +P   L   K + H +ISC A  D             S  KLDRRD ++   G    A+ 
Sbjct  29   RPRVPLSFKKSHVHPRISCKATRDEHEKPTHTTEAIGSSGKLDRRDMLIGLGGLYGAAAG  88

Query  413  LVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRP  589
            L  N  A   PI+AP+I+KC   PADLP GA   +CCPP  + +I++KLP  +  +R+RP
Sbjct  89   LGVNRKALGLPIEAPDISKCG--PADLPSGATPTDCCPPFTSKIIDFKLPPRSDPLRIRP  146

Query  590  AAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHN  769
            AAH +D + +AK+AKAVELMKALPADDPRNF QQA VHCAYC+G+YDQ+ FPD EIQVHN
Sbjct  147  AAHLVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHN  206

Query  770  SWLFFPFHR  796
            SW+FFP+HR
Sbjct  207  SWIFFPWHR  215



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 134/185 (72%), Gaps = 8/185 (4%)
 Frame = +2

Query  257  LSKPSQHLISSKRN--RHFKISCNAAGDGGGDSQ--SKLDRRDVllglgglygASSLVSN  424
            L KP +H+ +S +N  R +KISC ++          SK DRR++L+GLGGLYGA++L ++
Sbjct  26   LIKP-KHIPTSSKNPSRSYKISCKSSNHDHESPPPPSKFDRRNLLIGLGGLYGATTLATS  84

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAV-TTMRVRPAAHT  601
            P +FAAPI  P++ +C   PADLP GA   NCCPP+   +++++ PA    +R+RPAAH 
Sbjct  85   PFSFAAPISGPDVTQCG--PADLPAGATPTNCCPPLTGEILDFQFPAPPAKLRIRPAAHL  142

Query  602  MDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLF  781
             D   IAKF +AVELM+ALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+QVHNSWLF
Sbjct  143  ADDAYIAKFNRAVELMRALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQVHNSWLF  202

Query  782  FPFHR  796
            FPFHR
Sbjct  203  FPFHR  207



>dbj|BAM15849.1| hypothetical protein [Portulaca oleracea]
Length=614

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 142/222 (64%), Gaps = 18/222 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHF---KISCNAAGDGG-  340
            MAS+T P + T     S +S  N+S PL  K SQ  I   R  H    KISC+AA +   
Sbjct  1    MASIT-PLSTTNAATISATSTTNISNPLFPKTSQLSIPKCRKSHLPTRKISCSAAKNDDQ  59

Query  341  --------GDSQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADL  493
                    G++ +KLDRR+ ++   G    A++L   P +FAAPI  P+++KCE  PADL
Sbjct  60   NPRSNTHDGNANNKLDRRNMLIGLGGLYGAATNLGGAPASFAAPIATPDLSKCE--PADL  117

Query  494  PPGAV-VDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADD  670
            P  A+   NCCPPVATN+I+Y   A +T+RVRP AH +D   +AKF KA+  MKALP+ D
Sbjct  118  PSNAIDRSNCCPPVATNIIDYTPSASSTLRVRPPAHAVDATYLAKFNKAIAAMKALPSTD  177

Query  671  PRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            PR+F QQA VHCAYC+G Y+QV FP+ ++QVH SWLF PFHR
Sbjct  178  PRSFIQQARVHCAYCDGGYNQVGFPNLDLQVHGSWLFLPFHR  219



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 139/207 (67%), Gaps = 16/207 (8%)
 Frame = +2

Query  194  PCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGD---GGGDSQSKLD  364
            P + ++ T    +++ ++S    K SQ  I  KR    K++C A  +      DS +KLD
Sbjct  6    PSSSSSATVIPIATSTSISPFSQKTSQLSIVGKR----KVTCKATNEQNPSSKDSLNKLD  61

Query  365  RRDVllglgglygASSLVS--NPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            RRDVLL   G     S +S  +P AFAAP+ AP+I+KC    AD       DNCCPP +T
Sbjct  62   RRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPDISKCG--KAD----TTTDNCCPPKST  115

Query  539  NVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
            N+IN+KLP + +++RVRPAAH  D   IAK++KA+ELMKALPADDPR+F  QA VHCAYC
Sbjct  116  NIINFKLPPSNSSLRVRPAAHLADDAYIAKYSKAIELMKALPADDPRSFMNQANVHCAYC  175

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +GAYDQV FP+ ++Q+HNSWLFFPFHR
Sbjct  176  DGAYDQVGFPNLDLQIHNSWLFFPFHR  202



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 123/170 (72%), Gaps = 5/170 (3%)
 Frame = +2

Query  296  NRHFKISCNAAGDGGGDSQS-KLDRRDVllglgg-lygASSLVSNPLAFAAPIQAPEIAK  469
            +RH   SC +A D   D  S  LDRR+VLL LGG    A++  SN LAFA PI AP++ +
Sbjct  45   HRHAVTSCKSADDHHHDIDSGTLDRRNVLLRLGGLYGAAATFGSNSLAFADPIMAPDLTQ  104

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIAKFAKAVEL  646
            C   PAD+P G +V +CCPP  T + ++KLP    T+R+RPAAH +DKD I KF KA+ L
Sbjct  105  CG--PADIPAGGIVTDCCPPFTTKIQDFKLPPPSNTLRIRPAAHLVDKDYIDKFNKAIGL  162

Query  647  MKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            MKALP DDPR+F QQA+VHCAYC+GAY+QV +P  ++QVHNSWLFFPFHR
Sbjct  163  MKALPDDDPRSFKQQAVVHCAYCDGAYEQVGYPGLDLQVHNSWLFFPFHR  212



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 124/165 (75%), Gaps = 5/165 (3%)
 Frame = +2

Query  308  KISCNAAG-DGGGDSQSKLDRRDVllglgglygASSLVSNP-LAFAAPIQAPEIAKCEVP  481
            +ISC A+  +    S  K+DRRD+L+GL GLYG+S+L  +P  A AAPIQ P I+KC   
Sbjct  27   RISCKASNHNDQNTSNPKIDRRDILIGLTGLYGSSTLSQSPHFALAAPIQTPNISKCG--  84

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
            P DLPPGA   NCCPP AT +++++ P  T +RVRPAAH  D++ I K+ KA+ELMKALP
Sbjct  85   PPDLPPGADPTNCCPPPATTILDFQPPPPTKLRVRPAAHLADQNYIEKYKKAIELMKALP  144

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+F QQA VHCAYCNGAYDQ+ FP  E+QVHNSWLFFPFHR
Sbjct  145  EDDPRSFTQQANVHCAYCNGAYDQIGFP-VEVQVHNSWLFFPFHR  188



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 137/220 (62%), Gaps = 18/220 (8%)
 Frame = +2

Query  176  MASLTSPCTPTA---TTPKSFS---SAANLSTPLSKPSQHL---ISSK--RNRHFKISCN  322
            MASL  P   T+   T P SF+          PLS    H+   IS K  RN H K    
Sbjct  1    MASLPQPNLSTSSLSTCPSSFACPFYRQRRRVPLSSKKSHVHPRISCKATRNEHEKPMPT  60

Query  323  AAGDGGGDSQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
                G   S  KLDRRD ++   G    A+ L  N  A   PI+AP+++KC   PADLP 
Sbjct  61   TEAIG---SSGKLDRRDMLIGLGGLYGAATGLGVNRKALGLPIEAPDVSKCG--PADLPS  115

Query  500  GAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
            GA   +CCPP  + +I++KLP  +  +R+R AAH +D + +AK+AKAVELMKALPADDPR
Sbjct  116  GATPTDCCPPSTSKIIDFKLPPRSDPLRIRSAAHLVDSEYLAKYAKAVELMKALPADDPR  175

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            NF QQA VHCAYC+G+YDQ+ FPD E+QVHNSW+FFP+HR
Sbjct  176  NFTQQANVHCAYCDGSYDQIGFPDIELQVHNSWIFFPWHR  215



>ref|XP_010100571.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82814.1| Polyphenol oxidase [Morus notabilis]
Length=556

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = +2

Query  281  ISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglggl---ygASSLVSNPLAFAAPIQ  451
            I + R++    SC  +G+    S   +DRR+VL+GLGGL      + L SNPLA A P+ 
Sbjct  34   IPNLRHQRQPASCKGSGEHDQSSVGNVDRRNVLIGLGGLCGGAAVAGLGSNPLALADPVA  93

Query  452  APEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFA  631
             P++ KC   PAD PPGA+  +CCPPV+T V +YKLP+V+ +RVRP AH +D++ IAK++
Sbjct  94   PPDVTKCG--PADFPPGAIPSDCCPPVST-VKDYKLPSVSKLRVRPPAHAVDEEYIAKYS  150

Query  632  KAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +A+ELMKALP  DPR+F QQA VHCAYCNG+YDQV FP+ E+QVH SWLF PFHR
Sbjct  151  RAIELMKALPDSDPRSFTQQADVHCAYCNGSYDQVGFPNLELQVHTSWLFLPFHR  205



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 141/216 (65%), Gaps = 17/216 (8%)
 Frame = +2

Query  158  LVTRRPMASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDG  337
            + T  P +S ++   P AT+  S S  +  ++ LS   +H ++ K       + N     
Sbjct  1    MTTLFPSSSSSATVIPIATS-TSISPFSQKTSQLSIVGKHKVTCK-------ATNEQNPS  52

Query  338  GGDSQSKLDRRDVllglgglygASSLVS--NPLAFAAPIQAPEIAKCEVPPADLPPGAVV  511
              DS +KLDRRDVLL   G     S +S  +P AFAAP+ AP+I+KC    AD       
Sbjct  53   SKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPDISKCG--KAD----TTT  106

Query  512  DNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQ  688
            DNCCPP +TN+IN+KLP + +++RVRPAAH  D   IAK++KA+ELMKALPADDPR+F  
Sbjct  107  DNCCPPKSTNIINFKLPPSNSSLRVRPAAHLSDDAYIAKYSKAIELMKALPADDPRSFMN  166

Query  689  QALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QA VHCAYC+GAYDQV FP+ ++Q+HNSWLFFPFHR
Sbjct  167  QANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHR  202



>gb|AGU01537.1| polyphenol oxidase [Malus domestica]
Length=616

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 147/230 (64%), Gaps = 32/230 (14%)
 Frame = +2

Query  176  MASLTSPCTPTATT--PKSFSSAANLSTPLSKPSQHLISSKRN-RHFK---ISCNAAGDG  337
            MAS+++P   +AT+  P +F S      P S+   H ISS  N RH     +SC A  + 
Sbjct  1    MASMSAPLVTSATSIIPTTFLS------PFSQ-KYHRISSFGNPRHSNLQAVSCKATNNS  53

Query  338  GGDSQS----------------KLDRRDVllglgglygA-SSLVSNPLAFAAPIQAPEIA  466
               +++                 LDRR+VL+GLG LYG  + L S+P A A P+  P++A
Sbjct  54   SDQNKNPSTSSNDHDHENPSPVNLDRRNVLIGLGSLYGGVAGLGSDPFAVAKPVSPPDLA  113

Query  467  KCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVEL  646
            KC    AD P GAV  NCCPP +  ++++K P+ T +RVRPAAHT+DK  I K++KA+EL
Sbjct  114  KCGA--ADFPSGAVPTNCCPPTSQKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYSKAIEL  171

Query  647  MKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            MKALP DDPR+F QQA +HCAYC+GAYDQV FP+ E+Q+H SWLFFPFHR
Sbjct  172  MKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQSWLFFPFHR  221



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 6/173 (3%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGDSQSKLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIA  466
            +R+ H KISC A+ +    + +KLDRRDVL+GLGGL   A+ L  +  A   PIQAP++ 
Sbjct  41   RRHAHSKISCKASDEHEMTANAKLDRRDVLVGLGGLCGAAAGLGIDGKALGNPIQAPDLT  100

Query  467  KCEVPPADLPPGAVVDNCCPPV--ATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKA  637
            KC   PADLP GA   NCCPP      +I++K P  ++ +RVRPAAH +D D + K+ KA
Sbjct  101  KCG--PADLPKGATPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDSDYLDKYKKA  158

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VELM+ALPADDPRNF QQA VHCAYC+GAYDQ+ FP+ E+QVHNSWLFFP+HR
Sbjct  159  VELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHR  211



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 140/216 (65%), Gaps = 17/216 (8%)
 Frame = +2

Query  158  LVTRRPMASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDG  337
            + T  P +S ++   P AT+  S S  +  ++ LS   +H ++ K       + N     
Sbjct  1    MTTLFPSSSSSATVIPIATS-TSISPFSQKTSQLSIVGKHKVTCK-------ATNEQNPS  52

Query  338  GGDSQSKLDRRDVllglgglygASSLVS--NPLAFAAPIQAPEIAKCEVPPADLPPGAVV  511
              DS +KLDRRDVLL   G     S +S  +P AFAAP+  P+I+KC    AD       
Sbjct  53   SKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSTPDISKCG--KAD----TTT  106

Query  512  DNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQ  688
            DNCCPP +TN+IN+KLP + +++RVRPAAH  D   IAK++KA+ELMKALPADDPR+F  
Sbjct  107  DNCCPPKSTNIINFKLPPSNSSLRVRPAAHLSDDAYIAKYSKAIELMKALPADDPRSFMN  166

Query  689  QALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QA VHCAYC+GAYDQV FP+ ++Q+HNSWLFFPFHR
Sbjct  167  QANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHR  202



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 134/202 (66%), Gaps = 11/202 (5%)
 Frame = +2

Query  206  TATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFK---ISCNAAGDGGGDSQSKLDRRDV  376
            T  TP   S+++         SQ  I+ KRN  +    ISC A  D   D Q+ + RRDV
Sbjct  17   TNATPFIISNSSLFCLSFPNTSQLSITKKRNHPYVPRVISCKATND---DHQNPITRRDV  73

Query  377  llglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVV-DNCCPPVATNVINY  553
            L+ LGG  GA++L  +P AFA PI  PE  KC    ADLP  A    NCCPP +T ++++
Sbjct  74   LISLGGFCGATTL-GDPFAFAKPISTPEPTKCG--KADLPNYAKPPTNCCPPTSTKILDF  130

Query  554  KLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYD  730
            KLP+  + +R+RPAAH  D   IAK++KAV+LMKALP DDPR+F QQA VHCAYCNGAYD
Sbjct  131  KLPSSQSPLRIRPAAHLADDAYIAKYSKAVKLMKALPEDDPRSFMQQAKVHCAYCNGAYD  190

Query  731  QVNFPDQEIQVHNSWLFFPFHR  796
            QV FPD +IQVHNSWLFFPFHR
Sbjct  191  QVGFPDLQIQVHNSWLFFPFHR  212



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 6/173 (3%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGDSQSKLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIA  466
            +R+ H KISC A+ +    + +KLDRRDVL+GLGGL   A+ L  +  A   PIQAP++ 
Sbjct  39   RRHAHPKISCKASDEHEMTANAKLDRRDVLVGLGGLCGAAAGLGIDSKALGNPIQAPDLT  98

Query  467  KCEVPPADLPPGAVVDNCCPPV--ATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKA  637
            KC   PADLP GA   NCCPP      +I++K P  ++ +RVRPAAH +D D + K+ KA
Sbjct  99   KCG--PADLPTGATPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDSDYLDKYKKA  156

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VELM+ALPADDPRNF QQA VHCAYC+GAYDQ+ FP+ E+QVHNSWLFFP+HR
Sbjct  157  VELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHR  209



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 128/193 (66%), Gaps = 17/193 (9%)
 Frame = +2

Query  263  KPSQHLISSKRNRHF-KISCNAAG------------DGGGD-SQSKLDRRDVllglggly  400
            +P    +  +R R   K+SC A G             G G+ S  ++DRR+VL+ LGGLY
Sbjct  31   RPQVSTVGKRRQRMVGKVSCGARGGEQKPTQGDASSSGNGEGSLGRMDRRNVLISLGGLY  90

Query  401  gASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-M  577
            GA+ L ++ LAF API AP++ KC    ADLP  A   NCCPP ++ V+++KLP     M
Sbjct  91   GATGLGADRLAFGAPIMAPDLTKCGA--ADLPTSAKPTNCCPPTSSKVVDFKLPPQNEDM  148

Query  578  RVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEI  757
            RVR AAH +D + +AK+  A+  MKALP DDPRNF QQA VHCAYC+GAYDQV FPD E+
Sbjct  149  RVRQAAHLVDDEYVAKYQDAIARMKALPTDDPRNFTQQANVHCAYCDGAYDQVGFPDLEL  208

Query  758  QVHNSWLFFPFHR  796
            QVHNSWLFFPFHR
Sbjct  209  QVHNSWLFFPFHR  221



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 148/223 (66%), Gaps = 18/223 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGG  340
            MASL    T +     + + +A   +PL + + H+ ++  R+R F   K+SCN+A GD  
Sbjct  1    MASLPWSLTTSTAIANTTNISAFPPSPLFQRASHVPVARNRSRRFAPSKVSCNSANGDPN  60

Query  341  GDSQS--------KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPAD  490
             DS S        KLDRR+VLLG+GGLYGA+  +  + PLAF APIQAP+I+KC    A 
Sbjct  61   SDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--AT  118

Query  491  LPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPAD  667
            +P G    NCCPPV T +I+++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP D
Sbjct  119  VPDGVTPTNCCPPVTTKIIDFQLPSSGSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDD  178

Query  668  DPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DPR+F QQA VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  179  DPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHR  221



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 148/223 (66%), Gaps = 18/223 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGG  340
            MASL    T +     + + +A   +PL + + H+ ++  R+R F   K+SCN+A GD  
Sbjct  1    MASLPWSLTTSTAIANTTNISAFPPSPLFQRASHVPVARNRSRRFAPSKVSCNSANGDPN  60

Query  341  GDSQS--------KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPAD  490
             DS S        KLDRR+VLLG+GGLYGA+  +  + PLAF APIQAP+I+KC    A 
Sbjct  61   SDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--AT  118

Query  491  LPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPAD  667
            +P G    NCCPPV T +I+++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP D
Sbjct  119  VPDGVTPTNCCPPVTTKIIDFQLPSSGSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDD  178

Query  668  DPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DPR+F QQA VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  179  DPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHR  221



>emb|CBI25830.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 145/215 (67%), Gaps = 22/215 (10%)
 Frame = +2

Query  212  TTPKSFSSAANLS----TPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGGGDSQS---  355
            TT  + ++  N+S    +PL + + H+ ++  R+  F   K+SCN+A GD   DS S   
Sbjct  9    TTSTAIANTTNISAFPPSPLFQRASHVPVARNRSCRFAPSKVSCNSANGDPNSDSTSDVR  68

Query  356  -----KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
                 KLDRR+VLLG+GGLYGA+  +  + PLAF APIQAP+I+KC    A +P G    
Sbjct  69   ETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--ATVPDGVTAT  126

Query  515  NCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
            NCCPPV T +I+++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP DDPR+F QQ
Sbjct  127  NCCPPVTTKIIDFQLPSSDSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQ  186

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            A VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  187  ANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHR  221



>ref|XP_004146644.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]
 gb|KGN64656.1| hypothetical protein Csa_1G073640 [Cucumis sativus]
Length=577

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 129/184 (70%), Gaps = 10/184 (5%)
 Frame = +2

Query  251  TPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLV-SN  424
            TP  + ++ L+ + R     ISC A      +    K+DRRD+L+GL GLYG+S+L  S 
Sbjct  13   TPFLRKTKTLLITPR-----ISCKATNHNDQNFPNPKIDRRDILIGLTGLYGSSTLSQST  67

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
              A AAPI+ P I+KC   P DLPPGA   NCCPP AT +++++ P  + +RVRPAAH  
Sbjct  68   HFALAAPIETPNISKCG--PPDLPPGADATNCCPPPATTILDFQPPPPSKLRVRPAAHLA  125

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D++ I K+ KAVELMKALP DDPR+F QQA VHCAYCNGAYDQV FP  E+QVHNSWLFF
Sbjct  126  DRNYIEKYKKAVELMKALPEDDPRSFTQQANVHCAYCNGAYDQVGFP-VEVQVHNSWLFF  184

Query  785  PFHR  796
            PFHR
Sbjct  185  PFHR  188



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 146/215 (68%), Gaps = 22/215 (10%)
 Frame = +2

Query  212  TTPKSFSSAANLS----TPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGGGDSQS---  355
            TT  + ++  N+S    +PL + + H+ ++  R+R F   K+SCN+A GD   DS S   
Sbjct  9    TTFTAIANTTNISAFPPSPLFQRASHVPVARNRSRRFAPSKVSCNSANGDPNSDSTSDVR  68

Query  356  -----KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
                 KLDRR+VLLG+GGLYGA+  +  + PLAF APIQAP+I+KC    A +P G    
Sbjct  69   ETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--ATVPDGVTPT  126

Query  515  NCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
            NCCPPV T +I+++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP DDPR+F QQ
Sbjct  127  NCCPPVTTKIIDFQLPSSGSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQ  186

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            A VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  187  ANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHR  221



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 124/169 (73%), Gaps = 3/169 (2%)
 Frame = +2

Query  293  RNRHFKISCNAAGDGGGDSQSKLDRRDVllglggly-gASSLVSNPLAFAAPIQAPEIAK  469
            R +    +C  + +       KLDRR++L+GLGGLY  A+ L S+PLA A P+  P+++K
Sbjct  38   RYKGQSTTCKGSREDDQSPLGKLDRRNLLIGLGGLYGTAAGLGSDPLALANPVAPPDLSK  97

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELM  649
            C   PAD PPGA   NCCPP+++ +I+YKLP V+ +RVRPA HT+D+  IAK+ +AV+LM
Sbjct  98   CG--PADFPPGATPTNCCPPISSKIIDYKLPPVSKLRVRPATHTVDEAYIAKYNRAVQLM  155

Query  650  KALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K LP  DPR+F QQ+ +HCAYC+G+YDQV FP+ E+QVH SWLFFPFHR
Sbjct  156  KDLPDSDPRSFSQQSDIHCAYCDGSYDQVGFPNLELQVHESWLFFPFHR  204



>gb|ABI96932.1| putative polyphenol oxidase [Fallugia paradoxa]
Length=452

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP G    NCCPP AT +I++KLPA +T+RVRPAAH +
Sbjct  1    PFAFAKPVAPPDVSKCGA--ADLPNGVTPTNCCPPAATKIIDFKLPAPSTLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D   IAK++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DDVYIAKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96945.1| putative polyphenol oxidase [Prunus mexicana]
Length=452

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP+AT +I++KLPA   +RVRPAAH++
Sbjct  1    PFAFAKPVNPPDLSKCGA--ADLPTGATPTNCCPPLATKIIDFKLPAPGKLRVRPAAHSV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96926.1| putative polyphenol oxidase [Cercocarpus betuloides]
Length=455

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPPVA+ +I++KLP+ T +RVRPAAH +
Sbjct  1    PFAFAKPVAPPDVSKCGA--ADLPTGAQPTNCCPPVASKIIDFKLPSPTPLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  I K++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DKAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 133/194 (69%), Gaps = 13/194 (7%)
 Frame = +2

Query  224  SFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS---KLDRRDVllglgg  394
            +FS ++ +S  + KP Q + +       ++SC A      D+Q    K DRR+VLLGLGG
Sbjct  23   AFSHSSQVSL-IGKPRQFIRT-------RVSCKATNSDQNDAQPPVPKFDRRNVLLGLGG  74

Query  395  lygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT  574
            LYG   L S+P AFA P+  P+++KC    ADLP G    +CCPP  + +I++KLP+ T 
Sbjct  75   LYGVVGLGSDPFAFAKPVAPPDVSKCGA--ADLPNGVAPTDCCPPTPSKIIDFKLPSPTP  132

Query  575  MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQE  754
            +RVRPAAH +D   IAK+ KA+ELMKALP DDPR+F  QA VHCAYC+GAYDQ  FPD E
Sbjct  133  LRVRPAAHAVDDAYIAKYTKAMELMKALPDDDPRSFKNQANVHCAYCDGAYDQAGFPDLE  192

Query  755  IQVHNSWLFFPFHR  796
            +Q+HNSWLFFPFHR
Sbjct  193  LQIHNSWLFFPFHR  206



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 138/202 (68%), Gaps = 12/202 (6%)
 Frame = +2

Query  206  TATTPKSFSSAANLSTPLSKPSQHLISSKR-NRHFK---ISCNAAGDGGGDSQSKLDRRD  373
            T TTP   +S+     P  K SQ  I+ KR N H     ISC A      D Q+   RRD
Sbjct  8    TNTTPTISTSSFRHFFP--KTSQLFITKKRSNPHISRLPISCKATN---ADQQNPTTRRD  62

Query  374  VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINY  553
            +L+GLGGLYGA+++ ++P A A P+ AP++ KC    ADLP  A+  NCCPP +T ++++
Sbjct  63   ILIGLGGLYGATTIGNDPSALAKPVAAPDLTKCG--KADLPANALPTNCCPPPSTKILDF  120

Query  554  KLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYD  730
            KLP+    +R+RPAAH  D   +AK++KA+ELMKALP DDPR+F QQA VHCAYC+GAY 
Sbjct  121  KLPSSNNPLRIRPAAHLADDAYVAKYSKAIELMKALPDDDPRSFKQQASVHCAYCDGAYH  180

Query  731  QVNFPDQEIQVHNSWLFFPFHR  796
            QV FPD ++Q+HNSWLFFPFHR
Sbjct  181  QVGFPDLDLQIHNSWLFFPFHR  202



>ref|XP_006347083.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum tuberosum]
Length=616

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%), Gaps = 21/191 (11%)
 Frame = +2

Query  281  ISSKR----NRHFKISCNAAGDGGGDSQSK--------------LDRRDVllglgglygA  406
            ISS R    +R+F++SC    D   +  +               +DRR+VLLGLGGLYGA
Sbjct  35   ISSIRKHNVHRNFQVSCKTIDDNSHEHNNSPIDISKKNDSLNNMIDRRNVLLGLGGLYGA  94

Query  407  SSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRV  583
            S+LV   P A AAP+  P++ KC    ADLPPGA   NCCPP++ N+I+++LP+ T +R 
Sbjct  95   STLVGGLPFALAAPVNGPDVTKCGA--ADLPPGAAPVNCCPPMSGNIIDFQLPSSTALRT  152

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAH++D   I KF + ++LMK LP DDPR+F QQA VHCAYC+GAYDQ+ FP+ E+QV
Sbjct  153  RPAAHSVDSAYIEKFNRGIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQV  212

Query  764  HNSWLFFPFHR  796
            H+SW+F PFHR
Sbjct  213  HSSWIFLPFHR  223



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 140/212 (66%), Gaps = 18/212 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTP-LSKPSQHLISSKRNRHFK---ISCNAAGDGGG  343
            MASL  P         + S  ++ +T  L K SQ  I  KR  +F    +SC A     G
Sbjct  1    MASLLPPSV-------AISGGSDTATSFLPKTSQPSIPGKRKPNFISKPVSCKATN---G  50

Query  344  DSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            D Q+K DRRD+LLGLGGLYG SSL ++ LAFA P+  P+   C  P  DLP GA   NCC
Sbjct  51   DDQNKFDRRDILLGLGGLYGVSSL-NDSLAFAKPVTGPDFTHCGRP--DLPIGAANINCC  107

Query  524  PPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            PP +T ++++ LP     ++ RPAAH ++ D +AKF+KA+ELMKALPA DPR+F QQA V
Sbjct  108  PPPSTKIVDFVLPPSNAPLQTRPAAHLVNDDYLAKFSKAIELMKALPASDPRSFMQQANV  167

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAY Q+ FPD ++QVHNSWLFFPFHR
Sbjct  168  HCAYCDGAYHQLGFPDLDLQVHNSWLFFPFHR  199



>gb|ABI96929.1| putative polyphenol oxidase [Chamaebatiaria millefolium]
Length=453

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I++KLPA T +RVRPAAHT+
Sbjct  1    PFAFAKPVAPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFKLPAPTRLRVRPAAHTV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>emb|CAN62983.1| hypothetical protein VITISV_035472 [Vitis vinifera]
Length=607

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 145/223 (65%), Gaps = 18/223 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGG  340
            MASL    T +     + + +A   +PL + + H+ ++  R+  F   K+SCN+A GD  
Sbjct  1    MASLPWSLTTSTAIANTTNXSAFPPSPLFQRASHVPVARNRSXRFAPSKVSCNSANGDPN  60

Query  341  GDSQS--------KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPAD  490
             DS S        KLDRR+VLLG+GGLYGA+  +  + PLAF APIQAP+I+KC    A 
Sbjct  61   SDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--AT  118

Query  491  LPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPAD  667
            +P G    NCCPPV T  I ++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP D
Sbjct  119  VPDGVTXTNCCPPVTTKJIXFQLPSSDSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDD  178

Query  668  DPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DPR+F QQA VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  179  DPRSFKQQANVHCXYCQGAYDQVGYTDLELQVHASWLFLPFHR  221



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 134/206 (65%), Gaps = 10/206 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLD  364
            L S C PT+  PK+        +PL    +    SK+    K S     + G  S +  D
Sbjct  16   LPSSCIPTSCLPKT--------SPLFIFKKKKPFSKKLVSCKASNGNQNNEGSSSLNSFD  67

Query  365  RRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDN--CCPPVAT  538
            RRD+LLGLG LYGA++LVS+P A AAPI AP+++ CE             +  CCPP  T
Sbjct  68   RRDILLGLGTLYGATNLVSDPFALAAPIAAPDLSLCENSTVTSSSSGTSISVPCCPPKTT  127

Query  539  NVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCN  718
            N++++K P  +T+R+RPAAH +D + + KF KA+ELMKALP DDPR+F QQA VHCAYCN
Sbjct  128  NILDFKPPRFSTIRLRPAAHLVDANYLEKFTKAMELMKALPDDDPRSFKQQANVHCAYCN  187

Query  719  GAYDQVNFPDQEIQVHNSWLFFPFHR  796
            GAYDQV FPDQ++QVH SWLFFPFHR
Sbjct  188  GAYDQVGFPDQQLQVHFSWLFFPFHR  213



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 144/219 (66%), Gaps = 15/219 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHF---KISCNAAG-----  331
            MASL SP    ATT     +  +LS+   K SQ  +  K    +   ++SC A       
Sbjct  1    MASL-SPSAVMATTSTIPGTTTSLSSFSHKNSQISLIQKPKHSYAWSRVSCKATNSDQNP  59

Query  332  -DGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
             +   D+Q     LDRR+VLLGLGGLYG + L ++P AFA P+  P+++KC    ADLP 
Sbjct  60   SNNSNDAQPLGRTLDRRNVLLGLGGLYGVAGLGTDPFAFAKPVAPPDVSKCGA--ADLPT  117

Query  500  GAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRN  679
            GA   +CCPPVA  + +++LP  + +RVRPAAH +DK  I K++KA+ELMKALP DDPR+
Sbjct  118  GAQKTDCCPPVAQKIFDFQLPPQSKLRVRPAAHAVDKAYIEKYSKAIELMKALPDDDPRS  177

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F QQA +HCAYC+GAYDQ  FPD E+Q+H+SWLFFPFHR
Sbjct  178  FKQQANIHCAYCDGAYDQAGFPDLELQIHDSWLFFPFHR  216



>ref|XP_008349220.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=610

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 122/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query  284  SSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygA-SSLVSNPLAFAAPIQAPE  460
            SS +N++   S N   D    S   LDRR VL+GLG LYG  + L S+P A A P+  P+
Sbjct  53   SSDQNKNPSTSSNDH-DHENPSPVNLDRRXVLIGLGSLYGGVAGLGSDPFAVAKPVSPPD  111

Query  461  IAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAV  640
            +AKC    AD P GAV  NCCPP +  ++++K P+ T +RVRPAAH +DK  I K++KA+
Sbjct  112  LAKCGA--ADFPSGAVPTNCCPPTSQKIVDFKFPSPTKLRVRPAAHAVDKAYIEKYSKAI  169

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ELMKALP DDPR+F QQA VHCAYCNGAYDQV FP+ E+Q+H SWLFFPFHR
Sbjct  170  ELMKALPDDDPRSFTQQADVHCAYCNGAYDQVGFPNLELQIHQSWLFFPFHR  221



>gb|ABI96930.1| putative polyphenol oxidase [Crataegus monogyna]
Length=453

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA V NCCPP AT +I++KLPA   +R+RPAAH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPAPAKLRIRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  +P+ E+QVHNSWLFF
Sbjct  59   DKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96927.1| putative polyphenol oxidase [Chaenomeles speciosa]
Length=453

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA   NCCPP AT +I++KLPA T +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEFTNCCPPPATKIIDFKLPAPTKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFF
Sbjct  59   DKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 139/219 (63%), Gaps = 19/219 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPL-------SKPSQHLISSKRNRHFKISCNAAGD  334
            MASL+SP     T P S S ++             SKPS   I S R       C ++  
Sbjct  1    MASLSSPLVTKTTIPTSNSLSSLSQNSSHISLVQNSKPS--FIRSSR---IICKCTSSNQ  55

Query  335  GGGDS-----QSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPP  499
               D      Q+ LDRR+VL+GLGGLYG     ++P AFA P+  P+++KC    ADLPP
Sbjct  56   NPSDEHKHSHQTNLDRRNVLIGLGGLYGVGLGSADPFAFAKPVAPPDLSKCGA--ADLPP  113

Query  500  GAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRN  679
            GA   NCCPP++  ++++  P+ + +RVRPAAH +D+  I K++KA+ELMKALP  DPR+
Sbjct  114  GATPINCCPPISDKIVDFTFPSSSPLRVRPAAHAVDQAYIDKYSKAIELMKALPDSDPRS  173

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F QQA +HCAYC+GAYDQV FPD E+Q+H SWLF+PFHR
Sbjct  174  FSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFYPFHR  212



>gb|ABI96928.1| putative polyphenol oxidase [Chamaebatia foliolosa]
Length=455

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPPVA+ +I++KLP+ + +RVRPAAH +
Sbjct  1    PFAFAKPVAPPDVSKCGA--ADLPTGAQPTNCCPPVASKIIDFKLPSPSRLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96944.1| putative polyphenol oxidase [Prunus dulcis]
Length=451

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I++KLPA   +RVRPAAH +
Sbjct  1    PFAFAKPLNPPDLSKCGA--ADLPTGATPTNCCPPPATKIIDFKLPAPGKLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 139/221 (63%), Gaps = 23/221 (10%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPL-------SKPSQHLISSKRNRHFKISCNAAGD  334
            MASL+SP     T P S S ++             SKPS   I S R     I C +   
Sbjct  1    MASLSSPLVTKTTIPTSNSLSSLSQNSSHISLVQNSKPS--FIRSSR-----IICKSTSS  53

Query  335  GGGDS-------QSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADL  493
                S       Q+ +DRR+VL+GLGGLYG     ++P AFA P+  P+++KC    ADL
Sbjct  54   NQSPSDEHKHPHQTNVDRRNVLIGLGGLYGVGLGGADPFAFAKPVAPPDLSKCGA--ADL  111

Query  494  PPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDP  673
            PPGA   NCCPP++  ++++  P+ + +RVRPAAH +D+  I K++KA+ELMKALP  DP
Sbjct  112  PPGATPINCCPPISDKIVDFTFPSSSPLRVRPAAHAVDQAYIDKYSKAIELMKALPDSDP  171

Query  674  RNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            R+F QQA +HCAYC+GAYDQV FPD E+Q+H SWLFFPFHR
Sbjct  172  RSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFFPFHR  212



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +2

Query  347  SQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            S  KLDRRD ++   G    A+ L  N  A   PI+AP+++KC   PADLPPGA   +CC
Sbjct  23   SSGKLDRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDVSKCG--PADLPPGATPTDCC  80

Query  524  PPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            P   + +I++KLP  +  +R+R AAH +D + +AK+AKAVELMKALPADDPRNF QQA V
Sbjct  81   PSSTSKIIDFKLPPSSNPLRIRSAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQQANV  140

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            H AYC+GAY+Q+ FPD E+QVHNSW+FFP+HR
Sbjct  141  HSAYCDGAYEQIGFPDLELQVHNSWIFFPWHR  172



>gb|ABI96939.1| putative polyphenol oxidase [Neillia thyrsiflora]
Length=451

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+I+KC  P  DLP GA+  NCCPP+AT +I++K+PA   +R+RP AH +
Sbjct  1    PFAFAKPVAPPDISKCGAP--DLPTGALPTNCCPPLATKIIDFKVPAPNRLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K++KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQV FPD EIQ+HN WLFF
Sbjct  59   DQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPDLEIQIHNCWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 127/184 (69%), Gaps = 14/184 (8%)
 Frame = +2

Query  281  ISSKRNRHFKISCNAAGDG--------GGDSQSK--LDRRDVllglgglygASSLVS-NP  427
            I    NR F++SC  + D           DS +   +DRR++LLGLGGLYGA+++V  + 
Sbjct  43   IRKYGNRSFQVSCKGSEDDQTIYNTSKNSDSSNNKIIDRRNILLGLGGLYGAATIVGGHS  102

Query  428  LAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTM  604
             AFAAP+  P+++KC   PADLPPGA   NCCPP   N+I+++LP   TT+R RPAAH  
Sbjct  103  FAFAAPVNGPDVSKCG--PADLPPGAAPVNCCPPTTANIIDFQLPPPSTTLRTRPAAHAA  160

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D   I KF +A++LMK LP DDPR+F QQA VHCAYC+GAYDQ+ FP+ E+QVH SWLF 
Sbjct  161  DSAYIEKFNRAIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQVHFSWLFL  220

Query  785  PFHR  796
            PFHR
Sbjct  221  PFHR  224



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 122/170 (72%), Gaps = 9/170 (5%)
 Frame = +2

Query  308  KISCNAA-GD-----GGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAK  469
            +++C A  GD      G + Q K DRRDVLLGLGG+YGA++L ++P A A P+ APE+  
Sbjct  51   RVACRATNGDQQNINNGQNPQGKFDRRDVLLGLGGMYGAANLCNDPFALADPVSAPELTL  110

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVEL  646
            C    ADLP GA+  NCCPP +  + ++ LP+  T +RVRPAAH +D D IAK+ K +EL
Sbjct  111  CS--EADLPAGALPVNCCPPTSKKIKDFVLPSQNTPLRVRPAAHLVDNDYIAKYNKGIEL  168

Query  647  MKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            MK+LPADDPR+F QQA VHCAYC+GAY QV FPD  +QVH  WLFFPFHR
Sbjct  169  MKSLPADDPRSFTQQANVHCAYCDGAYTQVGFPDLSLQVHECWLFFPFHR  218



>gb|ABI96925.1| putative polyphenol oxidase [Adenostoma fasciculatum]
Length=454

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            PLAFA P+  P+++KC    ADLP GA   NCCP  AT +I++KLPA T +RVRPAAHT+
Sbjct  1    PLAFAKPVAPPDVSKCGA--ADLPTGAEPMNCCPLPATKIIDFKLPAPTQLRVRPAAHTV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +2

Query  359  LDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            LDRR+VLLGLGGLYG + L ++P AFA P+  P+++KC    ADLP GA   +CCPPVA 
Sbjct  73   LDRRNVLLGLGGLYGVAGLGTDPFAFAKPVAPPDVSKCGA--ADLPTGAQKTDCCPPVAK  130

Query  539  NVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCN  718
             + +++LP  + +RVRPAAH +DK  I K++KA+ELMKALP DDPR+F QQA +HCAYC+
Sbjct  131  KIFDFQLPPQSKLRVRPAAHAVDKAYIEKYSKAIELMKALPDDDPRSFKQQANIHCAYCD  190

Query  719  GAYDQVNFPDQEIQVHNSWLFFPFHR  796
            GAYDQ  FPD E+Q+H SWLFFPFHR
Sbjct  191  GAYDQAGFPDLELQIHGSWLFFPFHR  216



>gb|ABI96948.1| putative polyphenol oxidase [Sorbus californica]
Length=453

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA V NCCPP AT +I++KLPA   +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPAPAKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFF
Sbjct  59   DQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96951.1| putative polyphenol oxidase [Vauquelinia californica]
Length=453

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA V NCCPP AT +I++KLPA + +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPAPSKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  +P+ E+QVHNSWLFF
Sbjct  59   DQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_004232833.2| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum lycopersicum]
Length=626

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 21/191 (11%)
 Frame = +2

Query  281  ISSKR----NRHFKISCNAAGDGGGD-------------SQSKLDRRDVllglgglygAS  409
            ISS R    +R+F++SC    D   +             S + +DRR+VLLGLGGLYGAS
Sbjct  44   ISSIRKHNVHRNFQVSCKTIDDNNHEHNSPVDISKKNDSSNNMIDRRNVLLGLGGLYGAS  103

Query  410  SLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRV  583
            +LV   P   AAP+  P++ KC    ADLPPGA + NCCPP++ ++I+++LP+ +T +R 
Sbjct  104  TLVGGLPFVLAAPVNGPDVTKCGA--ADLPPGAELVNCCPPMSGSIIDFQLPSSSTPLRT  161

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAH++D   I KF +A++LMK LP DDPR+F QQA +HCAYC+GAYDQ+ FP+ E+QV
Sbjct  162  RPAAHSVDSAYIEKFNRAIQLMKQLPDDDPRSFKQQANIHCAYCDGAYDQLGFPNSELQV  221

Query  764  HNSWLFFPFHR  796
            H+SW+F PFHR
Sbjct  222  HSSWIFLPFHR  232



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = +2

Query  359  LDRRDVllglgglygA-SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVA  535
            LDRR VL+GLG LYG  + L S+P A A P+  P++AKC    AD P GAV  NCCPP +
Sbjct  77   LDRRHVLIGLGSLYGGVAGLGSDPFAVAKPVSPPDLAKCG--GADFPSGAVPXNCCPPTS  134

Query  536  TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
              ++++K P+ T +RVRPAAHT+DK  I K++KA+ELMKALP DDPR+F QQA  HCAYC
Sbjct  135  QKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADJHCAYC  194

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +GAYDQV FP+ E+Q+H  WLFFPFHR
Sbjct  195  DGAYDQVGFPNLELQIHQXWLFFPFHR  221



>gb|ABI96934.1| putative polyphenol oxidase [Gillenia trifoliata]
Length=453

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA   NCCPP AT +I++K PA   +R+RPAAH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEATNCCPPPATKIIDFKRPAPAQLRIRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+QVHNSWLFF
Sbjct  59   DQAYTDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96943.1| putative polyphenol oxidase [Prinsepia sinensis]
Length=457

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP  T +I+++LPA + +RVRPAAH +
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPTTKIIDFRLPAPSGLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQV FPD E+Q+HNSWLFF
Sbjct  59   DKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 127/188 (68%), Gaps = 8/188 (4%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHFK--ISCNAAG----DGGGDSQSKLDRRDVllglgglygASSLV  418
            L K SQ  I   +    K  +SC A+     + G  S +  DRRD+LLGLG LYGA++LV
Sbjct  26   LPKTSQLFIFKMKKPFSKNLVSCKASNGNQNNEGSSSLNSFDRRDILLGLGSLYGATNLV  85

Query  419  SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDN--CCPPVATNVINYKLPAVTTMRVRPA  592
            S+P A AA I AP+++ CE             +  CCPP  TN++++K P  +T+R+RPA
Sbjct  86   SDPFALAALIAAPDLSLCENSTVTSSSSGTSISVPCCPPKTTNILDFKPPRFSTIRLRPA  145

Query  593  AHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNS  772
            AH +D + + KF KA+ELMKALP DDPR+F QQA VHCAYCNGAYDQV FPDQ++QVH S
Sbjct  146  AHLVDANYLEKFTKAIELMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFS  205

Query  773  WLFFPFHR  796
            WLFFPFHR
Sbjct  206  WLFFPFHR  213



>gb|ABI96941.1| putative polyphenol oxidase [Physocarpus capitatus]
Length=451

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+I+KC    ADLP G    NCCPP  T +I++KLPA   +RVRP AH +
Sbjct  1    PFAFAKPVAPPDISKCGA--ADLPNGVQPTNCCPPPGTKIIDFKLPAPNRLRVRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K++KA++LMKALP DDPR+F QQALVHCAYC+GAYDQV FPD E+Q+HNSWLFF
Sbjct  59   DQAYIDKYSKAIQLMKALPDDDPRSFKQQALVHCAYCDGAYDQVGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 133/195 (68%), Gaps = 14/195 (7%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGDSQSK---------LDRRDVllglggl  397
            ST  +K S+     K   H F++SC    D    + SK         +DRR++LLGLGG+
Sbjct  30   STFFTKTSKVSTLRKYGNHSFQVSCKGTEDDQTINTSKSSDSSNNKIIDRRNMLLGLGGI  89

Query  398  ygASSLVS-NPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VT  571
            YGA++LV  +P AFAAP+  P+++KC   PADLPPGA   NCCPP   N+I+++LP   T
Sbjct  90   YGAATLVGGHPFAFAAPVPGPDVSKCG--PADLPPGAAPVNCCPPTTANIIDFQLPPPST  147

Query  572  TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQ  751
            T+R RPAAH+ D   I KF +A++LMK LP DDPR+F QQA VHCAYC+GAYDQ+ FP+ 
Sbjct  148  TLRTRPAAHSADSAYIEKFNRAIQLMKQLPDDDPRSFRQQANVHCAYCDGAYDQLGFPNS  207

Query  752  EIQVHNSWLFFPFHR  796
            E+QVH SWLF PFHR
Sbjct  208  ELQVHFSWLFLPFHR  222



>gb|ABI96938.1| putative polyphenol oxidase [Lyonothamnus floribundus]
Length=454

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I++KLPA + +RVRPAAH +
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAKPMNCCPPPATKIIDFKLPAPSRLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAY QV FPD E+Q+HNSWLFF
Sbjct  59   DQAYIEKYTKAMELMKALPEDDPRSFKQQAAVHCAYCDGAYHQVGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96940.1| putative polyphenol oxidase [Oemleria cerasiformis]
Length=457

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I+++LP+ + +RVRPAAH +
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPSPSRLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  I K+ KA+ELMK LP DDPR+F QQA VHCAYC+GAYDQV FPD E+Q+HNSWLFF
Sbjct  59   DKAYIDKYYKAMELMKGLPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 131/203 (65%), Gaps = 17/203 (8%)
 Frame = +2

Query  233  SAANLSTPLSKPSQ-HLISSKRNRH---FKISCNAAGD----------GGGDSQSKLDRR  370
            S  +LS  L K  Q   IS + N+H    K+SC A  +              S  KLDRR
Sbjct  19   STTSLSPSLQKKCQISTISKRSNKHCLPRKLSCKANNNDHDLSPTNDVASKTSNPKLDRR  78

Query  371  DVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVIN  550
            +VLLGLG L G + L ++P AFAAPI AP+I++C    AD P G    NCCPPV+  +++
Sbjct  79   NVLLGLGSLGGLAGLRADPFAFAAPISAPDISQCGA--ADFPSGVDPVNCCPPVSAQIVD  136

Query  551  YKLPAV-TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAY  727
            +KLPA    +RVRP AH +D    AKF +A ELMKALP  DPR+F QQA +HCAYC+GAY
Sbjct  137  FKLPASPGKLRVRPPAHAVDSAYTAKFKRAFELMKALPDSDPRSFKQQASIHCAYCDGAY  196

Query  728  DQVNFPDQEIQVHNSWLFFPFHR  796
            +Q+ FPD +IQVHNSWLFFPFHR
Sbjct  197  EQIGFPDLDIQVHNSWLFFPFHR  219



>gb|ABI96931.1| putative polyphenol oxidase [Exochorda racemosa]
Length=459

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I+++LPA  ++RVRPAAH +
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPAPNSLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            +K  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ+ FPD E+Q+HNSWLFF
Sbjct  59   NKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQIGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 10/185 (5%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHF----KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSN  424
            LSK SQ  I   RN ++     ISC A  +     Q+   RRD+L+ LGGLY A +L  +
Sbjct  19   LSKTSQLSIPKNRNCNYVNPHLISCKATAND--HDQNPTTRRDILIVLGGLYVAITL-GD  75

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHT  601
            PLAFA P+ AP++ KC    ADLP  A   NCCPP +T ++++KLP+  + +R+RPAAH 
Sbjct  76   PLAFAKPVSAPDLTKCG--KADLPSSAKPTNCCPPPSTKILDFKLPSSNSPLRIRPAAHV  133

Query  602  MDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLF  781
            +D   +AK++KA+ELMKALP DDPR+F QQA VHCAYC+GAY QV  PD ++QVHNSWLF
Sbjct  134  VDDAYLAKYSKAIELMKALPDDDPRSFMQQANVHCAYCDGAYHQVGLPDLDLQVHNSWLF  193

Query  782  FPFHR  796
            FPFHR
Sbjct  194  FPFHR  198



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 5/173 (3%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSK--LDRRDVllglgglygASSLVSNPLAFAAPIQAPE  460
            SK +   +++CN+     G+        RR++LLGLGGL GA++L +NP AFAAPI  P+
Sbjct  41   SKHHHTPRVTCNSGNQNKGEKPDIHIEQRRNILLGLGGLCGAATLNNNPFAFAAPISPPD  100

Query  461  IAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKA  637
            +  C   P DLP GA   NCCPP ++ +I++K P     +RVRPAAH +DK+ +AK+ KA
Sbjct  101  LTTCG--PPDLPEGAEPTNCCPPFSSTIIDFKFPPSNKPLRVRPAAHLVDKNYLAKYKKA  158

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ++LMK LPA+DPRNF QQA VHCAYC G+YDQV FP  E+QVH+SWLFFP+HR
Sbjct  159  IDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFPYHR  211



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 5/173 (3%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSK--LDRRDVllglgglygASSLVSNPLAFAAPIQAPE  460
            SK +   +++CN+     G+        RR++LLGLGGL GA++L +NP AFAAPI  P+
Sbjct  41   SKHHHTPRVTCNSGNQNKGEKPDIHIEQRRNILLGLGGLCGAATLNNNPFAFAAPISPPD  100

Query  461  IAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKA  637
            +  C   P DLP GA   NCCPP ++ +I++K P     +RVRPAAH +DK+ +AK+ KA
Sbjct  101  LTTCG--PPDLPEGAEPTNCCPPFSSTIIDFKFPPSNKPLRVRPAAHLVDKNYLAKYKKA  158

Query  638  VELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ++LMK LPA+DPRNF QQA VHCAYC G+YDQV FP  E+QVH+SWLFFP+HR
Sbjct  159  IDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFPYHR  211



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = +2

Query  296  NRHFKISCNAAGDGGGDSQSK---------LDRRDVllglgglygASSLVS-NPLAFAAP  445
            N  F++SC    D    + SK         +DRR++LLGLGG+YGA++LV  +P AFAAP
Sbjct  47   NYRFQVSCKGTEDDQTINTSKSSDSSNNKIIDRRNMLLGLGGIYGAATLVGGHPFAFAAP  106

Query  446  IQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIA  622
            +  P+++KC   PADLPPGA   NCCPP   N+I+++LP   TT+R RPAAH+ D   I 
Sbjct  107  VPGPDVSKCG--PADLPPGAAPVNCCPPTTANIIDFQLPPPSTTLRTRPAAHSADSAYIE  164

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            KF +A++LMK LP +DPR+F QQA VHCAYC+GAY+Q+ FP  E+QVH+SWLFFPFHR
Sbjct  165  KFNRAIQLMKQLPDNDPRSFKQQANVHCAYCDGAYEQLGFPSSELQVHSSWLFFPFHR  222



>gb|ABI96937.1| putative polyphenol oxidase [Kageneckia oblonga]
Length=453

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA   NCCPP AT +I++KLPA   +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEFTNCCPPPATKIIDFKLPAPGKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFF
Sbjct  59   DQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|ABI96935.1| putative polyphenol oxidase [Heteromeles arbutifolia]
Length=453

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA   NCCPP AT +I++KLPA   +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCGS--ADLPPGAEATNCCPPPATKIIDFKLPAPAKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFF
Sbjct  59   DQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 3/228 (1%)
 Frame = +2

Query  122  FHYI*RDAKQSGLVTRRPMASLTSPCT-PTATTPKSFSSAANLSTPLSKPSQHLISSKRN  298
            F +I   +KQ  L     + S ++P   P++    SF    +  +   K      +SK+ 
Sbjct  4    FTFIFTQSKQGTLTMGSTVNSPSTPIIIPSSPLQTSFIPKTSQLSIFKKKKPFNFASKKL  63

Query  299  RHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEV  478
               K S     +    S ++ DRRD+LLGLGGLYGA++LVS+P A AAPI AP+++ CE 
Sbjct  64   VSCKASDRNQNNADSSSLNRFDRRDILLGLGGLYGATNLVSDPFASAAPIAAPDLSLCEN  123

Query  479  PPADLPPGAVVDN--CCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMK  652
                        +  CCPP ATN+I++K P  + +R+RPAAH +D + + KF KA+ELMK
Sbjct  124  STVTSSSSGTSISVPCCPPKATNIIDFKPPRFSNIRLRPAAHLVDANYLEKFTKAMELMK  183

Query  653  ALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ALP DDPR+F QQA VHCAYCNG YD V FPDQ++Q+H SWLFFPFHR
Sbjct  184  ALPDDDPRSFKQQANVHCAYCNGVYDHVGFPDQQLQIHFSWLFFPFHR  231



>ref|XP_011098120.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
 gb|AFJ42577.1| polyphenol oxidase [Sesamum indicum]
Length=584

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 145/217 (67%), Gaps = 17/217 (8%)
 Frame = +2

Query  176  MASLTSPC-TPTATTPKSFSSAANLSTPLSKPSQHLISSKR-NRHFKISCNAAGDGGGDS  349
            MASL  PC TPT+   +S SS   L    +KPS  L  +KR +   ++S  A  +    S
Sbjct  1    MASLQIPCATPTS---QSRSSPHPL---FAKPSHFLTHAKRRSNRLRVSATAGQNQSNSS  54

Query  350  QS------KLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAV  508
            Q+      ++DRR+VLLGLGG  YGA++L+S+P A A P+Q PE+ KC     +L  G  
Sbjct  55   QNVETAQGRVDRRNVLLGLGGGLYGAANLISSPGASANPVQPPELDKCGTA-TNLNTGEQ  113

Query  509  VD-NCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFY  685
            +D NCCPPV   +++Y+LP V  ++VRP+AH +  + IAK+ KA++LMK LPADDPRNF 
Sbjct  114  LDINCCPPVTDRILDYRLPPVYQLKVRPSAHRVSPEYIAKYNKAIDLMKRLPADDPRNFM  173

Query  686  QQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QQA++HCAYCNGAYDQ      ++Q+HNSWLFFPFHR
Sbjct  174  QQAMIHCAYCNGAYDQPGQGSLDLQIHNSWLFFPFHR  210



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 122/168 (73%), Gaps = 9/168 (5%)
 Frame = +2

Query  299  RHFKISCNAAGDGGGDSQSKLDRRDVllglggly-gASSLVSNPLAFAAPIQAPEIAKCE  475
            R   ISC +    G      +DRRD+LLG+GGLY  A+ L  +  A  APIQAP+I+ C 
Sbjct  46   RRKMISCKSEKSRG------IDRRDLLLGVGGLYGAAAGLGLDRRAVGAPIQAPDISTCG  99

Query  476  VPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMK  652
             PPADLP  A   +CCPP  + ++++KLP  +  +RVRPAA ++D D +AK+ KAVELMK
Sbjct  100  -PPADLPATAPPTDCCPPYQSTIVDFKLPPRSDPLRVRPAAQSVDADYLAKYKKAVELMK  158

Query  653  ALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ALPADDPRNF QQA VHCAYC+GAYDQ+ FPD EIQVH+SWLFFP+HR
Sbjct  159  ALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHSSWLFFPWHR  206



>gb|ABI96950.1| putative polyphenol oxidase [Spiraea densiflora]
Length=454

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I+++LPA   +RVRPAAH +
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPAPNRLRVRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK+ IAK+ KA+ELMKALP  DPR+F  QA +HCAYC+GAYDQ  FPD E+QVHNSWLFF
Sbjct  59   DKNYIAKYNKAMELMKALPDSDPRSFKSQAAIHCAYCDGAYDQTGFPDLELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 121/181 (67%), Gaps = 9/181 (5%)
 Frame = +2

Query  266  PSQHLISSKRNRHFKISCNAAGDGGGD--SQSKLDRRDVllglgglygASSLVS-NPLAF  436
            P   +IS+ R+    ISC    D      +  K+DRR+VLLGLG L GA++    N LAF
Sbjct  40   PIARIISTPRH---AISCKTQDDHDHRHANSGKIDRRNVLLGLGTLSGATATFGPNSLAF  96

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            A PI AP+I  C   PA  P G    NCCPP  T ++++K+P+   T+RVRPAAH ++KD
Sbjct  97   ADPIMAPDITLCG--PATFPEGVATTNCCPPSTTKILDFKVPSQANTLRVRPAAHLVNKD  154

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAK+ K V+LMKALP DDPRNF QQA VHCAYC+G YDQ+ F D E QVH SWLF+PFH
Sbjct  155  YIAKYNKVVQLMKALPEDDPRNFMQQASVHCAYCDGTYDQLGFQDLEFQVHASWLFYPFH  214

Query  794  R  796
            R
Sbjct  215  R  215



>gb|KCW45575.1| hypothetical protein EUGRSUZ_L00688 [Eucalyptus grandis]
Length=226

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 136/221 (62%), Gaps = 21/221 (10%)
 Frame = +2

Query  176  MASLTSPCTPTATTP--KSFSSAANLST--PL--SKPSQHLISSKRN---RHFKISCNAA  328
            MASL SP T TA      SFSS   +ST  P    + S  L S  R    R   ISC A 
Sbjct  1    MASLPSPATATAVGTTTSSFSSPVAISTYGPFFRKRGSPSLYSKHRKPSIRRSTISCKAL  60

Query  329  GDGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKC-EVPPADLP  496
             +   +      KLDRR+VL+GL G YGA  L S+P A A PI  P+  +C +V P    
Sbjct  61   SNDDSEQNPMSVKLDRRNVLIGLSGFYGAVGLRSDPFALADPISVPDFTQCGKVKPC---  117

Query  497  PGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDP  673
                   CCPP  T V+++KLP+  +  RVRPAAH  DKD IAK A+A++LMKALPADDP
Sbjct  118  ----AKACCPPPTTEVLDFKLPSSNSPTRVRPAAHLADKDYIAKHAEAIKLMKALPADDP  173

Query  674  RNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            R+F QQA VHCAYC G Y+QV FPD ++QVH+SWLFFPFHR
Sbjct  174  RSFMQQANVHCAYCEGFYNQVGFPDLKLQVHSSWLFFPFHR  214



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 131/177 (74%), Gaps = 11/177 (6%)
 Frame = +2

Query  287  SKRNRHFK--ISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVS--NPLAFAAPIQA  454
            ++R  H +  I+C A  +   +  +K+DRRDVL+GLGGL GA++ +   +  A A PIQA
Sbjct  36   TRRALHVRPNIACKAGEEH--EIAAKVDRRDVLVGLGGLCGAAAGLGGFDKAALANPIQA  93

Query  455  PEIAKCEVPPADLPPGAVVDNCCPPV--ATNVINYKLPAVTT-MRVRPAAHTMDKDAIAK  625
            P+++KC   PADLP G  V NCCPP      ++++K P+ ++ +RVRPAAH +D + +AK
Sbjct  94   PDLSKCG--PADLPTGVPVVNCCPPYRPGAKIVDFKRPSPSSPLRVRPAAHLVDPEYLAK  151

Query  626  FAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            + KA+ELMKALPADDPRNF QQA VHCAYC+GAYDQ+ FP+ EIQVHNSWLFFP+HR
Sbjct  152  YKKAIELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLEIQVHNSWLFFPWHR  208



>gb|ABI96949.1| putative polyphenol oxidase [Spiraea cantoniensis]
Length=455

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+++KC    ADLP GA   NCCPP AT +I+++LPA   +RVRPAAH  
Sbjct  1    PFAFAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPAPNRLRVRPAAHAA  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  IAK+ KA+ELMKALP  DPR+F  QA VHCAYC+GAYDQV FPD E+QVHNSWLFF
Sbjct  59   DKAYIAKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQVGFPDLELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_011082856.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=558

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 140/213 (66%), Gaps = 11/213 (5%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISC-----NAAGDGG  340
            MASL  PC   ATTP S + +++     +KPS  +  +KR    ++SC     N +    
Sbjct  1    MASLHLPC---ATTPSSQTRSSSRPV-FAKPSHFITHAKRGHRLQVSCATENQNDSSRNV  56

Query  341  GDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-N  517
              SQ K+DRR++LLGLGGLYGAS+LVS P A A PI+ PEI KC     +L     +D N
Sbjct  57   ETSQGKVDRRNMLLGLGGLYGASNLVSAPGASANPIKPPEIDKCGTA-TNLNNNTQLDIN  115

Query  518  CCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQAL  697
            CCPP++ N+++Y+LP V  M++RP+AH +  + I K+  A++ MK LP +DPR+F QQA 
Sbjct  116  CCPPLSQNIVDYRLPPVFQMKIRPSAHRVSPEYIFKYNMAIDRMKRLPKEDPRSFMQQAN  175

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +HCAYCNGAYDQ      ++QVHNSWLFFPFHR
Sbjct  176  IHCAYCNGAYDQPGQGTLDLQVHNSWLFFPFHR  208



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  404  ASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRV  583
             + L S+P A A P+  P++AKC    AD P GAV  NCCPP +  ++++K P+ T +RV
Sbjct  25   VAGLGSDPFAVAKPVXPPDLAKCGA--ADFPSGAVPXNCCPPTSQKIVDFKFPSPTKLRV  82

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAHT+DK  I K++KA+ELMKALP DDPR+F QQA +HCAYC+GAYDQV FP+ E+Q+
Sbjct  83   RPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQI  142

Query  764  HNSWLFFPFHR  796
            H  WLFFPFHR
Sbjct  143  HQCWLFFPFHR  153



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 2/126 (2%)
 Frame = +2

Query  419  SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAH  598
            ++P AFA PI  P++ +C   PADLP GA+  NCCPP    +I++KLP  + +RVRPAA 
Sbjct  75   TDPFAFANPISPPDLTQCG--PADLPSGALPTNCCPPTYPKIIDFKLPPPSRLRVRPAAQ  132

Query  599  TMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWL  778
            T+D+  I K++KA+ LMKALP DDPRNF QQA VHCAYC+GAYDQV FPD E+Q+HN WL
Sbjct  133  TVDQSYIDKYSKAIALMKALPDDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQIHNCWL  192

Query  779  FFPFHR  796
            FFPFHR
Sbjct  193  FFPFHR  198



>gb|ABI96946.1| putative polyphenol oxidase [Pyrus communis subsp. caucasica]
Length=453

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLP GA   NCCPP AT +I++KLPA   +R+RP AH +
Sbjct  1    PFAFAKPIAPPDVSKCG--SADLPQGAEATNCCPPPATKIIDFKLPAPAKLRIRPPAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK    KF KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFF
Sbjct  59   DKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  404  ASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRV  583
             + L S+P A A P+  P++AKC    AD P GAV  NCCPP +  ++++K P+ T +RV
Sbjct  25   VAGLGSDPFAVAKPVXPPDLAKCGA--ADFPSGAVPINCCPPTSQKIVDFKFPSPTKLRV  82

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAHT+DK  I K++KA+ELMKALP DDPR+F QQA +HCAYC+GAYDQV FP+ E+Q+
Sbjct  83   RPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQI  142

Query  764  HNSWLFFPFHR  796
            H  WLFFPFHR
Sbjct  143  HQCWLFFPFHR  153



>gb|ABI96936.1| putative polyphenol oxidase [Holodiscus microphyllus]
Length=455

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P+I+KC    ADLP GA   NCCPP AT +I++KLPA   +R+RPAAH +
Sbjct  1    PFAFAKPVLPPDISKCGA--ADLPTGAEPMNCCPPPATKIIDFKLPATNRLRIRPAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  I K+ KA+ELMKALP  DPR+F  QA VHCAYC+GAYDQ  FPD E+Q+HNSWLFF
Sbjct  59   DKAYIDKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 120/171 (70%), Gaps = 6/171 (4%)
 Frame = +2

Query  296  NRHFKISCNAAG--DGGGDSQSKLDRRDVllglgglygAS-SLVSNPLAFAAPIQAPEIA  466
            N    ++C   G  D       K+DRR++LLGLGGLYGA+ S  SN LAFA PI AP++ 
Sbjct  47   NHRHALACKTRGVDDHHEIDSDKVDRRNILLGLGGLYGAAASFGSNSLAFADPIMAPDVT  106

Query  467  KCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIAKFAKAVE  643
            KC   P DLP GA+  NCCPP  T ++++KLP+   T+R+RPAAH +DKD I KF KA++
Sbjct  107  KC--GPPDLPKGAIRTNCCPPSTTKILDFKLPSPSNTLRIRPAAHLVDKDYITKFNKAIK  164

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LMKALP DDPR+F  QA VHCAYC+GAYD   F D ++QVH SWLF PFHR
Sbjct  165  LMKALPNDDPRSFKNQADVHCAYCDGAYDHFGFQDLDLQVHASWLFLPFHR  215



>gb|ABI96933.1| putative polyphenol oxidase [Gillenia stipulata]
Length=453

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA PI  P+++KC    ADLPPGA   NCCPP AT +I++K PA   +R+R AAH +
Sbjct  1    PFAFAKPIAPPDLSKCG--SADLPPGAEATNCCPPPATKIIDFKRPAPAQLRIRAAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            D+    K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FPD E+QVHNSWLFF
Sbjct  59   DQAYKDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQVHNSWLFF  118

Query  785  PFHR  796
            PFHR
Sbjct  119  PFHR  122



>gb|AAO16863.1| polyphenol oxidase [Ananas comosus]
Length=554

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRV  583
            + L  N  A AAPI AP+++ C  PPADLP  A    CCPP  + +I++KLP  +  +RV
Sbjct  34   TGLGLNRRAAAAPILAPDLSTCG-PPADLPASARPTVCCPPYQSTIIDFKLPPRSAPLRV  92

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAH +D D +AK+ KAVELM+ALPADDPRNF QQA VHCAYC+GAYDQ+ FPD EIQ+
Sbjct  93   RPAAHLVDADYLAKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQI  152

Query  764  HNSWLFFPFHR  796
            HNSWLFFP+HR
Sbjct  153  HNSWLFFPWHR  163



>gb|AAK29782.1|AF261957_1 polyphenol oxidase [Ananas comosus]
 gb|AAO16864.1| polyphenol oxidase [Ananas comosus]
Length=604

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRV  583
            + L  N  A AAPI AP+++ C  PPADLP  A    CCPP  + +I++KLP  +  +RV
Sbjct  84   TGLGLNRRAAAAPILAPDLSTCG-PPADLPASARPTVCCPPYQSTIIDFKLPPRSAPLRV  142

Query  584  RPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQV  763
            RPAAH +D D +AK+ KAVELM+ALPADDPRNF QQA VHCAYC+GAYDQ+ FPD EIQ+
Sbjct  143  RPAAHLVDADYLAKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQI  202

Query  764  HNSWLFFPFHR  796
            HNSWLFFP+HR
Sbjct  203  HNSWLFFPWHR  213



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 135/209 (65%), Gaps = 10/209 (5%)
 Frame = +2

Query  176  MASLTSPC-TPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQ  352
            MASLT     P+ TT   FS   + S     P  + +S +R     +SC A   G     
Sbjct  6    MASLTPTIPRPSTTTDSFFSFFPSKSPISFAPKLNRLSKRR-----VSCKAT-KGDQSPL  59

Query  353  SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
             K DRR+VL+GLGGLYG + L SN  + AAP+  P+++ C   P DLP GA   +CCPP 
Sbjct  60   GKFDRRNVLIGLGGLYGVNGLGSNSFSIAAPVAPPDLSNCG--PPDLPSGAKPTDCCPPK  117

Query  533  ATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
            +  +I++KLP  +  +RVRPAAH +DK+ I K++KA+ LMKALP DDPRNF QQA +HCA
Sbjct  118  SDKIIDFKLPPQSNQLRVRPAAHVVDKNYIEKYSKAIALMKALPEDDPRNFTQQANIHCA  177

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ AYDQV FPD E+QVHN WLFFP HR
Sbjct  178  YCDAAYDQVGFPDLELQVHNCWLFFPCHR  206



>ref|XP_009773174.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=621

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 124/178 (70%), Gaps = 13/178 (7%)
 Frame = +2

Query  296  NRHFKISCNAAGDGGGDSQSK---------LDRRDVllglgglygASSLVS-NPLAFAAP  445
            N  F++SC    D    + SK         +DRR++LLGLGG+YGA++LV  +P AFAAP
Sbjct  61   NYRFQVSCKGTEDDQTINTSKSSDSSNNKIIDRRNMLLGLGGIYGAATLVGGHPFAFAAP  120

Query  446  IQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIA  622
            +  P+++KC    ADLPPGA   NCCPP   N+I+++LP   TT+R RPAAHT D   I 
Sbjct  121  VPGPDVSKCGA--ADLPPGAAPVNCCPPTTGNIIDFQLPPPSTTLRTRPAAHTADNAYIE  178

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            KF +A++LMK LP DDPR+F  QA VHCAYC+GAYDQ+ FP+ E+QVH SWLF PFHR
Sbjct  179  KFNRAIQLMKQLPDDDPRSFKNQANVHCAYCDGAYDQLGFPNSELQVHFSWLFHPFHR  236



>ref|XP_011082857.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 132/211 (63%), Gaps = 7/211 (3%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAA---GDGGGD  346
            MAS   PC  T +      SA  L    +KPS  L  +KR+   ++SC  A    D   D
Sbjct  1    MASSHLPCATTISATLPLPSAQPL---FAKPSHFLTHAKRSPRLQVSCATAPNKNDSVDD  57

Query  347  S-QSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            + Q K+DRR++LLGLGGLYGA++LVS P A A PIQ PE+ KC V         V  +CC
Sbjct  58   TPQGKVDRRNMLLGLGGLYGATNLVSTPGASANPIQPPELDKCGVATNAANQKPVEFSCC  117

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVH  703
            PPV   +I+YKLP V  M++RP+AH +  + I K+  A++ MK LP DDPRNF QQA +H
Sbjct  118  PPVTQRIIDYKLPPVFQMKIRPSAHRVSPEYIFKYNMAIDRMKRLPQDDPRNFLQQANIH  177

Query  704  CAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            CAYCNGAYDQ      ++QVH SWLFFPFHR
Sbjct  178  CAYCNGAYDQPGQGTLDLQVHESWLFFPFHR  208



>gb|ACJ04909.1| polyphenol oxidase [synthetic construct]
Length=600

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 121/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRDVllglgglygASSLV-SNPLAF  436
            K N  F +SC+ A D   +          S  K DRR++L+GL GLYGA+ L  ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLEGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  YIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 127/190 (67%), Gaps = 9/190 (5%)
 Frame = +2

Query  248  STPLSKPSQH------LISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygA  406
            + PLS  SQ+      L   KR+   K+SC    +   D +QSKL+RR+VLLGLGGLYG 
Sbjct  19   TKPLSPFSQNNSQVSLLTKPKRSFGRKVSCKDTNNDEIDQAQSKLERRNVLLGLGGLYGV  78

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVR  586
              + ++P  +   I  P+++KC   PADLP G V   CCPP +T +I++KLPA   +R+R
Sbjct  79   GGMDTDPRGWGKAIAPPDVSKCG--PADLPQGGVPTICCPPRSTKIIDFKLPAPAKLRIR  136

Query  587  PAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVH  766
            P AH  D+    K  KA+ELMKALP DDPR+F QQ  VHCAYC+GAYDQV FP+ E+Q+H
Sbjct  137  PPAHAGDQAYRDKHYKAMELMKALPDDDPRSFKQQGAVHCAYCDGAYDQVGFPELELQIH  196

Query  767  NSWLFFPFHR  796
            NSWLFFP HR
Sbjct  197  NSWLFFPLHR  206



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 124/182 (68%), Gaps = 9/182 (5%)
 Frame = +2

Query  266  PSQHLISSKRNRHFK----ISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLA  433
            P +   S  +N  FK    I C A        + K DRRDVL+GLGGLY  ++ +++  A
Sbjct  14   PKKSKYSIIKNPKFKNPKSIPCKAINGEQEHPKHKFDRRDVLIGLGGLYYGAASLND--A  71

Query  434  FAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDK  610
             AAPI APE+ KC    AD+P G    +CCPPV+  ++++K P   + +RVRPAAH +D 
Sbjct  72   MAAPISAPEMEKCGR--ADVPEGVQTTDCCPPVSKRILDFKPPFSNSPVRVRPAAHLVDD  129

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            + I K++KA+ELMKALP DDPR+F QQA VHCAYC GAYDQV FP+ E+QVHNSWLFFPF
Sbjct  130  EYIRKYSKAIELMKALPHDDPRSFMQQANVHCAYCEGAYDQVGFPNLELQVHNSWLFFPF  189

Query  791  HR  796
            HR
Sbjct  190  HR  191



>ref|XP_007025707.1| Larreatricin hydroxylase isoform 2 [Theobroma cacao]
 ref|XP_007025708.1| Larreatricin hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY28329.1| Larreatricin hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY28330.1| Larreatricin hydroxylase isoform 2 [Theobroma cacao]
Length=411

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +2

Query  311  ISCNAAGDG--GGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKC-EVP  481
            +SC A  +G  G  S ++ DRRD+L+GLGGLYGA++L ++P A AAPI AP++  C +  
Sbjct  48   VSCKATNNGSKGDSSLNRFDRRDLLIGLGGLYGATNLSNDPFALAAPIAAPDLTLCGDAT  107

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             +D     V   CCPP  T VI++K P  + +R R AAH +D D +AKF KA+ELM+ALP
Sbjct  108  ISDTTKETVY--CCPPETTKVIDFKPPTYSKIRYRSAAHLVDPDYLAKFTKAMELMRALP  165

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+F QQA +HCAYCNGAYDQV F DQ+IQVH SWLFFPFHR
Sbjct  166  DDDPRSFKQQANIHCAYCNGAYDQVGF-DQDIQVHFSWLFFPFHR  209



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = +2

Query  284  SSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLV-SNPLAFAAPIQAPE  460
            SS +N++   S N   D    S   LDRR+VL+GLGGLYG  + + S+  A A P+  P+
Sbjct  53   SSDQNKNHSTSSNDH-DNENPSPVNLDRRNVLIGLGGLYGGVAGLGSDHFALAKPVSPPD  111

Query  461  IAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAV  640
            I KC   PADLP GA+  NCCPP +  ++++K P+   +RVRPAA ++DK  I K++KA+
Sbjct  112  IDKCG--PADLPSGALPTNCCPPTSQKIVDFKFPSPGKLRVRPAAQSVDKAYIDKYSKAI  169

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ELMKALP DDPR+F QQA VHCAYC+GAYD+V FP+ E+Q+HN WLFFPFHR
Sbjct  170  ELMKALPDDDPRSFSQQADVHCAYCDGAYDEVGFPNLELQIHNCWLFFPFHR  221



>gb|AAV65113.1| polyphenol oidase, partial [Camellia sinensis]
Length=320

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 125/181 (69%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDG-------GGDSQS---KLDRRDVllglgglygASSLV-SNPLAF  436
            K N  F +SC+ A D          ++Q+   K DRR++L+GLGGLYGA+ L  ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTPLGKFDRRNMLIGLGGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP  +  +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGE--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  YIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>ref|XP_010647100.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic 
[Vitis vinifera]
Length=563

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 139/209 (67%), Gaps = 22/209 (11%)
 Frame = +2

Query  212  TTPKSFSSAANLS----TPLSKPSQHL-ISSKRNRHF---KISCNAA-GDGGGDSQS---  355
            TT  + ++  N+S    +PL     H+ I+  R+R F   K+SCNAA GD   DS S   
Sbjct  9    TTSTAIANTTNISALPPSPLFHRVSHVPIARNRSRRFAPSKVSCNAANGDPNSDSTSDIR  68

Query  356  -----KLDRRDVllglgglygASSLV--SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
                 KLDRR+VLLG+GGLYGA++ +  + PLAF APIQAP+I KC    A +P G +  
Sbjct  69   ETSPGKLDRRNVLLGIGGLYGAAAGLGATKPLAFGAPIQAPDIRKCGT--ATVPNGVIPT  126

Query  515  NCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
            NCCPPV T  I ++LP+  + MR RPAAH + K+ +AK+ KA+EL KALP DDPR+F QQ
Sbjct  127  NCCPPVTTKPIPFQLPSSDSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQ  186

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWL  778
            A VHCAYC GAYDQV + D E+QVH SW+
Sbjct  187  ANVHCAYCQGAYDQVGYTDLELQVHASWV  215


 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 105/174 (60%), Gaps = 35/174 (20%)
 Frame = +2

Query  281  ISSKRNRHF---KISCNAA-GDGGGDSQS--------KLDRRDVllglgglygASSLV--  418
            I+  R+R F   K+SCNAA GD   DS S        KLDRR+VLLG+GGLYGA++ +  
Sbjct  220  IARNRSRRFAPSKVSCNAANGDPNSDSTSDIRETSPGKLDRRNVLLGIGGLYGAAAGLGA  279

Query  419  SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAH  598
            + PLAF APIQAP+I+KC           V D   P              T +  +PAAH
Sbjct  280  TKPLAFGAPIQAPDISKCGT-------ATVPDGVTP--------------TIVARQPAAH  318

Query  599  TMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQ  760
             + K+ +AK+ KA+EL KALP DDPR+F QQA VHC YC GAYDQV + D E+Q
Sbjct  319  LVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQ  372



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 124/193 (64%), Gaps = 17/193 (9%)
 Frame = +2

Query  263  KPSQHLISSKRNRHF--KISCNAAGDGGGD----------SQSKLDRRD-Vllglgglyg  403
            K SQ  +S  + RH   KISC A  +   +          +  KLDRR+ ++   G    
Sbjct  21   KTSQLSLSRCQTRHASPKISCKATKNDDENPRKIHEDKTIANKKLDRRNMLIGLGGLYGA  80

Query  404  ASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPPVATNVINYKLPAV-TTM  577
            A++L S+P   AAPI AP IA+C   PADLP  A  D NCCPPVA N+I++ LP    T+
Sbjct  81   ATALGSDPTTLAAPITAPNIAQCG--PADLPQDAQGDHNCCPPVAQNIIDFTLPPTPATL  138

Query  578  RVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEI  757
            +VRPAAH++D + + KF +A+ LMKALP  DPR+F QQA VHCAYC+G Y+QV FP+ ++
Sbjct  139  KVRPAAHSVDNEYLQKFNRAISLMKALPDTDPRSFSQQAKVHCAYCDGGYNQVGFPNLDL  198

Query  758  QVHNSWLFFPFHR  796
            QVH SWLF PFHR
Sbjct  199  QVHGSWLFLPFHR  211



>ref|XP_009407067.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 138/211 (65%), Gaps = 14/211 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFK--ISCNAAGDGGGDS  349
            MAS++   T   + P +FS   + S P    +   IS  ++ H    ISC+        +
Sbjct  1    MASISQLIT--TSIPTTFS--LSYSCPFPPRTTVSISGFKHLHHVSPISCSTRDH----N  52

Query  350  QSKLDRRDVllglgglygASS-LVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCP  526
            Q  +DRR VL+G+G LYGAS+ L S   A AAPI AP+++ C +  ADLPP A   NCCP
Sbjct  53   QPLVDRRHVLVGIGSLYGASAALTSLREASAAPIAAPDLSACGL--ADLPPDATPTNCCP  110

Query  527  PVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVH  703
            P A +   + +P  ++ +RVRPAAH++DKD IAKFAK V LMKALPADDPRNF Q A VH
Sbjct  111  PSAGDATEFVIPDPSSPLRVRPAAHSVDKDYIAKFAKGVALMKALPADDPRNFTQHANVH  170

Query  704  CAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            CAYC+GAY QV FPD E+QVHNSWLF P+HR
Sbjct  171  CAYCDGAYSQVGFPDLELQVHNSWLFLPWHR  201



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  446  IQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAK  625
            I  P+++KC    ADLPPGA V NCCPP AT +I++KLPA   +RVRP AH +DK    K
Sbjct  3    IAPPDVSKCG--SADLPPGAEVTNCCPPPATKIIDFKLPAPAKLRVRPPAHAVDKAYRDK  60

Query  626  FAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQ  FP+ E+QVHNSWLFFPFHR
Sbjct  61   FYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHR  117



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +2

Query  311  ISCNAAGDG--GGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKC-EVP  481
            +SC A  +G  G  S ++ DRRD+L+GLGGLYGA++L ++P A AAPI AP++  C +  
Sbjct  55   VSCKATNNGSKGDSSLNRFDRRDLLIGLGGLYGATNLSNDPFALAAPIAAPDLTLCGDAT  114

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             +D     V   CCPP  T VI++K P  + +R R AAH +D D +AKF KA+ELM+ALP
Sbjct  115  ISDTTKETVY--CCPPETTKVIDFKPPTYSKIRYRSAAHLVDPDYLAKFTKAMELMRALP  172

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+F QQA +HCAYCNGAYDQV F DQ+IQVH SWLFFPFHR
Sbjct  173  DDDPRSFKQQANIHCAYCNGAYDQVGF-DQDIQVHFSWLFFPFHR  216



>gb|AEY79826.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 119/179 (66%), Gaps = 14/179 (8%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL--AFAAP  445
            Q ++ +K  +  +++C A G        ++DRRDVLLGLG    A+ L + P   A AAP
Sbjct  23   QAVVPTKARQPRRLTCKATG-------GRVDRRDVLLGLGSAA-AAGLGTQPGRGAIAAP  74

Query  446  IQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAI  619
            IQAP++  C   P DLP  A   NCCP   T +I++ LP  +T  +RVRPAAH  D + +
Sbjct  75   IQAPDLGNCN--PPDLPDTAPDTNCCPTSGTGIIDFVLPPASTAPLRVRPAAHLADAEHL  132

Query  620  AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            AK+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  133  AKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  191



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 138/224 (62%), Gaps = 26/224 (12%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFK---ISCNAAGDGGGD  346
            MASL+ P T T T   S       S    K SQ  +  KRN  F    +SCNA     GD
Sbjct  1    MASLSPPATTTTTNISSLQP----SPLFHKASQVSLVGKRNPRFVRRVVSCNATN---GD  53

Query  347  SQ------------SKLDRRDVllglgglygASSLVSNPLAFAAP-IQAPEIAKCEVPPA  487
             +             KLDRR+VLLGLGGLYG S L +      A  I  P++++C    A
Sbjct  54   ERSTSSSKSGESPLGKLDRRNVLLGLGGLYGVSGLGAADPFAFAAPISPPDLSECGA--A  111

Query  488  DLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
            DLP GA   NCCPPV++ +I++KLP   + +R+RPAAH   K+ IAK+ KA+ELMKALP 
Sbjct  112  DLPAGAQPTNCCPPVSSKIIDFKLPPKNSPLRIRPAAHLASKEYIAKYKKAIELMKALPD  171

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F QQA VHCAYCNGAY QV FPD ++QVHNSWLF P+HR
Sbjct  172  DDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHR  215



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 137/224 (61%), Gaps = 26/224 (12%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFK---ISCNAAGDGGGD  346
            MASL+ P T T T   S       S    K SQ  +  KRN  F    +SCNA     GD
Sbjct  1    MASLSPPATTTTTNISSLQP----SPLFHKASQVSLVGKRNPRFVRRVVSCNATN---GD  53

Query  347  SQ------------SKLDRRDVllglgglygASSLVSNPLAFAAP-IQAPEIAKCEVPPA  487
             +             KLDRR+VLLGLGGLYG S L +      A  I  P++++C    A
Sbjct  54   ERSTSSSKSGESPLGKLDRRNVLLGLGGLYGVSGLGAADPFAFAAPISPPDLSECGA--A  111

Query  488  DLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
            DLP GA   NCCPPV++ +I++KLP   +  R+RPAAH   K+ IAK+ KA+ELMKALP 
Sbjct  112  DLPAGAQPTNCCPPVSSKIIDFKLPPKNSPFRIRPAAHLASKEYIAKYKKAIELMKALPD  171

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F QQA VHCAYCNGAY QV FPD ++QVHNSWLF P+HR
Sbjct  172  DDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHR  215



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRDVllglgglygASSLV-SNPLAF  436
            K N  F +SC+ A D   +          S  K DRR++L+GLGGLYGA+ L  ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADQK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KAV+LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  YIAKFSKAVQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 137/223 (61%), Gaps = 23/223 (10%)
 Frame = +2

Query  173  PMASLTSPCTPTATTP--KSFSSAANLST---------PLSKPSQHLISSKRNRHFKISC  319
            PMASL SP T TA      SFSS   +ST         P S  S+H   S R     ISC
Sbjct  64   PMASLPSPATTTAVGTTTSSFSSPVAISTYGPFFPKRGPASFYSKHRKPSIRRS--TISC  121

Query  320  NAAGDGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPAD  490
             A  +   +      KLDRR+VL+GLGG YGA  L S+P A A PI  P+  +C      
Sbjct  122  KALSNDDSEQNPMSVKLDRRNVLIGLGGFYGAVGLRSDPFALAEPISVPDFTQC----GK  177

Query  491  LPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPAD  667
            + P A    CCPP  T V+++KLP+  +  RVRPAAH  D+D IAK+A+A+ LMKALPAD
Sbjct  178  VNPCAKA--CCPPPTTEVLDFKLPSSNSPTRVRPAAHLADEDYIAKYAEAIRLMKALPAD  235

Query  668  DPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DPR+F QQA VHCAYC+G Y+QV FP  E+QVH SWLFFPFHR
Sbjct  236  DPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHR  278



>ref|XP_010100568.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82811.1| Polyphenol oxidase [Morus notabilis]
Length=591

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 6/151 (4%)
 Frame = +2

Query  356  KLDRRDVllglgglygAS--SLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPP  529
            K DRRDVLLGLGGLYG +  S V+ PLA AAPIQAP+++KC +P  D+PP   V+ CCPP
Sbjct  53   KYDRRDVLLGLGGLYGMAGLSTVNGPLASAAPIQAPDLSKCHLP-DDVPPTVHVE-CCPP  110

Query  530  VATNVINYKLPAV--TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVH  703
            VA  +I+Y  PA   + +RVR  AHT+DK+ I K+  A+E M+ALP DDPR+F QQA+VH
Sbjct  111  VAPKIIDYTPPAHIPSKLRVRLPAHTLDKEYIDKYNIAMERMRALPDDDPRSFTQQAMVH  170

Query  704  CAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            CAYCNGAYDQ+ FPD  IQVHN WLF PFHR
Sbjct  171  CAYCNGAYDQIGFPDINIQVHNCWLFLPFHR  201



>ref|XP_010100566.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82809.1| Polyphenol oxidase [Morus notabilis]
Length=586

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 12/187 (6%)
 Frame = +2

Query  254  PLSKPSQHLISSKRNRHFKISCNA-AGDGGGDSQ----SKLDRRDVllglgglygASSLV  418
            P  + +  L + +R  H + S ++ AG     SQ     K+DRR+VLLGLG     + + 
Sbjct  23   PFPRNNSILNTKRREAHVRRSLSSNAGSEEASSQWPQLGKVDRRNVLLGLG----ITGVG  78

Query  419  SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPPVATNVINYKLPAVTTMRVRPAA  595
            SNPLA A PI AP++ KC    A+L  G V+  +CCPP A  +I++K P  T +RVRP A
Sbjct  79   SNPLAMADPIAAPDLTKCG--NAELSDGTVLPVDCCPPTALEIIDFKPPPFTKLRVRPVA  136

Query  596  HTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSW  775
            H +DK+ IAK+ KA+ LMKALP  DPR+F QQA VHCAYCN AYDQ  +P  E+QVHNSW
Sbjct  137  HKVDKEYIAKYNKALSLMKALPDTDPRSFSQQADVHCAYCNSAYDQTGYPGVELQVHNSW  196

Query  776  LFFPFHR  796
            LF+PFHR
Sbjct  197  LFYPFHR  203



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 134/225 (60%), Gaps = 21/225 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSS----AANLSTPLSKPSQHLISSKR----NRHFKISCNAAG  331
            MA+  SP T + TT  ++SS      + S  L   SQ   S KR    +R   ISC A  
Sbjct  1    MATAPSP-TGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKRKHYISRRSSISCKATN  59

Query  332  DGGGDSQS----------KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVP  481
                + Q+          KLDRR+VL+GLGGLYGA++L   PLAFA P+  P++ KC + 
Sbjct  60   PNNNEKQNQPEQSSNLLGKLDRRNVLIGLGGLYGATTLAQKPLAFATPLAPPDLTKCTL-  118

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             A++  G     CCPPV+T +  +       +R RPAAH +  + +AKF KA  LM+ALP
Sbjct  119  -AEITTGGETVACCPPVSTKIKTFTXDQSIPLRTRPAAHLVTDEYLAKFKKAQALMRALP  177

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+  QQA VHCAYCNGAY QV FPD +IQVH SWLFFPFHR
Sbjct  178  EDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222



>gb|AAT75166.1| polyphenol oxidase [Camellia sinensis]
Length=575

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRDVllglgglygASSLV-SNPLAF  436
            K N  F +SC+ A D   +          S  K DRR++L+GLGGLYGA+ L  ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  YIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>gb|EYU34165.1| hypothetical protein MIMGU_mgv1a003246mg [Erythranthe guttata]
Length=597

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 136/216 (63%), Gaps = 11/216 (5%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQ-HLISSKR--NRHFKISCNAAGDGGGD  346
            M SL   C  T  T  S + +++    L KPS  H I+  +  NR   +SC++      D
Sbjct  1    MTSLYLSCA-TTNTAISATPSSHPRPLLPKPSHSHFITHAKLTNRLHHVSCSSTPQNQND  59

Query  347  SQSK-----LDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVV  511
               K     +DRR++L+G+GGLYGA++L S P A A PIQAPE+ KC     +L  G  +
Sbjct  60   ETKKPTAKVVDRRNMLVGMGGLYGATTLASTPSAAANPIQAPELNKCGTA-TNLNNGEKL  118

Query  512  D-NCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQ  688
            D NCCPP++  +I+YKLP V  M++RP+AH +  + + KF  A++ MK LP DDPRNF Q
Sbjct  119  DINCCPPISDRIIDYKLPPVFQMKIRPSAHRVSPEYMFKFNTAIDRMKRLPKDDPRNFMQ  178

Query  689  QALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QA +HCAYCNGAYDQ      ++Q+HNSWLFFPFHR
Sbjct  179  QANIHCAYCNGAYDQPGQGTLDLQIHNSWLFFPFHR  214



>gb|ACR82078.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRDVllglgglygASSLV-SNPLAF  436
            K N  F +SC+ A D   +          S  K DRR++L+GLGGLYGA+ L  ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  YIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 133/197 (68%), Gaps = 10/197 (5%)
 Frame = +2

Query  224  SFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLD-----RRDVllgl  388
            +F+++++L  P S+       +++ +H KI+C  + D   +S  + +     RR+VL+GL
Sbjct  19   NFNTSSSLQYPFSQKQHQPSKNRKPKHHKIAC-TSNDTNQNSPKEQEQKPSPRRNVLIGL  77

Query  389  gglygASSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA  565
            GGLYGA++L +N  LAF AP+  P++ KC +PP+  P   V  NCCPP + ++I++K P+
Sbjct  78   GGLYGATTLTNNNSLAFGAPVPIPDLTKCVIPPSGAP---VPINCCPPFSKDIIDFKYPS  134

Query  566  VTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFP  745
               +RVRPAA  +D D  AK+ KA+ELM+ALP DDPR+F QQA +HCAYC G Y Q+ +P
Sbjct  135  FEKLRVRPAAQLVDDDYFAKYNKALELMRALPDDDPRSFSQQAKIHCAYCVGGYKQLGYP  194

Query  746  DQEIQVHNSWLFFPFHR  796
            + E+ VHNSWLF  FHR
Sbjct  195  EIELSVHNSWLFLAFHR  211



>gb|ABF19602.1| polyphenol oxidase [Camellia sinensis var. assamica]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRDVllglgg  394
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR++L+GLGG
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGG  80

Query  395  lygASSLV-SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
            LYGA+ L  ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 122/196 (62%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRD-Vllglg  391
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR+ V+   G
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGG  80

Query  392  glygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
                A    ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 132/219 (60%), Gaps = 16/219 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRH--FKISCNAAGDGGGD  346
            MASL    +PT  +  +  SAA +ST L  K SQ  IS +  R    KISCN A +   +
Sbjct  1    MASLY--FSPTTKSTNTNISAAEISTHLIPKTSQLSISRRLARRPTRKISCNVAKNDDQN  58

Query  347  -------SQSKLDRRD-VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPG  502
                   S + LDRR+ ++   G    A++L   P + AAP+Q P    C    ADLP  
Sbjct  59   PKTNHERSNNMLDRRNMLIGLGGLYGAATTLGGGPASLAAPVQTPNPTACGA--ADLPSN  116

Query  503  AVVDNCCPPVATNVINYKLPAV-TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRN  679
            A   NCCPP ATN++++ LP    T+RVRP AH +D     KF +A+ LMKALP+ DPR+
Sbjct  117  AQGLNCCPPRATNIVDFVLPPTPNTLRVRPPAHLVDDQYRQKFNRAISLMKALPSTDPRS  176

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F QQA VHCAYCNG+Y  V FP+ ++QVHNSWLF+PFHR
Sbjct  177  FTQQANVHCAYCNGSYSPVGFPNLDLQVHNSWLFYPFHR  215



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = +2

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAV--VDNCCPPVATNVINYKLPAVTTMR  580
             +L +NP A A+PI  P+++KC VPP+DLP G      NCCPP +T + ++K P+   +R
Sbjct  82   GTLATNPSALASPISPPDLSKC-VPPSDLPSGTTPPNINCCPPYSTKITDFKFPSNQPLR  140

Query  581  VRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQ  760
            VR AAH +D + + K+ KA ELMKALP++DPRNF QQA +HCAYC+GAY Q+ FPD ++Q
Sbjct  141  VRQAAHLVDNEFLEKYKKATELMKALPSNDPRNFTQQANIHCAYCDGAYSQIGFPDLKLQ  200

Query  761  VHNSWLFFPFHR  796
            VH SWLFFPFHR
Sbjct  201  VHGSWLFFPFHR  212



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRDVllglgg  394
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR++L+GLGG
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTRTSLGKFDRRNMLIGLGG  80

Query  395  lygASSLV-SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
            LYGA+ L  ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRDVllglgg  394
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR++++GLGG
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGG  80

Query  395  lygASSLV-SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
            LYGA+ L  ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRDVllglgg  394
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR++L+GLGG
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGG  80

Query  395  lygASSLV-SNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
            LYGA+ L  ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 122/196 (62%), Gaps = 15/196 (8%)
 Frame = +2

Query  248  STPLSKPSQHLISSKRNRH-FKISCNAAGDGGGD----------SQSKLDRRD-Vllglg  391
            S P+ K +  + + +++ H F +SC+ A D   +          S  K DRR+ V+   G
Sbjct  21   SYPIFKNTSKIPTIRKHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGG  80

Query  392  glygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-V  568
                A    ++P A AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP   
Sbjct  81   LYGAAGLTDTDPPALAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS  138

Query  569  TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPD  748
              +RVRPAAH  D+  IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP 
Sbjct  139  NILRVRPAAHLADEKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPS  198

Query  749  QEIQVHNSWLFFPFHR  796
             E+QVHNSWLFFPFHR
Sbjct  199  TELQVHNSWLFFPFHR  214



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 113/181 (62%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRD-VllglgglygASSLVSNPLAF  436
            K N  F +SC+ A D   +          S  K DRR+ V+   G    A    ++P A 
Sbjct  36   KHNHSFNVSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGGLYGAAGLTDTDPPAL  95

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP+++KC    ADLP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  96   AAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  153

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  154  HIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  213

Query  794  R  796
            R
Sbjct  214  R  214



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 135/220 (61%), Gaps = 19/220 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQ-HLISSKRN----RHFKISCNAAGDGG  340
            MAS  SP +P A T     S    S     P++ H  S  RN       ++ C A  +GG
Sbjct  1    MAS--SPLSPLAATITGLRSTTPTSLSSFLPNKPHTTSLPRNPKQCLTGRVRCKAT-NGG  57

Query  341  GD----SQSKLDRRD--VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPG  502
             D      S+LDRR+  + LG GGLYG++ L +NP AFAAP+ APE  KC   PAD P G
Sbjct  58   DDHLQQGLSRLDRRNMLIGLGAGGLYGSTGLENNPFAFAAPVSAPEFTKC--GPADKPDG  115

Query  503  AVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPR  676
            + +D CCPP AT +I++KLP    +R R AA  + KD   +AK+ KA+ LM+ALP DDPR
Sbjct  116  STID-CCPPTATTIIDFKLPDKGPLRTRLAAQNVAKDPVYLAKYKKAIALMRALPDDDPR  174

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +F QQA VHC+YC+G Y QV + D EIQVH  WLF+PFHR
Sbjct  175  SFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFHR  214



>gb|AEM45936.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygAS-SLVSNPLAFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG              A AAPI
Sbjct  23   QALVPTKARQPRRLTCKATG-------GRVDRRDVLLGLGSAAATGLGTQRGRGAIAAPI  75

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH +D + +A
Sbjct  76   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLVDAEHLA  133

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  134  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  191



>gb|AEM45935.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 114/178 (64%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygAS-SLVSNPLAFAAPI  448
            Q L+ +K     +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  18   QALVPTKLRLPRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGTQRGRGAIAAPI  70

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  71   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAALRVRPAAHLADAEHLA  128

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  129  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  186



>gb|EYU26238.1| hypothetical protein MIMGU_mgv1a025156mg [Erythranthe guttata]
Length=587

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 139/214 (65%), Gaps = 9/214 (4%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            MASL  PCT TATTP S +  ++     +KPS  +  +KRN   +ISC+ +      SQ+
Sbjct  1    MASLHIPCTTTATTPSSATRPSSRHH-FAKPSHLITHAKRNNRLQISCSDSQKQKDSSQN  59

Query  356  ------KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD-  514
                   +DRR+VLLG GGL GA++L+S   A A P+QAP+I KC V   +L  G  +D 
Sbjct  60   ADTPQGNVDRRNVLLGFGGLCGAANLISTHTASANPVQAPQIDKCGVA-TNLNTGKQLDI  118

Query  515  NCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQA  694
            NCCPP+  N+I++K P +  MR RP+AH +  + + K+  A++ MK LP DDPR+F QQA
Sbjct  119  NCCPPMGKNIIDFKPPPLVQMRTRPSAHRVSAEYMFKYNTAIDRMKRLPKDDPRSFMQQA  178

Query  695  LVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             +HCAYCNGAYDQ      ++QVHNSWLFFPFHR
Sbjct  179  NIHCAYCNGAYDQPGQGTLDLQVHNSWLFFPFHR  212



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 136/222 (61%), Gaps = 23/222 (10%)
 Frame = +2

Query  176  MASLTSPCTPTATTP--KSFSSAANLST---------PLSKPSQHLISSKRNRHFKISCN  322
            MASL SP T TA      SFSS   +ST         P S  S+H   S R     ISC 
Sbjct  1    MASLPSPATTTAVGTTTSSFSSPVAISTYGPFFPKRGPASFYSKHRKPSIRRS--TISCK  58

Query  323  AAGDGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADL  493
            A  +   +      KLDRR+VL+GLGG YGA  L S+P A A PI  P+  +C      +
Sbjct  59   ALSNDDSEQNPMSVKLDRRNVLIGLGGFYGAVGLRSDPFALAEPISVPDFTQC----GKV  114

Query  494  PPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADD  670
             P A    CCPP  T V+++KLP+  +  RVRPAAH  D+D IAK+A+A+ LMKALPADD
Sbjct  115  NPCAKA--CCPPPTTEVLDFKLPSSNSPTRVRPAAHLADEDYIAKYAEAIRLMKALPADD  172

Query  671  PRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            PR+F QQA VHCAYC+G Y+QV FP  E+QVH SWLFFPFHR
Sbjct  173  PRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHR  214



>gb|ABA62017.1| polyphenol oxidase [synthetic construct]
Length=567

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  18   QALVPTKARQTRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPI  70

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  71   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  128

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  129  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  186



>gb|AHZ59731.1| copper-containing polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  18   QALVPTKARQTRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPI  70

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  71   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  128

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  129  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  186



>ref|XP_003593517.1| Polyphenol oxidase A1 [Medicago truncatula]
 gb|ABN08604.1| Tyrosinase [Medicago truncatula]
 gb|AES63768.1| polyphenoloxidase [Medicago truncatula]
Length=608

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 139/217 (64%), Gaps = 16/217 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAAN-LSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQ  352
            MAS+ SP +  +T   S SS+    S    K S+H I  +R +   +S N         +
Sbjct  1    MASI-SPISFISTINFSHSSSMYPFSQKQQKSSKHRILPRR-QVITLSGNNGNQNNPKEE  58

Query  353  SKL------DRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
             +L      +RR+VL+GLGGL    +  +NP A A+PI AP+++ C   P DLP GA   
Sbjct  59   EQLQNIVVGNRRNVLVGLGGL--CGTFTANPFALASPISAPDLSTCG--PPDLPSGATPS  114

Query  515  --NCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFY  685
              NCCPP +T +I+YK P+ T  +RVR AAH ++ + + K+ KA+ELMKALP++DPRNF 
Sbjct  115  GLNCCPPNSTKIIDYKFPSSTQPLRVRQAAHLVNDEYLQKYKKAIELMKALPSNDPRNFI  174

Query  686  QQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QQA +HCAYC+GAY QV FP+ ++QVH+SWLFFPFHR
Sbjct  175  QQANIHCAYCDGAYSQVGFPNLDLQVHSSWLFFPFHR  211



>gb|AEY79825.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  18   QALVPTKARQTRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPI  70

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  71   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  128

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  129  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  186



>dbj|BAH36895.1| polyphenol oxidase [Triticum aestivum]
Length=545

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  6    QALVPTKARQTRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPI  58

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  59   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  116

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  117  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  174



>gb|AEM45931.1| polyphenol oxidase [Triticum aestivum]
 gb|AEM45932.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPI  448
            Q L+ +K  +  +++C A G        ++DRRDVLLGLG    A         A AAPI
Sbjct  18   QALVPTKARQTRRLTCKATG-------GRVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPI  70

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  71   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  128

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  129  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  186



>gb|ACH69546.1| catechol oxidase 40kDa isozyme [Ipomoea batatas]
Length=153

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 2/94 (2%)
 Frame = +2

Query  521  CPPVATNVINYKLPAVT--TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQA  694
            CPP+ATNVI YK+P  +   M++RPA H MDK+ IAKF KA+ LMK LPADDPRNFYQQA
Sbjct  1    CPPLATNVIPYKVPRTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQA  60

Query  695  LVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LVHCAYCNG Y Q ++PD+EIQVHNSWLFFPFHR
Sbjct  61   LVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  94



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 10/184 (5%)
 Frame = +2

Query  260  SKPSQHLIS--SKRNRHFK--ISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNP  427
            S P  H +S  +K NRH    +SC +  +   + Q+   RRD+L+GLGGLYGA+SL S+P
Sbjct  21   SFPETHRVSRITKPNRHNIPIVSCKSGKND--NEQNPATRRDLLIGLGGLYGATSL-SDP  77

Query  428  LAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTM  604
             A+A PI AP+I +CE+    LP  +   NCCPP +T + N++ P+ ++ MR+RPAAH +
Sbjct  78   FAYANPIAAPDITQCEL--VTLPSESDPSNCCPPTSTKIKNFEFPSASSPMRIRPAAHLV  135

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFF  784
            DK  +AK+AKA+ LMK+LP DDPR+F  QA VHCAYC+GAY Q  FPD ++Q+H SWLFF
Sbjct  136  DKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFF  195

Query  785  PFHR  796
            P+HR
Sbjct  196  PWHR  199



>gb|AEM45934.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 114/178 (64%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygAS-SLVSNPLAFAAPI  448
            Q ++ +K  +  ++SC A G        ++DRRDVLLGLG              A AAPI
Sbjct  23   QAVVPTKARQPRRLSCKATG-------GRVDRRDVLLGLGSAAATGLGRQRGRGAIAAPI  75

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  76   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  133

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  134  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  191



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 136/223 (61%), Gaps = 25/223 (11%)
 Frame = +2

Query  176  MASLTSPCTPTATTP--KSFSSAANLST---------PLSKPSQHLISSKRNRHFKISCN  322
            MASL SP T TA      SFSS   +ST         P S  S+H   S R     ISC 
Sbjct  1    MASLPSPATATAVGTTTSSFSSIVAISTYGPFFRKRGPASLYSKHRKPSIRRS--TISCK  58

Query  323  AAGDGGGDSQ---SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKC-EVPPAD  490
            A  +   +      KLDRR+ L+GLGG YGA  L S+P A A PI   +  +C +V P  
Sbjct  59   ALSNDDSEQNPMSVKLDRRNALIGLGGFYGAVGLRSDPFALADPISVLDFTQCGKVKPC-  117

Query  491  LPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPAD  667
                  V +CCPP  T V+++KLP   +  RVRPAAH  DKD IAK+A+A +LMKALPAD
Sbjct  118  ------VKDCCPPPTTKVLDFKLPPSNSPTRVRPAAHLADKDYIAKYAEATKLMKALPAD  171

Query  668  DPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DPR+F QQA VHCAYC+G Y QV FP+ E+QVH+SWLFFPFHR
Sbjct  172  DPRSFMQQANVHCAYCDGYYHQVGFPNLELQVHDSWLFFPFHR  214



>gb|ABI96942.1| putative polyphenol oxidase [Dasiphora fruticosa]
Length=452

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  428  LAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMD  607
             AFA P+  P+++KC    ADLP G    +CCPP  + +I++KLP+ T +RVRPAAH +D
Sbjct  2    FAFAKPVAPPDVSKCGA--ADLPNGVAPTDCCPPTPSKIIDFKLPSPTPLRVRPAAHAVD  59

Query  608  KDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFP  787
               IAK+ KA+ELMKALP  DPR+F  QA VHCAYC+GAYDQ  FP+ E+Q+HNSWLFFP
Sbjct  60   DAYIAKYTKAMELMKALPDSDPRSFKNQANVHCAYCDGAYDQAGFPELELQIHNSWLFFP  119

Query  788  FHR  796
            FHR
Sbjct  120  FHR  122



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 138/220 (63%), Gaps = 17/220 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKP--SQHLISSKRN-RHFKISCNAAGDGGGD  346
            MAS+  P +P +    + SS  N S+ L  P   +H  S  R  +H +I+C  + D   +
Sbjct  1    MASI--PSSPLSLMSFNVSSNFNTSSSLLYPFSQKHRPSKNRKPKHHQIAC-TSNDTNQN  57

Query  347  S-----QSKLDRRDVllglgglygASSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAV  508
            S     Q    RR+VL+GLGGLYGA++  +N  LAF AP+  P++  C VPP +LP    
Sbjct  58   SPKEQEQKSSPRRNVLIGLGGLYGATTFTNNNSLAFGAPVPIPDLTSCVVPPIELPDDMK  117

Query  509  VDN----CCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
            + N    CCPP ++++I++K P    +RVRPAA  ++ D  AK+ KA+ELM+ALP DDPR
Sbjct  118  IINPPLSCCPPFSSDIIDFKFPTFKKLRVRPAAQLVNDDYFAKYNKALELMRALPNDDPR  177

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +FYQQA +HCAYC G Y Q  + D E+QVHNSWLF PFHR
Sbjct  178  SFYQQANIHCAYCVGGYTQKGY-DAELQVHNSWLFLPFHR  216



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 126/183 (69%), Gaps = 8/183 (4%)
 Frame = +2

Query  260  SKPSQHLIS--SKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPL  430
            S P  H +S   K NRH  I   +   G  D  Q+   RRDVL+GLGGLYGA+SL S+P 
Sbjct  21   SFPKTHRVSRIKKPNRH-NIPIVSCKSGKNDHEQNPATRRDVLIGLGGLYGATSL-SDPF  78

Query  431  AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMD  607
            A+A PI  P+I +CE+    LP  +   NCCPP +T + N++ P+ ++ MR+RPAAH +D
Sbjct  79   AYANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSASSPMRIRPAAHLVD  136

Query  608  KDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFP  787
            K  +AK+AKA+ LMK+LP DDPR+F  QA VHCAYC+GAY Q  FPD ++Q+H SWLFFP
Sbjct  137  KAYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFP  196

Query  788  FHR  796
            +HR
Sbjct  197  WHR  199



>gb|ABM68051.1| polyphenol oxidase [Trifolium pratense]
Length=604

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 144/216 (67%), Gaps = 14/216 (6%)
 Frame = +2

Query  176  MASLT-SPCTPTATTPKS-FSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDS  349
            MAS++ SP +  +    S F+++++L  P S+       +++ ++ KI+C  + D   +S
Sbjct  1    MASISPSPLSLMSLNISSNFNTSSSLQYPFSQKQHQPSKNRKPKYHKIAC-TSNDTNQNS  59

Query  350  -----QSKLDRRDVllglgglygASSLVSN-PLAFAAPIQAPEIAKC-EVPPADLPPGAV  508
                 Q    RR+VL+GLGGLYGA++L +N  LAF AP+  P+++KC +  P D+ P   
Sbjct  60   PKEQEQKSSPRRNVLIGLGGLYGATTLTNNNSLAFGAPVPIPDLSKCVKSTPKDIDP---  116

Query  509  VDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQ  688
            VD CCPP ++N+I++K P    +R RPAA  +D D IAK+ +A++LMKALPADDPR+F Q
Sbjct  117  VD-CCPPFSSNIIDFKFPTFGKLRERPAAQLVDDDYIAKYKEALKLMKALPADDPRSFEQ  175

Query  689  QALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            QA VHCAYC G Y Q+ +P  ++ VHNSWLFFPFHR
Sbjct  176  QAKVHCAYCVGGYTQLGYPGVQLSVHNSWLFFPFHR  211



>ref|XP_011082867.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=586

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 121/185 (65%), Gaps = 17/185 (9%)
 Frame = +2

Query  284  SSKRNRHFKISCNAAGDGGGDSQ-----------SKLDRRDVllglgglygASSLVSNPL  430
            ++KR R F +SC A    G D Q            K DRR++L+G+GGLYGA++LVS   
Sbjct  31   NAKRTRQFNLSCKARN--GNDEQRESPGKEETFQGKFDRRNLLVGMGGLYGAANLVSADY  88

Query  431  --AFAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPPVATNVINYKLPAVTTMRVRPAAHT  601
              AFA+PI AP+++KC     +L     +D NCCPP++   I+YKLP VT MR RPAAH 
Sbjct  89   SPAFASPISAPDLSKC-TRGTNLNTQQPLDVNCCPPLSQKSIDYKLPPVTKMRFRPAAHL  147

Query  602  MDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLF  781
              ++ IAK+ KAVELMKALP DDPR+F QQA VHCAYCN  Y+Q   P   +Q+HN W F
Sbjct  148  ASQEYIAKYEKAVELMKALPEDDPRSFMQQANVHCAYCNLTYEQTGDPSLRLQIHNCWHF  207

Query  782  FPFHR  796
            FP+HR
Sbjct  208  FPWHR  212



>gb|AEM45933.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 113/178 (63%), Gaps = 12/178 (7%)
 Frame = +2

Query  272  QHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygAS-SLVSNPLAFAAPI  448
            Q ++ +K  +   +SC A G        ++DRRDVLLG+G              A AAPI
Sbjct  23   QAVVPTKARQPRHLSCKATG-------GRVDRRDVLLGIGSAAATGLGRQRGRGAIAAPI  75

Query  449  QAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT--MRVRPAAHTMDKDAIA  622
            QAP++  C   P DLP  A   NCCP   T +I++ LP  ++  +RVRPAAH  D + +A
Sbjct  76   QAPDLGNCN--PPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLA  133

Query  623  KFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            K+ +AV LMK LPADDPR+F QQ  VHCAYC+GAYDQV FPD EIQVHN WLFFP+HR
Sbjct  134  KYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  191



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = +2

Query  365  RRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNV  544
            RR+VLLGLGGL GA +L +NP AFAAPI  P++  C   P D P GA   NCCPP ++ +
Sbjct  75   RRNVLLGLGGLCGAVTLNNNPFAFAAPISPPDLNTCG--PPDTPAGANPTNCCPP-SSKI  131

Query  545  INYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNG  721
            I++K P     +RVRPAAH ++ + +AK+ KA++LMK LP+DDPRNF QQA VHCAYC+G
Sbjct  132  IDFKFPPSNQPLRVRPAAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDG  191

Query  722  AYDQVNFPDQEIQVHNSWLFFPFHR  796
            AY QV FPD ++Q+HNSWLFFPFHR
Sbjct  192  AYHQVGFPDLDLQIHNSWLFFPFHR  216



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 118/189 (62%), Gaps = 15/189 (8%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHFKISCNAAGDGGGDSQ---------SKLDRRDVllglgglygAS  409
             S  S+H I+    R   ISC A      + Q          KLDRR+VL+GLGGLYGA+
Sbjct  40   FSGKSKHYIA----RRSSISCKATNPNYNNEQDQQQSSNLLGKLDRRNVLIGLGGLYGAT  95

Query  410  SLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRP  589
            +L   PLAFA P+  P++ KC+  PA++  G     CCPPV+T +  +       +R RP
Sbjct  96   TLAPKPLAFANPLAPPDLTKCK--PAEITTGGETVECCPPVSTKIKTFTPDRSIPLRTRP  153

Query  590  AAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHN  769
            AAH +  + +AKF KA  LM+ALP DDPR+  QQA VHCAYCNGAY QV FPD +IQ+H 
Sbjct  154  AAHLVTDEYLAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQIHF  213

Query  770  SWLFFPFHR  796
            SWLFFPFHR
Sbjct  214  SWLFFPFHR  222



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 121/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGD----------SQSKLDRRDVllglgglygASSLV-SNPLAF  436
            K N  FK SC+ A D   +          S  K DRR++L+GLGGLYGA+ L  ++P A 
Sbjct  32   KHNHSFKASCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTDTDPPAL  91

Query  437  AAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKD  613
            AAP+ AP ++KC    A+LP  A   NCCPP    +I +KLP     +RVRPAAH  D+ 
Sbjct  92   AAPVTAPYLSKCGA--ANLPADAKPTNCCPPKTNKIIEFKLPPPSNILRVRPAAHLADEK  149

Query  614  AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFH  793
             IAKF+KA++LMK+LP DDPR+F QQ+ +HCAYC GAY QV FP  E+QVHNSWLFFPFH
Sbjct  150  YIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFH  209

Query  794  R  796
            R
Sbjct  210  R  210



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = +2

Query  365  RRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNV  544
            RR+VLLGLGGL GA +L +NP AFAAPI  P++  C   P D P GA   NCCPP ++ +
Sbjct  75   RRNVLLGLGGLCGAVTLNNNPFAFAAPISPPDLNTCG--PPDTPAGANPTNCCPP-SSKI  131

Query  545  INYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNG  721
            I++K P     +RVRPAAH ++ + +AK+ KA++LMK LP+DDPRNF QQA VHCAYC+G
Sbjct  132  IDFKFPPSNQPLRVRPAAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDG  191

Query  722  AYDQVNFPDQEIQVHNSWLFFPFHR  796
            AY QV FPD ++Q+HNSWLFFPFHR
Sbjct  192  AYHQVGFPDLDLQIHNSWLFFPFHR  216



>ref|XP_011098121.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 135/215 (63%), Gaps = 16/215 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQ-  352
            MASL  P  PTAT P S S         ++PS  +  +KR+   ++SC  A      S+ 
Sbjct  1    MASLPLPL-PTAT-PSSQSRPV-----FARPSYFISHAKRSNRLRVSCADAQKKKEASRD  53

Query  353  -----SKLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
                  K+DRR++LLGLGG  Y A++L+  P A A PI+APE+ KC V   +L  G  +D
Sbjct  54   VETPIGKVDRRNMLLGLGGGLYSAANLIPTPGASANPIKAPELDKCGVA-TNLNTGEKLD  112

Query  515  -NCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
             NCCPP + N+ +Y+LP V  M+VRP+AH +  + I K+  A++ MK LP DDPRNF QQ
Sbjct  113  MNCCPPTSENIADYQLPPVVQMKVRPSAHRVSPEYIFKYNMAIDRMKRLPKDDPRNFMQQ  172

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            A +HCAYCNGAYDQ      ++QVHNSWLFFPFHR
Sbjct  173  ANIHCAYCNGAYDQPGQGTLDLQVHNSWLFFPFHR  207



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 134/225 (60%), Gaps = 21/225 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSS----AANLSTPLSKPSQHLISSKR----NRHFKISCNAAG  331
            MA+  SP T + TT  ++SS      + S  L   SQ   S K     +R   ISC A  
Sbjct  1    MATAPSP-TGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKSKQYVSRRSSISCKATN  59

Query  332  DGGGDSQS----------KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVP  481
                + Q+          KLDRR+VLLGLGGLYGA++L   PLAFAAP+  P++ KC + 
Sbjct  60   PNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAAPLAPPDLTKCTL-  118

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             A++  G     CCPPV+T +  +       +R RPAAH +  + +AKF KA  LM+ALP
Sbjct  119  -AEITTGGETVACCPPVSTKIKAFTPDRSIPLRTRPAAHLVTDEYLAKFKKAQALMRALP  177

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+  QQA VHCAYCNGAY QV FPD +IQVH SWLFFPFHR
Sbjct  178  EDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222



>gb|ACB12082.1| polyphenol oxidase [Triticum monococcum subsp. aegilopoides]
Length=577

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 126/209 (60%), Gaps = 12/209 (6%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            M S   P + T   P S  + A  +  L +       +++ RH  ISC A G G      
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRN--LLRALHRRKDARQPRHLSISCEATGRG------  52

Query  356  KLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            ++DRR+V+LGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP  
Sbjct  53   RVDRREVILGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTP  110

Query  533  ATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
             T + +++LP A + +RVRPAAH +D   +A++ +AV LMK LPADDPR+F QQ  VHCA
Sbjct  111  GTGITDFELPPASSPLRVRPAAHLVDAGYLARYERAVALMKQLPADDPRSFEQQWHVHCA  170

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  171  YCDAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|ACB12083.1| polyphenol oxidase [Triticum monococcum]
Length=577

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 126/209 (60%), Gaps = 12/209 (6%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            M S   P + T   P S  + A  +  L +       +++ RH  ISC A G G      
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRN--LLRALHRRKDARQPRHLSISCEATGRG------  52

Query  356  KLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            ++DRR+V+LGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP  
Sbjct  53   RVDRREVILGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTP  110

Query  533  ATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
             T + +++LP A + +RVRPAAH +D   +A++ +AV LMK LPADDPR+F QQ  VHCA
Sbjct  111  GTGITDFELPPASSPLRVRPAAHLVDAGYLARYERAVALMKQLPADDPRSFEQQWHVHCA  170

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  171  YCDAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 129/213 (61%), Gaps = 19/213 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAA-GDGGGDS  349
            MA+L S  T T      F + +   TPL  KP Q L         ++ C A  GD     
Sbjct  12   MAALHSTTTTTLFRSPLFPNKSQ--TPLQRKPKQCLAG-------RVRCKATKGDNDSLD  62

Query  350  Q--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            Q  ++LDRR++L+GLG      +   NP AFAAPI AP++  C   PAD P G+ +D CC
Sbjct  63   QGLARLDRRNMLIGLGAGGLYGA-AGNPFAFAAPISAPDLTTCG--PADKPDGSTID-CC  118

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRNFYQQAL  697
            PP  T +I++KLP    +R RPAA  + KD   +AK+ KAVELM+ALP DDPR+  QQA+
Sbjct  119  PPTTTTIIDFKLPDKGPLRTRPAAQDVAKDPAYLAKYKKAVELMRALPDDDPRSHAQQAM  178

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  179  VHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHR  211



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 125/186 (67%), Gaps = 11/186 (6%)
 Frame = +2

Query  251  TPLSKPSQHLISSKRNRHF---KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVS  421
            +P     QH+  +KR  H    ++SC A  D    +Q+   RRDVL+GLGGLY A++L +
Sbjct  7    SPFFPKPQHVTKTKRLNHPYVPRVSCKATDD----TQNPPTRRDVLIGLGGLYSATNL-A  61

Query  422  NPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAH  598
            +  AFA PI  P++ KCE+   DLP      NCC P+   +I+++ P+  + +R R AAH
Sbjct  62   DRTAFAKPITPPDLTKCEL--VDLPNPENPSNCCTPLPKKIIDFRPPSPFSPLRTRRAAH  119

Query  599  TMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWL  778
             +D+D +AK+A+A+ LMK+LP DDPRNFYQQA VHCAYCNGAY+QV FP  EI VH+ W 
Sbjct  120  LVDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWF  179

Query  779  FFPFHR  796
            FFP+HR
Sbjct  180  FFPWHR  185



>gb|ADG85002.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 126/209 (60%), Gaps = 12/209 (6%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            M S   P + T   P S  + A  +  L +   H   +++ R   ISC AAG G      
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRN--LLRALHHRKDARQPRRLSISCEAAGGG------  52

Query  356  KLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
             +DRR+VLLGLG    A         A AAPIQAP++  C+ P   LP      NCCP  
Sbjct  53   SVDRREVLLGLGSAAAAGLATDQGRGAIAAPIQAPDLRNCQTPA--LPNTPPDTNCCPTP  110

Query  533  ATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
             T++ +++LP A + +RVRPAAH +D + +AK+ +AV LMK LPADDPR+F QQ  VHCA
Sbjct  111  GTSITDFELPPASSPLRVRPAAHLVDAEYLAKYERAVALMKQLPADDPRSFEQQWHVHCA  170

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ A+DQV FPD E+Q+HN WLFFP+HR
Sbjct  171  YCDAAFDQVGFPDLELQIHNCWLFFPWHR  199



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 126/183 (69%), Gaps = 8/183 (4%)
 Frame = +2

Query  260  SKPSQHLIS--SKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPL  430
            S P  H +S   K NRH  I   +   G  D  Q+   RRD+L+GLGGLYGA+SL S+P 
Sbjct  21   SFPKTHRVSRIKKPNRH-NIPIVSCKSGKNDHEQNPATRRDLLIGLGGLYGATSL-SDPF  78

Query  431  AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMD  607
            A+A PI  P+I +CE+    LP  +   NCCPP +T + N++ P+ ++ MR+RPAAH +D
Sbjct  79   AYANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSASSPMRIRPAAHLVD  136

Query  608  KDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFP  787
            K  +AK+AKA+ LMK+LP DDPR+F  QA VHCAYC+GAY Q  FPD ++Q+H SWLFFP
Sbjct  137  KAYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFP  196

Query  788  FHR  796
            +HR
Sbjct  197  WHR  199



>gb|ACB12085.1| polyphenol oxidase, partial [Triticum turgidum subsp. durum]
Length=279

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 122/207 (59%), Gaps = 11/207 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRN-RHFKISCNAAGDGGGDSQSKL  361
            + S   P + TP+   S   L+        HL    R  R   +SC A G        ++
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRNLLRGLHLRKDARQPRRLSVSCEATGG------CRV  54

Query  362  DRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            DRR+VLLGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP   T
Sbjct  55   DRREVLLGLGGAAAAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGT  112

Query  539  NVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
             + ++ LP V++ +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  VHCAYC
Sbjct  113  GITDFVLPPVSSPLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYC  172

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            + AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  173  DAAYDQVGFPDLELQIHNCWLFFPWHR  199



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 9/188 (5%)
 Frame = +2

Query  248  STPLSKPSQ-HLIS--SKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSL  415
            S PL+  S+ H +S   K NRH  I   +   G  D  Q+   RRD+L+GLGGLYGA+SL
Sbjct  10   SIPLAASSKTHRVSRFKKPNRH-NIPIVSCKSGKNDHEQNPATRRDLLIGLGGLYGATSL  68

Query  416  VSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPA  592
             S+P A+A PI  P+I +CE+    LP  +   NCCPP +T + N++ P+ ++ MR+RPA
Sbjct  69   -SDPFAYANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSASSPMRIRPA  125

Query  593  AHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNS  772
            AH +DK  +AK+AKA+ LMK+LP DDPR+F  QA VHCAYC+GAY Q  FPD ++Q+H S
Sbjct  126  AHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFS  185

Query  773  WLFFPFHR  796
            WLFFP+HR
Sbjct  186  WLFFPWHR  193



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDN--CCPPVATNVINYKLPAVTT-M  577
             +  +NP A A+PI  P+++ C   P DLP GA  +N  CCPP +T +INYK+P+    +
Sbjct  86   GTFTTNPFALASPISPPDLSTCG--PPDLPLGATPNNINCCPPNSTKIINYKIPSSNQPL  143

Query  578  RVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEI  757
            RVR AAH ++ + + K+ KA+ELMKALP++DPR+F QQA +HCAYC+GAY QV FP+ ++
Sbjct  144  RVRQAAHLVNDEYLQKYKKAIELMKALPSNDPRSFIQQANIHCAYCDGAYSQVGFPNLDL  203

Query  758  QVHNSWLFFPFHR  796
            QVHNSWLFFPFHR
Sbjct  204  QVHNSWLFFPFHR  216



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 133/225 (59%), Gaps = 21/225 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSS----AANLSTPLSKPSQHLISSKR----NRHFKISCNAAG  331
            MA+  SP T + TT  ++SS      + S  L   SQ   S K     +R   ISC A  
Sbjct  1    MATAPSP-TGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKSKQYISRRSSISCKATN  59

Query  332  DGGGDSQS----------KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVP  481
                + Q+          KLDRR+VLLGLGGLYGA++L   PLAFAAP+  P++ KC + 
Sbjct  60   PNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAAPLAPPDLTKCTL-  118

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             A++  G     CCPPV+T +  +       +R RPAAH +  + +AKF  A  LM+ALP
Sbjct  119  -AEITTGGETVACCPPVSTKIKAFTPDRSIPLRTRPAAHLVTDEYLAKFKNAQALMRALP  177

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+  QQA VHCAYCNGAY QV FPD +IQVH SWLFFPFHR
Sbjct  178  EDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222



>gb|ABI96947.1| putative polyphenol oxidase [Rhodotypos scandens]
Length=447

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +2

Query  425  PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
            P AFA P+  P++++C    ADLP GAV  NCCPP +T +I+++ P  + +RVR AAH +
Sbjct  1    PFAFAKPVLPPDVSECGA--ADLPTGAVPTNCCPPPSTKIIDFRPPTPSRLRVRQAAHAV  58

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNF-PDQEIQVHNSWLF  781
            D+  I K+ KA+ELMKALP DDPR+F QQA VHCAYC+GAYDQV   P  E+QVHNSWLF
Sbjct  59   DRAYIDKYTKALELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGTDPKVELQVHNSWLF  118

Query  782  FPFHR  796
            FPFHR
Sbjct  119  FPFHR  123



>gb|ACB12087.1| truncated polyphenol oxidase [Aegilops tauschii]
Length=466

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEI  463
            +++ R   ISC A G G      ++DRR+VLLGLGG   A         A AAPIQAP++
Sbjct  36   ARQPRRISISCEATGGG------RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDL  89

Query  464  AKCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAV  640
              C+ P  DLP      NCCP   T + +++LP A + +RVRPAAH +D + +AK+ +AV
Sbjct  90   RNCQTP--DLPNTPPDTNCCPTPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAV  147

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  148  ALMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  199



>ref|XP_004171214.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Cucumis 
sativus]
Length=277

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = +2

Query  251  TPLSKPSQHLISSKRNRHFKISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNP  427
            TP  + ++ L+ + R     ISC A      +    K+DRRD+L+GL GLYG+S+L  +P
Sbjct  13   TPFLRKTKTLLITPR-----ISCKATNHNDQNFPNPKIDRRDILIGLTGLYGSSTLSQSP  67

Query  428  -LAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTM  604
              A AAPI+ P I+KC   P DLPPGA   NCCPP AT +++++ P  + +RVRPAAH  
Sbjct  68   HFALAAPIETPNISKCG--PPDLPPGADATNCCPPPATTILDFQPPPPSKLRVRPAAHLA  125

Query  605  DKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFP  745
            D++ I K+ KAVELMKALP DDPR+F QQA VHCAYCNGAYDQV FP
Sbjct  126  DRNYIEKYKKAVELMKALPEDDPRSFTQQANVHCAYCNGAYDQVGFP  172



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +2

Query  365  RRDVllglgglygASSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATN  541
            RR+VLLGLGGL GA +L +N P AFAAPI  P++  C   P DLP G    NCCPP ++ 
Sbjct  75   RRNVLLGLGGLCGAVTLNNNNPFAFAAPISPPDLNTCG--PPDLPAGVKPTNCCPP-SSK  131

Query  542  VINYKL-PAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCN  718
            +I++K  P+   +RVRPAAH ++ + +AK+ KA++LMK LP+DDPRNF QQA VHCAYC+
Sbjct  132  IIDFKFSPSNQPLRVRPAAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCD  191

Query  719  GAYDQVNFPDQEIQVHNSWLFFPFHR  796
            GAY QV FPD ++QVHNSWLFFPFHR
Sbjct  192  GAYHQVGFPDLDLQVHNSWLFFPFHR  217



>gb|AII22009.1| polyphenol oxidase-7 [Gossypium hirsutum]
Length=616

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 132/219 (60%), Gaps = 16/219 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKR-----NRHFKISCNAAGDGG  340
            MAS T+  +   T P +FS     ST L K SQ  I  K+     N    +SC A+    
Sbjct  1    MASTTNSPSTGLTLP-NFS--IQTSTFLPKTSQRSIFKKKKPFNFNSKRVVSCKASNGKQ  57

Query  341  GDSQS----KLDRRDVllglgglyg-ASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGA  505
             D+ +    + DRRD+LLGLGG    A+SLV +P A A PI+ P+++ C     D     
Sbjct  58   NDADTSFLNRFDRRDILLGLGGSLYGATSLVRDPFALADPIE-PDLSSCGESTVDTSKAC  116

Query  506  VVDNCCPPVA--TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRN  679
            +   CCPP    + +I+++ P    +R RPAAH +D+D + KF  A+E MKALP DDPRN
Sbjct  117  MNVPCCPPKLKDSKIIDFEPPLGCKIRYRPAAHLVDRDYLYKFESAMERMKALPVDDPRN  176

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            F QQA +HCAYCNGAY QV FPDQ+++VH SWLFFPFHR
Sbjct  177  FMQQANIHCAYCNGAYSQVGFPDQKLEVHYSWLFFPFHR  215



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 126/195 (65%), Gaps = 22/195 (11%)
 Frame = +2

Query  263  KPSQHLISSKRNRHFK---ISCNAAGDGGGDSQ------------SKLDRRDVllglggl  397
            K SQ  +  KRN  F    +SCNA     GD +             KLDRR+VLLGLGGL
Sbjct  27   KASQVSLVGKRNPRFVRRVVSCNATN---GDERSTSSSKSGESPLGKLDRRNVLLGLGGL  83

Query  398  ygASSLVSNPLAFAAP-IQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT  574
            YG S L +      A  I  P++++C    ADLP GA   NCCPPV++ +I++KLP   +
Sbjct  84   YGVSGLGAADPFAFAAPISPPDLSECGA--ADLPAGAQPTNCCPPVSSKIIDFKLPPKNS  141

Query  575  -MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQ  751
              R+RPAAH   K+ IAK+ KA+ELMKALP DDPR+F QQA VHCAYCNGAY QV FPD 
Sbjct  142  PFRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDL  201

Query  752  EIQVHNSWLFFPFHR  796
            ++QVHNSWLF P+HR
Sbjct  202  DLQVHNSWLFLPYHR  216



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 8/164 (5%)
 Frame = +2

Query  311  ISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPA  487
            +SC +   G  D  Q+   RRD+L+GLGGLYGA+SL S+P A+A PI  P+I +CE+ P 
Sbjct  42   VSCKS---GKNDHEQNPATRRDLLIGLGGLYGATSL-SDPFAYANPIAPPDITQCELVP-  96

Query  488  DLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
             LP  +   NCCPP +T + N++ P+ ++ MR+RPAAH +D+  +AK+AKA+ LMK+LP 
Sbjct  97   -LPSESDPSNCCPPTSTEIKNFEFPSASSPMRIRPAAHLVDQAYVAKYAKAIALMKSLPD  155

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F  QA VHCAYC+GAY Q  FPD E+Q+H SWLFFP+HR
Sbjct  156  DDPRSFKSQADVHCAYCDGAYHQAGFPDLELQIHFSWLFFPWHR  199



>dbj|BAH36897.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEI  463
            +++ R   ISC A G G      ++DRR+VLLGLGG   A         A AAPIQAP++
Sbjct  36   ARQPRRISISCEATGGG------RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDL  89

Query  464  AKCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAV  640
              C+ P  DLP      NCCP   T + +++LP A + +RVRPAAH +D + +AK+ +AV
Sbjct  90   RNCQTP--DLPNTPPDTNCCPTPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAV  147

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  148  ALMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  199



>gb|ABK62803.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEI  463
            +++ R   ISC A G G      ++DRR+VLLGLGG   A         A AAPIQAP++
Sbjct  36   ARQPRRISISCEATGGG------RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDL  89

Query  464  AKCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAV  640
              C+ P  DLP      NCCP   T + +++LP A + +RVRPAAH +D + +AK+ +AV
Sbjct  90   RNCQTP--DLPNTPPDTNCCPTPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAV  147

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  148  ALMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  199



>gb|ACB12086.1| polyphenol oxidase [Aegilops tauschii]
Length=577

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEI  463
            +++ R   ISC A G G      ++DRR+VLLGLGG   A         A AAPIQAP++
Sbjct  36   ARQPRRISISCEATGGG------RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDL  89

Query  464  AKCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAV  640
              C+ P  DLP      NCCP   T + +++LP A + +RVRPAAH +D + +AK+ +AV
Sbjct  90   RNCQTP--DLPNTPPDTNCCPTPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAV  147

Query  641  ELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  148  ALMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  199



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 136/210 (65%), Gaps = 11/210 (5%)
 Frame = +2

Query  182  SLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKL  361
            S  S  +P++  P  FS   + S+   KP   +I+   N +++   N   +      +  
Sbjct  8    SFISKVSPSSLYP--FSHKQHQSSKHIKPKHQVITCTGNNNYQ--NNPQEEQQVPHINVE  63

Query  362  DRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDN--CCPPV  532
             RR+VL+GLGGL    ++L +NP A A+PI  P+++ C   P DLP GA  +N  CCPP 
Sbjct  64   HRRNVLIGLGGLCSTFTTLNNNPFALASPISPPDLSTCG--PPDLPLGATPNNINCCPPN  121

Query  533  ATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
            +TN+I++K+P+    +R+R AAH +D   + K+ KAVELMK+LP+DDPR+F QQA +HCA
Sbjct  122  STNIIDFKIPSTNQPLRIRQAAHLVDNKYLRKYNKAVELMKSLPSDDPRSFIQQANIHCA  181

Query  710  YCNGAYDQVNFP-DQEIQVHNSWLFFPFHR  796
            YC+GAY QV FP D ++QVHNSWLFFPFHR
Sbjct  182  YCDGAYSQVGFPSDLDLQVHNSWLFFPFHR  211



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 133/225 (59%), Gaps = 21/225 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSS----AANLSTPLSKPSQHLISSKR----NRHFKISCNAAG  331
            MA+  SP T + TT  ++SS      + S  L   SQ   S K     +R   ISC A  
Sbjct  1    MATAPSP-TGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKSKQYVSRRSSISCKATN  59

Query  332  DGGGDSQS----------KLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVP  481
                + Q+          KLDRR+VLLGLGGLYGA++L   PLAFAAP+  P++ KC + 
Sbjct  60   PNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAAPLAPPDLTKCTL-  118

Query  482  PADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALP  661
             A++  G     CCPPV+T +  +       +R RPAAH +  + +AKF KA  LM+ALP
Sbjct  119  -AEITTGGETVACCPPVSTKIKAFTPDRSIPLRTRPAAHLVTDEYLAKFKKAQALMRALP  177

Query  662  ADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             DDPR+  QQA VHCAYCN AY QV FPD +IQVH SWLFFPFHR
Sbjct  178  EDDPRSMVQQAKVHCAYCNDAYPQVGFPDIDIQVHFSWLFFPFHR  222



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 123/179 (69%), Gaps = 11/179 (6%)
 Frame = +2

Query  272  QHLISSKRNRHF---KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAA  442
            QH+  +KR  H    ++SC A  D    +Q+   RRDVL+GLGGLY A++L ++  AFA 
Sbjct  14   QHVTKTKRLNHPYVPRVSCKATDD----TQNPPTRRDVLIGLGGLYSATNL-ADRTAFAK  68

Query  443  PIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAI  619
            PI  P++ KCE+   DLP      NCC P+   +I+++ P+  + +R R AAH +D+D +
Sbjct  69   PITPPDLTKCEL--VDLPNPENPSNCCTPLPKKIIDFRPPSPFSPLRTRRAAHLVDEDYV  126

Query  620  AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            AK+A+A+ LMK+LP +DPRNFYQQA VHCAYCNGAY+QV FP  EI VH+ W FFP+HR
Sbjct  127  AKYAEAISLMKSLPENDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFFFPWHR  185



>gb|AED02598.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=584

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 12/171 (7%)
 Frame = +2

Query  308  KISCNAAGDGGGD----SQSKLDRRD--VllglgglygASSLVSNPLAFAAPIQAPEIAK  469
            ++ C A  +GG D      S+LDRR+  + LG GGLYGA+ L +NP A AAP+ AP++ +
Sbjct  44   RVRCKAT-NGGNDHLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAAPVSAPDLTQ  102

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVE  643
            C   PAD P G  +D CCPP  T +I++KLP    +R R AA  + KD   +AK+ KA+ 
Sbjct  103  CG--PADKPDGTTID-CCPPTTTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYKKAIA  159

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LM+ALP DDPR+F QQA+VHC+YC+G Y QV +P+ EIQVH  WLFFPFHR
Sbjct  160  LMRALPDDDPRSFTQQAMVHCSYCDGGYPQVGYPNLEIQVHFCWLFFPFHR  210



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 129/219 (59%), Gaps = 27/219 (12%)
 Frame = +2

Query  188  TSPCTPTATTPKSFSSAANL----------STPLS-KPSQHLISSKRNRHFKISCNAA-G  331
            +SP  PT+T     S+   L           TPL  KP Q L         ++ C A  G
Sbjct  3    SSPLPPTSTMAALHSTTTTLFRSPLFPNKSQTPLQRKPKQCLAG-------RVRCKATKG  55

Query  332  DGGGDSQ--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGA  505
            D     Q  ++LDRR++L+GLG      +   NP AFAAPI AP++  C   PAD P G+
Sbjct  56   DNDNLDQGLARLDRRNMLIGLGAGGLYGA-AGNPFAFAAPISAPDLTTCG--PADKPDGS  112

Query  506  VVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRN  679
             +D CCPP  T +I+++LP    +R RPAA  + KD   +AK+ KAVELM+ALP DDPR+
Sbjct  113  TID-CCPPSTTTIIDFELPDSGPLRTRPAAQDVAKDPAYLAKYKKAVELMRALPDDDPRS  171

Query  680  FYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
              QQA+VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  172  HAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHR  210



>dbj|BAK03848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 121/212 (57%), Gaps = 18/212 (8%)
 Frame = +2

Query  182  SLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHF---KISCNAAGDGGGDSQ  352
            S+TS   P  TT       +NL   + K   H +   R       +++C A G       
Sbjct  9    SITS--APRCTTTLGTRMPSNLQALVPKGHAHALLRDRKEARQPRRLACKATG-------  59

Query  353  SKLDRRDVllglgglygAS-SLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPP  529
             ++DRRDVLLGLG    A         A AAPIQAP++  C   P +LP  A   NCCP 
Sbjct  60   GRVDRRDVLLGLGSAAAAGLGTRRGRGAIAAPIQAPDLGNCN--PPELPNTAPDTNCCPT  117

Query  530  VATNVINYKLPAVTT---MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
              T + ++ LP   +   +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  V
Sbjct  118  SGTGITDFVLPPAASSAPLRVRPAAHLVDAGHLAKYERAVALMKQLPADDPRSFEQQWRV  177

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAYDQ  FPD EIQVHN WLFFP+HR
Sbjct  178  HCAYCDGAYDQAGFPDLEIQVHNCWLFFPWHR  209



>dbj|BAJ10872.1| polyphenol oxidase [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 121/212 (57%), Gaps = 18/212 (8%)
 Frame = +2

Query  182  SLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHF---KISCNAAGDGGGDSQ  352
            S+TS   P  TT       +NL   + K   H +   R       +++C A G       
Sbjct  4    SITS--APRCTTTLGTRMPSNLQALVPKGHAHALLRDRKEARQPRRLACKATG-------  54

Query  353  SKLDRRDVllglgglygAS-SLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPP  529
             ++DRRDVLLGLG    A         A AAPIQAP++  C   P +LP  A   NCCP 
Sbjct  55   GRVDRRDVLLGLGSAAAAGLGTRRGRGAIAAPIQAPDLGNCN--PPELPNTAPDTNCCPT  112

Query  530  VATNVINYKLPAVTT---MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
              T + ++ LP   +   +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  V
Sbjct  113  SGTGITDFVLPPAASSAPLRVRPAAHLVDAGHLAKYERAVALMKQLPADDPRSFEQQWRV  172

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYC+GAYDQ  FPD EIQVHN WLFFP+HR
Sbjct  173  HCAYCDGAYDQAGFPDLEIQVHNCWLFFPWHR  204



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 141/220 (64%), Gaps = 17/220 (8%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKP--SQHLISSKRN-RHFKISCNAAGDGGGD  346
            MAS++S  +P +    + SS  N S+ L  P   +H  S  R  +H +I+C  + D   +
Sbjct  1    MASISS--SPLSLMSFNVSSNFNTSSSLPYPFSQKHQPSKNRKPKHHQIAC-TSNDTNQN  57

Query  347  SQSKLD-----RRDVllglgglygASSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAV  508
            S  + +     RR+VL+GLGGLYGA++  +N  LAF AP+  P++  C VPP +LP    
Sbjct  58   SPKEQEQKASPRRNVLIGLGGLYGATTFTNNNSLAFGAPVPIPDLTSCVVPPIELPDDIK  117

Query  509  -VD---NCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
             +D   +CCPP ++++I++K P    +RVRPAA  ++ D  AK+ KA+ELM+ALP DDPR
Sbjct  118  NIDPPISCCPPFSSDIIDFKFPTFNKLRVRPAAQLVNDDYFAKYNKALELMRALPDDDPR  177

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +FYQQA +HCAYC G Y Q  + D E+QVHNSWLF PFHR
Sbjct  178  SFYQQANIHCAYCVGGYTQKGY-DVELQVHNSWLFLPFHR  216



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  407  SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDN--CCPPVATNVINYKLPAVTT-M  577
             +  +NP A A+PI  P+++ C   P DLP GA  +N  CCPP +T +INYK+P+    +
Sbjct  85   GTFTTNPFALASPISPPDLSTCG--PPDLPLGATPNNINCCPPNSTKIINYKIPSSNQPL  142

Query  578  RVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEI  757
            RVR AAH ++ + + K+ KA+ELMKALP+ DPR+F QQA +HCAYC+GAY QV FP+ ++
Sbjct  143  RVRQAAHLVNDEYLQKYKKALELMKALPSSDPRSFVQQANIHCAYCDGAYSQVGFPNLDL  202

Query  758  QVHNSWLFFPFHR  796
            QVHNSWLFFPFHR
Sbjct  203  QVHNSWLFFPFHR  215



>gb|EYU34167.1| hypothetical protein MIMGU_mgv1a026988mg, partial [Erythranthe 
guttata]
Length=224

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 4/182 (2%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNP-LA  433
             +KPS  L  +KRN H ++   ++     +  SK+DRR++LLGLGG+YGA++L+S P  A
Sbjct  31   FAKPSHFLTHAKRNHHRRLISCSSSSS--NEGSKVDRRNMLLGLGGMYGAANLLSTPDSA  88

Query  434  FAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPPVATNVINYKLPAVTTMRVRPAAHTMDK  610
             A PIQAP+I KC     D   G     NCCPP   ++I+YKLP     +VRP+AH +  
Sbjct  89   SANPIQAPQIDKCGNSTYDTSAGVATQINCCPPFQGSIIDYKLPNFPKPKVRPSAHRLSP  148

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            + + KF  AV+ M+ L  DDPR+F QQA +HCAYCNG YDQ      ++QVHN WLFFPF
Sbjct  149  EYLFKFNTAVDRMRRLDKDDPRSFMQQANIHCAYCNGGYDQPGQGTLDLQVHNGWLFFPF  208

Query  791  HR  796
            HR
Sbjct  209  HR  210



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 136/215 (63%), Gaps = 14/215 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAA-NLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQ  352
            MAS+ SP +  +T   S SS+    S    K S+H    +R +    S N +       +
Sbjct  1    MASI-SPLSIISTIKISHSSSMYQFSQKQQKSSKHRKLPRR-QVITFSGNISNQNNPKEE  58

Query  353  SKL------DRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVD  514
             +L      +RR+VL+GLGGL    +  +NP A A+PI  P+++KC    + +  GA+  
Sbjct  59   QELQNIVVGNRRNVLIGLGGL--CGTFTTNPFALASPISPPDLSKCR--SSHISSGAIDI  114

Query  515  NCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQ  691
            +CCPP +T +I+YK P +T  +RVR AAH ++ + + K+ KA+ELMKALP++DPR+F QQ
Sbjct  115  DCCPPKSTKIIDYKFPPLTQPLRVRQAAHLVNDEYLQKYKKAIELMKALPSNDPRSFMQQ  174

Query  692  ALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            A VHCAYC+GAY QV FP+ ++QVH SWLFFPFHR
Sbjct  175  ANVHCAYCDGAYSQVGFPNLDLQVHGSWLFFPFHR  209



>ref|XP_008364151.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=582

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 130/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANL-STPLS-KPSQHLISSKRNRHFKISCNAAGDGGGDSQ--  352
            ++S   PT+T     S+   L  +PL    SQ  +  K  +  +++    GD     Q  
Sbjct  1    MSSSPLPTSTMATLHSTTTTLFRSPLFPNKSQTPLQRKPKQCLRVAQKTKGDNDNLDQGL  60

Query  353  SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            ++LDRR++L+GLG      + V NP AFAAP+ AP++  C   PA+ P G+ +D CCPP 
Sbjct  61   ARLDRRNMLIGLGAGGLYGA-VGNPFAFAAPVSAPDLTTCG--PANKPDGSTID-CCPPT  116

Query  533  ATNVINYKLPAVTTMRVRPAAHTM--DKDAIAKFAKAVELMKALPADDPRNFYQQALVHC  706
             T +I+++LP    +R RPAA  +  D + +AK+ KAVELM+ALP DDPR+  QQA+VHC
Sbjct  117  TTTIIDFELPDSGPLRTRPAAQDVANDPEYLAKYKKAVELMRALPDDDPRSHAQQAMVHC  176

Query  707  AYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  177  SYCDGGYPQVGYSDLEIQVHYCWLFFPFHR  206



>pdb|2P3X|A Chain A, Crystal Structure Of Grenache (Vitis Vinifera) Polyphenol 
Oxidase
Length=339

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +2

Query  440  APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDA  616
            APIQAP+I+KC    A +P G    NCCPPV T +I+++LP+  + MR RPAAH + K+ 
Sbjct  1    APIQAPDISKCGT--ATVPDGVTPTNCCPPVTTKIIDFQLPSSGSPMRTRPAAHLVSKEY  58

Query  617  IAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            +AK+ KA+EL KALP DDPR+F QQA VHC YC GAYDQV + D E+QVH SWLF PFHR
Sbjct  59   LAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHR  118



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = +2

Query  362  DRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATN  541
            +RR+VLLGLGGL GA +L +NP AFAAP+  P++  C   P DL  G    NCCPP ++ 
Sbjct  73   NRRNVLLGLGGLCGAVTLNNNPFAFAAPVLPPDLTTCG--PPDLAEGVKPINCCPP-SSK  129

Query  542  VINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCN  718
            +I++K P     +RVRPAAH +  D +AK+ KA++LMK LP++DPR+F QQA VHCAYC+
Sbjct  130  IIDFKFPPSNQPLRVRPAAHLVTDDYLAKYKKALDLMKKLPSNDPRSFMQQANVHCAYCD  189

Query  719  GAYDQVNFPDQEIQVHNSWLFFPFHR  796
            GAY QV FPD ++QVHNSWLFFPFHR
Sbjct  190  GAYHQVGFPDLDLQVHNSWLFFPFHR  215



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = +2

Query  311  ISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPA  487
            +SC +   G  D  Q+   RRD+L+GLGGLYGA+SL S+P A+A PI  P+I +CE+   
Sbjct  42   VSCKS---GKNDHEQNPATRRDLLIGLGGLYGATSL-SDPFAYANPIAPPDITQCEL--V  95

Query  488  DLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
             LP  +   NCCPP +T + N++ P+ ++ MR+RPAAH +DK  +AK+AKA+ LMK+LP 
Sbjct  96   TLPTESDPSNCCPPTSTKIKNFEFPSASSPMRIRPAAHLVDKAYVAKYAKAIALMKSLPD  155

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F  QA VHCAYC+GAY Q  FPD ++Q+H SWLFFP+HR
Sbjct  156  DDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHR  199



>sp|Q9FRX6.1|AS1_ANTMA RecName: Full=Aureusidin synthase; Short=AmAS1 [Antirrhinum majus]
 dbj|BAB20048.1| aureusidin synthase [Antirrhinum majus]
 gb|ABR57233.1| aureusidin synthase [Antirrhinum majus]
Length=562

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 10/135 (7%)
 Frame = +2

Query  416  VSNPLAFA-------APIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA-VT  571
            ++N LA+A        PI AP++ KC  P  DLPPG    NCCPP+   +I+++LP   T
Sbjct  46   IANSLAYARFASTSTGPIAAPDVTKCGQP--DLPPGTAPINCCPPIPAKIIDFELPPPST  103

Query  572  TMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQ  751
            TMRVR AAH +D   IAKF KAVELM+ALP DDPR+F QQA VHCAYC GAY+Q  F + 
Sbjct  104  TMRVRRAAHLVDDAYIAKFKKAVELMRALPEDDPRSFKQQANVHCAYCAGAYNQAGFTNL  163

Query  752  EIQVHNSWLFFPFHR  796
            ++Q+H SWLFFPFHR
Sbjct  164  KLQIHRSWLFFPFHR  178



>gb|AAS00454.1| polyphenol oxidase [Triticum aestivum]
Length=542

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 111/171 (65%), Gaps = 10/171 (6%)
 Frame = +2

Query  290  KRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIA  466
            +      ISC A G G      ++DRR+VLLGLGG   A         A AAPIQAP++ 
Sbjct  2    RHEGRISISCEATGGG------RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLR  55

Query  467  KCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVE  643
             C+ P  DLP      NCCP   T + +++LP A + +RVRPAAH +D + +AK+ +AV 
Sbjct  56   NCQTP--DLPNTPPDTNCCPTPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAVA  113

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  114  LMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  164



>gb|AHX26182.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 103/149 (69%), Gaps = 6/149 (4%)
 Frame = +2

Query  362  DRRDVllglgglygASSLVSNPL---AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            DRRDVLLGL G   A  L S+     A AAPIQAP++  C   P DLP      NCCPP 
Sbjct  34   DRRDVLLGLSGAAAAGLLTSSSSRGGAIAAPIQAPDLRDCH--PPDLPDTVGDVNCCPPG  91

Query  533  A-TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
            A T ++++ LP    +RVRPAAH +D++ +AK+ KAV LMK LP DDPR+F QQ  VHCA
Sbjct  92   AGTAIVDFTLPPAVGLRVRPAAHLVDEEYLAKYEKAVALMKELPDDDPRSFTQQWRVHCA  151

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             C+GA+DQV FPD EIQ+HN WLFFP+HR
Sbjct  152  NCDGAFDQVGFPDLEIQIHNCWLFFPWHR  180



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = +2

Query  311  ISCNAAGDGGGD-SQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPA  487
            +SC +   G  D  Q+   RRD+L+GLGGLYGA+SL S+P A+A PI  P+I +CE+   
Sbjct  42   VSCKS---GKNDHEQNPATRRDLLIGLGGLYGATSL-SDPFAYANPIAPPDITQCEL--V  95

Query  488  DLPPGAVVDNCCPPVATNVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
             LP  +   NCCP  +T + N++ P+ ++ MR+RPAAH +DK ++AK+AKA+ LMK+LP 
Sbjct  96   TLPSESNPTNCCPQTSTKIKNFEFPSASSPMRIRPAAHLVDKASLAKYAKAIALMKSLPD  155

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPR+F  QA VHCAYC+GAY Q  FPD E+Q+H SWLFFP+HR
Sbjct  156  DDPRSFKSQANVHCAYCDGAYHQAGFPDLELQIHFSWLFFPWHR  199



>ref|XP_010100567.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82810.1| Polyphenol oxidase [Morus notabilis]
Length=604

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +2

Query  314  SCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADL  493
            + N++  G G    KLDRR++LLGLGGLYGA+ L S+  A A P+  P+++KC  P + L
Sbjct  64   TANSSNSGVG----KLDRRNMLLGLGGLYGAAGLGSDRFAIADPLLPPDLSKCSTP-SGL  118

Query  494  PPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDP  673
            P G VV  CCPP +  +I+YK P  T +RVRPAAH +D + IAK+ +A + M+ LP  DP
Sbjct  119  PAG-VVTECCPPYSDEIIDYK-PPRTPLRVRPAAHLVDSEYIAKYNEATKRMRKLPDSDP  176

Query  674  RNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            RNF QQA VHCAYCNGAYDQVN+P+  +QVHN W FFPFHR
Sbjct  177  RNFMQQANVHCAYCNGAYDQVNYPEIVLQVHNGWHFFPFHR  217



>ref|XP_006370128.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
 gb|AEH41424.1| polyphenol oxidase [Populus trichocarpa]
 gb|ERP66697.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
Length=573

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 131/202 (65%), Gaps = 8/202 (4%)
 Frame = +2

Query  197  CTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFK-ISCNAAGDGGGDSQSKLDRRD  373
             +P  T+P + S+++   + L K +  +  ++ + +F  +SC A  D   D Q+   RRD
Sbjct  5    LSPLTTSPSAISTSSLCPSILKKHAPFVARNQSHPNFHTVSCKARND---DHQNPSTRRD  61

Query  374  VllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINY  553
            VL+GLGGLYGA++L S+P A+A PIQ P+IA C V   + P      NCCPP+   +I++
Sbjct  62   VLIGLGGLYGATNL-SDPFAYAKPIQPPDIADCSV--INEPDPENPTNCCPPLTRKIIDF  118

Query  554  KLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYD  730
            KLP+    +R+R  AH +D + IAK+ +A+ LMK LP DDPRNF QQA VHCAYC+G Y 
Sbjct  119  KLPSQNEPLRIRRPAHLVDDNYIAKYNRAIALMKQLPEDDPRNFTQQANVHCAYCDGGYH  178

Query  731  QVNFPDQEIQVHNSWLFFPFHR  796
            QV  PD   QVH SWLFFP+HR
Sbjct  179  QVGMPDLNYQVHFSWLFFPWHR  200



>gb|EMT30149.1| hypothetical protein F775_52610 [Aegilops tauschii]
Length=394

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 103/171 (60%), Gaps = 29/171 (17%)
 Frame = +2

Query  287  SKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIA  466
            +++ R   ISC A G GG   Q                          A AAPIQAP++ 
Sbjct  36   ARQPRRISISCEATG-GGAVRQG-------------------------AIAAPIQAPDLR  69

Query  467  KCEVPPADLPPGAVVDNCCPPVATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVE  643
             C+ P  DLP      NCCPP  T + +++LP A + +RVRPAAH +D + +AK+ +AV 
Sbjct  70   NCQTP--DLPNTPPDTNCCPPPGTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAVA  127

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LMK LPADDPR+F QQ  VHCAYC+ A+DQV FPD EIQVHN WLFFP+HR
Sbjct  128  LMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHR  178



>ref|XP_008225000.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 116/171 (68%), Gaps = 12/171 (7%)
 Frame = +2

Query  308  KISCNAAGDGGGD----SQSKLDRRD--VllglgglygASSLVSNPLAFAAPIQAPEIAK  469
            ++ C A  +GG D      S+LDRR+  + LG GGLYGA+ L +NP A AAPI AP++ +
Sbjct  48   RVRCKAT-NGGNDHLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAAPISAPDLTQ  106

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVE  643
            C   PAD P G+ +D CCPP  T +I++KLP    +R R AA  + KD   +AK+ KA+ 
Sbjct  107  CG--PADKPDGSTID-CCPPTTTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYKKAIA  163

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LM+ALP DDPR+F QQA+VHC YC+  Y QV +P+ EIQVH  WLFFPFHR
Sbjct  164  LMRALPDDDPRSFTQQAMVHCTYCDDGYPQVGYPNLEIQVHFCWLFFPFHR  214



>ref|XP_007211883.1| hypothetical protein PRUPE_ppa003608mg [Prunus persica]
 gb|EMJ13082.1| hypothetical protein PRUPE_ppa003608mg [Prunus persica]
Length=562

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 12/171 (7%)
 Frame = +2

Query  308  KISCNAAGDGGGD----SQSKLDRRD--VllglgglygASSLVSNPLAFAAPIQAPEIAK  469
            ++ C A  +GG D      S+LDRR+  + LG GGLYGA+ L +NP AFAAP+ AP   +
Sbjct  35   RVRCKAT-NGGDDHLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFAFAAPVSAPNFTQ  93

Query  470  CEVPPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVE  643
            C   PAD P G+ +D CCPP  T +I++KLP    +R R AA  + KD   +AK+ KA+ 
Sbjct  94   C--GPADKPDGSTID-CCPPTVTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYKKAIA  150

Query  644  LMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            LM+ALP DDPR+F QQA VHC+YC+G Y QV + D EIQVH  WLF+PFHR
Sbjct  151  LMRALPDDDPRSFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFHR  201



>gb|ACB12084.1| polyphenol oxidase [Triticum dicoccoides]
Length=577

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 122/207 (59%), Gaps = 11/207 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRN-RHFKISCNAAGDGGGDSQSKL  361
            + S   P + TP+   S   L+        HL    R  R   +SC A G        ++
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRNLLRGLHLRKDARQPRRLSVSCEATGG------CRV  54

Query  362  DRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            DRR+VLLGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP   T
Sbjct  55   DRREVLLGLGGAAAAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGT  112

Query  539  NVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
             + ++ LP V++ +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  VHCAYC
Sbjct  113  GITDFVLPPVSSPLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYC  172

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            + AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  173  DAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|ABK62802.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 122/207 (59%), Gaps = 11/207 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRN-RHFKISCNAAGDGGGDSQSKL  361
            + S   P + TP+   S   L+        HL    R  R   +SC A G        ++
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRNLLRGLHLRKDARQPRRLSVSCEATGG------CRV  54

Query  362  DRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            DRR+VLLGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP   T
Sbjct  55   DRREVLLGLGGAAAAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGT  112

Query  539  NVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
             + ++ LP V++ +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  VHCAYC
Sbjct  113  GITDFVLPPVSSPLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYC  172

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            + AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  173  DAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|ABK62801.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 122/207 (59%), Gaps = 11/207 (5%)
 Frame = +2

Query  185  LTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRN-RHFKISCNAAGDGGGDSQSKL  361
            + S   P + TP+   S   L+        HL    R  R   +SC A G        ++
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRNLLRGLHLRKDARQPRRLSVSCEATGG------CRV  54

Query  362  DRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVAT  538
            DRR+VLLGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP   T
Sbjct  55   DRREVLLGLGGAAAAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGT  112

Query  539  NVINYKLPAVTT-MRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYC  715
             + ++ LP V++ +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  VHCAYC
Sbjct  113  GITDFVLPPVSSPLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYC  172

Query  716  NGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            + AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  173  DAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 19/213 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAA-GDGGGDS  349
            MA+L S  T T      F + +   TP+  KP Q L         ++ C A  GD     
Sbjct  1    MAALHSTTTTTLFRSPLFPNKSQ--TPVQRKPKQCLAG-------RVRCKATKGDNDNLD  51

Query  350  Q--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            Q  ++LDRR++L+GLG      +   NP AFAAP+ AP++  C   PAD P G+ +D CC
Sbjct  52   QGPARLDRRNMLIGLGAGGLYGA-AGNPFAFAAPVSAPDLTTCG--PADKPDGSTID-CC  107

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRNFYQQAL  697
            PP  T +I++KLP    +R RPAA  + KD   +AK+ KA++LM+ LP DDPR+  QQA+
Sbjct  108  PPTTTTIIDFKLPDSGPLRTRPAAQNVAKDPAYLAKYKKAIQLMRELPDDDPRSHAQQAM  167

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  168  VHCSYCDGGYPQVGYTDLEIQVHYCWLFFPFHR  200



>gb|AII22005.1| polyphenol oxidase-3 [Gossypium hirsutum]
Length=627

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 131/220 (60%), Gaps = 16/220 (7%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKR-----NRHFKISCNAAGDGG  340
            MAS T+  +   T P +FS     ST L K SQ  I  K+     N    +SC A+    
Sbjct  1    MASTTNSPSTLLTLP-NFS--IQTSTFLPKTSQRSIFQKKKPFNFNSKTVVSCKASNGKQ  57

Query  341  GDSQ-----SKLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPG  502
             D+      ++ DRRD+LLGLGG  YGA+SLV +P A A     PE++ C     D    
Sbjct  58   NDADHTSFLNRFDRRDILLGLGGGLYGATSLVRDPFALAVVPIEPELSSCGESTVDTGKT  117

Query  503  AVVDNCCPPVA--TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPR  676
             +   CCPP    + +I+++ P    +R RPAAH +D+D + KF  A+E MKALP DDPR
Sbjct  118  CMNVPCCPPELKDSKIIDFEPPLGCKIRYRPAAHLVDRDYLYKFELAMERMKALPVDDPR  177

Query  677  NFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            NF QQA +HCAYCNGAY QV FPDQ+++VH SWLFFPFHR
Sbjct  178  NFMQQANIHCAYCNGAYSQVGFPDQKLEVHYSWLFFPFHR  217



>dbj|BAA08234.1| polyphenol oxidase [Phytolacca americana]
Length=586

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 122/198 (62%), Gaps = 20/198 (10%)
 Frame = +2

Query  242  NLSTPL-SKPSQHLISSKRNRHF---KISCNAAGD-------GGGDSQSKLDRRDVllgl  388
            N+S PL  K SQ  +   RNR     KISC    D           + +KLDRR++L+GL
Sbjct  21   NISNPLFPKTSQFSLPGCRNRRHVMPKISCKVDKDELYPKTTNDDGNTNKLDRRNMLIGL  80

Query  389  gglygA-SSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATNVINYKLPA  565
            G +YGA ++L   P   AAP+  P        P +     V  NCCPP A N+++++LP 
Sbjct  81   GSIYGAGTTLGGGPATLAAPLITPN-------PTEFGASDVGLNCCPPTARNIVDFQLPP  133

Query  566  V-TTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNF  742
              TT+RVRP AH +D   + KF++A+ LMKALPA+DPRNF QQA VHCAYC+G Y Q  F
Sbjct  134  QPTTLRVRPPAHLVDDQYLQKFSRAISLMKALPANDPRNFSQQANVHCAYCDGGYTQTGF  193

Query  743  PDQEIQVHNSWLFFPFHR  796
            P+ E+QVH SWLFFPFHR
Sbjct  194  PNLELQVHFSWLFFPFHR  211



>gb|EYU34166.1| hypothetical protein MIMGU_mgv1a003279mg [Erythranthe guttata]
Length=594

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 117/182 (64%), Gaps = 4/182 (2%)
 Frame = +2

Query  257  LSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNP-LA  433
             +KPS  L  +KRN H ++   ++     +  SK+DRR++LLGLGG+YGA++L+S P  A
Sbjct  31   FAKPSHFLTHAKRNHHRRLISCSSSSS--NEGSKVDRRNMLLGLGGMYGAANLLSTPDSA  88

Query  434  FAAPIQAPEIAKCEVPPADLPPGAVVD-NCCPPVATNVINYKLPAVTTMRVRPAAHTMDK  610
             A PIQAP+I KC     D   G     NCCPP    +I+YKLP     +VRP+AH +  
Sbjct  89   SANPIQAPQIDKCGNSTYDTSAGVATQINCCPPFTGTIIDYKLPNFPKTKVRPSAHRLSP  148

Query  611  DAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPF  790
            + + KF  AV+ M+ LP DDPR+F QQA +HCAYCNG YDQ      ++QVHN WLFFPF
Sbjct  149  EYLFKFNTAVDRMRRLPKDDPRSFMQQANIHCAYCNGGYDQPGQGTLDLQVHNGWLFFPF  208

Query  791  HR  796
            HR
Sbjct  209  HR  210



>ref|XP_008356047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=317

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 9/168 (5%)
 Frame = +2

Query  308  KISCNAA-GDGGGDSQ--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEV  478
            ++ C A  GD     Q  ++LDRR++L+GLG      +   NP AFAAP+ AP++  C  
Sbjct  48   RVXCKATKGDNENLDQGLARLDRRNMLIGLGAGGLYGA-AGNPFAFAAPVSAPDLTTCG-  105

Query  479  PPADLPPGAVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMK  652
             PAD P G+ +D CCPP  T +I++KLP    +R R AA  + K+   +AK+ KA+ELM+
Sbjct  106  -PADKPDGSTID-CCPPTTTTIIDFKLPDRGPLRTRLAAQDVAKNPAYLAKYKKAIELMR  163

Query  653  ALPADDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            ALP DDPR+F QQA VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  164  ALPDDDPRSFAQQAKVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHR  211



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 127/218 (58%), Gaps = 17/218 (8%)
 Frame = +2

Query  188  TSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRN----RHFKISCNAAGDGGGDSQ-  352
            T+P   T  T  S  S  + ST L   SQ  +S K      R   ISC A  +   ++Q 
Sbjct  3    TAPSPTTMGTYSSLISTNSFSTFLPNKSQLSLSGKSKHYVARRSSISCKATNNNSSNNQN  62

Query  353  ----------SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPG  502
                       KLDRR++L+GLGGLYGA++L   P AFA PI  P++ KC++  A++  G
Sbjct  63   EQQEESSRLLGKLDRRNILIGLGGLYGATTLDPKPFAFADPIAPPDLTKCQL--AEITTG  120

Query  503  AVVDNCCPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNF  682
                 CCPPV T +  +K      +R RPAA  +  + +AKF KA   M+ALP DDPR+ 
Sbjct  121  GETVPCCPPVTTKIKTFKPDLSIPLRTRPAAQQVTDEYLAKFKKAQAAMRALPDDDPRSM  180

Query  683  YQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             QQA VHCAYCNGAY QV FPD ++QVH SWLFFPFHR
Sbjct  181  VQQAKVHCAYCNGAYPQVGFPDNDLQVHFSWLFFPFHR  218



>gb|EYU26237.1| hypothetical protein MIMGU_mgv1a026995mg [Erythranthe guttata]
Length=590

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = +2

Query  350  QSKLDRRDVllglgg-lygASSLVSNP-LAFAAPIQAPEIAKCEVPPADLPPGAVVD-NC  520
            Q KLDRR+VLLG+GG    A+SLVS P  A A P+QAP++ KC     DL  G  +D NC
Sbjct  66   QGKLDRRNVLLGMGGLYGAAASLVSTPPEASANPVQAPQLDKCGTA-TDLNTGKKLDLNC  124

Query  521  CPPVATNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALV  700
            CPPV  N+I+YK+P    M++RP+AH +    + K+  AV+ MK LP DDPR+F QQA++
Sbjct  125  CPPVTDNIIDYKIPPALRMKLRPSAHRVSAQYMFKYNLAVDRMKRLPDDDPRSFSQQAMI  184

Query  701  HCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            HCAYCNGAYDQ      ++Q+HNSWLFFPFHR
Sbjct  185  HCAYCNGAYDQPGQGSLDLQIHNSWLFFPFHR  216



>gb|AAK13243.1| polyphenol oxidase [Trifolium pratense]
Length=623

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 131/208 (63%), Gaps = 18/208 (9%)
 Frame = +2

Query  224  SFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQSKLD-----------RR  370
            +F+++++L  P S+       +K+ +H KI+C  + D   +S  + +           RR
Sbjct  19   NFNTSSSLLYPFSQKQHQPSKNKKPKHHKIAC-TSNDTNQNSPKEQEQKPSPSNIVGHRR  77

Query  371  DVllglgglygASSLVSN-PLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPVATN--  541
            +VL+GLGGLYGA++L +N  LAFA P+  P++ KC +PP  LP      +CCPP+++N  
Sbjct  78   NVLIGLGGLYGATTLTNNNSLAFADPVPIPDLTKCVIPPTGLPNNITPFSCCPPISSNLK  137

Query  542  VINYKLPAVTTMRVRPAAHTMDK---DAIAKFAKAVELMKALPADDPRNFYQQALVHCAY  712
            +I+++ P    +RVR AAH  D    D  AK+ KA+ LMKALP DDPR+F QQA VHCAY
Sbjct  138  IIDFEFPTFKKLRVRRAAHLNDSISIDNFAKYDKALNLMKALPDDDPRSFVQQAKVHCAY  197

Query  713  CNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            C G Y Q  +P+ E+QVH SWLF PFHR
Sbjct  198  CVGGYTQKGYPNTELQVHFSWLFLPFHR  225



>gb|ABK62804.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 125/209 (60%), Gaps = 12/209 (6%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            M S   P + T+    S  + A  +  L +       +++ R   ISC A G        
Sbjct  1    MESSRMPLSATSRMSCSLQTLARRN--LLRALHRRKDARQPRRLSISCEATGG------R  52

Query  356  KLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            ++DRR+VLLGLGG   A         A AAPIQAP+++ C+ P   LP      NCCP  
Sbjct  53   RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLSNCQTPA--LPNTPPDTNCCPTP  110

Query  533  ATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
             T + +++LP A + +RVRPAAH +D + +AK+ +AV LMK LPADDPR+F QQ  VHCA
Sbjct  111  GTGITDFELPPASSPLRVRPAAHLVDAEYLAKYERAVALMKQLPADDPRSFEQQWHVHCA  170

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  171  YCDAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|AAK56323.1|AF380300_1 polyphenol oxidase 2 precursor [Malus domestica]
Length=586

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 19/213 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAA-GDGGGDS  349
            MA+L S  T T      F + +   TPL  KP Q L         ++ C A  GD     
Sbjct  12   MAALHSTTTTTLFRSPLFPNKSQ--TPLQRKPKQCLAG-------RVRCKATKGDNDNLD  62

Query  350  Q--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            Q  ++LDRR++L+GLG     S+   N  AFAAP+ AP++  C   PAD P G+ +D CC
Sbjct  63   QGLARLDRRNMLIGLGTGGLYSA-AGNSFAFAAPVSAPDLTTCG--PADKPDGSTID-CC  118

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRNFYQQAL  697
            PP+ T +I++KLP    +R R AA  + K+   +AK+ KA+ELM+ALP DDPR+  QQA 
Sbjct  119  PPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRALPDDDPRSLVQQAK  178

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  179  VHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHR  211



>ref|XP_008364152.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08583.1| polyphenol oxidase IVa [Malus domestica]
Length=587

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 19/213 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAA-GDGGGDS  349
            MA+L S  T T      F + +   TPL  KP Q L         ++ C A  GD     
Sbjct  12   MAALHSTTTTTLFRSPLFPNKSQ--TPLQRKPKQCLAG-------RVRCKATKGDNDNLD  62

Query  350  Q--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            Q  ++LDRR++L+GLG     S+   N  AFAAP+ AP++  C   PAD P G+ +D CC
Sbjct  63   QGLARLDRRNMLIGLGTGGLYSA-AGNSFAFAAPVSAPDLTTCG--PADKPDGSTID-CC  118

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRNFYQQAL  697
            PP+ T +I++KLP    +R R AA  + K+   +AK+ KA+ELM+ALP DDPR+  QQA 
Sbjct  119  PPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRALPDDDPRSLVQQAK  178

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  179  VHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHR  211



>gb|ACP28057.1| polyphenol oxidase [Populus simonii x Populus nigra]
Length=305

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 114/164 (70%), Gaps = 8/164 (5%)
 Frame = +2

Query  308  KISCNAAGDGGGDSQSKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPA  487
            ++SC A  D    +Q+   RRDVL+GLGGLYGA++L     A+A PI  P++  CE+   
Sbjct  30   RVSCKATDD----TQNPATRRDVLIGLGGLYGATNLADR-TAYAKPITPPDLTNCEL--V  82

Query  488  DLPPGAVVDNCCPPVATNVINYKLPA-VTTMRVRPAAHTMDKDAIAKFAKAVELMKALPA  664
            DLP      NCCPP+   +I+++ P+  + +R R AAH +D+D +AK+A+A+ LMK+LP 
Sbjct  83   DLPNPENPTNCCPPLPKKIIDFRPPSPFSPLRTRRAAHLVDEDYVAKYAEAISLMKSLPE  142

Query  665  DDPRNFYQQALVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            DDPRNFYQQA VHCAYC+ AY+QV FP  E+ VH  WLFFP+HR
Sbjct  143  DDPRNFYQQANVHCAYCDDAYEQVGFPKLELDVHFCWLFFPWHR  186



>ref|XP_008371330.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
Length=587

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 19/213 (9%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLS-KPSQHLISSKRNRHFKISCNAA-GDGGGDS  349
            MA+L S  T T      F + +   TPL  KP Q L         ++ C A  GD     
Sbjct  12   MAALHSTTTTTLFRSPLFPNKSQ--TPLQRKPKQCLAG-------RVRCKATKGDNDNLD  62

Query  350  Q--SKLDRRDVllglgglygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNCC  523
            Q  ++LDRR++L+GLG     S+   N  AFAAP+ AP++  C   PAD P G+ +D CC
Sbjct  63   QGLARLDRRNMLIGLGTGGLYSA-AGNSFAFAAPVSAPDLTTCG--PADKPDGSTID-CC  118

Query  524  PPVATNVINYKLPAVTTMRVRPAAHTMDKD--AIAKFAKAVELMKALPADDPRNFYQQAL  697
            PP+ T +I++KLP    +R R AA  + K+   +AK+ KA+ELM+ALP DDPR+  QQA 
Sbjct  119  PPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRALPDDDPRSLVQQAK  178

Query  698  VHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            VHC+YC+G Y QV + D EIQVH  WLFFPFHR
Sbjct  179  VHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHR  211



>gb|ACB12081.1| polyphenol oxidase [Triticum urartu]
Length=577

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 123/209 (59%), Gaps = 12/209 (6%)
 Frame = +2

Query  176  MASLTSPCTPTATTPKSFSSAANLSTPLSKPSQHLISSKRNRHFKISCNAAGDGGGDSQS  355
            M S   P + T   P S  + A  +  L +       +++ R   +SC A G        
Sbjct  1    MESSRMPLSATPRMPCSLQTLARRN--LLRALHRRKDARQPRRLPVSCEATG------GR  52

Query  356  KLDRRDVllglgglygASSLVSNPL-AFAAPIQAPEIAKCEVPPADLPPGAVVDNCCPPV  532
            ++DRR+VLLGLGG   A         A AAPIQAP++  C+ P  +LP      NCCP  
Sbjct  53   RVDRREVLLGLGGAAAAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTP  110

Query  533  ATNVINYKLP-AVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQALVHCA  709
             T + ++ LP A + +RVRPAAH +D   +AK+ +AV LMK LPADDPR+F QQ  VHCA
Sbjct  111  GTGITDFVLPPASSPLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCA  170

Query  710  YCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
            YC+ AYDQV FPD E+Q+HN WLFFP+HR
Sbjct  171  YCDAAYDQVGFPDLELQIHNCWLFFPWHR  199



>gb|AII22008.1| polyphenol oxidase-6 [Gossypium hirsutum]
Length=627

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 126/214 (59%), Gaps = 17/214 (8%)
 Frame = +2

Query  206  TATTPKSFSSAANLS----TPLSKPSQHLISSKR-----NRHFKISCNAAGDGGGDSQ--  352
            T  +P +  +  N S    T L K SQ  I  K+     N    +SC A+     D+   
Sbjct  4    TVNSPSTLLTLPNFSIQTSTFLPKTSQRSIFQKKKPFNFNSKTVVSCKASNGKQNDADHT  63

Query  353  ---SKLDRRDVllglggl-ygASSLVSNPLAFAAPIQAPEIAKCEVPPADLPPGAVVDNC  520
               ++ DRRD+LLGLGG  YGA+SLV +P A A     PE++ C     D     +   C
Sbjct  64   SFLNRFDRRDILLGLGGGLYGATSLVRDPFALAVVPIEPELSSCGESTVDTGKTCMNVPC  123

Query  521  CPPVA--TNVINYKLPAVTTMRVRPAAHTMDKDAIAKFAKAVELMKALPADDPRNFYQQA  694
            CPP    + +I+++ P    +R RPAAH +D+D + KF  A+E MKALP DDPRNF QQA
Sbjct  124  CPPELKDSKIIDFEPPLGCKIRYRPAAHLVDRDYLYKFELAMERMKALPVDDPRNFMQQA  183

Query  695  LVHCAYCNGAYDQVNFPDQEIQVHNSWLFFPFHR  796
             +HCAYCNGAY QV FPDQ+++VH SWLFFPFHR
Sbjct  184  NIHCAYCNGAYSQVGFPDQKLEVHYSWLFFPFHR  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1462956747896