BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15353_g1_i2 len=1629 path=[1607:0-1219 2827:1220-1222
2830:1223-1628]

Length=1629
                                                                      Score     E

ref|XP_011099632.1|  PREDICTED: transcription factor BEE 2              244   3e-72   
emb|CDP02008.1|  unnamed protein product                                233   8e-68   
gb|EYU28613.1|  hypothetical protein MIMGU_mgv1a010637mg                226   2e-65   
ref|XP_009597248.1|  PREDICTED: transcription factor BEE 2-like i...    222   1e-63   
ref|XP_009597249.1|  PREDICTED: transcription factor BEE 2-like i...    220   3e-63   
ref|XP_009803327.1|  PREDICTED: transcription factor HBI1-like is...    215   7e-61   
ref|XP_009803168.1|  PREDICTED: transcription factor HBI1-like          214   1e-60   
ref|XP_009803326.1|  PREDICTED: transcription factor HBI1-like is...    214   1e-60   
ref|XP_009592416.1|  PREDICTED: transcription factor HBI1-like          211   4e-59   
ref|XP_006346952.1|  PREDICTED: transcription factor bHLH64-like        208   2e-58   
ref|XP_007046905.1|  Basic helix-loop-helix DNA-binding superfami...    208   1e-57   
ref|XP_004233521.1|  PREDICTED: transcription factor HBI1               201   9e-56   
emb|CBI37656.3|  unnamed protein product                                199   1e-54   
gb|EPS69456.1|  hypothetical protein M569_05311                         192   5e-54   
gb|KDO47528.1|  hypothetical protein CISIN_1g022116mg                   195   1e-53   
ref|XP_008377294.1|  PREDICTED: transcription factor bHLH63 isofo...    198   2e-53   
ref|XP_004289668.1|  PREDICTED: transcription factor bHLH63-like        198   2e-53   
ref|XP_010088933.1|  hypothetical protein L484_018560                   199   3e-53   
ref|XP_007199864.1|  hypothetical protein PRUPE_ppa005829mg             198   3e-53   
gb|KHG04515.1|  Transcription factor bHLH63 -like protein               197   5e-53   
ref|XP_002284113.1|  PREDICTED: transcription factor bHLH63             197   7e-53   Vitis vinifera
ref|XP_007046906.1|  Basic helix-loop-helix DNA-binding superfami...    195   1e-52   
ref|XP_008385895.1|  PREDICTED: transcription factor bHLH63-like ...    196   1e-52   
ref|XP_008385893.1|  PREDICTED: transcription factor bHLH63-like ...    196   1e-52   
ref|XP_006469146.1|  PREDICTED: transcription factor bHLH63-like ...    196   2e-52   
ref|XP_006423284.1|  hypothetical protein CICLE_v10028494mg             196   2e-52   
ref|XP_006469145.1|  PREDICTED: transcription factor bHLH63-like ...    196   2e-52   
ref|XP_008236908.1|  PREDICTED: transcription factor bHLH63             195   4e-52   
ref|XP_008385894.1|  PREDICTED: transcription factor bHLH63-like ...    194   4e-52   
ref|XP_008385892.1|  PREDICTED: transcription factor bHLH63-like ...    194   6e-52   
ref|XP_002305434.2|  hypothetical protein POPTR_0004s16330g             193   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009378517.1|  PREDICTED: transcription factor bHLH63-like ...    194   8e-52   
ref|XP_002313791.1|  basic helix-loop-helix family protein              193   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009378515.1|  PREDICTED: transcription factor bHLH63-like ...    193   2e-51   
ref|XP_002313497.2|  hypothetical protein POPTR_0009s12000g             193   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009378528.1|  PREDICTED: transcription factor bHLH63-like        192   3e-51   
ref|XP_003603935.1|  Transcription factor BEE                           191   3e-51   
ref|XP_011037512.1|  PREDICTED: transcription factor bHLH63 isofo...    192   3e-51   
gb|AES74186.2|  BHLH transcription factor                               191   3e-51   
gb|AFK40379.1|  unknown                                                 191   3e-51   
gb|KDP41786.1|  hypothetical protein JCGZ_26804                         192   4e-51   
ref|XP_011037513.1|  PREDICTED: transcription factor bHLH63 isofo...    192   4e-51   
gb|KHN25381.1|  Transcription factor bHLH63                             190   7e-51   
ref|XP_011048343.1|  PREDICTED: transcription factor bHLH63-like ...    191   8e-51   
ref|XP_003541034.1|  PREDICTED: transcription factor bHLH49-like ...    190   9e-51   
ref|XP_011048325.1|  PREDICTED: transcription factor bHLH63-like ...    191   1e-50   
ref|XP_006592100.1|  PREDICTED: transcription factor bHLH49-like ...    190   1e-50   
ref|XP_007042169.1|  Cryptochrome-interacting basic-helix-loop-he...    191   1e-50   
ref|XP_011048316.1|  PREDICTED: transcription factor bHLH63-like ...    191   1e-50   
ref|XP_007046908.1|  Basic helix-loop-helix DNA-binding superfami...    187   2e-50   
ref|XP_007046907.1|  Basic helix-loop-helix DNA-binding superfami...    187   2e-50   
ref|XP_011048311.1|  PREDICTED: transcription factor bHLH63-like ...    190   2e-50   
ref|XP_011048333.1|  PREDICTED: transcription factor bHLH63-like ...    190   3e-50   
ref|XP_004173629.1|  PREDICTED: transcription factor bHLH63-like        190   3e-50   
ref|XP_011048302.1|  PREDICTED: transcription factor bHLH63-like ...    189   3e-50   
ref|XP_002266502.2|  PREDICTED: transcription factor HBI1               187   4e-50   Vitis vinifera
ref|XP_006590895.1|  PREDICTED: transcription factor bHLH49-like ...    188   5e-50   
ref|XP_002512912.1|  conserved hypothetical protein                     189   5e-50   Ricinus communis
ref|XP_003537877.1|  PREDICTED: transcription factor bHLH49-like ...    188   5e-50   
ref|XP_009334563.1|  PREDICTED: transcription factor bHLH63-like ...    188   9e-50   
gb|ACU23524.1|  unknown                                                 187   1e-49   Glycine max [soybeans]
ref|XP_009334562.1|  PREDICTED: transcription factor bHLH63-like ...    187   2e-49   
gb|KCW63995.1|  hypothetical protein EUGRSUZ_G01683                     186   2e-49   
ref|XP_007042171.1|  Cryptochrome-interacting basic-helix-loop-he...    186   3e-49   
ref|XP_010028604.1|  PREDICTED: transcription factor bHLH63-like ...    186   3e-49   
ref|XP_004148552.1|  PREDICTED: transcription factor bHLH63-like        188   4e-49   
ref|XP_010263637.1|  PREDICTED: transcription factor HBI1               187   4e-49   
ref|XP_007042170.1|  Cryptochrome-interacting basic-helix-loop-he...    185   5e-49   
ref|XP_010028605.1|  PREDICTED: transcription factor HBI1-like is...    186   6e-49   
ref|XP_010066167.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    186   6e-49   
ref|XP_008448085.1|  PREDICTED: uncharacterized protein LOC103490373    189   1e-48   
ref|XP_007046909.1|  Basic helix-loop-helix DNA-binding superfami...    182   2e-48   
ref|XP_003522925.1|  PREDICTED: transcription factor bHLH63-like        183   4e-48   
ref|XP_003606932.1|  BHLH transcription factor                          181   4e-48   
ref|XP_004507453.1|  PREDICTED: transcription factor bHLH63-like        182   4e-48   
gb|KHN33752.1|  Transcription factor bHLH63                             182   5e-48   
ref|XP_009378518.1|  PREDICTED: transcription factor bHLH63-like ...    180   7e-48   
ref|XP_008377295.1|  PREDICTED: transcription factor bHLH63 isofo...    180   8e-48   
ref|XP_009111901.1|  PREDICTED: transcription factor bHLH63-like        179   1e-47   
ref|XP_006878569.1|  hypothetical protein AMTR_s00011p00241810          182   1e-47   
ref|XP_010432168.1|  PREDICTED: transcription factor BEE 2-like i...    178   2e-47   
ref|XP_011088410.1|  PREDICTED: transcription factor bHLH63             181   2e-47   
ref|XP_007042174.1|  Cryptochrome-interacting basic-helix-loop-he...    180   2e-47   
ref|XP_006365113.1|  PREDICTED: transcription factor bHLH64-like        181   3e-47   
ref|XP_004234555.1|  PREDICTED: transcription factor BEE 2              176   3e-47   
ref|XP_007136166.1|  hypothetical protein PHAVU_009G023500g             180   6e-47   
ref|XP_003527205.1|  PREDICTED: transcription factor bHLH63-like        179   6e-47   
gb|ACN21632.1|  putative basic helix-loop-helix protein BHLH7           177   7e-47   Lotus japonicus
ref|XP_004500808.1|  PREDICTED: transcription factor bHLH63-like        178   9e-47   
ref|XP_004230908.1|  PREDICTED: transcription factor bHLH63-like ...    180   9e-47   
ref|XP_010690861.1|  PREDICTED: transcription factor HBI1               181   1e-46   
ref|XP_009587041.1|  PREDICTED: transcription factor bHLH63-like        179   1e-46   
ref|XP_009334565.1|  PREDICTED: transcription factor bHLH63-like ...    179   1e-46   
gb|KHN20066.1|  Transcription factor bHLH63                             178   2e-46   
ref|XP_010315306.1|  PREDICTED: transcription factor bHLH63-like ...    179   2e-46   
emb|CDX75440.1|  BnaA01g02620D                                          176   3e-46   
ref|XP_006412217.1|  hypothetical protein EUTSA_v10025748mg             176   3e-46   
ref|XP_006411992.1|  hypothetical protein EUTSA_v10025820mg             175   4e-46   
ref|XP_007042172.1|  Cryptochrome-interacting basic-helix-loop-he...    175   4e-46   
ref|XP_006411990.1|  hypothetical protein EUTSA_v10025820mg             174   4e-46   
ref|XP_002869033.1|  predicted protein                                  174   5e-46   
gb|KFK30277.1|  hypothetical protein AALP_AA7G240400                    174   5e-46   
ref|XP_010437601.1|  PREDICTED: transcription factor bHLH63-like        174   9e-46   
gb|KHG11613.1|  Transcription factor bHLH63 -like protein               177   9e-46   
ref|XP_006284188.1|  hypothetical protein CARUB_v10005334mg             173   1e-45   
ref|XP_010446781.1|  PREDICTED: transcription factor BEE 2-like i...    173   1e-45   
emb|CDX69067.1|  BnaC01g03860D                                          174   1e-45   
ref|XP_010432403.1|  PREDICTED: transcription factor bHLH63-like        174   1e-45   
ref|XP_010432169.1|  PREDICTED: transcription factor BEE 2-like i...    173   1e-45   
ref|XP_010437337.1|  PREDICTED: transcription factor BEE 2 isofor...    173   1e-45   
ref|XP_009762311.1|  PREDICTED: transcription factor bHLH63-like        176   2e-45   
ref|XP_010437335.1|  PREDICTED: transcription factor BEE 2 isofor...    173   2e-45   
ref|XP_010447065.1|  PREDICTED: transcription factor bHLH63-like        174   2e-45   
ref|XP_009112485.1|  PREDICTED: transcription factor HBI1-like is...    172   2e-45   
gb|AAN18284.1|  putative bHLH transcription factor                      172   3e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24785.1|  BnaA08g15250D                                          172   4e-45   
gb|AAM61556.1|  unknown                                                 171   4e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46300.1|  BnaA07g02010D                                          172   4e-45   
emb|CAB16839.1|  putative protein                                       171   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383184.1|  hypothetical protein POPTR_0005s12370g             171   5e-45   
gb|AAK96779.1|  Unknown protein                                         171   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531040.1|  PREDICTED: transcription factor HBI1-like          172   6e-45   
ref|NP_195372.1|  transcription factor BEE 2                            171   6e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10947.1|AF488591_1  putative bHLH transcription factor            171   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310242.2|  hypothetical protein POPTR_0007s13020g             173   9e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009102251.1|  PREDICTED: transcription factor HBI1-like          172   9e-45   
ref|XP_009109313.1|  PREDICTED: transcription factor BEE 2              171   1e-44   
ref|XP_009112483.1|  PREDICTED: transcription factor HBI1-like is...    171   1e-44   
ref|XP_006283943.1|  hypothetical protein CARUB_v10005062mg             172   2e-44   
emb|CDY53074.1|  BnaC03g76640D                                          171   2e-44   
gb|EPS74146.1|  hypothetical protein M569_00610                         163   2e-44   
gb|KFK30278.1|  hypothetical protein AALP_AA7G240400                    169   3e-44   
ref|XP_006411991.1|  hypothetical protein EUTSA_v10025820mg             169   4e-44   
emb|CAA18832.1|  putative protein                                       169   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10952.1|AF488596_1  putative bHLH transcription factor            169   6e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDO97040.1|  unnamed protein product                                172   6e-44   
ref|NP_195179.2|  cryptochrome-interacting basic-helix-loop-helix 1     169   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446782.1|  PREDICTED: transcription factor BEE 2-like i...    168   7e-44   
gb|AAM53299.1|  unknown protein                                         169   7e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30317.1|  BnaA09g09600D                                          169   7e-44   
ref|XP_011003720.1|  PREDICTED: transcription factor HBI1-like is...    168   7e-44   
ref|XP_002977203.1|  hypothetical protein SELMODRAFT_106386             164   8e-44   
ref|XP_010437338.1|  PREDICTED: transcription factor BEE 2 isofor...    168   8e-44   
ref|XP_002966517.1|  hypothetical protein SELMODRAFT_72702              161   9e-44   
ref|XP_009403910.1|  PREDICTED: transcription factor bHLH63-like ...    170   1e-43   
ref|XP_006409170.1|  hypothetical protein EUTSA_v10022772mg             169   1e-43   
ref|XP_009138432.1|  PREDICTED: transcription factor BEE 2-like         167   1e-43   
ref|XP_010437336.1|  PREDICTED: transcription factor BEE 2 isofor...    168   1e-43   
ref|XP_010940086.1|  PREDICTED: transcription factor bHLH63-like        169   1e-43   
ref|XP_011003719.1|  PREDICTED: transcription factor HBI1-like is...    168   1e-43   
ref|XP_008810718.1|  PREDICTED: transcription factor BEE 2-like i...    170   1e-43   
ref|XP_010254797.1|  PREDICTED: transcription factor HBI1-like is...    171   1e-43   
emb|CDY42693.1|  BnaA03g53460D                                          167   1e-43   
gb|KFK40214.1|  hypothetical protein AALP_AA3G345500                    168   1e-43   
ref|XP_010254796.1|  PREDICTED: transcription factor HBI1-like is...    171   2e-43   
ref|XP_011003717.1|  PREDICTED: transcription factor HBI1-like is...    168   2e-43   
ref|XP_010925976.1|  PREDICTED: transcription factor bHLH63-like        169   2e-43   
ref|XP_011003718.1|  PREDICTED: transcription factor HBI1-like is...    167   2e-43   
ref|NP_849508.1|  transcription factor BEE 2                            166   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112484.1|  PREDICTED: transcription factor HBI1-like is...    167   6e-43   
ref|XP_009406341.1|  PREDICTED: transcription factor bHLH62-like        171   7e-43   
ref|XP_002869141.1|  hypothetical protein ARALYDRAFT_491205             166   7e-43   
ref|XP_010548320.1|  PREDICTED: transcription factor HBI1-like is...    167   9e-43   
ref|XP_002886164.1|  basic helix-loop-helix family protein              166   1e-42   
ref|XP_011025811.1|  PREDICTED: transcription factor BEE 2              167   1e-42   
ref|XP_010907240.1|  PREDICTED: transcription factor bHLH62             170   2e-42   
ref|XP_010548321.1|  PREDICTED: transcription factor HBI1-like is...    166   2e-42   
ref|XP_008810719.1|  PREDICTED: transcription factor BEE 2-like i...    165   2e-42   
ref|XP_004147655.1|  PREDICTED: transcription factor bHLH78-like        169   2e-42   
ref|XP_001780050.1|  predicted protein                                  159   2e-42   
gb|AAM10953.1|AF488597_1  putative bHLH transcription factor            164   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849976.1|  transcription factor bHLH64                           164   5e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51216.1|  BnaC09g09710D                                          164   6e-42   
ref|XP_009403909.1|  PREDICTED: transcription factor bHLH63-like ...    165   6e-42   
ref|XP_008813505.1|  PREDICTED: transcription factor bHLH62-like ...    168   6e-42   
emb|CDY20923.1|  BnaC06g01430D                                          164   7e-42   
ref|XP_008813504.1|  PREDICTED: transcription factor bHLH62-like ...    168   9e-42   
ref|XP_008809650.1|  PREDICTED: transcription factor bHLH78-like ...    168   9e-42   
ref|XP_008809649.1|  PREDICTED: transcription factor bHLH78-like ...    167   1e-41   
ref|NP_001189548.1|  transcription factor bHLH64                        164   1e-41   
ref|XP_010468729.1|  PREDICTED: transcription factor HBI1-like          162   1e-41   
emb|CBI17295.3|  unnamed protein product                                166   1e-41   
ref|XP_002965357.1|  hypothetical protein SELMODRAFT_439190             168   2e-41   
ref|XP_008439060.1|  PREDICTED: transcription factor bHLH62-like        167   2e-41   
ref|XP_008795935.1|  PREDICTED: transcription factor bHLH63-like        162   2e-41   
ref|XP_001783811.1|  predicted protein                                  157   2e-41   
ref|XP_006298096.1|  hypothetical protein CARUB_v10014138mg             162   2e-41   
ref|XP_010246667.1|  PREDICTED: transcription factor bHLH78             167   3e-41   
gb|KHG20666.1|  Transcription factor bHLH62 -like protein               166   3e-41   
ref|XP_009403911.1|  PREDICTED: transcription factor bHLH63-like ...    162   3e-41   
ref|XP_006848450.1|  hypothetical protein AMTR_s00013p00245920          166   4e-41   
emb|CAN73299.1|  hypothetical protein VITISV_005183                     166   4e-41   Vitis vinifera
gb|KDP45272.1|  hypothetical protein JCGZ_15137                         166   4e-41   
ref|XP_010489535.1|  PREDICTED: transcription factor HBI1-like is...    162   4e-41   
ref|XP_002264969.2|  PREDICTED: transcription factor bHLH77-like        166   4e-41   Vitis vinifera
ref|XP_011084194.1|  PREDICTED: transcription factor bHLH78-like        165   4e-41   
ref|XP_010414188.1|  PREDICTED: transcription factor HBI1 isoform X1    161   5e-41   
ref|XP_010685111.1|  PREDICTED: transcription factor bHLH78             166   6e-41   
gb|ABR16552.1|  unknown                                                 166   8e-41   Picea sitchensis
emb|CDY29225.1|  BnaA06g25320D                                          161   8e-41   
emb|CAE00874.1|  TA1 protein                                            157   8e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542232.1|  PREDICTED: transcription factor bHLH49-like        156   9e-41   
ref|XP_009757727.1|  PREDICTED: transcription factor bHLH62-like        164   9e-41   
gb|EYU37805.1|  hypothetical protein MIMGU_mgv1a007881mg                162   9e-41   
gb|ABK24344.1|  unknown                                                 163   1e-40   Picea sitchensis
emb|CDP03937.1|  unnamed protein product                                164   1e-40   
ref|XP_007028903.1|  Basic helix-loop-helix DNA-binding superfami...    160   1e-40   
ref|XP_011089038.1|  PREDICTED: transcription factor bHLH62 isofo...    164   1e-40   
gb|KDO70234.1|  hypothetical protein CISIN_1g0086311mg                  157   1e-40   
gb|KDO70235.1|  hypothetical protein CISIN_1g0086311mg                  157   1e-40   
ref|XP_007028902.1|  Basic helix-loop-helix DNA-binding superfami...    160   1e-40   
ref|XP_010913102.1|  PREDICTED: transcription factor bHLH78-like ...    164   1e-40   
ref|XP_006363573.1|  PREDICTED: transcription factor bHLH49-like        163   1e-40   
ref|XP_009620571.1|  PREDICTED: transcription factor bHLH48-like ...    157   1e-40   
ref|XP_003576061.2|  PREDICTED: transcription factor bHLH49-like        159   2e-40   
ref|XP_009621297.1|  PREDICTED: transcription factor bHLH78-like ...    163   2e-40   
ref|XP_010913103.1|  PREDICTED: transcription factor bHLH78-like ...    164   2e-40   
ref|XP_007028901.1|  Basic helix-loop-helix DNA-binding superfami...    160   2e-40   
ref|XP_009621298.1|  PREDICTED: transcription factor bHLH78-like ...    163   2e-40   
ref|XP_009771720.1|  PREDICTED: transcription factor bHLH78-like        163   2e-40   
ref|NP_565434.1|  transcription factor bHLH64                           160   2e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10270.1|  unnamed protein product                                162   2e-40   
ref|XP_010673318.1|  PREDICTED: transcription factor bHLH78             163   2e-40   
ref|XP_011089037.1|  PREDICTED: transcription factor bHLH62 isofo...    163   2e-40   
ref|XP_001775637.1|  predicted protein                                  154   3e-40   
ref|XP_010926677.1|  PREDICTED: transcription factor bHLH77-like        163   3e-40   
ref|XP_009108724.1|  PREDICTED: transcription factor bHLH63-like ...    158   3e-40   
ref|XP_010243164.1|  PREDICTED: transcription factor bHLH62-like        164   3e-40   
ref|XP_010526758.1|  PREDICTED: transcription factor HBI1-like          159   3e-40   
ref|XP_004248023.1|  PREDICTED: transcription factor bHLH62             161   3e-40   
gb|KDO70232.1|  hypothetical protein CISIN_1g0086311mg                  157   3e-40   
ref|XP_007201182.1|  hypothetical protein PRUPE_ppa003350mg             164   3e-40   
gb|KDO70233.1|  hypothetical protein CISIN_1g0086311mg                  156   3e-40   
ref|XP_006358792.1|  PREDICTED: transcription factor bHLH62-like        161   3e-40   
ref|XP_008244684.1|  PREDICTED: transcription factor bHLH62             163   3e-40   
ref|XP_001780480.1|  predicted protein                                  155   4e-40   
ref|XP_006298095.1|  hypothetical protein CARUB_v10014138mg             157   4e-40   
ref|XP_002320444.1|  hypothetical protein POPTR_0014s14650g             163   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011042744.1|  PREDICTED: transcription factor bHLH77-like        163   4e-40   
gb|AAM10951.1|AF488595_1  putative bHLH transcription factor            161   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451395.1|  PREDICTED: transcription factor bHLH62-like        161   4e-40   
ref|XP_009150738.1|  PREDICTED: transcription factor HBI1-like is...    159   4e-40   
ref|XP_004148863.1|  PREDICTED: transcription factor bHLH62-like        154   5e-40   
ref|XP_006647763.1|  PREDICTED: transcription factor bHLH63-like        159   5e-40   
ref|XP_009415543.1|  PREDICTED: transcription factor bHLH49-like        160   5e-40   
ref|NP_187390.1|  transcription factor bHLH62                           161   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943354.1|  PREDICTED: transcription factor bHLH49 isofo...    162   6e-40   
ref|XP_009620568.1|  PREDICTED: transcription factor bHLH48-like ...    158   6e-40   
dbj|BAD44326.1|  putative bHLH transcription factor (bHLH062)           161   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392658.1|  PREDICTED: transcription factor bHLH77             157   6e-40   
ref|XP_010927987.1|  PREDICTED: transcription factor bHLH49-like        162   6e-40   
ref|XP_004292343.1|  PREDICTED: transcription factor bHLH62-like        162   6e-40   
gb|KHG16496.1|  Transcription factor bHLH62 -like protein               160   6e-40   
ref|XP_010681179.1|  PREDICTED: transcription factor bHLH49 isofo...    161   7e-40   
ref|XP_010044347.1|  PREDICTED: transcription factor bHLH49             162   7e-40   
tpg|DAA61908.1|  TPA: putative HLH DNA-binding domain superfamily...    160   7e-40   
ref|XP_010257881.1|  PREDICTED: transcription factor bHLH49 isofo...    161   7e-40   
ref|XP_002460392.1|  hypothetical protein SORBIDRAFT_02g027430          160   7e-40   Sorghum bicolor [broomcorn]
ref|XP_006352666.1|  PREDICTED: transcription factor bHLH78-like        161   7e-40   
ref|XP_002884644.1|  predicted protein                                  160   8e-40   
ref|XP_004296985.1|  PREDICTED: transcription factor bHLH78-like        162   8e-40   
ref|XP_010681176.1|  PREDICTED: transcription factor bHLH49 isofo...    161   9e-40   
dbj|BAJ93982.1|  predicted protein                                      160   9e-40   
ref|XP_003578282.1|  PREDICTED: transcription factor bHLH49-like        160   9e-40   
ref|XP_006297628.1|  hypothetical protein CARUB_v10013649mg             160   9e-40   
ref|XP_009380361.1|  PREDICTED: transcription factor bHLH63 isofo...    159   1e-39   
gb|EMS47333.1|  Transcription factor bHLH49                             159   1e-39   
ref|XP_002303073.2|  basic helix-loop-helix family protein              162   1e-39   Populus trichocarpa [western balsam poplar]
gb|KDP32569.1|  hypothetical protein JCGZ_13119                         160   1e-39   
ref|XP_010681178.1|  PREDICTED: transcription factor bHLH49 isofo...    161   1e-39   
ref|XP_010943352.1|  PREDICTED: transcription factor bHLH49 isofo...    161   1e-39   
ref|XP_006645221.1|  PREDICTED: transcription factor bHLH78-like        160   1e-39   
ref|NP_001168271.1|  putative HLH DNA-binding domain superfamily ...    160   1e-39   Zea mays [maize]
ref|XP_008792945.1|  PREDICTED: transcription factor bHLH62-like        161   1e-39   
ref|XP_009596972.1|  PREDICTED: transcription factor bHLH62-like        160   1e-39   
ref|XP_009620567.1|  PREDICTED: transcription factor bHLH48-like ...    157   1e-39   
ref|NP_001169165.1|  uncharacterized protein LOC100383015               160   1e-39   Zea mays [maize]
ref|XP_006492985.1|  PREDICTED: transcription factor bHLH62-like        160   1e-39   
ref|XP_008222784.1|  PREDICTED: transcription factor bHLH62             161   1e-39   
ref|XP_010489536.1|  PREDICTED: transcription factor HBI1-like is...    157   1e-39   
gb|KDO52837.1|  hypothetical protein CISIN_1g011621mg                   160   1e-39   
tpg|DAA40320.1|  TPA: putative HLH DNA-binding domain superfamily...    160   1e-39   
ref|XP_006421053.1|  hypothetical protein CICLE_v10004862mg             160   1e-39   
ref|XP_006484281.1|  PREDICTED: transcription factor bHLH49-like ...    161   2e-39   
ref|XP_007034153.1|  Basic helix-loop-helix DNA-binding superfami...    161   2e-39   
ref|XP_009593502.1|  PREDICTED: transcription factor bHLH49-like        160   2e-39   
ref|XP_007140690.1|  hypothetical protein PHAVU_008G133600g             161   2e-39   
ref|XP_010257872.1|  PREDICTED: transcription factor bHLH49 isofo...    161   2e-39   
ref|XP_009788675.1|  PREDICTED: transcription factor bHLH62-like        160   2e-39   
ref|XP_009767242.1|  PREDICTED: transcription factor bHLH49             160   2e-39   
ref|XP_010936695.1|  PREDICTED: transcription factor bHLH63             158   2e-39   
ref|XP_009150737.1|  PREDICTED: transcription factor HBI1-like is...    157   2e-39   
gb|EYU22588.1|  hypothetical protein MIMGU_mgv1a025708mg                157   2e-39   
ref|XP_004971039.1|  PREDICTED: transcription factor bHLH78-like ...    160   2e-39   
ref|XP_007221818.1|  hypothetical protein PRUPE_ppa003543mg             161   2e-39   
ref|XP_010486282.1|  PREDICTED: transcription factor bHLH62-like        160   2e-39   
gb|EEC73857.1|  hypothetical protein OsI_08622                          157   2e-39   
ref|NP_001047868.1|  Os02g0705500                                       157   2e-39   
ref|XP_010414196.1|  PREDICTED: transcription factor HBI1 isoform X2    157   2e-39   
ref|XP_007034154.1|  Basic helix-loop-helix DNA-binding superfami...    161   2e-39   
ref|XP_009379992.1|  PREDICTED: transcription factor bHLH77             160   2e-39   
ref|XP_002458978.1|  hypothetical protein SORBIDRAFT_03g043690          160   2e-39   
ref|XP_002301743.2|  hypothetical protein POPTR_0002s23650g             161   2e-39   
ref|XP_009372199.1|  PREDICTED: transcription factor bHLH62             161   2e-39   
ref|XP_009631088.1|  PREDICTED: transcription factor bHLH49-like ...    160   2e-39   
ref|XP_009631087.1|  PREDICTED: transcription factor bHLH49-like ...    160   2e-39   
ref|XP_002534345.1|  transcription factor, putative                     160   2e-39   
ref|XP_006421483.1|  hypothetical protein CICLE_v10005087mg             156   2e-39   
ref|XP_006484279.1|  PREDICTED: transcription factor bHLH49-like ...    160   2e-39   
ref|XP_008784898.1|  PREDICTED: transcription factor bHLH63-like        157   3e-39   
ref|XP_010464354.1|  PREDICTED: transcription factor bHLH62-like        159   3e-39   
ref|XP_010261463.1|  PREDICTED: transcription factor bHLH49             160   3e-39   
ref|XP_008797585.1|  PREDICTED: transcription factor bHLH49-like ...    160   3e-39   
ref|XP_010257880.1|  PREDICTED: transcription factor bHLH49 isofo...    160   3e-39   
ref|XP_010093880.1|  hypothetical protein L484_019916                   160   3e-39   
ref|NP_001063455.1|  Os09g0474100                                       158   3e-39   
ref|XP_004957102.1|  PREDICTED: transcription factor bHLH49-like        160   3e-39   
ref|XP_010527427.1|  PREDICTED: transcription factor bHLH77-like        157   4e-39   
emb|CDY17466.1|  BnaC03g65970D                                          154   4e-39   
ref|XP_008382580.1|  PREDICTED: transcription factor bHLH62 isofo...    160   4e-39   
ref|XP_010273628.1|  PREDICTED: transcription factor bHLH74-like ...    158   4e-39   
gb|EEC84745.1|  hypothetical protein OsI_31742                          158   4e-39   
gb|EPS62866.1|  hypothetical protein M569_11921                         148   4e-39   
ref|XP_010273618.1|  PREDICTED: transcription factor bHLH74-like ...    158   4e-39   
ref|XP_008788970.1|  PREDICTED: transcription factor bHLH49-like        159   4e-39   
ref|XP_009381314.1|  PREDICTED: transcription factor bHLH77-like        158   4e-39   
ref|XP_008337491.1|  PREDICTED: transcription factor bHLH77             160   4e-39   
ref|XP_010532719.1|  PREDICTED: transcription factor bHLH77             157   4e-39   
ref|XP_008797586.1|  PREDICTED: transcription factor bHLH49-like ...    159   4e-39   
ref|XP_002489318.1|  hypothetical protein SORBIDRAFT_0010s017130        155   4e-39   
ref|XP_006660739.1|  PREDICTED: transcription factor bHLH49-like        158   4e-39   
ref|XP_008651560.1|  PREDICTED: BHLH transcription factor isoform X1    156   5e-39   
ref|XP_006348631.1|  PREDICTED: transcription factor bHLH49-like ...    159   5e-39   
ref|XP_006348629.1|  PREDICTED: transcription factor bHLH49-like ...    159   5e-39   
tpg|DAA62210.1|  TPA: putative HLH DNA-binding domain superfamily...    156   5e-39   
ref|NP_001151910.1|  BHLH transcription factor                          156   5e-39   
ref|XP_004239006.1|  PREDICTED: transcription factor bHLH49             159   5e-39   
ref|XP_006437828.1|  hypothetical protein CICLE_v10031122mg             160   5e-39   
ref|NP_001145523.1|  uncharacterized protein LOC100278938               158   5e-39   
ref|XP_011024588.1|  PREDICTED: transcription factor bHLH62             160   5e-39   
ref|XP_008382579.1|  PREDICTED: transcription factor bHLH62 isofo...    160   6e-39   
ref|XP_006490044.1|  PREDICTED: transcription factor bHLH48-like        157   6e-39   
ref|XP_008466092.1|  PREDICTED: transcription factor bHLH49-like        159   6e-39   
ref|XP_008372543.1|  PREDICTED: transcription factor bHLH62-like        159   6e-39   
ref|XP_004953614.1|  PREDICTED: transcription factor bHLH63-like ...    156   6e-39   
ref|XP_006297936.1|  hypothetical protein CARUB_v10013979mg             156   6e-39   
ref|XP_006421482.1|  hypothetical protein CICLE_v10005087mg             157   6e-39   
ref|XP_006484809.1|  PREDICTED: transcription factor bHLH78-like ...    158   6e-39   
ref|XP_006437240.1|  hypothetical protein CICLE_v10031135mg             158   6e-39   
ref|XP_009627868.1|  PREDICTED: transcription factor bHLH62-like        159   7e-39   
ref|XP_008382578.1|  PREDICTED: transcription factor bHLH62 isofo...    160   7e-39   
gb|KDO57239.1|  hypothetical protein CISIN_1g015330mg                   157   7e-39   
ref|XP_001757672.1|  predicted protein                                  147   7e-39   
ref|XP_009795428.1|  PREDICTED: transcription factor bHLH48-like ...    155   7e-39   
emb|CDX86296.1|  BnaA06g30130D                                          153   7e-39   
ref|XP_008807018.1|  PREDICTED: transcription factor bHLH49-like ...    158   7e-39   
ref|XP_009776786.1|  PREDICTED: transcription factor bHLH49-like        159   7e-39   
ref|XP_006661402.1|  PREDICTED: transcription factor bHLH77-like        154   7e-39   
ref|XP_006414789.1|  hypothetical protein EUTSA_v10025750mg             155   7e-39   
ref|XP_011102313.1|  PREDICTED: transcription factor bHLH49-like        157   8e-39   
ref|XP_011000012.1|  PREDICTED: transcription factor bHLH77             159   8e-39   
gb|KFK38192.1|  hypothetical protein AALP_AA3G081200                    157   8e-39   
ref|XP_009147085.1|  PREDICTED: transcription factor bHLH62             157   8e-39   
emb|CDX77488.1|  BnaA07g06260D                                          155   8e-39   
ref|XP_006407846.1|  hypothetical protein EUTSA_v10020729mg             157   8e-39   
emb|CDY28061.1|  BnaC05g44630D                                          157   8e-39   
emb|CDY35923.1|  BnaA05g30270D                                          157   8e-39   
ref|XP_009627192.1|  PREDICTED: transcription factor bHLH49-like        159   8e-39   
ref|XP_009102591.1|  PREDICTED: transcription factor bHLH77 isofo...    155   8e-39   
ref|XP_004957264.1|  PREDICTED: transcription factor bHLH49-like        155   8e-39   
gb|KEH27902.1|  BHLH transcription factor                               159   8e-39   
emb|CDX85122.1|  BnaC07g07840D                                          155   9e-39   
dbj|BAJ94720.1|  predicted protein                                      153   1e-38   
ref|XP_006437241.1|  hypothetical protein CICLE_v10031135mg             159   1e-38   
ref|XP_006418851.1|  hypothetical protein EUTSA_v10002586mg             155   1e-38   
ref|XP_006484808.1|  PREDICTED: transcription factor bHLH78-like ...    159   1e-38   
ref|XP_007045714.1|  Basic helix-loop-helix DNA-binding superfami...    159   1e-38   
gb|KHG19755.1|  Transcription factor bHLH60                             155   1e-38   
ref|XP_008807015.1|  PREDICTED: transcription factor bHLH49-like ...    158   1e-38   
gb|KDO60872.1|  hypothetical protein CISIN_1g044652mg                   159   1e-38   
ref|XP_004297184.1|  PREDICTED: transcription factor bHLH49-like        157   1e-38   
ref|XP_001772019.1|  predicted protein                                  149   1e-38   
ref|XP_010905158.1|  PREDICTED: transcription factor bHLH62-like        158   1e-38   
ref|XP_008783047.1|  PREDICTED: transcription factor bHLH49-like ...    158   1e-38   
ref|XP_007045713.1|  Basic helix-loop-helix DNA-binding superfami...    159   1e-38   
gb|ABK94855.1|  unknown                                                 155   1e-38   
ref|XP_008243775.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    158   1e-38   
ref|XP_010532469.1|  PREDICTED: transcription factor bHLH49-like ...    158   1e-38   
gb|KDO69861.1|  hypothetical protein CISIN_1g023847mg                   149   1e-38   
gb|EAZ09639.1|  hypothetical protein OsI_31923                          155   1e-38   
ref|XP_007049642.1|  Basic helix-loop-helix DNA-binding superfami...    159   1e-38   
emb|CDY05670.1|  BnaC02g38670D                                          152   1e-38   
ref|XP_010511918.1|  PREDICTED: transcription factor bHLH49-like        158   1e-38   
ref|NP_001052532.2|  Os04g0350700                                       152   1e-38   
ref|XP_002516384.1|  transcription factor, putative                     158   1e-38   
ref|XP_009106418.1|  PREDICTED: transcription factor bHLH77-like        154   1e-38   
ref|XP_009371096.1|  PREDICTED: transcription factor bHLH62 isofo...    158   1e-38   
gb|KHG19754.1|  Transcription factor bHLH60                             155   1e-38   
ref|XP_009373612.1|  PREDICTED: transcription factor bHLH62-like        158   1e-38   
gb|EEE57652.1|  hypothetical protein OsJ_08085                          153   1e-38   
gb|ACF83761.1|  unknown                                                 155   1e-38   
ref|NP_001063582.1|  Os09g0501600                                       155   1e-38   
ref|XP_010512743.1|  PREDICTED: transcription factor bHLH77-like        155   1e-38   
emb|CDY64034.1|  BnaC06g42050D                                          154   2e-38   
ref|XP_007045712.1|  Basic helix-loop-helix DNA-binding superfami...    158   2e-38   
ref|XP_006414788.1|  hypothetical protein EUTSA_v10025750mg             154   2e-38   
ref|XP_004489951.1|  PREDICTED: transcription factor bHLH79-like        152   2e-38   
ref|XP_004228422.1|  PREDICTED: transcription factor bHLH49-like        158   2e-38   
ref|XP_002452680.1|  hypothetical protein SORBIDRAFT_04g030530          155   2e-38   
ref|XP_010942244.1|  PREDICTED: transcription factor bHLH49-like ...    156   2e-38   
ref|XP_002887213.1|  basic helix-loop-helix family protein              157   2e-38   
ref|XP_008797587.1|  PREDICTED: transcription factor bHLH49-like ...    157   2e-38   
ref|XP_007153872.1|  hypothetical protein PHAVU_003G072000g             152   2e-38   
ref|XP_004166054.1|  PREDICTED: transcription factor bHLH49-like        158   2e-38   
ref|XP_010552543.1|  PREDICTED: transcription factor bHLH49-like ...    155   2e-38   
gb|KGN49799.1|  hypothetical protein Csa_5G135350                       158   2e-38   
ref|XP_010466724.1|  PREDICTED: transcription factor bHLH77             155   2e-38   
ref|XP_004149484.1|  PREDICTED: transcription factor bHLH49-like        158   2e-38   
ref|XP_002885587.1|  predicted protein                                  155   2e-38   
ref|XP_007225728.1|  hypothetical protein PRUPE_ppa003619mg             158   2e-38   
ref|XP_010414685.1|  PREDICTED: transcription factor BPE-like           151   2e-38   
gb|AFW73021.1|  putative HLH DNA-binding domain superfamily protein     154   2e-38   
gb|KFK39667.1|  hypothetical protein AALP_AA3G273700                    155   2e-38   
ref|XP_008389360.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    158   2e-38   
ref|XP_003519229.1|  PREDICTED: transcription factor BPE-like iso...    152   2e-38   
ref|XP_010488446.1|  PREDICTED: transcription factor bHLH77-like        155   2e-38   
ref|XP_008339739.1|  PREDICTED: transcription factor bHLH49-like        158   2e-38   
gb|KHN28697.1|  Transcription factor BPE                                152   2e-38   
ref|XP_010552542.1|  PREDICTED: transcription factor bHLH49-like ...    155   2e-38   
ref|XP_010547134.1|  PREDICTED: transcription factor bHLH62-like        157   2e-38   
emb|CDY22605.1|  BnaC08g42390D                                          154   2e-38   
ref|XP_011070889.1|  PREDICTED: transcription factor bHLH49-like ...    157   2e-38   
ref|XP_009356474.1|  PREDICTED: transcription factor bHLH49-like        158   2e-38   
ref|XP_010552022.1|  PREDICTED: transcription factor bHLH62-like        157   2e-38   
ref|NP_001045188.1|  Os01g0915600                                       157   2e-38   
ref|XP_011070886.1|  PREDICTED: transcription factor bHLH49-like ...    157   2e-38   
gb|KHG04243.1|  Transcription factor bHLH62 -like protein               157   2e-38   
ref|XP_003628711.1|  BHLH transcription factor                          157   2e-38   
ref|XP_010532461.1|  PREDICTED: transcription factor bHLH49-like ...    157   2e-38   
ref|XP_006302168.1|  hypothetical protein CARUB_v10020178mg             157   2e-38   
ref|XP_011009204.1|  PREDICTED: transcription factor bHLH49             158   2e-38   
ref|XP_002514566.1|  conserved hypothetical protein                     158   2e-38   
ref|NP_189011.2|  transcription factor bHLH77                           155   2e-38   
ref|XP_009631983.1|  PREDICTED: transcription factor bHLH79 isofo...    152   2e-38   
ref|XP_010057670.1|  PREDICTED: transcription factor bHLH48-like ...    154   2e-38   
ref|XP_002314910.2|  basic helix-loop-helix family protein              157   2e-38   
ref|XP_004173848.1|  PREDICTED: transcription factor BPE-like           149   2e-38   
ref|XP_010548292.1|  PREDICTED: transcription factor BPE isoform X3     152   2e-38   
ref|XP_006573185.1|  PREDICTED: transcription factor bHLH49-like ...    157   3e-38   
ref|XP_003532044.1|  PREDICTED: transcription factor bHLH79-like        152   3e-38   
ref|XP_008796704.1|  PREDICTED: transcription factor bHLH79             150   3e-38   
ref|XP_009631984.1|  PREDICTED: transcription factor bHLH79 isofo...    152   3e-38   
ref|XP_006655999.1|  PREDICTED: transcription factor bHLH49-like        155   3e-38   
ref|XP_006573184.1|  PREDICTED: transcription factor bHLH49-like ...    157   3e-38   
ref|XP_011077884.1|  PREDICTED: transcription factor bHLH49             157   3e-38   
ref|XP_003564914.1|  PREDICTED: transcription factor bHLH77-like ...    156   3e-38   
ref|NP_001288445.1|  transcription factor bHLH49                        154   3e-38   
ref|XP_003532257.1|  PREDICTED: transcription factor bHLH78-like        157   3e-38   
ref|XP_011102214.1|  PREDICTED: transcription factor bHLH49-like        157   3e-38   
gb|KHG19333.1|  Transcription factor bHLH62 -like protein               157   3e-38   
gb|AAM10942.1|AF488584_1  putative bHLH transcription factor            156   3e-38   
ref|XP_010415500.1|  PREDICTED: transcription factor bHLH49-like        157   4e-38   
tpg|DAA44192.1|  TPA: putative HLH DNA-binding domain superfamily...    149   4e-38   
ref|XP_010548267.1|  PREDICTED: transcription factor BPE isoform X1     152   4e-38   
ref|NP_001031093.1|  protein CIB5                                       153   4e-38   
ref|XP_003578371.1|  PREDICTED: transcription factor bHLH49-like        154   4e-38   
ref|XP_010548286.1|  PREDICTED: transcription factor BPE isoform X2     152   4e-38   
gb|ADD60710.1|  putative TA1 protein                                    155   4e-38   
ref|XP_010513668.1|  PREDICTED: transcription factor bHLH49-like        148   4e-38   
ref|NP_001031255.1|  transcription factor bHLH49                        156   4e-38   
ref|XP_006653293.1|  PREDICTED: transcription factor bHLH62-like        151   4e-38   
ref|XP_006602464.1|  PREDICTED: transcription factor bHLH78-like ...    157   4e-38   
ref|NP_001136513.1|  uncharacterized protein LOC100216628               152   4e-38   
tpg|DAA40452.1|  TPA: putative HLH DNA-binding domain superfamily...    152   4e-38   
dbj|BAJ91447.1|  predicted protein                                      154   4e-38   
emb|CBI15304.3|  unnamed protein product                                151   4e-38   
ref|NP_177058.1|  transcription factor bHLH49                           156   4e-38   
gb|EMT26213.1|  Transcription factor bHLH49                             155   4e-38   
ref|XP_006574976.1|  PREDICTED: transcription factor bHLH49-like ...    156   4e-38   
gb|ADD60699.1|  putative TA1 protein                                    155   4e-38   
gb|EEE55883.1|  hypothetical protein OsJ_04533                          156   4e-38   
gb|AIA57941.1|  basic helix-loop-helix protein                          147   4e-38   
gb|KEH22550.1|  BHLH transcription factor                               156   4e-38   
tpg|DAA40453.1|  TPA: putative HLH DNA-binding domain superfamily...    153   4e-38   
ref|XP_010449526.1|  PREDICTED: transcription factor BPE-like           151   4e-38   
ref|XP_010654214.1|  PREDICTED: transcription factor bHLH49 isofo...    157   4e-38   
ref|XP_007157558.1|  hypothetical protein PHAVU_002G079400g             151   5e-38   
gb|EAZ28953.1|  hypothetical protein OsJ_12999                          150   5e-38   
ref|NP_001167725.1|  putative HLH DNA-binding domain superfamily ...    149   5e-38   
emb|CDP00498.1|  unnamed protein product                                157   5e-38   
ref|XP_009127689.1|  PREDICTED: transcription factor bHLH49-like        155   5e-38   
ref|XP_003520142.1|  PREDICTED: transcription factor bHLH49-like ...    157   5e-38   
dbj|BAK00309.1|  predicted protein                                      155   5e-38   
ref|XP_010100794.1|  hypothetical protein L484_015823                   157   5e-38   
gb|EMS64147.1|  Transcription factor bHLH49                             154   5e-38   
ref|XP_010942243.1|  PREDICTED: transcription factor bHLH49-like ...    156   5e-38   
ref|XP_010654210.1|  PREDICTED: transcription factor bHLH49 isofo...    156   5e-38   
ref|XP_002511487.1|  DNA binding protein, putative                      151   5e-38   
gb|EMS57911.1|  Transcription factor bHLH49                             155   5e-38   
ref|XP_009396939.1|  PREDICTED: transcription factor bHLH79-like ...    150   5e-38   



>ref|XP_011099632.1| PREDICTED: transcription factor BEE 2 [Sesamum indicum]
Length=318

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 217/385 (56%), Gaps = 75/385 (19%)
 Frame = +1

Query  148   MLRCAQSS---PENNNVSYSAADLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFP  318
             MLR AQSS   P N+       DLSVLERQRA  QRLY      +               
Sbjct  1     MLRFAQSSSASPANH------MDLSVLERQRAQLQRLYHQQQQQS---------------  39

Query  319   ALLDGNLTNLASLWHAEENSPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATP  498
                          WH +EN      D     +   + + SS T A VP S +    N++ 
Sbjct  40    -------------WHNQEN------DCFDLLSVVSNSNDSSRTKAVVPKSDQQC--NSSL  78

Query  499   GGGRANGTATSTRKRKAEHCLE-DKKWEGETTDVQ-SEITVKCERETsgssaskenkkss  672
                 AN  + S +KRKAE  +E D K +G   + + SEIT+K ERE S ++ SK +    
Sbjct  79    ANREANNVSCSLKKRKAEFDVEEDGKEKGVLAEEEKSEITMKTERENSSNTCSKVS----  134

Query  673   ggsgEDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGM  852
                  +VQK DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGC KV GKAGM
Sbjct  135   -----EVQKPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCYKVTGKAGM  189

Query  853   LDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleav  1032
             LDEIINYVQSLQKQVEFLSMKLAA+NPRL+F++DN+F KE+PAY+ S PAA         
Sbjct  190   LDEIINYVQSLQKQVEFLSMKLAAVNPRLDFSIDNIFAKEIPAYIASLPAAQFEAANSTC  249

Query  1033  naaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSS  1212
                 L YNP+Q         G ++   D+     Q++ P    +    S  IPEA+LDSS
Sbjct  250   ----LQYNPMQ--------PGPSNCGVDIAMDRSQMLPP----RPGTSSLPIPEAFLDSS  293

Query  1213  YFPQLQ---GWESECWQTPFNGSFH  1278
                QLQ   GWES+   + FN  FH
Sbjct  294   CISQLQQLSGWESDWPSSLFNAGFH  318



>emb|CDP02008.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   233 bits (594),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 212/359 (59%), Gaps = 50/359 (14%)
 Frame = +1

Query  208   LSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEENSPNA  387
             +SVLERQRA+ QRLYQ   H   +  +      +  P     NL N   L   +ENSPN 
Sbjct  1     MSVLERQRAVLQRLYQQQQHQQDMHSSQPTT--SSMPLFQYQNLVN--PLKVHQENSPN-  55

Query  388   VVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHCLED  567
                  G    +++ +++++       S      N T    + +  A+S +KRKAE     
Sbjct  56    ----FGFTCSEITTTNTNLEMDHHQLSCS----NVTAASSKTHHVASS-KKRKAE-----  101

Query  568   KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQATDS  747
                          ITVK E+E SG ++ + +   +    E VQK+DYIHVRARRGQATDS
Sbjct  102   -----------VGITVKSEKENSGRNSRENSSSKAS---EVVQKTDYIHVRARRGQATDS  147

Query  748   HSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKLAAL  927
             HSLAERARREKISKKMKCLQDLVPGCNKV GKAGMLDEIINYVQSLQKQVEFLSMKLA L
Sbjct  148   HSLAERARREKISKKMKCLQDLVPGCNKVTGKAGMLDEIINYVQSLQKQVEFLSMKLATL  207

Query  928   NPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFATATSRGGAASM  1107
             NPRL+FN+DN+F KE PAY+ SFP   AA P+E V++A L +N  QQ  T++        
Sbjct  208   NPRLDFNVDNIFAKEFPAYIASFP--TAATPIEVVHSALLQFNQGQQEPTSSG-------  258

Query  1108  ETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQGWESECWQTPFNG--SFH  1278
               DM  +  Q M+P   ++    S + PEAY DS        W+S+ WQ+ +N   S+H
Sbjct  259   -PDMAINPAQ-MVP---QRTGTSSLTFPEAYFDSISSLSTPTWDSD-WQSFYNNVVSYH  311



>gb|EYU28613.1| hypothetical protein MIMGU_mgv1a010637mg [Erythranthe guttata]
 gb|EYU28614.1| hypothetical protein MIMGU_mgv1a010637mg [Erythranthe guttata]
Length=306

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 168/251 (67%), Gaps = 35/251 (14%)
 Frame = +1

Query  538   KRKAEHCLEDKKWE-GETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIH  714
             KRKA+  +E+      E  + +SEIT K E ETSG++ SKE+ K S     +VQK DYIH
Sbjct  87    KRKAQFDMEENSENIVEAEEEKSEITAKTEMETSGNTCSKESSKVS-----EVQKPDYIH  141

Query  715   VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQ  894
             VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKV GKAGMLDEIINYVQSLQKQ
Sbjct  142   VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVTGKAGMLDEIINYVQSLQKQ  201

Query  895   VEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFA  1074
             VEFLSMKLA +NPRL+FN+D++F KE+PAY+ S              A  LHYN +QQ  
Sbjct  202   VEFLSMKLATVNPRLDFNVDDIFAKEIPAYISSL-------QAAQFEATCLHYNTMQQ--  252

Query  1075  TATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ---GWESE  1245
               ++ GG  S+       D   MLPH+ + EN        A LD S+  QLQ   GWES+
Sbjct  253   GTSNCGGDISL-------DQSQMLPHN-KAEN--------ALLDPSFISQLQQLSGWESD  296

Query  1246  CWQTPFNGSFH  1278
              W + FN  FH
Sbjct  297   -WPSLFNAGFH  306



>ref|XP_009597248.1| PREDICTED: transcription factor BEE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 157/368 (43%), Positives = 198/368 (54%), Gaps = 63/368 (17%)
 Frame = +1

Query  205   DLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEENSPN  384
             ++S+LERQRAIF+RLYQ     + L           F +L+  ++ + + +    +N P 
Sbjct  6     EISILERQRAIFERLYQCQQQLSSLPNQNLAH----FNSLISEHIMDCSQV----QNFPI  57

Query  385   AV---VDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
              +   +D   R          +   +    +S      +      ++ T TST+KRKAE 
Sbjct  58    KIDPQLDESSRSLNMFGSEQKTWAGSDFANNSLELAHQSLSTLSNSSMTKTSTKKRKAEF  117

Query  556   CLED----KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRA  723
               ED    +K EGE  +V+SEITVK  +E S  S              +V+K DYIHVRA
Sbjct  118   YEEDEYKARKIEGEAGEVKSEITVKSAKENSKIS--------------EVKKPDYIHVRA  163

Query  724   RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEF  903
             RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKV+GKA MLDEIINYVQSLQKQVEF
Sbjct  164   RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVIGKARMLDEIINYVQSLQKQVEF  223

Query  904   LSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFATAT  1083
             LSMKL+A N     N DNLF KE P++M +F   A            L  N  QQ     
Sbjct  224   LSMKLSASN----LNTDNLFAKEFPSHMANFANPAC-----------LQNNLFQQQRQEG  268

Query  1084  SRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP---QLQGWESECWQ  1254
             S  G A+M                QR+E+    S PEA+LDSS+ P   QL  +E++  Q
Sbjct  269   SNVGVATMSP--------------QRREDCLM-SFPEAFLDSSHVPAVHQLANFETD-MQ  312

Query  1255  TPFNGSFH  1278
               F   F 
Sbjct  313   CLFGVHFQ  320



>ref|XP_009597249.1| PREDICTED: transcription factor BEE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=302

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 190/348 (55%), Gaps = 59/348 (17%)
 Frame = +1

Query  205   DLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEENSPN  384
             ++S+LERQRAIF+RLYQ     + L           F +L+  ++ + + +    +N P 
Sbjct  6     EISILERQRAIFERLYQCQQQLSSLPNQNLAH----FNSLISEHIMDCSQV----QNFPI  57

Query  385   AV---VDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
              +   +D   R          +   +    +S      +      ++ T TST+KRKAE 
Sbjct  58    KIDPQLDESSRSLNMFGSEQKTWAGSDFANNSLELAHQSLSTLSNSSMTKTSTKKRKAEF  117

Query  556   CLED----KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRA  723
               ED    +K EGE  +V+SEITVK  +E S  S              +V+K DYIHVRA
Sbjct  118   YEEDEYKARKIEGEAGEVKSEITVKSAKENSKIS--------------EVKKPDYIHVRA  163

Query  724   RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEF  903
             RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKV+GKA MLDEIINYVQSLQKQVEF
Sbjct  164   RRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVIGKARMLDEIINYVQSLQKQVEF  223

Query  904   LSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFATAT  1083
             LSMKL+A N     N DNLF KE P++M +F   A            L  N  QQ     
Sbjct  224   LSMKLSASN----LNTDNLFAKEFPSHMANFANPAC-----------LQNNLFQQQRQEG  268

Query  1084  SRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQL  1227
             S  G A+M                QR+E+    S PEA+LDSS+ P +
Sbjct  269   SNVGVATMSP--------------QRREDCLM-SFPEAFLDSSHVPYI  301



>ref|XP_009803327.1| PREDICTED: transcription factor HBI1-like isoform X2 [Nicotiana 
sylvestris]
Length=327

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 157/359 (44%), Positives = 203/359 (57%), Gaps = 72/359 (20%)
 Frame = +1

Query  205   DLSVLERQRAIFQRLYQ-----PIIHDNHLAGAGAPAPENP--------FPALLDGNLTN  345
             ++ +LERQRAIF+RLYQ       + + +LA   +   E+         FP+ +D  +  
Sbjct  6     EMRILERQRAIFERLYQCHQQLSSLPNQNLAQLNSLISEHKMDCNQVQNFPSKIDPQM--  63

Query  346   LASLWHAEENSPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTA  525
                    + NSP+  +++ G E    + S+ +  +  +   S +   N++        T 
Sbjct  64    -------DGNSPS--LNMFGSEQKNWAGSNFTNNSLELARQSLSTLSNSSI-------TR  107

Query  526   TSTRKRKAEHCLED----KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDV  693
             TST+KRK E   ED    +K EGE   V+SEITVK E+E SG+++ + +K S      +V
Sbjct  108   TSTKKRKTEFYEEDDCKARKLEGEAGKVKSEITVKSEKENSGNNSKENSKIS------EV  161

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKV+GKAGMLDEIINY
Sbjct  162   KKLDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVIGKAGMLDEIINY  221

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHY  1053
             VQSLQKQVEFLSMKLAA N     N DNL  KE P+ M +F                   
Sbjct  222   VQSLQKQVEFLSMKLAASN----LNTDNLVAKEFPSQMANFA------------------  259

Query  1054  NPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
             NP      A  +      +       V  ML   QR+E+    S PEA+LDSS+ P +Q
Sbjct  260   NP------ACLQNNLFQQQQQGSSIGVATMLS--QRREDCLM-SFPEAFLDSSHVPAVQ  309



>ref|XP_009803168.1| PREDICTED: transcription factor HBI1-like [Nicotiana sylvestris]
Length=331

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 172/287 (60%), Gaps = 36/287 (13%)
 Frame = +1

Query  196  SAADLSVLERQRAIFQRLY------------QPIIHDNHLAGAGAPAPENPFPALLDGNL  339
            S  ++SVLERQRA+ +RLY            Q +   N+L         +     ++ N 
Sbjct  3    SCGEMSVLERQRAVLERLYSQSKQQLSSLPLQNLAQFNNLITEQMMGSLDIPIERMNENF  62

Query  340  TNLASLWHAEENSPNAVVDV----HGRETGKLSRSS---SSITAAAVPTSSKANDQNATP  498
            TN  +++  E +   A++      + +ET + S S+   SSIT  + P   K  D    P
Sbjct  63   TNF-NMFGREHDK--AIIGFGFTNNWQETARPSFSTVSNSSITTVS-PPPEKEIDTIVAP  118

Query  499  GGGRANGTATSTRKRKAEHCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssgg  678
             G        ST KRKAE   E++  + +    QSEI+ K +R      A+  N      
Sbjct  119  TGN-----VVSTNKRKAEQFSEEE--DCKIKRPQSEISEKSQR------AASGNNSKENS  165

Query  679  sgEDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLD  858
               +VQK DYIHVRARRGQATDSHSLAERARREKISKKMK LQ+LVPGCNKV GKAGMLD
Sbjct  166  KTSEVQKPDYIHVRARRGQATDSHSLAERARREKISKKMKYLQELVPGCNKVTGKAGMLD  225

Query  859  EIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            EIINYVQSLQKQVEFLSMKLAALNPRL+ N DNLF K+ P+YM +FP
Sbjct  226  EIINYVQSLQKQVEFLSMKLAALNPRLDLNTDNLFTKDFPSYMSNFP  272



>ref|XP_009803326.1| PREDICTED: transcription factor HBI1-like isoform X1 [Nicotiana 
sylvestris]
Length=328

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 203/360 (56%), Gaps = 73/360 (20%)
 Frame = +1

Query  205   DLSVLERQRAIFQRLYQ-----PIIHDNHLAGAGAPAPENP--------FPALLDGNLTN  345
             ++ +LERQRAIF+RLYQ       + + +LA   +   E+         FP+ +D  +  
Sbjct  6     EMRILERQRAIFERLYQCHQQLSSLPNQNLAQLNSLISEHKMDCNQVQNFPSKIDPQM--  63

Query  346   LASLWHAEENSPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTA  525
                    + NSP+  +++ G E    + S+ +  +  +   S +   N++        T 
Sbjct  64    -------DGNSPS--LNMFGSEQKNWAGSNFTNNSLELARQSLSTLSNSSI-------TR  107

Query  526   TSTRKRKAEHCLED-----KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgED  690
             TST+KRK E   E+     +K EGE   V+SEITVK E+E SG+++ + +K S      +
Sbjct  108   TSTKKRKTEQFYEEDDCKARKLEGEAGKVKSEITVKSEKENSGNNSKENSKIS------E  161

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             V+K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKV+GKAGMLDEIIN
Sbjct  162   VKKLDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVIGKAGMLDEIIN  221

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLH  1050
             YVQSLQKQVEFLSMKLAA N     N DNL  KE P+ M +F                  
Sbjct  222   YVQSLQKQVEFLSMKLAASN----LNTDNLVAKEFPSQMANFA-----------------  260

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
              NP      A  +      +       V  ML   QR+E+    S PEA+LDSS+ P +Q
Sbjct  261   -NP------ACLQNNLFQQQQQGSSIGVATMLS--QRREDCLM-SFPEAFLDSSHVPAVQ  310



>ref|XP_009592416.1| PREDICTED: transcription factor HBI1-like [Nicotiana tomentosiformis]
Length=331

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 169/285 (59%), Gaps = 32/285 (11%)
 Frame = +1

Query  196  SAADLSVLERQRAIFQRLYQ---------PIIH----DNHLAGAGAPAPENPFPALLDGN  336
            S  ++SVLERQRA+ +RLY          P+ +    +N + G    + + P    ++ N
Sbjct  3    SCGEMSVLERQRAVLERLYSQSKQQLSSLPLQNFAQFNNLITGQMMGSLDVPI-ERMNEN  61

Query  337  LTNLASLWHAEENSPNAV-VDVHGRETGKLSRSS---SSITAAAVPTSSKANDQNATPGG  504
             TN        +          + +ET + S S+   SSIT  + P   K  D    P  
Sbjct  62   FTNFDMFGREHDKGITGFGFTNNWQETARPSFSTVSNSSITTVS-PPPEKEIDTIVAP--  118

Query  505  GRANGTATSTRKRKAEHCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsg  684
             R N  A ST+KRK E   E++  + +    QSEI+ K +R      A+  N        
Sbjct  119  -RRN--AVSTKKRKTEQFPEEE--DCKIKRPQSEISEKSQR------AASGNNSKENSKT  167

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             +VQK DYIHVRARRGQATDSHSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEI
Sbjct  168  SEVQKPDYIHVRARRGQATDSHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEI  227

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            INYVQSLQKQVEFLSMKLA LNPRL+ N DN F K+ P+YM +FP
Sbjct  228  INYVQSLQKQVEFLSMKLAVLNPRLDLNTDNFFTKDFPSYMSNFP  272



>ref|XP_006346952.1| PREDICTED: transcription factor bHLH64-like [Solanum tuberosum]
Length=303

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 158/274 (58%), Gaps = 51/274 (19%)
 Frame = +1

Query  208  LSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENP----FPALLDGNLTNLASLWHAEEN  375
            +SVLERQRA+ +RLY      NH     +  P+      F     GN  N       E N
Sbjct  4    MSVLERQRAVLERLY------NHSKQQLSSLPQQELAHLFTGCFQGNFNNFNMFGGRESN  57

Query  376  SPNAVVDVHGRETGKLSRSS---SSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRK  546
                   V+ +E  + S S+   SSIT  + P   K ND  +T    R N    ST+KRK
Sbjct  58   F------VNCQEMARPSFSTVSNSSITTVS-PPPEKENDL-STMIAPREN--VVSTKKRK  107

Query  547  AEHCLED--KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVR  720
            AE   E+  +K  G  +   S+ +                         +VQK DYIHVR
Sbjct  108  AEFSEEEDCEKCPGNDSKENSKTS-------------------------EVQKPDYIHVR  142

Query  721  ARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVE  900
            ARRGQATDSHSLAERARREKISKKMK LQDLVPGCNKV GKAGMLDEIINYVQSLQKQVE
Sbjct  143  ARRGQATDSHSLAERARREKISKKMKYLQDLVPGCNKVTGKAGMLDEIINYVQSLQKQVE  202

Query  901  FLSMKLAALNPRLEFNMDNLFPKELPAYM-GSFP  999
            FLSMKLA LNPRL+ N DN+F K+ P+YM  +FP
Sbjct  203  FLSMKLATLNPRLDLNTDNIFAKDFPSYMTTTFP  236



>ref|XP_007046905.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX91062.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=385

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 163/263 (62%), Gaps = 39/263 (15%)
 Frame = +1

Query  529   STRKRKAEHC----LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQ  696
             S  KRK E       +DK+ +GE  + +SE+  KC  E S +S+   +K S      +VQ
Sbjct  149   SFNKRKVEAVQDDKCKDKRIKGEV-EGESEVKTKCSTEVSRNSSKGNSKAS------EVQ  201

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  202   KPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGKAGMLDEIINYV  261

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYN  1056
             QSLQ+QVEFLSMKLAA+NP +EFN+DNL  KE PAY+ +FPAAA +  +  +    L +N
Sbjct  262   QSLQRQVEFLSMKLAAVNPSVEFNVDNLPAKEFPAYVANFPAAAKSPAMANLAC--LQFN  319

Query  1057  PLQQFATAT--SRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
             PLQ+  +    + G      T+ + S                S SIPE  L SS   QLQ
Sbjct  320   PLQKAVSCMLDATGHPPQTATEGIAS---------------ASISIPEQALSSSCITQLQ  364

Query  1231  GWESECWQTP-------FNGSFH  1278
              + +  W T        +N  FH
Sbjct  365   PFST--WNTDPQGLYNVYNMGFH  385



>ref|XP_004233521.1| PREDICTED: transcription factor HBI1 [Solanum lycopersicum]
Length=305

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 154/365 (42%), Positives = 195/365 (53%), Gaps = 71/365 (19%)
 Frame = +1

Query  208   LSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEENSPNA  387
             +SVLERQRA+ +R+Y    H      +  P  E     L+ G +    +++   +++   
Sbjct  4     MSVLERQRAVLERIYN---HSKQQLSSLVPQQE--LAHLITGCVQGNFNMFGGGDSN---  55

Query  388   VVDVHGRETGKLSRSS---SSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHC  558
                V+ +E  + S S+   SSIT  + P   +++  +      R N    ST+KRKAE  
Sbjct  56    --FVNFQEMARPSFSTISNSSITTVSPPPEKESDLSSMI--APREN--VVSTKKRKAEFI  109

Query  559   LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQA  738
              E+                 CE+     S              +VQK DYIHVRARRGQA
Sbjct  110   EEED----------------CEKSPGNDSKENSKTS-------EVQKPDYIHVRARRGQA  146

Query  739   TDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKL  918
             TDSHSLAERARREKISKKMK LQDLVPGCNKV GKAGMLDEIINYVQSLQKQVEFLSMKL
Sbjct  147   TDSHSLAERARREKISKKMKYLQDLVPGCNKVTGKAGMLDEIINYVQSLQKQVEFLSMKL  206

Query  919   AALNPRLEFNMDNLFPKELPAYM-GSFPaaaaampleavnaaFLHYNPLQQFATATSRGG  1095
             A LNPRL+ N DN+F K+LP+YM  +FP   A   L         YN +Q    A S G 
Sbjct  207   ATLNPRLDLNTDNIFVKDLPSYMTTTFPPTVAVPTLS-------EYNMIQH-QQAGSTG-  257

Query  1096  AASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF----PQLQGWESECWQTPF  1263
                        DV  MLP  QR++     S P+ YL SS+     PQ   +E +  Q+ F
Sbjct  258   -----------DVAQMLP--QRRD---LMSFPDTYLGSSHVTVVQPQQPTFEPD-LQSLF  300

Query  1264  NGSFH  1278
             +  F+
Sbjct  301   SVGFN  305



>emb|CBI37656.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 136/201 (68%), Gaps = 21/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  136   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  195

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DN   KE+ PA   +FP     M  E  N ++
Sbjct  196   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDNFLAKEVFPACAANFP--TIGMSSEMTNPSY  253

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             LHY+P+QQ AT     G    E  + R+   I  P           SIP+ +LDS  F Q
Sbjct  254   LHYDPIQQVATCGVEMGINPAEIALRRT---ISAPV----------SIPDTFLDSC-FTQ  299

Query  1225  LQ---GWESECWQTPFNGSFH  1278
             +Q    W+++  Q  +   FH
Sbjct  300   IQPSSTWDAD-LQNLYGPEFH  319



>gb|EPS69456.1| hypothetical protein M569_05311, partial [Genlisea aurea]
Length=200

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 121/155 (78%), Gaps = 6/155 (4%)
 Frame = +1

Query  535  RKRKAEHCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIH  714
            RKRK E  +E++  +G+  + +SEIT+K +RE S ++  +E  K S     +VQK DYIH
Sbjct  18   RKRKPEFDVEEE-GQGQADEEKSEITMKADREASTNTCCRETSKVS-----EVQKPDYIH  71

Query  715  VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQ  894
            VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCN V GKAGMLDEIINYVQSLQKQ
Sbjct  72   VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNTVTGKAGMLDEIINYVQSLQKQ  131

Query  895  VEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            VEFLSMKLAA+N R +F+ D+ F KE PA +   P
Sbjct  132  VEFLSMKLAAVNTRFDFSTDSFFLKESPASVCCLP  166



>gb|KDO47528.1| hypothetical protein CISIN_1g022116mg [Citrus sinensis]
Length=302

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  95    EVQKHDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  154

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNLF KE  P    +FP    +  +    A  
Sbjct  155   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDNLFAKEAFPVCPSNFPTIGMSSEMTHPAAYL  214

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQ--RKENNPSESIPEAYLDSSYF  1218
               +N LQQ A + S              D+ I+ P     R+  +   S PE ++DSS +
Sbjct  215   HQFNSLQQQAVSCS------------GLDLGIINPSEMGLRRTISAPVSAPETFIDSSCY  262

Query  1219  PQLQ---GWESE  1245
             P LQ    W+S+
Sbjct  263   PHLQPSSNWDSD  274



>ref|XP_008377294.1| PREDICTED: transcription factor bHLH63 isoform X1 [Malus domestica]
Length=430

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 138/201 (69%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+ P    +FP     M  E  N+ +
Sbjct  281   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEMFPTCAANFP--TMGMSSEMTNSVY  338

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  NP+QQ  +++          DM  +   + L   +R  + PS SIPE +LD+S F Q
Sbjct  339   LQLNPMQQLVSSSG--------LDMGLNSTDLAL---RRTISAPS-SIPEPFLDTSCFTQ  386

Query  1225  LQG---WESECWQTPFNGSFH  1278
              Q    W+ +  Q  FN  F 
Sbjct  387   AQPTAIWDVD-LQNIFNVEFQ  406



>ref|XP_004289668.1| PREDICTED: transcription factor bHLH63-like [Fragaria vesca subsp. 
vesca]
Length=422

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 183/306 (60%), Gaps = 31/306 (10%)
 Frame = +1

Query  403   GRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHCL-------  561
             G E   ++R+ S     A  T  K+N+  A+P      G   S +KRKA+          
Sbjct  108   GFEMNNIARTFSCPPKVAAET--KSNNAVASPKISSPAGKE-SFKKRKADKAQNNKAVGE  164

Query  562   ---EDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRG  732
                 DK+ +G   +  S+IT +   + +   +S +  K +  + E VQK DYIHVRARRG
Sbjct  165   DDSSDKRMKGCAEEGDSKITEQNSPKNNDRESSADTSKGNSKASE-VQKPDYIHVRARRG  223

Query  733   QATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSM  912
             QATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINYVQSLQ+QVEFLSM
Sbjct  224   QATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEFLSM  283

Query  913   KLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaFLHYNPLQQFATATSR  1089
             KLAA+NPRL+FN+D+L  KE+ PA M +FP     M  E  ++A+L +N +QQ    +  
Sbjct  284   KLAAVNPRLDFNIDDLITKEMFPANMVNFP--TIGMSSEMTSSAYLQFNHVQQLLQCS--  339

Query  1090  GGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ---GWESECWQTP  1260
                  +E+  + S    +L    R+  +   S+PE + D+S F Q+Q    W+++  Q  
Sbjct  340   ----GLESSGISSPDSTLL----RRSFSTPVSVPETFADTSCFTQVQPPTTWDAD-MQNL  390

Query  1261  FNGSFH  1278
             FN  FH
Sbjct  391   FNVEFH  396



>ref|XP_010088933.1| hypothetical protein L484_018560 [Morus notabilis]
 gb|EXB37137.1| hypothetical protein L484_018560 [Morus notabilis]
Length=470

 Score =   199 bits (505),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 178/321 (55%), Gaps = 48/321 (15%)
 Frame = +1

Query  412   TGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHC----------L  561
             TG +SR+SSS    A  T    + ++ +P    +     S +KRKA+             
Sbjct  136   TGAISRTSSSPPTVAPLTPEVKSRESFSPEKTSSAAGRESFKKRKADKVNNTKGVQEDDS  195

Query  562   EDKKWEGETTDVQSEITV----KCERETsgssaskenkkssggsgEDVQKSDYIHVRARR  729
              +K+ +G   +  S+IT     K     + +  S  +         +VQK DYIHVRARR
Sbjct  196   REKRAKGSAEEGDSKITEQNSPKNNNTNANNRESSADTSKENSKASEVQKPDYIHVRARR  255

Query  730   GQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLS  909
             GQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINYVQSLQ+QVEFLS
Sbjct  256   GQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEFLS  315

Query  910   MKLAALNPRLEFNMDNLFPKEL----------------PAYMGSFPaaaaampleavnaa  1041
             MKLAA+NPRL+FN+D+LF KEL                PA  G+       M  E  N+ 
Sbjct  316   MKLAAVNPRLDFNIDDLFAKELLIIVIFLKQITIKQMFPACAGAGGFQTLGMSAEMSNSP  375

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L +NP QQ  +    GG   +E  M   D+ +      R+  +   SIPE +LD+S + 
Sbjct  376   YLQFNPAQQVVSC---GG---LEMGMNSHDMGL------RRTISAPVSIPETFLDTSCYT  423

Query  1222  QLQ---GWESE---CWQTPFN  1266
             Q+Q    W+SE    + T FN
Sbjct  424   QIQPPTTWDSELQNLYSTEFN  444



>ref|XP_007199864.1| hypothetical protein PRUPE_ppa005829mg [Prunus persica]
 gb|EMJ01063.1| hypothetical protein PRUPE_ppa005829mg [Prunus persica]
Length=441

 Score =   198 bits (503),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 140/201 (70%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  231   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  290

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+ PA   +FP     M  E  N+A+
Sbjct  291   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEMFPACAANFP--TIGMSSEMTNSAY  348

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF--  1218
             + +NP+QQ  +      +  ++  +  SD+ +      R+  +   SIPE +LD+S F  
Sbjct  349   VQFNPVQQMVS------SCGLDMGINSSDLAL------RRTISAPVSIPETFLDTSCFTQ  396

Query  1219  -PQLQGWESECWQTPFNGSFH  1278
              P    W+++  Q  FN  F 
Sbjct  397   APPTAIWDAD-LQNLFNVEFQ  416



>gb|KHG04515.1| Transcription factor bHLH63 -like protein [Gossypium arboreum]
Length=421

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  208   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  267

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+F++DNLF K++ P  M +FP     +  E  N ++
Sbjct  268   NYVQSLQRQVEFLSMKLAAVNPRLDFDIDNLFAKDVFPPCMTNFP--TVGISSEMANPSY  325

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSSYFP  1221
             LH+NP+QQ          + +E  +   D+ +     +R  + P  +I +A +LD+S F 
Sbjct  326   LHFNPVQQVV------ACSGVEMGLNSPDIAL-----RRTISAPESTILDASFLDTSCFT  374

Query  1222  QLQ---GWESECWQTPFNGSF  1275
             Q+Q    W+ E  Q  +N +F
Sbjct  375   QIQPSPTWDVE-LQNVYNVAF  394



>ref|XP_002284113.1| PREDICTED: transcription factor bHLH63 [Vitis vinifera]
Length=456

 Score =   197 bits (501),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 136/201 (68%), Gaps = 21/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  247   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  306

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DN   KE+ PA   +FP     M  E  N ++
Sbjct  307   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDNFLAKEVFPACAANFP--TIGMSSEMTNPSY  364

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             LHY+P+QQ AT     G    E  + R+   I  P           SIP+ +LDS  F Q
Sbjct  365   LHYDPIQQVATCGVEMGINPAEIALRRT---ISAP----------VSIPDTFLDSC-FTQ  410

Query  1225  LQ---GWESECWQTPFNGSFH  1278
             +Q    W+++  Q  +   FH
Sbjct  411   IQPSSTWDAD-LQNLYGPEFH  430



>ref|XP_007046906.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOX91063.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=382

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 135/184 (73%), Gaps = 15/184 (8%)
 Frame = +1

Query  529   STRKRKAEHC----LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQ  696
             S  KRK E       +DK+ +GE  + +SE+  KC  E S +S+   +K S      +VQ
Sbjct  149   SFNKRKVEAVQDDKCKDKRIKGEV-EGESEVKTKCSTEVSRNSSKGNSKAS------EVQ  201

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  202   KPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGKAGMLDEIINYV  261

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYN  1056
             QSLQ+Q  FLSMKLAA+NP +EFN+DNL  KE PAY+ +FPAAA +  +  +    L +N
Sbjct  262   QSLQRQ--FLSMKLAAVNPSVEFNVDNLPAKEFPAYVANFPAAAKSPAMANLAC--LQFN  317

Query  1057  PLQQ  1068
             PLQ+
Sbjct  318   PLQK  321



>ref|XP_008385895.1| PREDICTED: transcription factor bHLH63-like isoform X4 [Malus 
domestica]
Length=425

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 135/201 (67%), Gaps = 20/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  217   EVQKLDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  276

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL FN+D+LF KE LP    +F      M  E  N+A+
Sbjct  277   NYVQSLQRQVEFLSMKLAAVNPRLHFNIDDLFAKEMLPTCAANF--QTIGMSSEMTNSAY  334

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  NP+QQ A+     G  S +  + R+   I  P           SIPE +LD+S F Q
Sbjct  335   LQLNPMQQLASCGLDMGLNSTDLALQRA---IRAPG----------SIPEPFLDTSCFTQ  381

Query  1225  LQG---WESECWQTPFNGSFH  1278
              Q    W+++  Q  FN  F 
Sbjct  382   AQPTAIWDAD-LQNIFNVEFQ  401



>ref|XP_008385893.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Malus 
domestica]
Length=426

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 135/202 (67%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  217   EVQKLDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  276

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMKLAA+NPRL FN+D+LF KE  LP    +F      M  E  N+A
Sbjct  277   NYVQSLQRQVEFLSMKLAAVNPRLHFNIDDLFAKEQMLPTCAANF--QTIGMSSEMTNSA  334

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L  NP+QQ A+     G  S +  + R+   I  P           SIPE +LD+S F 
Sbjct  335   YLQLNPMQQLASCGLDMGLNSTDLALQRA---IRAPG----------SIPEPFLDTSCFT  381

Query  1222  QLQG---WESECWQTPFNGSFH  1278
             Q Q    W+++  Q  FN  F 
Sbjct  382   QAQPTAIWDAD-LQNIFNVEFQ  402



>ref|XP_006469146.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Citrus 
sinensis]
Length=430

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  223   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  282

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNLF KE  P    +FP    +  +    A  
Sbjct  283   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDNLFAKEAFPVCPSNFPTIGMSSEMTHPAAYL  342

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQ--RKENNPSESIPEAYLDSSYF  1218
               +N LQQ A + S              D+ I+ P     R+  +   S PE ++DSS +
Sbjct  343   HQFNSLQQQAVSCS------------GLDLGIINPSEMGLRRTISAPVSAPETFIDSSCY  390

Query  1219  PQLQ---GWESE  1245
             P LQ    W+S+
Sbjct  391   PHLQPSSNWDSD  402



>ref|XP_006423284.1| hypothetical protein CICLE_v10028494mg [Citrus clementina]
 gb|ESR36524.1| hypothetical protein CICLE_v10028494mg [Citrus clementina]
Length=430

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  233   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  292

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNLF KE  P    +FP    +  +    A  
Sbjct  293   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDNLFAKEAFPVCPSNFPTIGMSSEMTHPAAYL  352

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQ--RKENNPSESIPEAYLDSSYF  1218
               +N LQQ A + S              D+ I+ P     R+  +   S PE ++DSS +
Sbjct  353   HQFNSLQQQAVSCS------------GLDLGIINPSEMGLRRTISAPVSAPETFIDSSCY  400

Query  1219  PQLQ---GWESE  1245
             P LQ    W+S+
Sbjct  401   PHLQPSSNWDSD  412



>ref|XP_006469145.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Citrus 
sinensis]
Length=440

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  233   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  292

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNLF KE  P    +FP    +  +    A  
Sbjct  293   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDNLFAKEAFPVCPSNFPTIGMSSEMTHPAAYL  352

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQ--RKENNPSESIPEAYLDSSYF  1218
               +N LQQ A + S              D+ I+ P     R+  +   S PE ++DSS +
Sbjct  353   HQFNSLQQQAVSCS------------GLDLGIINPSEMGLRRTISAPVSAPETFIDSSCY  400

Query  1219  PQLQ---GWESE  1245
             P LQ    W+S+
Sbjct  401   PHLQPSSNWDSD  412



>ref|XP_008236908.1| PREDICTED: transcription factor bHLH63 [Prunus mume]
Length=440

 Score =   195 bits (495),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 139/201 (69%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  230   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  289

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+ PA   +F      M  E  N+A+
Sbjct  290   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEMFPACAANF--QTIGMSSEMTNSAY  347

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF--  1218
             + +NP+QQ  +      +  ++  +  SD+ +      R+  +   SIPE +LD+S F  
Sbjct  348   VQFNPVQQMVS------SCGLDMGINSSDLAL------RRTISAPVSIPETFLDTSCFTQ  395

Query  1219  -PQLQGWESECWQTPFNGSFH  1278
              P    W+++  Q  FN  F 
Sbjct  396   APPTAIWDAD-LQNLFNVEFQ  415



>ref|XP_008385894.1| PREDICTED: transcription factor bHLH63-like isoform X3 [Malus 
domestica]
Length=426

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 133/202 (66%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  217   EVQKLDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  276

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL FN+D+LF KE LP    +F      M  E  N+A+
Sbjct  277   NYVQSLQRQVEFLSMKLAAVNPRLHFNIDDLFAKEMLPTCAANF--QTIGMSSEMTNSAY  334

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  NP+QQ A+     G  S +  + R+   I  P           SIPE +LD+S F Q
Sbjct  335   LQLNPMQQLASCGLDMGLNSTDLALQRA---IRAPG----------SIPEPFLDTSCFTQ  381

Query  1225  LQGWESECW----QTPFNGSFH  1278
              Q   +  W    Q  FN  F 
Sbjct  382   -QAQPTAIWDADLQNIFNVEFQ  402



>ref|XP_008385892.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Malus 
domestica]
Length=427

 Score =   194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 133/203 (66%), Gaps = 22/203 (11%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  217   EVQKLDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  276

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMKLAA+NPRL FN+D+LF KE  LP    +F      M  E  N+A
Sbjct  277   NYVQSLQRQVEFLSMKLAAVNPRLHFNIDDLFAKEQMLPTCAANF--QTIGMSSEMTNSA  334

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L  NP+QQ A+     G  S +  + R+   I  P           SIPE +LD+S F 
Sbjct  335   YLQLNPMQQLASCGLDMGLNSTDLALQRA---IRAPG----------SIPEPFLDTSCFT  381

Query  1222  QLQGWESECW----QTPFNGSFH  1278
             Q Q   +  W    Q  FN  F 
Sbjct  382   Q-QAQPTAIWDADLQNIFNVEFQ  403



>ref|XP_002305434.2| hypothetical protein POPTR_0004s16330g [Populus trichocarpa]
 gb|EEE85945.2| hypothetical protein POPTR_0004s16330g [Populus trichocarpa]
Length=413

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 134/190 (71%), Gaps = 17/190 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCN + GKAGMLDEII
Sbjct  202   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNNITGKAGMLDEII  261

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNLF KE  PA   +FP  A  M  +  NAA+
Sbjct  262   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDNLFAKEAFPACSTNFP--AIGMSPDMTNAAY  319

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L +NP QQ   +        ++  +   D+ +      R+  +   SIPE +LDSS F Q
Sbjct  320   LQFNPAQQQLVS-----CCGLDMGINPPDMGL------RRTTSTPVSIPETFLDSSCFTQ  368

Query  1225  LQG---WESE  1245
             +Q    W+++
Sbjct  369   IQAPPTWDAD  378



>ref|XP_009378517.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   194 bits (492),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 137/201 (68%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+ P    +FP     M  E  N+ +
Sbjct  281   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEMFPTCAANFP--TMGMSSEMTNSVY  338

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  N +QQ  +++          DM      + L   +R  + PS SIPE +LD+S F Q
Sbjct  339   LQLNTMQQLVSSSG--------LDMGLDSTDLAL---RRTISAPS-SIPEPFLDTSCFTQ  386

Query  1225  LQG---WESECWQTPFNGSFH  1278
              Q    W+++  Q  F+  F 
Sbjct  387   PQPTAIWDAD-LQNIFDVEFQ  406



>ref|XP_002313791.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE87746.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=439

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 18/200 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  228   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  287

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN DNLF +E  PA   +FP     M  +  N A+
Sbjct  288   NYVQSLQRQVEFLSMKLAAVNPRLDFNFDNLFAREAFPACSVNFP--TIGMSSDMTNPAY  345

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L +NP QQ           +   DM            +R  ++P ESIPE +LDSS F Q
Sbjct  346   LQFNPAQQQLVTCCGLDMGTDPPDM----------GLKRTTSSP-ESIPETFLDSSCFTQ  394

Query  1225  LQ---GWESECWQTPFNGSF  1275
                   W+++  Q  +N +F
Sbjct  395   AHPPPAWDAD-LQNLYNVAF  413



>ref|XP_009378515.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 136/202 (67%), Gaps = 20/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE   P    +FP     M  E  N+ 
Sbjct  281   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEQMFPTCAANFP--TMGMSSEMTNSV  338

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L  N +QQ  +++          DM      + L   +R  + PS SIPE +LD+S F 
Sbjct  339   YLQLNTMQQLVSSSG--------LDMGLDSTDLAL---RRTISAPS-SIPEPFLDTSCFT  386

Query  1222  QLQG---WESECWQTPFNGSFH  1278
             Q Q    W+++  Q  F+  F 
Sbjct  387   QPQPTAIWDAD-LQNIFDVEFQ  407



>ref|XP_002313497.2| hypothetical protein POPTR_0009s12000g [Populus trichocarpa]
 gb|EEE87452.2| hypothetical protein POPTR_0009s12000g [Populus trichocarpa]
Length=440

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 134/201 (67%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  228   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  287

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN DNLF +E   PA   +FP     M  +  N A
Sbjct  288   NYVQSLQRQVEFLSMKLAAVNPRLDFNFDNLFAREQAFPACSVNFP--TIGMSSDMTNPA  345

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L +NP QQ           +   DM            +R  ++P ESIPE +LDSS F 
Sbjct  346   YLQFNPAQQQLVTCCGLDMGTDPPDM----------GLKRTTSSP-ESIPETFLDSSCFT  394

Query  1222  QLQ---GWESECWQTPFNGSF  1275
             Q      W+++  Q  +N +F
Sbjct  395   QAHPPPAWDAD-LQNLYNVAF  414



>ref|XP_009378528.1| PREDICTED: transcription factor bHLH63-like [Pyrus x bretschneideri]
Length=430

 Score =   192 bits (488),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 128/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+ F KE+ P    +FP     M  E  N+ +
Sbjct  281   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDFFAKEMFPTCAANFP--TMGMSSEMTNSVY  338

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  N +QQ  +++          DM      + L   +R  + PS SIPE +LD+S F Q
Sbjct  339   LQLNTMQQLVSSSG--------LDMGLDSTDLAL---RRTISAPS-SIPEPFLDTSCFTQ  386

Query  1225  LQ  1230
              Q
Sbjct  387   PQ  388



>ref|XP_003603935.1| Transcription factor BEE [Medicago truncatula]
 gb|KEH36364.1| BHLH transcription factor [Medicago truncatula]
Length=398

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 146/239 (61%), Gaps = 31/239 (13%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DVQK+DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  182   DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaa--  1041
             NYVQSLQKQVEFLSMKLA +NPRL+FN+D+LF KE+      FP   A    +A+  +  
Sbjct  242   NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEV------FPNCDANASFQAMGMSTG  295

Query  1042  ------FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYL  1203
                   +L +N  QQF      GG   ++  M  SD+ +      R+  +   SIP+ ++
Sbjct  296   LNSNNPYLQFNSPQQFV---PYGG---LDAGMNPSDMGL------RRSISAPVSIPQTFI  343

Query  1204  DSSYFPQLQGWESECWQTPFNGSFH*LGNHELKVALiiiiffiypiypRLKVQNNLEIE  1380
             DSS F Q Q   S  W+    G F  L N     A          ++  L   NNL+IE
Sbjct  344   DSSCFSQ-QILPSTIWE----GDFQNLYNFNFDQARATSFPTQSQLFTGLVEANNLKIE  397



>ref|XP_011037512.1| PREDICTED: transcription factor bHLH63 isoform X1 [Populus euphratica]
Length=439

 Score =   192 bits (488),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 17/190 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCN + GKAGMLDEII
Sbjct  228   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNNITGKAGMLDEII  287

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE  PA   +FP     +  +  NAA+
Sbjct  288   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDSLFAKEAFPACSTNFP--TFGISPDMTNAAY  345

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L +NP QQ   +        ++  +   D+ +      R+  +   SIPE +LDSS F Q
Sbjct  346   LQFNPAQQQLVS-----CCGLDMGINPPDMGL------RRTTSTPVSIPETFLDSSCFTQ  394

Query  1225  LQG---WESE  1245
             +Q    W+++
Sbjct  395   IQAPPTWDAD  404



>gb|AES74186.2| BHLH transcription factor [Medicago truncatula]
Length=397

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 146/239 (61%), Gaps = 32/239 (13%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DVQK+DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  182   DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaa--  1041
             NYVQSLQKQVEFLSMKLA +NPRL+FN+D+LF KE+      FP   A    +A+  +  
Sbjct  242   NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEV------FPNCDANASFQAMGMSTG  295

Query  1042  ------FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYL  1203
                   +L +N  QQF      GG   ++  M  SD+ +      R+  +   SIP+ ++
Sbjct  296   LNSNNPYLQFNSPQQFV---PYGG---LDAGMNPSDMGL------RRSISAPVSIPQTFI  343

Query  1204  DSSYFPQLQGWESECWQTPFNGSFH*LGNHELKVALiiiiffiypiypRLKVQNNLEIE  1380
             DSS F Q+    S  W+    G F  L N     A          ++  L   NNL+IE
Sbjct  344   DSSCFSQI--LPSTIWE----GDFQNLYNFNFDQARATSFPTQSQLFTGLVEANNLKIE  396



>gb|AFK40379.1| unknown [Medicago truncatula]
Length=397

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 146/239 (61%), Gaps = 32/239 (13%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DVQK+DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  182   DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaa--  1041
             NYVQSLQKQVEFLSMKLA +NPRL+FN+D+LF KE+      FP   A    +A+  +  
Sbjct  242   NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEV------FPNCDANASFQAMGMSTG  295

Query  1042  ------FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYL  1203
                   +L +N  QQF      GG   ++  M  SD+ +      R+  +   SIP+ ++
Sbjct  296   LNSNNPYLQFNSPQQFV---PYGG---LDAGMNPSDMGL------RRSISAPVSIPQTFI  343

Query  1204  DSSYFPQLQGWESECWQTPFNGSFH*LGNHELKVALiiiiffiypiypRLKVQNNLEIE  1380
             DSS F Q+    S  W+    G F  L N     A          ++  L   NNL+IE
Sbjct  344   DSSCFSQI--LPSTIWE----GDFQNLYNFNFDQARATSFPTQSQLFTGLVEANNLKIE  396



>gb|KDP41786.1| hypothetical protein JCGZ_26804 [Jatropha curcas]
Length=434

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 156/247 (63%), Gaps = 17/247 (7%)
 Frame = +1

Query  565   DKKWEGETTDVQSEITVKCERETsgssa----skenkkssggsgEDVQKSDYIHVRARRG  732
             DK+ +G   + +S+IT K   +T+ S      +            ++QK DYIHVRARRG
Sbjct  169   DKRIKGCAEEGESKITDKTNNKTNSSKNINKENSAETSKDNSKVTEIQKPDYIHVRARRG  228

Query  733   QATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSM  912
             QATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINYVQSLQ+QVEFLSM
Sbjct  229   QATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEFLSM  288

Query  913   KLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaFLHYNPLQQFATATSR  1089
             KLAA+NPRL+FN+DNLF KE  PA + +FP     M  +  N A+L +NP+QQ      +
Sbjct  289   KLAAVNPRLDFNIDNLFAKENFPACVTNFP--TIGMSSDMTNPAYLQFNPVQQQQQHQQQ  346

Query  1090  GGAASMETDMVRSDVQIMLPHH--QRKENNPSESIPEAYLDSSYFPQLQ---GWESECWQ  1254
                 +        D+ I  P     R+  +   S+PE ++DSS F Q+Q    W+++  Q
Sbjct  347   QQLVT----CCGLDIGINNPSDIVLRRTISAPISMPEMFVDSSCFTQIQPSSTWDAD-LQ  401

Query  1255  TPFNGSF  1275
               +N +F
Sbjct  402   NLYNVAF  408



>ref|XP_011037513.1| PREDICTED: transcription factor bHLH63 isoform X2 [Populus euphratica]
Length=433

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 17/190 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCN + GKAGMLDEII
Sbjct  222   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNNITGKAGMLDEII  281

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE  PA   +FP     +  +  NAA+
Sbjct  282   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDSLFAKEAFPACSTNFP--TFGISPDMTNAAY  339

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L +NP QQ   +        ++  +   D+ +      R+  +   SIPE +LDSS F Q
Sbjct  340   LQFNPAQQQLVS-----CCGLDMGINPPDMGL------RRTTSTPVSIPETFLDSSCFTQ  388

Query  1225  LQG---WESE  1245
             +Q    W+++
Sbjct  389   IQAPPTWDAD  398



>gb|KHN25381.1| Transcription factor bHLH63 [Glycine soja]
Length=404

 Score =   190 bits (483),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 136/202 (67%), Gaps = 18/202 (9%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKAGMLDEIINY
Sbjct  187   QKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVAGKAGMLDEIINY  246

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+ P+   SFP     +    + N ++L
Sbjct  247   VQSLQRQVEFLSMKLAAVNPRLDFNIDELFAKEVFPSCAQSFPNIGIPSDMSISNNPSYL  306

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSES---IPEAYLDSSYF  1218
              +N  QQ  +    GG        + + + I  P+   + N  S S   +PE +LDSS F
Sbjct  307   QFNSAQQLVSCC--GG--------LINSMGISPPNMGLRTNIISTSTVPLPETFLDSSCF  356

Query  1219  PQL---QGWESECWQTPFNGSF  1275
              Q+     WE   +Q+ +N +F
Sbjct  357   AQILPSSNWEGGDFQSLYNVAF  378



>ref|XP_011048343.1| PREDICTED: transcription factor bHLH63-like isoform X6 [Populus 
euphratica]
Length=429

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 134/202 (66%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E   PA   +FP     M  +  N A
Sbjct  289   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREQAFPACSVNFP--TIGMSSDMTNPA  346

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYF  1218
             +L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F
Sbjct  347   YLQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCF  394

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q      W+++  Q  +N +F
Sbjct  395   TQAHPPPAWDAD-LQNLYNVAF  415



>ref|XP_003541034.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Glycine 
max]
Length=402

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 136/202 (67%), Gaps = 18/202 (9%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDL+PGCNKV GKAGMLDEIINY
Sbjct  185   QKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLIPGCNKVAGKAGMLDEIINY  244

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+ P+   SFP     +    + N ++L
Sbjct  245   VQSLQRQVEFLSMKLAAVNPRLDFNIDELFAKEVFPSCAQSFPNIGIPSDMSISNNPSYL  304

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSES---IPEAYLDSSYF  1218
              +N  QQ  +    GG        + + + I  P+   + N  S S   +PE +LDSS F
Sbjct  305   QFNSAQQLVSCC--GG--------LINSMGISPPNMGLRTNIISTSTVPLPETFLDSSCF  354

Query  1219  PQL---QGWESECWQTPFNGSF  1275
              Q+     WE   +Q+ +N +F
Sbjct  355   AQILPSSNWEGGDFQSLYNVAF  376



>ref|XP_011048325.1| PREDICTED: transcription factor bHLH63-like isoform X4 [Populus 
euphratica]
Length=440

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 134/201 (67%), Gaps = 20/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E  PA   +FP     M  +  N A+
Sbjct  289   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREAFPACSVNFP--TIGMSSDMTNPAY  346

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYFP  1221
             L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F 
Sbjct  347   LQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCFT  394

Query  1222  QLQ---GWESECWQTPFNGSF  1275
             Q      W+++  Q  +N +F
Sbjct  395   QAHPPPAWDAD-LQNLYNVAF  414



>ref|XP_006592100.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Glycine 
max]
Length=403

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 136/202 (67%), Gaps = 18/202 (9%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDL+PGCNKV GKAGMLDEIINY
Sbjct  186   QKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLIPGCNKVAGKAGMLDEIINY  245

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+ P+   SFP     +    + N ++L
Sbjct  246   VQSLQRQVEFLSMKLAAVNPRLDFNIDELFAKEVFPSCAQSFPNIGIPSDMSISNNPSYL  305

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSES---IPEAYLDSSYF  1218
              +N  QQ  +    GG        + + + I  P+   + N  S S   +PE +LDSS F
Sbjct  306   QFNSAQQLVSCC--GG--------LINSMGISPPNMGLRTNIISTSTVPLPETFLDSSCF  355

Query  1219  PQL---QGWESECWQTPFNGSF  1275
              Q+     WE   +Q+ +N +F
Sbjct  356   AQILPSSNWEGGDFQSLYNVAF  377



>ref|XP_007042169.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
1 [Theobroma cacao]
 gb|EOX98000.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
1 [Theobroma cacao]
Length=440

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 138/201 (69%), Gaps = 20/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN++NLF KE+ P+   +FP     M  E  N  +
Sbjct  289   NYVQSLQRQVEFLSMKLAAVNPRLDFNVENLFAKEVFPSCTTNFP--TVGMSSEMANPPY  346

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSSYFP  1221
             L  +P+Q   +         +E  M   D   M P   R+  +   SIP+A +LDSS FP
Sbjct  347   LQVSPVQHVVS------CCGLEMGMNTPD---MAP---RRTISAPVSIPDASFLDSSCFP  394

Query  1222  QLQ---GWESECWQTPFNGSF  1275
             Q+Q    W+ E  Q  +N +F
Sbjct  395   QIQPSATWDVE-LQNLYNVAF  414



>ref|XP_011048316.1| PREDICTED: transcription factor bHLH63-like isoform X3 [Populus 
euphratica]
Length=441

 Score =   191 bits (484),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 134/202 (66%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E   PA   +FP     M  +  N A
Sbjct  289   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREQAFPACSVNFP--TIGMSSDMTNPA  346

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYF  1218
             +L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F
Sbjct  347   YLQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCF  394

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q      W+++  Q  +N +F
Sbjct  395   TQAHPPPAWDAD-LQNLYNVAF  415



>ref|XP_007046908.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOX91065.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 4 [Theobroma cacao]
Length=314

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 11/156 (7%)
 Frame = +1

Query  529  STRKRKAEHC----LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQ  696
            S  KRK E       +DK+ +GE  + +SE+  KC  E S +S+   +K S      +VQ
Sbjct  149  SFNKRKVEAVQDDKCKDKRIKGEV-EGESEVKTKCSTEVSRNSSKGNSKAS------EVQ  201

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  202  KPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGKAGMLDEIINYV  261

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY  984
            QSLQ+QVEFLSMKLAA+NP +EFN+DNL  KE P++
Sbjct  262  QSLQRQVEFLSMKLAAVNPSVEFNVDNLPAKEPPSH  297



>ref|XP_007046907.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOX91064.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=315

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 120/161 (75%), Gaps = 11/161 (7%)
 Frame = +1

Query  529  STRKRKAEHC----LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQ  696
            S  KRK E       +DK+ +GE  + +SE+  KC  E S +S+   +K S      +VQ
Sbjct  149  SFNKRKVEAVQDDKCKDKRIKGEV-EGESEVKTKCSTEVSRNSSKGNSKAS------EVQ  201

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  202  KPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGKAGMLDEIINYV  261

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            QSLQ+QVEFLSMKLAA+NP +EFN+DNL  KE P     +P
Sbjct  262  QSLQRQVEFLSMKLAAVNPSVEFNVDNLPAKEQPPSHQQWP  302



>ref|XP_011048311.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Populus 
euphratica]
Length=447

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 134/201 (67%), Gaps = 20/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E  PA   +FP     M  +  N A+
Sbjct  289   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREAFPACSVNFP--TIGMSSDMTNPAY  346

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYFP  1221
             L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F 
Sbjct  347   LQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCFT  394

Query  1222  QLQ---GWESECWQTPFNGSF  1275
             Q      W+++  Q  +N +F
Sbjct  395   QAHPPPAWDAD-LQNLYNVAF  414



>ref|XP_011048333.1| PREDICTED: transcription factor bHLH63-like isoform X5 [Populus 
euphratica]
Length=439

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 134/202 (66%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E   PA   +FP     M  +  N A
Sbjct  280   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREQAFPACSVNFP--TIGMSSDMTNPA  337

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYF  1218
             +L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F
Sbjct  338   YLQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCF  385

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q      W+++  Q  +N +F
Sbjct  386   TQAHPPPAWDAD-LQNLYNVAF  406



>ref|XP_004173629.1| PREDICTED: transcription factor bHLH63-like [Cucumis sativus]
 gb|KGN43145.1| hypothetical protein Csa_7G000520 [Cucumis sativus]
Length=456

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 18/202 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAERARREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  240   EVQKPDYIHVRARRGQATDSHSLAERARREKISERMKYLQDLVPGCNKITGKAGMLDEII  299

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---PAYMGSFPaaaaampleavna  1038
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+        +FP+           +
Sbjct  300   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDDLFNKEVFPPSCTAANFPSVGGMSSEMTDPS  359

Query  1039  aFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF  1218
             ++L +NP  Q            +E  +  S V +      R+  +   S PE +LDSS  
Sbjct  360   SYLQFNPNNQ-----QMDSCCGLEMGINTSHVAL------RRTISAPVSFPENFLDSSCL  408

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q Q   GW+ +  Q  +N  F
Sbjct  409   TQFQPSSGWDVD-LQNMYNVGF  429



>ref|XP_011048302.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Populus 
euphratica]
Length=448

 Score =   189 bits (481),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 134/202 (66%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLSMK+A +NPRL+FN+DNLF +E   PA   +FP     M  +  N A
Sbjct  289   NYVQSLQRQVEFLSMKIATVNPRLDFNVDNLFAREQAFPACSVNFP--TIGMSSDMTNPA  346

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPS-ESIPEAYLDSSYF  1218
             +L +NP QQ    T  G            D+ I  P    K    S ESIPE +LDSS F
Sbjct  347   YLQFNPAQQ-QLVTCCG-----------LDMGIDPPDMGLKRTTSSPESIPETFLDSSCF  394

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q      W+++  Q  +N +F
Sbjct  395   TQAHPPPAWDAD-LQNLYNVAF  415



>ref|XP_002266502.2| PREDICTED: transcription factor HBI1 [Vitis vinifera]
 emb|CBI17503.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   187 bits (476),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 132/198 (67%), Gaps = 19/198 (10%)
 Frame = +1

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             K DYIHVRARRGQATDSHSLAERARREKISKKMK LQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  184   KPDYIHVRARRGQATDSHSLAERARREKISKKMKYLQDLVPGCNKITGKAGMLDEIINYV  243

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaFLHY  1053
             QSLQ+QVEFLS+KLA +NPR +FN+D    KE PAY+ + FP   AA   E  N  FL +
Sbjct  244   QSLQRQVEFLSLKLATMNPRTDFNLDTFLGKEFPAYVAAGFP--TAAASSEMANLPFLQF  301

Query  1054  NPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ-  1230
              P+ Q  T+        M  D  +S +Q+          + S S+PE + +S+ F Q+Q 
Sbjct  302   QPVPQGITSCE----LHMPIDPPQSALQMT--------TSSSTSVPEMFTNSTSFSQVQP  349

Query  1231  --GWESECWQTPFNGSFH  1278
                W+++  Q+ + G F 
Sbjct  350   FTTWDTDL-QSLYTGEFQ  366



>ref|XP_006590895.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Glycine 
max]
Length=421

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 135/201 (67%), Gaps = 17/201 (8%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK +YIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKAGMLDEIINY
Sbjct  205   QKPEYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVAGKAGMLDEIINY  264

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+ P+   SFP          + N ++L
Sbjct  265   VQSLQRQVEFLSMKLAAVNPRLDFNLDELFTKEVFPSCAQSFPNIGMPLDMSMSNNPSYL  324

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESI--PEAYLDSSYFP  1221
              +N  QQ  +    GG        + +++ I  P+   + N  +  +  PE +LDSS F 
Sbjct  325   PFNSAQQLVSCC--GG--------LINNMGISPPNMGLRRNISTSPVPLPETFLDSSCFT  374

Query  1222  QL---QGWESECWQTPFNGSF  1275
             Q+     WE   +Q+ +N +F
Sbjct  375   QILPSSNWEGGDFQSLYNVAF  395



>ref|XP_002512912.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49415.1| conserved hypothetical protein [Ricinus communis]
Length=444

 Score =   189 bits (480),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 139/203 (68%), Gaps = 16/203 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  225   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  284

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+DNL  KE  P    +FP  A  +  +  N A+
Sbjct  285   NYVQSLQRQVEFLSMKLAAVNPRLDFNIDNLIAKETFPPCPTNFP--AIGLSSDMTNPAY  342

Query  1045  LHYNPLQQFATATSRGG---AASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
             L +NP+QQ      +        ++  +   D+ I      R+  +   SIPE+Y+DSS 
Sbjct  343   LQFNPVQQQQQQQQQQQLVTCCGLDMGINNPDMGI------RRTISAPVSIPESYIDSSC  396

Query  1216  FPQLQG---WESECWQTPFNGSF  1275
             F Q+Q    W+++  Q  +N +F
Sbjct  397   FNQIQSSSTWDAD-LQNLYNVAF  418



>ref|XP_003537877.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Glycine 
max]
 gb|KHN39787.1| Transcription factor bHLH49 [Glycine soja]
Length=420

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 135/201 (67%), Gaps = 17/201 (8%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK +YIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKAGMLDEIINY
Sbjct  204   QKPEYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVAGKAGMLDEIINY  263

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+ P+   SFP          + N ++L
Sbjct  264   VQSLQRQVEFLSMKLAAVNPRLDFNLDELFTKEVFPSCAQSFPNIGMPLDMSMSNNPSYL  323

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESI--PEAYLDSSYFP  1221
              +N  QQ  +    GG        + +++ I  P+   + N  +  +  PE +LDSS F 
Sbjct  324   PFNSAQQLVSCC--GG--------LINNMGISPPNMGLRRNISTSPVPLPETFLDSSCFT  373

Query  1222  QL---QGWESECWQTPFNGSF  1275
             Q+     WE   +Q+ +N +F
Sbjct  374   QILPSSNWEGGDFQSLYNVAF  394



>ref|XP_009334563.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Pyrus 
x bretschneideri]
Length=429

 Score =   188 bits (477),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 132/201 (66%), Gaps = 19/201 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKI ++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   EVQKPDYIHVRARRGQATDSHSLAERVRREKIGERMKYLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLS KLAA+NPRL+FN+D+LF KE+ P    +F      M  E  N+A+
Sbjct  280   NYVQSLQRQVEFLSTKLAAVNPRLDFNIDDLFAKEMFPTCGANF--QTIGMSSEMTNSAY  337

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L  NP+QQ          AS   DM  +   + L   +R  + P    PE +LD+S F Q
Sbjct  338   LQLNPMQQL---------ASCGLDMGLNSTDLAL---RRTISAPGSIPPEPFLDTSCFTQ  385

Query  1225  LQG---WESECWQTPFNGSFH  1278
              Q    W++   Q  FN  F 
Sbjct  386   AQPTAIWDAG-LQNIFNVEFQ  405



>gb|ACU23524.1| unknown [Glycine max]
Length=402

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 135/202 (67%), Gaps = 18/202 (9%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDL+PGCNKV GKAGMLDEIINY
Sbjct  185   QKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLIPGCNKVAGKAGMLDEIINY  244

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaa-ampleavnaaFL  1047
             VQSLQ+QVEFLSMKLAA+NP L+FN+D LF KE+ P+   SFP     +    + N ++L
Sbjct  245   VQSLQRQVEFLSMKLAAVNPGLDFNIDELFAKEVFPSCAQSFPNIGIPSDMSISNNPSYL  304

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSES---IPEAYLDSSYF  1218
              +N  QQ  +    GG        + + + I  P+   + N  S S   +PE +LDSS F
Sbjct  305   QFNSAQQLVSCC--GG--------LINSMGISPPNMGLRTNIISTSTVPLPETFLDSSCF  354

Query  1219  PQL---QGWESECWQTPFNGSF  1275
              Q+     WE   +Q+ +N +F
Sbjct  355   AQILPSSNWEGGDFQSLYNVAF  376



>ref|XP_009334562.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Pyrus 
x bretschneideri]
Length=430

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 131/202 (65%), Gaps = 20/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKI ++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   EVQKPDYIHVRARRGQATDSHSLAERVRREKIGERMKYLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLS KLAA+NPRL+FN+D+LF KE   P    +F      M  E  N+A
Sbjct  280   NYVQSLQRQVEFLSTKLAAVNPRLDFNIDDLFAKEQMFPTCGANF--QTIGMSSEMTNSA  337

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
             +L  NP+QQ          AS   DM  +   + L   +R  + P    PE +LD+S F 
Sbjct  338   YLQLNPMQQL---------ASCGLDMGLNSTDLAL---RRTISAPGSIPPEPFLDTSCFT  385

Query  1222  QLQG---WESECWQTPFNGSFH  1278
             Q Q    W++   Q  FN  F 
Sbjct  386   QAQPTAIWDAG-LQNIFNVEFQ  406



>gb|KCW63995.1| hypothetical protein EUGRSUZ_G01683 [Eucalyptus grandis]
Length=397

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/339 (42%), Positives = 184/339 (54%), Gaps = 46/339 (14%)
 Frame = +1

Query  178   NNNVSYSAADLSVLERQRAIFQRLY--QPIIHDNHL-AGAGAPAPENPFPALLDGNLTNL  348
             N  V+   +D++VLERQR  F  L+  Q ++   H  AG  A    + F  +  G + NL
Sbjct  20    NLAVAGECSDMTVLERQRTRFLWLHEQQQLLQKGHFGAGQFAAGYGDGFMMMSGGGVANL  79

Query  349   ASLWHAEENSPNAVVDVHGRE-------------------TGKLSRSSSSITAAAVPTSS  471
                   +        +V G E                   T  +SR+SS     A    +
Sbjct  80    NRHLKVDPGFLKYTSEVGGYEIPGQGFVACEIEVGTGPEITSPISRTSSCPPPPAASVDT  139

Query  472   KANDQNAT-PGGGRANGTATSTRK------RKAEHCLEDKKWEGETTDVQSEITVKCE--  624
                +  ++   G R    +   RK       K E  L+DKK++G   + +S+ T +    
Sbjct  140   GCGEMASSEKAGSRVRKDSCKKRKYDKAKDTKVEDDLKDKKFKGSAEEGESKTTEQTNDK  199

Query  625   ------RETsgssaskenkkssggsgEDVQKSDYIHVRARRGQATDSHSLAERARREKIS  786
                   RETS S++ + ++ S      +V+K DYIHVRARRGQATDSHSLAERARREKIS
Sbjct  200   DSNNNNRETSASTSKENSRVS------EVEKPDYIHVRARRGQATDSHSLAERARREKIS  253

Query  787   KKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFP  966
             ++ K LQDLVPGCNK+ GKAGMLDEIINYVQSLQ QVEFLSMKLAA+  R++FNMD L  
Sbjct  254   QRTKYLQDLVPGCNKIAGKAGMLDEIINYVQSLQGQVEFLSMKLAAVTSRVDFNMDPLLA  313

Query  967   KE-LPAYMGSFPaaaaampleavnaaFLHYNPLQQFATA  1080
             KE LP    SFP  A  +P E +NAA+L YNP  Q  + 
Sbjct  314   KEMLPNCTASFP--AIDIPTEMINAAYLQYNPAHQVVSC  350



>ref|XP_007042171.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
3 [Theobroma cacao]
 gb|EOX98002.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
3 [Theobroma cacao]
Length=418

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 130/193 (67%), Gaps = 16/193 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN++NLF KE+ P+   +FP     M  E  N  +
Sbjct  289   NYVQSLQRQVEFLSMKLAAVNPRLDFNVENLFAKEVFPSCTTNFP--TVGMSSEMANPPY  346

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSSYFP  1221
             L  +P+Q   +         +E  M   D   M P   R+  +   SIP+A +LDSS FP
Sbjct  347   LQVSPVQHVVS------CCGLEMGMNTPD---MAP---RRTISAPVSIPDASFLDSSCFP  394

Query  1222  QLQGWESECWQTP  1260
              +      C   P
Sbjct  395   VIFSAPYHCCALP  407



>ref|XP_010028604.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW55364.1| hypothetical protein EUGRSUZ_I01279 [Eucalyptus grandis]
Length=433

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 134/201 (67%), Gaps = 20/201 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DV K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  224   DVPKPDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKITGKAGMLDEII  283

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+ ++DN+F KE+ PA   SFP     M  +  N A+
Sbjct  284   NYVQSLQRQVEFLSMKLAAVNPRLDLDLDNIFAKEMNPACTASFP--TIDMLSDITNPAY  341

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L ++P Q  A+ +      + ++ + R+   I  P           SIP+ ++DSS F Q
Sbjct  342   LPFSPTQTVASCSGMEIGINPDSGLRRT---ISAPL----------SIPDTFVDSSCFSQ  388

Query  1225  LQ---GWESECWQTPFNGSFH  1278
              Q    W+    Q  +N  FH
Sbjct  389   SQQPLTWDLG-LQNLYNMEFH  408



>ref|XP_004148552.1| PREDICTED: transcription factor bHLH63-like [Cucumis sativus]
Length=523

 Score =   188 bits (478),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 18/202 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAERARREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  240   EVQKPDYIHVRARRGQATDSHSLAERARREKISERMKYLQDLVPGCNKITGKAGMLDEII  299

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---PAYMGSFPaaaaampleavna  1038
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+        +FP+           +
Sbjct  300   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDDLFNKEVFPPSCTAANFPSVGGMSSEMTDPS  359

Query  1039  aFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF  1218
             ++L +NP  Q            +E  +  S V +      R+  +   S PE +LDSS  
Sbjct  360   SYLQFNPNNQ-----QMDSCCGLEMGINTSHVAL------RRTISAPVSFPENFLDSSCL  408

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q Q   GW+ +  Q  +N  F
Sbjct  409   TQFQPSSGWDVD-LQNMYNVGF  429



>ref|XP_010263637.1| PREDICTED: transcription factor HBI1 [Nelumbo nucifera]
Length=478

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 133/203 (66%), Gaps = 23/203 (11%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +V K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  262   EVPKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  321

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE----LPAYMG-SFPaaaaampleav  1032
             NYVQSLQ+QVEFLSMKLAA+NP L+FN+DN F KE     PA  G SFP     +  E  
Sbjct  322   NYVQSLQRQVEFLSMKLAAVNPSLDFNVDNFFGKESAQTFPACNGNSFP--TVGLSSEMA  379

Query  1033  naaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQ--RKENNPSESIPEAYLD  1206
             N A+L +NP+QQ     S GG           D+ I  P     R+ ++   S+PEA+LD
Sbjct  380   NPAYLQFNPVQQ---VVSCGGL----------DMAINPPDEMTIRRTSSTPISMPEAFLD  426

Query  1207  SSYFPQLQGWESECWQTPFNGSF  1275
             ++ F Q     S  W+    G +
Sbjct  427   TTGFTQAP-HSSSSWEMDLQGLY  448



>ref|XP_007042170.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
2, partial [Theobroma cacao]
 gb|EOX98001.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
2, partial [Theobroma cacao]
Length=408

 Score =   185 bits (470),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 16/180 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN++NLF KE+ P+   +FP     M  E  N  +
Sbjct  289   NYVQSLQRQVEFLSMKLAAVNPRLDFNVENLFAKEVFPSCTTNFP--TVGMSSEMANPPY  346

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSSYFP  1221
             L  +P+Q   +         +E  M   D   M P   R+  +   SIP+A +LDSS FP
Sbjct  347   LQVSPVQHVVS------CCGLEMGMNTPD---MAP---RRTISAPVSIPDASFLDSSCFP  394



>ref|XP_010028605.1| PREDICTED: transcription factor HBI1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW55365.1| hypothetical protein EUGRSUZ_I01279 [Eucalyptus grandis]
Length=420

 Score =   186 bits (471),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 127/185 (69%), Gaps = 16/185 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DV K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  224   DVPKPDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKITGKAGMLDEII  283

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+ ++DN+F KE+ PA   SFP     M  +  N A+
Sbjct  284   NYVQSLQRQVEFLSMKLAAVNPRLDLDLDNIFAKEMNPACTASFP--TIDMLSDITNPAY  341

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L ++P Q  A+ +      + ++ + R+   I  P           SIP+ ++DSS F  
Sbjct  342   LPFSPTQTVASCSGMEIGINPDSGLRRT---ISAPL----------SIPDTFVDSSCFSN  388

Query  1225  LQGWE  1239
             L   E
Sbjct  389   LYNME  393



>ref|XP_010066167.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH63 [Eucalyptus 
grandis]
Length=448

 Score =   186 bits (472),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 141/339 (42%), Positives = 184/339 (54%), Gaps = 46/339 (14%)
 Frame = +1

Query  178   NNNVSYSAADLSVLERQRAIFQRLY--QPIIHDNHL-AGAGAPAPENPFPALLDGNLTNL  348
             N  V+   +D++VLERQR  F  L+  Q ++   H  AG  A    + F  +  G + NL
Sbjct  20    NLAVAGECSDMTVLERQRTRFLWLHEQQQLLQKGHFGAGQFAAGYGDGFMMMSGGGVANL  79

Query  349   ASLWHAEENSPNAVVDVHGRE-------------------TGKLSRSSSSITAAAVPTSS  471
                   +        +V G E                   T  +SR+SS     A    +
Sbjct  80    NRHLKVDPGFLKYTSEVGGYEIPGQGFVACEIEVGTGPEITSPISRTSSCPPPPAASVDT  139

Query  472   KANDQNAT-PGGGRANGTATSTRK------RKAEHCLEDKKWEGETTDVQSEITVKCE--  624
                +  ++   G R    +   RK       K E  L+DKK++G   + +S+ T +    
Sbjct  140   GCGEMASSEKAGSRVRKDSCKKRKYDKAKDTKVEDDLKDKKFKGSAEEGESKTTEQTNDK  199

Query  625   ------RETsgssaskenkkssggsgEDVQKSDYIHVRARRGQATDSHSLAERARREKIS  786
                   RETS S++ + ++ S      +V+K DYIHVRARRGQATDSHSLAERARREKIS
Sbjct  200   DSNNNNRETSASTSKENSRVS------EVEKPDYIHVRARRGQATDSHSLAERARREKIS  253

Query  787   KKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFP  966
             ++ K LQDLVPGCNK+ GKAGMLDEIINYVQSLQ QVEFLSMKLAA+  R++FNMD L  
Sbjct  254   QRTKYLQDLVPGCNKIAGKAGMLDEIINYVQSLQGQVEFLSMKLAAVTSRVDFNMDPLLA  313

Query  967   KE-LPAYMGSFPaaaaampleavnaaFLHYNPLQQFATA  1080
             KE LP    SFP  A  +P E +NAA+L YNP  Q  + 
Sbjct  314   KEMLPNCTASFP--AIDIPTEMINAAYLQYNPAHQVVSC  350



>ref|XP_008448085.1| PREDICTED: uncharacterized protein LOC103490373 [Cucumis melo]
Length=626

 Score =   189 bits (479),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 131/202 (65%), Gaps = 18/202 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAERARREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  410   EVQKPDYIHVRARRGQATDSHSLAERARREKISERMKYLQDLVPGCNKITGKAGMLDEII  469

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---PAYMGSFPaaaaampleavna  1038
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+        +FPA           +
Sbjct  470   NYVQSLQRQVEFLSMKLAAVNPRLDFNVDDLFNKEVFPPSCTAANFPAIGGMSSEMTDPS  529

Query  1039  aFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF  1218
             ++L +NP  Q            +E  +  S V +      R+  +   S PE +LDSS  
Sbjct  530   SYLQFNPNNQ-----QMDSCCGLEMGINTSHVAL------RRTISAPVSFPENFLDSSCL  578

Query  1219  PQLQ---GWESECWQTPFNGSF  1275
              Q Q   GW+ +  Q  +N  F
Sbjct  579   TQFQPSSGWDVD-LQNMYNVGF  599



>ref|XP_007046909.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 5 [Theobroma cacao]
 gb|EOX91066.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 5 [Theobroma cacao]
Length=361

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 11/148 (7%)
 Frame = +1

Query  529  STRKRKAEHC----LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQ  696
            S  KRK E       +DK+ +GE  + +SE+  KC  E S +S+   +K S      +VQ
Sbjct  149  SFNKRKVEAVQDDKCKDKRIKGEV-EGESEVKTKCSTEVSRNSSKGNSKAS------EVQ  201

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  202  KPDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGKAGMLDEIINYV  261

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNL  960
            QSLQ+QVEFLSMKLAA+NP +EFN+DNL
Sbjct  262  QSLQRQVEFLSMKLAAVNPSVEFNVDNL  289



>ref|XP_003522925.1| PREDICTED: transcription factor bHLH63-like [Glycine max]
Length=398

 Score =   183 bits (464),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 133/207 (64%), Gaps = 20/207 (10%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++M  LQDLVPGCNKV GKAGMLDEIINY
Sbjct  187   EKPDYIHVRARRGQATDSHSLAERVRREKISERMNYLQDLVPGCNKVTGKAGMLDEIINY  246

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavna-aFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+F+MD+LF K++ P    +FP    +     +   A+L
Sbjct  247   VQSLQRQVEFLSMKLAAVNPRLDFSMDDLFDKDVFPTCAANFPNIGMSSTSSDITNPAYL  306

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQL  1227
              +N  QQ            ++T +  SDV +      R+  +   S+PE YL SS F Q+
Sbjct  307   PFNSPQQIFQYD------GLDTGINPSDVGL------RRTISAPVSMPETYLQSSCFTQM  354

Query  1228  QGWESECWQTPFNGSFH*LGNHELKVA  1308
                 S  W+    G F  L N ++  A
Sbjct  355   --LPSSTWE----GDFQNLCNFDVDQA  375



>ref|XP_003606932.1| BHLH transcription factor [Medicago truncatula]
 gb|AES89129.1| transcription factor [Medicago truncatula]
Length=344

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 161/269 (60%), Gaps = 31/269 (12%)
 Frame = +1

Query  496   PGGGRANGTATSTRKRKAEHCLE----DKKWEGETTDVQSEIT--VKCERETsgssaske  657
             PG         + +KRKA+H ++    DK+ +    + +S+IT  +K  + T   +    
Sbjct  60    PGDLGFENVEETVKKRKADHKVDMKSKDKRIKVSVEEGESKITEQIKGNKNTKLKNRENC  119

Query  658   nkkssggsgE--DVQ--KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGC  825
             +   S  + +  ++Q  K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC
Sbjct  120   DDVGSKENSKGSEIQNHKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGC  179

Query  826   NKVVGKAGMLDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaa  1005
             NK+ GKAGMLDEIINYVQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+      F   
Sbjct  180   NKIAGKAGMLDEIINYVQSLQRQVEFLSMKLAAVNPRLDFNIDELFAKEV------FTQN  233

Query  1006  aaampleavnaaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHH--QRKENNP-  1176
                M  E  N A+L +N  QQ  +    GG        + +++ I+ P    +R  N P 
Sbjct  234   FQMMQSEMSNPAYLQFNSAQQQVSCC--GG--------LINNMGILPPEIGVRRNINAPA  283

Query  1177  SESIPEAYLDSSYFPQLQGWESECWQTPF  1263
             S S+PE +LD S F  +    S  W+  F
Sbjct  284   SASLPEIFLDPSCFTHI--LPSSTWEGDF  310



>ref|XP_004507453.1| PREDICTED: transcription factor bHLH63-like [Cicer arietinum]
Length=363

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 127/178 (71%), Gaps = 10/178 (6%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  152   QKLDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKIAGKAGMLDEIINY  211

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHY  1053
             VQSLQ+QVEFLSMKLAA+NPRL+FN+D LF KE+  +  +FP  +  M  +  N ++L++
Sbjct  212   VQSLQRQVEFLSMKLAAVNPRLDFNIDELFAKEV--FPQNFP--SIGMQSDMANPSYLNF  267

Query  1054  NPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQL  1227
             N  QQ  ++ S  G       ++  D+ I      R+  N   S+PE ++DSS F  +
Sbjct  268   NSSQQLVSSLSYCGGIINNIGLMPPDIDI------RRNINAPASLPEMFVDSSCFTHI  319



>gb|KHN33752.1| Transcription factor bHLH63 [Glycine soja]
Length=398

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 133/207 (64%), Gaps = 20/207 (10%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++M  LQDLVPGCNKV GKAGMLDEIINY
Sbjct  187   EKPDYIHVRARRGQATDSHSLAERVRREKISERMNYLQDLVPGCNKVTGKAGMLDEIINY  246

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavna-aFL  1047
             VQSLQ+QVEFLSMKLAA+NPRL+F+MD+LF K++ P    +FP    +     +   A+L
Sbjct  247   VQSLQRQVEFLSMKLAAVNPRLDFSMDDLFDKDVFPTCAANFPNIGMSSTSSDITNPAYL  306

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQL  1227
              +N  QQ            ++T +  SDV +      R+  +   S+PE YL SS F Q+
Sbjct  307   PFNSPQQIFQYD------GLDTGINPSDVGL------RRTISAPVSMPETYLQSSCFTQM  354

Query  1228  QGWESECWQTPFNGSFH*LGNHELKVA  1308
                 S  W+    G F  L N ++  A
Sbjct  355   --LPSSTWE----GDFQNLCNFDVDQA  375



>ref|XP_009378518.1| PREDICTED: transcription factor bHLH63-like isoform X3 [Pyrus 
x bretschneideri]
Length=322

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221  EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELP  978
            NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+P
Sbjct  281  NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEVP  317



>ref|XP_008377295.1| PREDICTED: transcription factor bHLH63 isoform X2 [Malus domestica]
Length=322

 Score =   180 bits (456),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  221  EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  280

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELP  978
            NYVQSLQ+QVEFLSMKLAA+NPRL+FN+D+LF KE+P
Sbjct  281  NYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEVP  317



>ref|XP_009111901.1| PREDICTED: transcription factor bHLH63-like [Brassica rapa]
Length=328

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 170/310 (55%), Gaps = 39/310 (13%)
 Frame = +1

Query  196   SAADLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEEN  375
             + AD+SVLERQRA     + P    N               + ++G   +   L  A  +
Sbjct  16    NCADMSVLERQRAQLNYHHLPGFFSN--------------SSTINGGEIDDGFLASAGLD  61

Query  376   SPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
              P    +VHG    ++S S  +IT      +   N +    G      T T     K + 
Sbjct  62    LPEIYGEVHG--DARISVSPGNIT------NESGNSKKRKFG---CVDTETKVFNEKKKM  110

Query  556   CLEDKKWEGETTDVQSEITVKCER-----ETsgssaskenkkssggsgEDVQKSDYIHVR  720
              + D++ E E  + +S+IT +  +     +             S    +D Q++DYIHVR
Sbjct  111   MMMDREVEVEEEEEKSKITEQSTKSIMKMKNKAKKEQNSCSNDSSKVTKDSQRTDYIHVR  170

Query  721   ARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVE  900
             ARRGQATDSHS+AERARREKIS++MK LQDLVPGC K+ GKAGMLDEIINYVQSLQ+QVE
Sbjct  171   ARRGQATDSHSIAERARREKISERMKFLQDLVPGCEKITGKAGMLDEIINYVQSLQRQVE  230

Query  901   FLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavn--------aaFLHY  1053
             FLSMKLA ++PRL+FN+D++F KE + A M + P +     +   +        + ++H+
Sbjct  231   FLSMKLATVSPRLDFNIDDIFAKEVVSAPMMNLPNSVMPPHMMVNSGYPHDMVNSGYVHF  290

Query  1054  NPLQQFATAT  1083
             NP+QQ  T++
Sbjct  291   NPMQQVVTSS  300



>ref|XP_006878569.1| hypothetical protein AMTR_s00011p00241810 [Amborella trichopoda]
 gb|ERM94714.1| hypothetical protein AMTR_s00011p00241810 [Amborella trichopoda]
Length=441

 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 150/246 (61%), Gaps = 25/246 (10%)
 Frame = +1

Query  559   LEDKKWEGE-TTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQ  735
             ++DK+ +GE   D   E++ +   + + +S              +VQK DYIHVRARRGQ
Sbjct  188   MKDKRIKGERDGDGDEEVSKQRRNDNNNTSEMSVETTKDSSKASEVQKPDYIHVRARRGQ  247

Query  736   ATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMK  915
             ATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINYVQSLQ+QVEFLSMK
Sbjct  248   ATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQQQVEFLSMK  307

Query  916   LAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFATATSRGG  1095
             LAA+NPRL+FN+DN F KE+ +     P  ++ +  E  +A++LH+N        T++  
Sbjct  308   LAAVNPRLDFNIDNFFTKEIFS-----PCNSSMVSPELASASYLHFN--------TAQPA  354

Query  1096  AASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQG------WESECWQT  1257
             A    T     DV I      R+  +   +IP+ +++    P  QG      W+++  Q 
Sbjct  355   AMQPVTPCCGLDVPISTTEALRRTTSGPVTIPDPFIE----PGFQGNGSLPTWDADL-QA  409

Query  1258  PFNGSF  1275
              +N  F
Sbjct  410   LYNMGF  415



>ref|XP_010432168.1| PREDICTED: transcription factor BEE 2-like isoform X1 [Camelina 
sativa]
Length=305

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 149/268 (56%), Gaps = 36/268 (13%)
 Frame = +1

Query  205  DLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPE--NPFPALLDGNLTNLASLWHAEENS  378
            DLSVL+R + + Q   Q ++    L   G+   E        L  N   L S  H +E  
Sbjct  2    DLSVLDRLKWLQQ---QQLVSPEFLQIIGSDGREELKRVETYLGNNNDELQSFRHFQEFG  58

Query  379  PNA-VVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
            P+   +D      G +SR+SS                +  P     +  A +   ++   
Sbjct  59   PDYDTID------GCISRTSSF---------------HMEPVKNNEDNRAIALHNKR---  94

Query  556  CLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQ  735
                 K EG+T   + +  +K E ET  S   K N  ++  S E +QK DYIHVRARRG+
Sbjct  95   -----KLEGKTEQREKKKKIKAEDETESSMKGKSNMSNTETSSE-IQKPDYIHVRARRGE  148

Query  736  ATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMK  915
            ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMK
Sbjct  149  ATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMK  208

Query  916  LAALNPRLEFNMDNLFPKELPAYMGSFP  999
            L+ +NP LE ++D L  K+  AY    P
Sbjct  209  LSVINPELESHIDELSAKQFQAYFTGLP  236



>ref|XP_011088410.1| PREDICTED: transcription factor bHLH63 [Sesamum indicum]
Length=426

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 127/189 (67%), Gaps = 17/189 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             DV K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  217   DVPKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  276

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+F++DN   KE+ PA   + P        E VN + 
Sbjct  277   NYVQSLQRQVEFLSMKLAAINPRLDFDIDNYLAKEIFPACTSNVP--TIGASAEMVNPSH  334

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
             L +N L    + T+         +M  + + I L    R+  +   SIP+ +LDSS   Q
Sbjct  335   LQFNSLGHELSGTA--------LEMCVNPLDITL----RRTISAPVSIPDTFLDSSSLNQ  382

Query  1225  LQ--GWESE  1245
             +Q   WE E
Sbjct  383   IQHLTWEDE  391



>ref|XP_007042174.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
6, partial [Theobroma cacao]
 gb|EOX98005.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
6, partial [Theobroma cacao]
Length=377

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 120/182 (66%), Gaps = 39/182 (21%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  229   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  288

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFL  1047
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN++NLF KE+                        
Sbjct  289   NYVQSLQRQVEFLSMKLAAVNPRLDFNVENLFAKEV------------------------  324

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSSYFPQ  1224
               +P+Q   +         +E  M   D   M P   R+  +   SIP+A +LDSS FPQ
Sbjct  325   --SPVQHVVS------CCGLEMGMNTPD---MAP---RRTISAPVSIPDASFLDSSCFPQ  370

Query  1225  LQ  1230
             +Q
Sbjct  371   IQ  372



>ref|XP_006365113.1| PREDICTED: transcription factor bHLH64-like [Solanum tuberosum]
Length=442

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 132/197 (67%), Gaps = 14/197 (7%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             D +K DYIHVRARRGQATDSHSLAER RREKIS++M+ LQDLVPGCNK+ GKAGMLDEII
Sbjct  228   DDKKLDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPGCNKITGKAGMLDEII  287

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+ ++DN F K++ A   S F    A    E ++ A 
Sbjct  288   NYVQSLQRQVEFLSMKLAAVNPRLDIDVDNFFNKDIFATSTSTFSTVGAGTSSEMLSMAQ  347

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQ  1224
               +N LQQ  +      ++ +E D++  +   +     R+  +    IPE +LDSS   Q
Sbjct  348   RQFNSLQQIMS------SSGLEMDILNLNEMAL-----RRTTSAPVPIPEMFLDSSSINQ  396

Query  1225  LQGWESECWQTPFNGSF  1275
             +Q +++  W T  +  +
Sbjct  397   VQSFQT--WDTDLDNMY  411



>ref|XP_004234555.1| PREDICTED: transcription factor BEE 2 [Solanum lycopersicum]
Length=266

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 143/262 (55%), Gaps = 60/262 (23%)
 Frame = +1

Query  208  LSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEENSPNA  387
            +S+LERQRAIF+ LY                  N  P   + NL  L SL          
Sbjct  1    MSILERQRAIFEHLY---------QCQQQQQTSNSLP---NQNLAQLNSLM---------  39

Query  388  VVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAE-----  552
                          S +++  +         D     G  + N T+   +KRK+E     
Sbjct  40   --------------SENTMEFSQFQNFPFKIDTQIDFGSEKRNWTS---KKRKSEVYEEY  82

Query  553  HCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRG  732
             C + ++ +GE  +V++E+ VK E+  +                 + + +D+IHVRARRG
Sbjct  83   EC-KVERLDGEAGEVKTEMIVKTEKGKNSKENL------------EAKNTDFIHVRARRG  129

Query  733  QATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSM  912
            QATDSHSLAERARREKISKKMKCLQDLVPGCNKV+GKAGMLDEIINYVQSLQKQVEFLS+
Sbjct  130  QATDSHSLAERARREKISKKMKCLQDLVPGCNKVIGKAGMLDEIINYVQSLQKQVEFLSI  189

Query  913  KLAALNPRLEFNMDNLFPKELP  978
            KLA  N     N DNLF KELP
Sbjct  190  KLATSN----VNTDNLFAKELP  207



>ref|XP_007136166.1| hypothetical protein PHAVU_009G023500g [Phaseolus vulgaris]
 gb|ESW08160.1| hypothetical protein PHAVU_009G023500g [Phaseolus vulgaris]
Length=404

 Score =   180 bits (456),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 127/192 (66%), Gaps = 19/192 (10%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  195   QKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINY  254

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaFLH  1050
             VQSLQ+QVEFLSMKLAA+NPRLEF++D+LF KE+ P    +FP     M  +  N+A+L 
Sbjct  255   VQSLQRQVEFLSMKLAAVNPRLEFSVDDLFEKEVFPTSAANFP--NIGMSSDLTNSAYLQ  312

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSE-SIPEAYLDSSYFPQL  1227
             +N  QQ     S GG           D  I  P    K +  +  S+PE Y  SS F Q+
Sbjct  313   FNSPQQM---VSYGGL----------DTGINPPCMGLKRSISAHVSMPETYHHSSCFTQM  359

Query  1228  QGWESECWQTPF  1263
                 S  W+  F
Sbjct  360   --LPSSAWEGDF  369



>ref|XP_003527205.1| PREDICTED: transcription factor bHLH63-like [Glycine max]
Length=384

 Score =   179 bits (454),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 144/400 (36%), Positives = 210/400 (53%), Gaps = 52/400 (13%)
 Frame = +1

Query  148   MLRCAQSSPENNNVSYSAADLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPENPFPALL  327
             ML CA +S    N++  A D++VLERQRA  +  +Q      + +G       N F  + 
Sbjct  1     MLHCANTS---GNLAV-AGDMTVLERQRARMK--WQE--EQGYFSG-------NSFNGVF  45

Query  328   DGNLTNLASLWHAEENSPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGG  507
               +  ++        +S  A+ +V  +   + + SSS     + P +    +  + P   
Sbjct  46    SSSSLHVHDSIMVAADSGCALAEVVAQAQARSTNSSSISRTFSCPPALVEPESESKPKPK  105

Query  508   RANGTATST--RKRK----------AEHCLEDKKWEGETTDVQSEITVKCERETsgssas  651
               + +      +KRK          AE+  +DK+ +  + D +S+IT      T+ ++  
Sbjct  106   PTDSSVGKDGFKKRKPDKPHHPKVVAENDNKDKRIKFGSDDGESKITKSNTTNTNTNNNK  165

Query  652   kenkkssggsgEDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK  831
             +   ++S       +K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK
Sbjct  166   ETCAETSNSKAS--EKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK  223

Query  832   VVGKAGMLDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaa  1008
             V GKAGMLDEIINYVQSLQ+QVEFLSMKLAA+NPRL+ ++D+LF K++ +   + FP   
Sbjct  224   VTGKAGMLDEIINYVQSLQRQVEFLSMKLAAVNPRLDLSIDDLFDKDVFSTCATNFPNIG  283

Query  1009  aampleavnaaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESI  1188
              +   +  N A+L +N  QQ  +             +  SD+ +      R+  +   S+
Sbjct  284   ISSTSDISNPAYLQFNSPQQIFSYDG----------LDPSDMGL------RRTISAPVSM  327

Query  1189  PEAYLDSSYFPQLQGWESECWQTPFNGSFH*LGNHELKVA  1308
             PE YL SS F Q+    S  W+    G F  L N +   A
Sbjct  328   PETYLQSSCFTQM--LPSSTWE----GDFQNLCNFDFDQA  361



>gb|ACN21632.1| putative basic helix-loop-helix protein BHLH7 [Lotus japonicus]
Length=340

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 142/230 (62%), Gaps = 21/230 (9%)
 Frame = +1

Query  547   AEHCLEDKKWEGETTDVQSEIT----VKCERETsgssaskenkkssggsgEDVQKSDYIH  714
             AE+  +DK+ + ++ D +S IT    +K  +  + S        SS     + QK DYIH
Sbjct  107   AENDSKDKRIKVDSEDGESNITGKISIKDNKTATKSKNRGTCANSSNSKENEDQKLDYIH  166

Query  715   VRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQ  894
             VRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINYVQSLQ+Q
Sbjct  167   VRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQ  226

Query  895   VEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaFLHYN-PLQQ  1068
             VEFLSMKLA +NP LEFN D+LF K + P+   +FP            A +L +N P QQ
Sbjct  227   VEFLSMKLATVNPALEFNSDDLFDKVVFPSCDSTFP-----AINLTNPATYLQFNSPPQQ  281

Query  1069  FATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF  1218
               +     G      +M  SDV +      R+  +   S+PE ++DSS +
Sbjct  282   MVSY----GGLDTGMNMNPSDVGL------RRTISAPVSVPETFIDSSCY  321



>ref|XP_004500808.1| PREDICTED: transcription factor bHLH63-like [Cicer arietinum]
Length=357

 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 132/205 (64%), Gaps = 27/205 (13%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  142   EKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINY  201

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaa----  1041
             VQSLQ+QVEFLSMKLA +NPR +FN+D+LF KE+      FP   A     A+  +    
Sbjct  202   VQSLQRQVEFLSMKLATVNPRHDFNIDDLFEKEV------FPNCDANATFSAMGISSELN  255

Query  1042  ----FLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDS  1209
                 ++ +N  QQF    S GG  +  T M  SD+ +      R+  +   S+PE ++DS
Sbjct  256   SINPYVQFNSPQQFV---SYGGLDN--TGMNPSDMGL------RRTISAPVSLPETFIDS  304

Query  1210  SYFPQLQGWESECWQTPFNGSFH*L  1284
             S F Q+    S  W+  F   ++ L
Sbjct  305   SCFSQI--LPSTTWEGDFQNLYNNL  327



>ref|XP_004230908.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Solanum 
lycopersicum]
Length=434

 Score =   180 bits (456),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 16/198 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             D +K DYIHVRARRGQATDSHSLAER RREKIS++M+ LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   DDKKLDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+ + DN F K++ A   S F A  A    E ++ A 
Sbjct  280   NYVQSLQRQVEFLSMKLAAVNPRLDIDADNFFNKDIFATSTSTFSAVGAGTSSEMLSMAQ  339

Query  1045  LHYNPLQQFATATS-RGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
               +N LQQ  +++    G  ++    +R      +P            IPE +LDSS   
Sbjct  340   RQFNSLQQIMSSSGLEMGIVNLNEMALRRTTSAPVP------------IPEMFLDSSSIN  387

Query  1222  QLQGWESECWQTPFNGSF  1275
             Q+Q +++  W T  +  +
Sbjct  388   QVQSFQT--WNTDLDNMY  403



>ref|XP_010690861.1| PREDICTED: transcription factor HBI1 [Beta vulgaris subsp. vulgaris]
Length=480

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 131/202 (65%), Gaps = 21/202 (10%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             ++ K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  270   ELDKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  329

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLA +NPRL+F++D+L  KE+  A   S P     +  +  + ++
Sbjct  330   NYVQSLQRQVEFLSMKLATVNPRLDFSIDDLIAKEVFAACSTSLP--TMGVSPDLTHPSY  387

Query  1045  LHYNPLQQF-ATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF-  1218
             L YNP++Q    + S      ++  + RS   I  P           SIPE +LD+SYF 
Sbjct  388   LQYNPIEQMDPVSVSTVAVNPIDLGLKRS---ISAP----------VSIPENFLDTSYFN  434

Query  1219  --PQLQGWESECWQTPFNGSFH  1278
               P    W+ E  Q  +N  F 
Sbjct  435   QIPNFLQWDPE-LQNIYNMDFQ  455



>ref|XP_009587041.1| PREDICTED: transcription factor bHLH63-like [Nicotiana tomentosiformis]
Length=444

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 127/195 (65%), Gaps = 14/195 (7%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++M+ LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  232   KKPDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPGCNKITGKAGMLDEIINY  291

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPaaaaampleavnaaFLH  1050
             VQSLQ+QVEFLSMKLAA+NPRL+  +DN F K++ A    +FP   A    E ++ A   
Sbjct  292   VQSLQRQVEFLSMKLAAVNPRLDIEIDNFFNKDIFATSTANFPTVGAGTSSEMLSMAQRQ  351

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
             +N LQQ  +++         ++M             R+  +   SIPE +LDSS   Q+Q
Sbjct  352   FNSLQQIVSSSGFEMGILNLSEMAL-----------RRTTSAPVSIPEIFLDSSNINQVQ  400

Query  1231  GWESECWQTPFNGSF  1275
              + +  W T  +  +
Sbjct  401   SFPT--WDTDLDNMY  413



>ref|XP_009334565.1| PREDICTED: transcription factor bHLH63-like isoform X3 [Pyrus 
x bretschneideri]
Length=406

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKI ++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   EVQKPDYIHVRARRGQATDSHSLAERVRREKIGERMKYLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--LPAYMGSFPaaaaampleavnaa  1041
             NYVQSLQ+QVEFLS KLAA+NPRL+FN+D+LF KE   P    +F      M  E  N+A
Sbjct  280   NYVQSLQRQVEFLSTKLAAVNPRLDFNIDDLFAKEQMFPTCGANF--QTIGMSSEMTNSA  337

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRS  1128
             +L  NP+QQ A+     G  S +  + R+
Sbjct  338   YLQLNPMQQLASCGLDMGLNSTDLALRRT  366



>gb|KHN20066.1| Transcription factor bHLH63 [Glycine soja]
Length=386

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 131/206 (64%), Gaps = 23/206 (11%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKAGMLDEIINY
Sbjct  180   EKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGKAGMLDEIINY  239

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaFLH  1050
             VQSLQ+QVEFLSMKLAA+NPRL+ ++D+LF K++ +   + FP    +   +  N A+L 
Sbjct  240   VQSLQRQVEFLSMKLAAVNPRLDLSIDDLFDKDVFSTCATNFPNIGISSTSDISNPAYLQ  299

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
             +N  QQ  +             +  SD+ +      R+  +   S+PE YL SS F Q+ 
Sbjct  300   FNSPQQIFSYDG----------LDPSDMGL------RRTISAPVSMPETYLQSSCFTQM-  342

Query  1231  GWESECWQTPFNGSFH*LGNHELKVA  1308
                S  W+    G F  L N +   A
Sbjct  343   -LPSSTWE----GDFQNLCNFDFDQA  363



>ref|XP_010315306.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Solanum 
lycopersicum]
Length=446

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 16/198 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             D +K DYIHVRARRGQATDSHSLAER RREKIS++M+ LQDLVPGCNK+ GKAGMLDEII
Sbjct  220   DDKKLDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPGCNKITGKAGMLDEII  279

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLAA+NPRL+ + DN F K++ A   S F A  A    E ++ A 
Sbjct  280   NYVQSLQRQVEFLSMKLAAVNPRLDIDADNFFNKDIFATSTSTFSAVGAGTSSEMLSMAQ  339

Query  1045  LHYNPLQQFATATS-RGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFP  1221
               +N LQQ  +++    G  ++    +R      +P            IPE +LDSS   
Sbjct  340   RQFNSLQQIMSSSGLEMGIVNLNEMALRRTTSAPVP------------IPEMFLDSSSIN  387

Query  1222  QLQGWESECWQTPFNGSF  1275
             Q+Q +++  W T  +  +
Sbjct  388   QVQSFQT--WNTDLDNMY  403



>emb|CDX75440.1| BnaA01g02620D [Brassica napus]
Length=329

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 9/142 (6%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             +D Q++DYIHVRARRGQATDSHS+AERARREKIS++MK LQDLVPGC K+ GKAGMLDEI
Sbjct  160   KDSQRTDYIHVRARRGQATDSHSIAERARREKISERMKFLQDLVPGCEKITGKAGMLDEI  219

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavn--  1035
             INYVQSLQ+QVEFLSMKLA ++PRL+FN+D++F KE + A M + P       +   +  
Sbjct  220   INYVQSLQRQVEFLSMKLATVSPRLDFNIDDIFAKEVVSAPMMNLPNTVMPPHMMVNSGY  279

Query  1036  ------aaFLHYNPLQQFATAT  1083
                   + ++H+NP+QQ  T++
Sbjct  280   PHDMVNSGYVHFNPMQQVVTSS  301



>ref|XP_006412217.1| hypothetical protein EUTSA_v10025748mg [Eutrema salsugineum]
 gb|ESQ53670.1| hypothetical protein EUTSA_v10025748mg [Eutrema salsugineum]
Length=320

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 120/164 (73%), Gaps = 19/164 (12%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK+DYIHVRARRGQATDSHS+AERARREKIS++MK LQDLVPGC+K+ GKAGMLDEIINY
Sbjct  152   QKTDYIHVRARRGQATDSHSIAERARREKISERMKYLQDLVPGCDKITGKAGMLDEIINY  211

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE--------LP---AYMGSFPaaaaamp  1020
             VQSLQ+QVEFLSMKLAA+NPRL+ ++D++  KE        LP     M S+    A  P
Sbjct  212   VQSLQRQVEFLSMKLAAVNPRLDLDIDDIIAKEVVSAPMTNLPLPTTVMPSYEMVNAGYP  271

Query  1021  leavnaaFLHYNPLQQFATATSR-----GGAASMETDMVRSDVQ  1137
              E VN+ +LH NP+QQ AT++ +      G A +   M  SDVQ
Sbjct  272   YEMVNSGYLHCNPMQQVATSSDQLSCFNNGEAPL---MWDSDVQ  312



>ref|XP_006411992.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
 dbj|BAJ33809.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53445.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
Length=304

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGC KV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCTKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP LEF+++ L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVLNPELEFHINELSTKQFQAYFADLP  235



>ref|XP_007042172.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
4 [Theobroma cacao]
 gb|EOX98003.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 
4 [Theobroma cacao]
Length=319

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  162  EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  221

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLAA+NPRL+FN++NLF KE+
Sbjct  222  NYVQSLQRQVEFLSMKLAAVNPRLDFNVENLFAKEV  257



>ref|XP_006411990.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
 gb|ESQ53443.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
Length=290

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGC KV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCTKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP LEF+++ L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVLNPELEFHINELSTKQFQAYFADLP  235



>ref|XP_002869033.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45292.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=304

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 147/267 (55%), Gaps = 35/267 (13%)
 Frame = +1

Query  205  DLSVLERQRAIFQRLYQPIIHDNHLAGAGAPAPE--NPFPALLDGNLTNLASLWHAEENS  378
            DLSVL+R + + Q   Q ++    L   G+   E      + L  N   L S  H  E  
Sbjct  2    DLSVLDRLKWLQQ---QQMVSPEFLQILGSDGREELKRVESYLGNNNDELQSFRHFPEFG  58

Query  379  PNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHC  558
            P+     +    G +SR+SS       P  +  +++  +    R     T  R++K    
Sbjct  59   PD-----YDTTDGCISRTSS---FQMEPVKNSGHNRAISLQNKRKPEGKTEKREKKK---  107

Query  559  LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQA  738
                              +K E ET  S   K N  ++  S E +QK DYIHVRARRG+A
Sbjct  108  ------------------IKAEDETESSMKGKTNMSNTETSSE-IQKPDYIHVRARRGEA  148

Query  739  TDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKL  918
            TD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMKL
Sbjct  149  TDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMKL  208

Query  919  AALNPRLEFNMDNLFPKELPAYMGSFP  999
            + +NP LE ++D+L  K+  AY    P
Sbjct  209  SVINPELECHIDDLSAKQFQAYFTGLP  235



>gb|KFK30277.1| hypothetical protein AALP_AA7G240400 [Arabis alpina]
Length=308

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             +K DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIIN
Sbjct  135  TEKQDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIIN  194

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKL+ +NP LEF++D L  K+  AY  + P
Sbjct  195  YVQSLQQQVEFLSMKLSVINPELEFHIDELSAKQFQAYFTNLP  237



>ref|XP_010437601.1| PREDICTED: transcription factor bHLH63-like [Camelina sativa]
Length=334

 Score =   174 bits (442),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 110/145 (76%), Gaps = 13/145 (9%)
 Frame = +1

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             +QK+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEIIN
Sbjct  161   IQKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIIN  220

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------aaa  1011
             YVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+              +
Sbjct  221   YVQSLQRQIEFLSMKLAVVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVNSGYSHEMVNS  280

Query  1012  ampleavnaaFLHYNPLQQFATATS  1086
                 E V++ +LH+NP+QQ  T +S
Sbjct  281   GYSNEMVSSGYLHFNPMQQVDTTSS  305



>gb|KHG11613.1| Transcription factor bHLH63 -like protein [Gossypium arboreum]
Length=438

 Score =   177 bits (449),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 125/177 (71%), Gaps = 16/177 (9%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK D+IHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  219   EVQKPDFIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  278

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFPaaaaampleavnaaF  1044
             NYVQSLQ+QVEFLSMKLA +NPRL+F++DNL+ KE+  +   +FP     M  E  N ++
Sbjct  279   NYVQSLQRQVEFLSMKLATVNPRLDFSIDNLYAKEVFSSCTTNFP--TLEMAPEMANPSY  336

Query  1045  LHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEA-YLDSS  1212
             L +NP+QQ            +E  +   D+ +      R+  +   SIP+A +LDSS
Sbjct  337   LQFNPIQQVVP------CCGVEMGINSPDMTL------RRTISAPVSIPDASFLDSS  381



>ref|XP_006284188.1| hypothetical protein CARUB_v10005334mg [Capsella rubella]
 gb|EOA17086.1| hypothetical protein CARUB_v10005334mg [Capsella rubella]
Length=304

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = +1

Query  559  LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQA  738
            L++K+     T+ + +  +K E ET  S  +K +  ++  S E +QK DYIHVRARRG+A
Sbjct  90   LQNKRKPQGKTEKREKKKIKSEDETESSMKAKSHMSNTETSSE-IQKPDYIHVRARRGEA  148

Query  739  TDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKL  918
            TD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMKL
Sbjct  149  TDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMKL  208

Query  919  AALNPRLEFNMDNLFPKELPAYMGSFP  999
            + +NP LE ++D L  K+  AY    P
Sbjct  209  SVVNPELECHIDELSAKQFQAYFTGLP  235



>ref|XP_010446781.1| PREDICTED: transcription factor BEE 2-like isoform X1 [Camelina 
sativa]
Length=304

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  556  CLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQ  735
             L++K+     T+ + +  +K E ET  S   K N  ++  S E +QK DYIHVRARRG+
Sbjct  89   ALQNKRKPEGKTEKREKKKIKAEDETESSMKGKSNMSNTETSSE-IQKPDYIHVRARRGE  147

Query  736  ATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMK  915
            ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMK
Sbjct  148  ATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMK  207

Query  916  LAALNPRLEFNMDNLFPKELPAYMGSFP  999
            L+ +NP LE ++D L  K+  AY    P
Sbjct  208  LSVINPELESHIDELSAKQFQAYFTGLP  235



>emb|CDX69067.1| BnaC01g03860D [Brassica napus]
Length=340

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 109/142 (77%), Gaps = 9/142 (6%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             +D Q++DYIHVRARRGQATDSHS+AERARREKIS +MK LQDLVPGC K+ GKAGMLDEI
Sbjct  174   KDSQRTDYIHVRARRGQATDSHSIAERARREKISGRMKFLQDLVPGCEKITGKAGMLDEI  233

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavn--  1035
             INYVQSLQ+QVEFLSMKLA ++PRL+FN+D++F KE + A M + P       +   +  
Sbjct  234   INYVQSLQRQVEFLSMKLATVSPRLDFNIDDIFSKEVVSAPMMNLPNTVMPPHMMVNSGY  293

Query  1036  ------aaFLHYNPLQQFATAT  1083
                   + ++H+NP+QQ  T++
Sbjct  294   PHDMVNSGYVHFNPMQQVVTSS  315



>ref|XP_010432403.1| PREDICTED: transcription factor bHLH63-like [Camelina sativa]
Length=336

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 110/145 (76%), Gaps = 13/145 (9%)
 Frame = +1

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             +QK+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEIIN
Sbjct  163   IQKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIIN  222

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------aaa  1011
             YVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+              +
Sbjct  223   YVQSLQRQIEFLSMKLAVVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVNSGYSHEMVNS  282

Query  1012  ampleavnaaFLHYNPLQQFATATS  1086
                 E V++ +LH+NP+QQ  T +S
Sbjct  283   GYSNEMVSSGYLHFNPMQQVDTTSS  307



>ref|XP_010432169.1| PREDICTED: transcription factor BEE 2-like isoform X2 [Camelina 
sativa]
Length=303

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = +1

Query  568  KKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQATDS  747
            +K EG+T   + +  +K E ET  S   K N  ++  S E +QK DYIHVRARRG+ATD 
Sbjct  94   RKLEGKTEQREKKKKIKAEDETESSMKGKSNMSNTETSSE-IQKPDYIHVRARRGEATDR  152

Query  748  HSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKLAAL  927
            HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMKL+ +
Sbjct  153  HSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMKLSVI  212

Query  928  NPRLEFNMDNLFPKELPAYMGSFP  999
            NP LE ++D L  K+  AY    P
Sbjct  213  NPELESHIDELSAKQ--AYFTGLP  234



>ref|XP_010437337.1| PREDICTED: transcription factor BEE 2 isoform X3 [Camelina sativa]
Length=304

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELESHIDELSAKQFQAYFTGLP  235



>ref|XP_009762311.1| PREDICTED: transcription factor bHLH63-like [Nicotiana sylvestris]
Length=444

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 122/182 (67%), Gaps = 12/182 (7%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             +K DYIHVRARRGQATDSHSLAER RREKIS++M+ LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  232   KKPDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPGCNKITGKAGMLDEIINY  291

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS-FPaaaaampleavnaaFLH  1050
             VQSLQ+QVEFLSMKLAA+NPRL+ ++DN   K++ A   S FP   A    E ++ A   
Sbjct  292   VQSLQRQVEFLSMKLAAVNPRLDIDVDNFLNKDIFATSTSNFPTVGAGTSSEMLSMAQRQ  351

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
             +N LQQ  +++         ++M             R+  +   SIPE +LDSS   Q+Q
Sbjct  352   FNSLQQIVSSSGFEMGILNLSEMAL-----------RRTTSAPVSIPEIFLDSSNINQVQ  400

Query  1231  GW  1236
              +
Sbjct  401   SF  402



>ref|XP_010437335.1| PREDICTED: transcription factor BEE 2 isoform X1 [Camelina sativa]
Length=309

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  137  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  196

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D L  K+  AY    P
Sbjct  197  NYVQSLQQQVEFLSMKLSVINPELESHIDELSAKQFQAYFTGLP  240



>ref|XP_010447065.1| PREDICTED: transcription factor bHLH63-like [Camelina sativa]
Length=338

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 110/146 (75%), Gaps = 14/146 (10%)
 Frame = +1

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             +QK+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEIIN
Sbjct  164   IQKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIIN  223

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY--MGSFPa------------aa  1008
             YVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +   M   P+              
Sbjct  224   YVQSLQRQIEFLSMKLAVVNPRPDFDMDDIFAKEVASSTPMTVVPSPEMVNSGYSHEMVN  283

Query  1009  aampleavnaaFLHYNPLQQFATATS  1086
             +    E V++ +LH+NP+QQ  T +S
Sbjct  284   SGYSNEMVSSGYLHFNPMQQVDTTSS  309



>ref|XP_009112485.1| PREDICTED: transcription factor HBI1-like isoform X3 [Brassica 
rapa]
Length=282

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            +QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCN V GKAG+LDEIIN
Sbjct  124  IQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNTVTGKAGVLDEIIN  183

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKLA +NP LEF +++L  K+  AY  +FP
Sbjct  184  YVQSLQRQVEFLSMKLAVINPELEFAVEDLSVKQFQAYFTNFP  226



>gb|AAN18284.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=288

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = +1

Query  559  LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQA  738
            L++K+     T+ + +  +K E ET  S   K N  ++  S E +QK DYIHVRARRG+A
Sbjct  74   LQNKRKPEGKTEKREKKKIKAEDETEPSMKGKSNMSNTETSSE-IQKPDYIHVRARRGEA  132

Query  739  TDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMKL  918
            TD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMKL
Sbjct  133  TDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMKL  192

Query  919  AALNPRLEFNMDNLFPKELPAYMGSFP  999
            + +NP LE ++D+L  K+  AY    P
Sbjct  193  SVINPELECHIDDLSAKQFQAYFTGPP  219



>emb|CDY24785.1| BnaA08g15250D [Brassica napus]
Length=300

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREK+SKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  128  EIQKRDYIHVRARRGEATDRHSLAERARREKLSKKMKCLQDIVPGCNKVTGKAGMLDEII  187

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP LE++++ L  K+  A     P
Sbjct  188  NYVQSLQQQVEFLSMKLSVLNPELEYHINELSTKQFQACFTDLP  231



>gb|AAM61556.1| unknown [Arabidopsis thaliana]
Length=288

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  116  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  175

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  176  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPP  219



>emb|CDY46300.1| BnaA07g02010D [Brassica napus]
 emb|CDY25162.1| BnaC07g03450D [Brassica napus]
Length=337

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            + QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCNKV G+AGMLDEII
Sbjct  173  ETQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNKVTGRAGMLDEII  232

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKLA LNP LE  M++L  K+  AY  + P
Sbjct  233  NYVQSLQRQVEFLSMKLAVLNPELELAMEDLSVKQFQAYFTNLP  276



>emb|CAB16839.1| putative protein [Arabidopsis thaliana]
 emb|CAB80320.1| putative protein [Arabidopsis thaliana]
Length=300

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  128  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  187

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  188  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPP  231



>ref|XP_006383184.1| hypothetical protein POPTR_0005s12370g [Populus trichocarpa]
 gb|ERP60981.1| hypothetical protein POPTR_0005s12370g [Populus trichocarpa]
Length=300

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K+DYIHVRARRGQATDSHSLAERARREKISKKMK LQDLVPGCNK+ G+AGMLDEIINYV
Sbjct  195  KTDYIHVRARRGQATDSHSLAERARREKISKKMKSLQDLVPGCNKITGRAGMLDEIINYV  254

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            QSLQ+QVEFLSMKLAALNPR EFN+DN   KE
Sbjct  255  QSLQRQVEFLSMKLAALNPRPEFNIDNFSGKE  286



>gb|AAK96779.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15707.1| Unknown protein [Arabidopsis thaliana]
Length=304

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPP  235



>ref|XP_010531040.1| PREDICTED: transcription factor HBI1-like [Tarenaya hassleriana]
Length=338

 Score =   172 bits (437),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 128/203 (63%), Gaps = 15/203 (7%)
 Frame = +1

Query  373  NSPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAE  552
            N    +V +H    G +SR++S      V T+     +N     G   GTA + RK    
Sbjct  83   NHNTGLVPLHDAIDGCISRTNS-CRMEPVDTTGVMLKRN-----GENRGTAMNKRKS---  133

Query  553  HCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRG  732
               E K  E E TD   +I ++ E E+S    S  +   +     D+QK DYIHVRARRG
Sbjct  134  ---EIKTGE-ENTD--KKIKMEGEAESSMKGRSNISNTEASSDTSDIQKLDYIHVRARRG  187

Query  733  QATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSM  912
            QATD HSLAERARR+KISKKMKCLQDLVPGCN V GKAGMLDEIINYVQSLQ+QVEFLSM
Sbjct  188  QATDRHSLAERARRDKISKKMKCLQDLVPGCNNVTGKAGMLDEIINYVQSLQRQVEFLSM  247

Query  913  KLAALNPRLEFNMDNLFPKELPA  981
            KL+ LNP ++F++D L  K+  A
Sbjct  248  KLSVLNPAIDFDIDALSAKQFQA  270



>ref|NP_195372.1| transcription factor BEE 2 [Arabidopsis thaliana]
 sp|Q93VJ4.1|BEE2_ARATH RecName: Full=Transcription factor BEE 2; AltName: Full=Basic 
helix-loop-helix protein 58; Short=AtbHLH58; Short=bHLH 58; 
AltName: Full=Protein Brassinosteroid enhanced expression 2; 
AltName: Full=Transcription factor EN 80; AltName: Full=bHLH 
transcription factor bHLH058 [Arabidopsis thaliana]
 gb|AAK44046.1|AF370231_1 unknown protein [Arabidopsis thaliana]
 gb|AAL15228.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86669.1| transcription factor BEE 2 [Arabidopsis thaliana]
Length=304

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPP  235



>gb|AAM10947.1|AF488591_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=304

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPP  235



>ref|XP_002310242.2| hypothetical protein POPTR_0007s13020g [Populus trichocarpa]
 gb|EEE90692.2| hypothetical protein POPTR_0007s13020g [Populus trichocarpa]
Length=388

 Score =   173 bits (439),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +1

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             K+DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNK+ G+AGMLDEIINYV
Sbjct  212   KTDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKITGRAGMLDEIINYV  271

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYN  1056
             QSLQ+QVEF+SMKLAA+N R +   DN+  KE PAY+ SFPAA  +  +  +    L  N
Sbjct  272   QSLQRQVEFISMKLAAVNRRPD--TDNVSGKESPAYIASFPAATMSSTIANLPH--LQLN  327

Query  1057  PLQQFATAT  1083
              +QQ AT++
Sbjct  328   LVQQQATSS  336



>ref|XP_009102251.1| PREDICTED: transcription factor HBI1-like [Brassica rapa]
Length=337

 Score =   172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCNKV G+AGMLDEIINY
Sbjct  175  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNKVTGRAGMLDEIINY  234

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            VQSLQ+QVEFLSMKLA LNP LE  M++L  K+  AY  + P
Sbjct  235  VQSLQRQVEFLSMKLAVLNPELELAMEDLSVKQFQAYFTNLP  276



>ref|XP_009109313.1| PREDICTED: transcription factor BEE 2 [Brassica rapa]
Length=300

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREK+SKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  128  EIQKRDYIHVRARRGEATDRHSLAERARREKLSKKMKCLQDIVPGCNKVTGKAGMLDEII  187

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP L+++++ L  K+  A     P
Sbjct  188  NYVQSLQQQVEFLSMKLSVLNPELDYHINELSTKQFQACFTDLP  231



>ref|XP_009112483.1| PREDICTED: transcription factor HBI1-like isoform X1 [Brassica 
rapa]
Length=331

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            +QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCN V GKAG+LDEIIN
Sbjct  173  IQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNTVTGKAGVLDEIIN  232

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKLA +NP LEF +++L  K+  AY  +FP
Sbjct  233  YVQSLQRQVEFLSMKLAVINPELEFAVEDLSVKQFQAYFTNFP  275



>ref|XP_006283943.1| hypothetical protein CARUB_v10005062mg [Capsella rubella]
 gb|EOA16841.1| hypothetical protein CARUB_v10005062mg [Capsella rubella]
Length=375

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 111/147 (76%), Gaps = 13/147 (9%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             +++QK+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  203   KELQKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  262

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------a  1005
             INYVQSLQ+Q+EFLSMKLA +NPR +F++D++F KE+ +  M   P+             
Sbjct  263   INYVQSLQRQIEFLSMKLAVVNPRPDFDIDDIFAKEVASTPMTVVPSPEMVNSGYSHEMV  322

Query  1006  aaampleavnaaFLHYNPLQQFATATS  1086
              +    E  ++ +LH+NP+QQ  T TS
Sbjct  323   NSGYSNEMASSGYLHFNPMQQVDTTTS  349



>emb|CDY53074.1| BnaC03g76640D [Brassica napus]
Length=335

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREK+SKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  163  EIQKRDYIHVRARRGEATDRHSLAERARREKLSKKMKCLQDIVPGCNKVTGKAGMLDEII  222

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP LE++++ L  K+  A     P
Sbjct  223  NYVQSLQQQVEFLSMKLSVLNPELEYHINELSTKQFQACFTDLP  266



>gb|EPS74146.1| hypothetical protein M569_00610, partial [Genlisea aurea]
Length=101

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK+DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEIINY
Sbjct  15   QKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINY  74

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMD  954
            VQSLQ+QVE LSMKLAA++PRL+FNM+
Sbjct  75   VQSLQRQVELLSMKLAAVSPRLDFNME  101



>gb|KFK30278.1| hypothetical protein AALP_AA7G240400 [Arabis alpina]
Length=306

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             +K DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIIN
Sbjct  135  TEKQDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIIN  194

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKL+ +NP LEF++D L  K+  AY  + P
Sbjct  195  YVQSLQQQVEFLSMKLSVINPELEFHIDELSAKQ--AYFTNLP  235



>ref|XP_006411991.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
 gb|ESQ53444.1| hypothetical protein EUTSA_v10025820mg [Eutrema salsugineum]
Length=292

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGC KV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCTKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP LEF+++ L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVLNPELEFHINELSTKQ--AYFADLP  233



>emb|CAA18832.1| putative protein [Arabidopsis thaliana]
 emb|CAB80170.1| putative protein [Arabidopsis thaliana]
Length=324

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 111/146 (76%), Gaps = 13/146 (9%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             ++++K+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  162   KELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  221

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------a  1005
             INYVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+             
Sbjct  222   INYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMV  281

Query  1006  aaampleavnaaFLHYNPLQQFATAT  1083
              +    E VN+ +LH NP+QQ  T++
Sbjct  282   HSGYSSEMVNSGYLHVNPMQQVNTSS  307



>gb|AAM10952.1|AF488596_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=335

 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 111/146 (76%), Gaps = 13/146 (9%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             ++++K+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  162   KELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  221

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------a  1005
             INYVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+             
Sbjct  222   INYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMV  281

Query  1006  aaampleavnaaFLHYNPLQQFATAT  1083
              +    E VN+ +LH NP+QQ  T++
Sbjct  282   HSGYSSEMVNSGYLHVNPMQQVNTSS  307



>emb|CDO97040.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 125/189 (66%), Gaps = 16/189 (8%)
 Frame = +1

Query  688   DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
             +VQK DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNK+ GKAGMLDEII
Sbjct  222   EVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  281

Query  868   NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFL  1047
             NYVQSLQ+QVEFLSMKLAA+NPRL+FN+ ++  KE+ A +G+          E +N    
Sbjct  282   NYVQSLQRQVEFLSMKLAAINPRLDFNIGDISTKEIFA-VGTSELHTIGSTSEIINPLNY  340

Query  1048  HYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQL  1227
              ++ +QQ  +         +ET    S++ +      R+  +   SI E   DS YF Q+
Sbjct  341   PFDSIQQVVS------CCGLETGADPSEMAL------RRTISAPVSIHETLRDSPYFSQI  388

Query  1228  Q---GWESE  1245
                  W++E
Sbjct  389   HPSSTWDAE  397



>ref|NP_195179.2| cryptochrome-interacting basic-helix-loop-helix 1 [Arabidopsis 
thaliana]
 sp|Q8GY61.1|BH063_ARATH RecName: Full=Transcription factor bHLH63; AltName: Full=Basic 
helix-loop-helix protein 63; Short=AtbHLH63; Short=bHLH 63; 
AltName: Full=Protein CRYPTOCHROME INTERACTING BASIC-HELIX-LOOP-HELIX 
1; AltName: Full=Transcription factor EN 84; AltName: 
Full=bHLH transcription factor bHLH063 [Arabidopsis thaliana]
 dbj|BAC42487.1| putative bHLH transcription factor bHLH063 [Arabidopsis thaliana]
 gb|AAO63377.1| At4g34530 [Arabidopsis thaliana]
 gb|AEE86389.1| cryptochrome-interacting basic-helix-loop-helix 1 [Arabidopsis 
thaliana]
Length=335

 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 111/146 (76%), Gaps = 13/146 (9%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             ++++K+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  162   KELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  221

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------a  1005
             INYVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+             
Sbjct  222   INYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMV  281

Query  1006  aaampleavnaaFLHYNPLQQFATAT  1083
              +    E VN+ +LH NP+QQ  T++
Sbjct  282   HSGYSSEMVNSGYLHVNPMQQVNTSS  307



>ref|XP_010446782.1| PREDICTED: transcription factor BEE 2-like isoform X2 [Camelina 
sativa]
Length=302

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  556  CLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHVRARRGQ  735
             L++K+     T+ + +  +K E ET  S   K N  ++  S E +QK DYIHVRARRG+
Sbjct  89   ALQNKRKPEGKTEKREKKKIKAEDETESSMKGKSNMSNTETSSE-IQKPDYIHVRARRGE  147

Query  736  ATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQVEFLSMK  915
            ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEIINYVQSLQ+QVEFLSMK
Sbjct  148  ATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEIINYVQSLQQQVEFLSMK  207

Query  916  LAALNPRLEFNMDNLFPKELPAYMGSFP  999
            L+ +NP LE ++D L  K+  AY    P
Sbjct  208  LSVINPELESHIDELSAKQ--AYFTGLP  233



>gb|AAM53299.1| unknown protein [Arabidopsis thaliana]
Length=335

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 111/146 (76%), Gaps = 13/146 (9%)
 Frame = +1

Query  685   EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             ++++K+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  162   KELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  221

Query  865   INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY-MGSFPa------------a  1005
             INYVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+ +  M   P+             
Sbjct  222   INYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMV  281

Query  1006  aaampleavnaaFLHYNPLQQFATAT  1083
              +    E VN+ +LH NP+QQ  T++
Sbjct  282   HSGYSSEMVNSGYLHVNPMQQVNTSS  307



>emb|CDY30317.1| BnaA09g09600D [Brassica napus]
Length=331

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            +QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCN V GKAG+LDEIIN
Sbjct  173  IQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNTVTGKAGVLDEIIN  232

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKLA +NP LE  +++L  K+  AY  +FP
Sbjct  233  YVQSLQRQVEFLSMKLAVINPELELAVEDLSVKQFQAYFTNFP  275



>ref|XP_011003720.1| PREDICTED: transcription factor HBI1-like isoform X4 [Populus 
euphratica]
Length=304

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 116/163 (71%), Gaps = 8/163 (5%)
 Frame = +1

Query  514  NGTATSTRKRKAEHCL-EDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgED  690
            NG+  ++ KRKAE    E+   + +  +V S++  K   E S  S+ +  K S+      
Sbjct  148  NGSGDNSNKRKAEFVAAEECDNKIKVVEVDSKVKEKSSPEISADSSKENQKTSA------  201

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            + K+DYIHVRARRGQATDSHSLAERARREKI KKMK LQDLVPGCNK+ G+AGMLDEIIN
Sbjct  202  LPKTDYIHVRARRGQATDSHSLAERARREKIRKKMKSLQDLVPGCNKITGRAGMLDEIIN  261

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKLAAL PR EFN+DN   KE P     FP
Sbjct  262  YVQSLQRQVEFLSMKLAALYPRPEFNIDNFSGKE-PLCHQQFP  303



>ref|XP_002977203.1| hypothetical protein SELMODRAFT_106386, partial [Selaginella 
moellendorffii]
 gb|EFJ21812.1| hypothetical protein SELMODRAFT_106386, partial [Selaginella 
moellendorffii]
Length=158

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  54   DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  113

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLAA+NPRLEFN+++L  KE+
Sbjct  114  LQRQVEFLSMKLAAVNPRLEFNVESLLGKEV  144



>ref|XP_010437338.1| PREDICTED: transcription factor BEE 2 isoform X4 [Camelina sativa]
Length=302

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELESHIDELSAKQ--AYFTGLP  233



>ref|XP_002966517.1| hypothetical protein SELMODRAFT_72702, partial [Selaginella moellendorffii]
 ref|XP_002982358.1| hypothetical protein SELMODRAFT_72704, partial [Selaginella moellendorffii]
 gb|EFJ16603.1| hypothetical protein SELMODRAFT_72704, partial [Selaginella moellendorffii]
 gb|EFJ32544.1| hypothetical protein SELMODRAFT_72702, partial [Selaginella moellendorffii]
Length=102

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEIINYV
Sbjct  10   KQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYV  69

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            QSLQ+QVEFLSMKLAA+NPRL+ N+D L  KE+
Sbjct  70   QSLQRQVEFLSMKLAAVNPRLDINLDGLLTKEV  102



>ref|XP_009403910.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=364

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 124/346 (36%), Positives = 176/346 (51%), Gaps = 30/346 (9%)
 Frame = +1

Query  205   DLSVLERQRAI---FQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEEN  375
             DLSVLERQ A    +Q+  +   + N   G      +  F AL  G           E+N
Sbjct  10    DLSVLERQGACLLNWQQQGREQSNYNPRGGGYCRQMQTSFQALPSG--------CGGEKN  61

Query  376   SPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
             + +   DVHG      S     +     P    AN +  +      N ++ S+RKRKA+ 
Sbjct  62    ANHG--DVHG-SIDCFSNGWPDLANIRYPVHGAANVEETSI----TNVSSNSSRKRKADK  114

Query  556   CLEDK------KWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYIHV  717
                 K      K +     ++ E       ET   +  +     +    +   K+D IHV
Sbjct  115   SPRSKENGGGGKGDSSCKRIKEETGGGATSETGQPNKKEAASGDASKKNDKPPKTDCIHV  174

Query  718   RARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQKQV  897
             RARRGQATDSHSLAER RRE+IS++MK LQDLVPGC+K+ GKAGMLDEIINYVQSLQ+QV
Sbjct  175   RARRGQATDSHSLAERVRRERISQRMKYLQDLVPGCSKITGKAGMLDEIINYVQSLQRQV  234

Query  898   EFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQFAT  1077
             EFLSMKLA  +P ++ N+DN+F +ELP  +   P+  +        ++ L      +F +
Sbjct  235   EFLSMKLATASPLMDINIDNIFGRELPMLVQINPSCKSGSTAMIGMSSELLDQSYLRFDS  294

Query  1078  ATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
                    + ++T M  SD+ +      R+  NP  ++P+A   SS+
Sbjct  295   LQHPHPCSGLDTFMDSSDLVL------RQNVNPPVAVPDASFGSSF  334



>ref|XP_006409170.1| hypothetical protein EUTSA_v10022772mg [Eutrema salsugineum]
 dbj|BAJ34477.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50623.1| hypothetical protein EUTSA_v10022772mg [Eutrema salsugineum]
Length=342

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCNKV GKAGMLDEIINY
Sbjct  180  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNKVTGKAGMLDEIINY  239

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            VQSLQ+QVEFLSMKLA LNP LE  +++L  K+  AY  + P
Sbjct  240  VQSLQRQVEFLSMKLAVLNPELELAVEDLSVKQFQAYFTNLP  281



>ref|XP_009138432.1| PREDICTED: transcription factor BEE 2-like [Brassica rapa]
Length=280

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 8/107 (7%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            DV K DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  125  DVLKQDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  184

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMG---SFP  999
            NYVQSLQ+QVEFLSMKL+ LNP+LEF+++     EL + M    SFP
Sbjct  185  NYVQSLQQQVEFLSMKLSFLNPQLEFHIN-----ELSSMMADPRSFP  226



>ref|XP_010437336.1| PREDICTED: transcription factor BEE 2 isoform X2 [Camelina sativa]
Length=307

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  137  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  196

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D L  K+  AY    P
Sbjct  197  NYVQSLQQQVEFLSMKLSVINPELESHIDELSAKQ--AYFTGLP  238



>ref|XP_010940086.1| PREDICTED: transcription factor bHLH63-like [Elaeis guineensis]
Length=334

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 102/150 (68%), Gaps = 17/150 (11%)
 Frame = +1

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             KS+ IHVRARRGQATDSHSLAER RRE+IS++MK LQDLVPGCNK+ GKAGMLDEIINYV
Sbjct  129   KSECIHVRARRGQATDSHSLAERVRRERISERMKYLQDLVPGCNKITGKAGMLDEIINYV  188

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-----PAYMGSFPaaaaampleavnaa  1041
             QSLQ+QVEFLSMKLAA+NPRL+F++DN F +E+     P  M  F   +           
Sbjct  189   QSLQRQVEFLSMKLAAVNPRLDFHIDNFFDREIDLACNPGVMPMFDMPSK----------  238

Query  1042  FLHYNPLQQFATATSRGGAASMETDMVRSD  1131
                +NP  QF +          + DM  SD
Sbjct  239   --QWNPYIQFNSLHPTTACCGFDVDMCSSD  266



>ref|XP_011003719.1| PREDICTED: transcription factor HBI1-like isoform X3 [Populus 
euphratica]
Length=308

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +1

Query  514  NGTATSTRKRKAEHCL-EDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgED  690
            NG+  ++ KRKAE    E+   + +  +V S++  K   E S  S+ +  K S+      
Sbjct  148  NGSGDNSNKRKAEFVAAEECDNKIKVVEVDSKVKEKSSPEISADSSKENQKTSA------  201

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            + K+DYIHVRARRGQATDSHSLAERARREKI KKMK LQDLVPGCNK+ G+AGMLDEIIN
Sbjct  202  LPKTDYIHVRARRGQATDSHSLAERARREKIRKKMKSLQDLVPGCNKITGRAGMLDEIIN  261

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            YVQSLQ+QVEFLSMKLAAL PR EFN+DN   KE
Sbjct  262  YVQSLQRQVEFLSMKLAALYPRPEFNIDNFSGKE  295



>ref|XP_008810718.1| PREDICTED: transcription factor BEE 2-like isoform X1 [Phoenix 
dactylifera]
Length=375

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 115/200 (58%), Gaps = 31/200 (16%)
 Frame = +1

Query  703   DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
             DYIHVRARRGQATD HSLAER RREKIS++MK LQDLVPGCNK+ GKA MLDEIINYVQS
Sbjct  179   DYIHVRARRGQATDRHSLAERVRREKISERMKFLQDLVPGCNKITGKASMLDEIINYVQS  238

Query  883   LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---------PAYMGSFPaaaaampleavn  1035
             LQKQVEFLSMKLA+ N  LE+N+D  F KE+         PA M   P A          
Sbjct  239   LQKQVEFLSMKLASANSTLEYNIDEFFSKEMDPVSSTTCPPAGMPCEPVA----------  288

Query  1036  aaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
                L Y P      A +RGG      DM     ++ L    R+  +   ++PEA++DS Y
Sbjct  289   ---LSYLPFNNSEQAVARGGL-----DMALDHPELAL----RRTMSAPAAVPEAFMDSCY  336

Query  1216  FPQLQGWESECWQTPFNGSF  1275
                     S  W T     +
Sbjct  337   TVTTVNGSSVTWDTNMRSCY  356



>ref|XP_010254797.1| PREDICTED: transcription factor HBI1-like isoform X2 [Nelumbo 
nucifera]
Length=455

 Score =   171 bits (434),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 105/135 (78%), Gaps = 8/135 (6%)
 Frame = +1

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             V K DYIHVRARRGQATDSHSLAER RREKIS +MK LQ+LVPGCNK+ GKAGMLDEIIN
Sbjct  249   VPKPDYIHVRARRGQATDSHSLAERVRREKISDRMKYLQNLVPGCNKITGKAGMLDEIIN  308

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE------LPAYMGSFPaaaaampleav  1032
             YVQSLQ+QVEFLSMKLAA+NPR++F++DNLF KE       P   G+F  + A +  E  
Sbjct  309   YVQSLQRQVEFLSMKLAAVNPRIDFSVDNLFRKESAQTFPAPDCTGNF--STAGLSSEMA  366

Query  1033  naaFLHYNPLQQFAT  1077
             N A+L +NP+ Q  +
Sbjct  367   NPAYLQFNPVHQVVS  381



>emb|CDY42693.1| BnaA03g53460D [Brassica napus]
Length=280

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            DV K DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  125  DVLKQDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  184

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ LNP+LEF++  L    + A   SFP
Sbjct  185  NYVQSLQQQVEFLSMKLSFLNPQLEFHIHEL--SSMMADQRSFP  226



>gb|KFK40214.1| hypothetical protein AALP_AA3G345500 [Arabis alpina]
Length=332

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKK K LQDLVPGCNKV GKAGMLDEIINY
Sbjct  170  QKLDYIHVRARRGQATDRHSLAERARREKISKKYKYLQDLVPGCNKVTGKAGMLDEIINY  229

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            VQSLQ+QVEFLSMKLA +NP LE  M++L  K+  AY  + P
Sbjct  230  VQSLQRQVEFLSMKLAVINPELELAMEDLSVKQFQAYFTNLP  271



>ref|XP_010254796.1| PREDICTED: transcription factor HBI1-like isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 105/135 (78%), Gaps = 8/135 (6%)
 Frame = +1

Query  691   VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             V K DYIHVRARRGQATDSHSLAER RREKIS +MK LQ+LVPGCNK+ GKAGMLDEIIN
Sbjct  249   VPKPDYIHVRARRGQATDSHSLAERVRREKISDRMKYLQNLVPGCNKITGKAGMLDEIIN  308

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE------LPAYMGSFPaaaaampleav  1032
             YVQSLQ+QVEFLSMKLAA+NPR++F++DNLF KE       P   G+F  + A +  E  
Sbjct  309   YVQSLQRQVEFLSMKLAAVNPRIDFSVDNLFRKESAQTFPAPDCTGNF--STAGLSSEMA  366

Query  1033  naaFLHYNPLQQFAT  1077
             N A+L +NP+ Q  +
Sbjct  367   NPAYLQFNPVHQVVS  381



>ref|XP_011003717.1| PREDICTED: transcription factor HBI1-like isoform X1 [Populus 
euphratica]
Length=350

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +1

Query  514  NGTATSTRKRKAEHCL-EDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgED  690
            NG+  ++ KRKAE    E+   + +  +V S++  K   E S  S+ +  K S+      
Sbjct  148  NGSGDNSNKRKAEFVAAEECDNKIKVVEVDSKVKEKSSPEISADSSKENQKTSA------  201

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            + K+DYIHVRARRGQATDSHSLAERARREKI KKMK LQDLVPGCNK+ G+AGMLDEIIN
Sbjct  202  LPKTDYIHVRARRGQATDSHSLAERARREKIRKKMKSLQDLVPGCNKITGRAGMLDEIIN  261

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            YVQSLQ+QVEFLSMKLAAL PR EFN+DN   KE
Sbjct  262  YVQSLQRQVEFLSMKLAALYPRPEFNIDNFSGKE  295



>ref|XP_010925976.1| PREDICTED: transcription factor bHLH63-like [Elaeis guineensis]
Length=384

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 112/180 (62%), Gaps = 31/180 (17%)
 Frame = +1

Query  703   DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
             DYIHVRARRGQATD HSLAER RREKIS++M  LQDLVPGCNK+ GKA MLDEIINYVQS
Sbjct  178   DYIHVRARRGQATDRHSLAERVRREKISERMNFLQDLVPGCNKITGKASMLDEIINYVQS  237

Query  883   LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---------PAYMGSFPaaaaampleavn  1035
             LQKQVEFLSMKLA++NP LEFN D  F KE+         PA M   P  A+        
Sbjct  238   LQKQVEFLSMKLASVNPSLEFNTDEFFSKEIDPVPSTICPPAGMPCEPVDAS--------  289

Query  1036  aaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
                  Y P      A +RGG      DM   + ++ L    R+  +   ++PEA++DS +
Sbjct  290   -----YLPFDNLEQAVARGG-----LDMALDNSELAL----RRTMSAPAAVPEAFMDSCF  335



>ref|XP_011003718.1| PREDICTED: transcription factor HBI1-like isoform X2 [Populus 
euphratica]
Length=309

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +1

Query  514  NGTATSTRKRKAEHCL-EDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgED  690
            NG+  ++ KRKAE    E+   + +  +V S++  K   E S  S+ +  K S+      
Sbjct  148  NGSGDNSNKRKAEFVAAEECDNKIKVVEVDSKVKEKSSPEISADSSKENQKTSA------  201

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            + K+DYIHVRARRGQATDSHSLAERARREKI KKMK LQDLVPGCNK+ G+AGMLDEIIN
Sbjct  202  LPKTDYIHVRARRGQATDSHSLAERARREKIRKKMKSLQDLVPGCNKITGRAGMLDEIIN  261

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            YVQSLQ+QVEFLSMKLAAL PR EFN+DN   KE
Sbjct  262  YVQSLQRQVEFLSMKLAALYPRPEFNIDNFSGKE  295



>ref|NP_849508.1| transcription factor BEE 2 [Arabidopsis thaliana]
 gb|AEE86670.1| transcription factor BEE 2 [Arabidopsis thaliana]
Length=302

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRG+ATD HSLAERARREKISKKMKCLQD+VPGCNKV GKAGMLDEII
Sbjct  132  EIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKVTGKAGMLDEII  191

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ+QVEFLSMKL+ +NP LE ++D+L  K+  AY    P
Sbjct  192  NYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQ--AYFTGPP  233



>ref|XP_009112484.1| PREDICTED: transcription factor HBI1-like isoform X2 [Brassica 
rapa]
Length=329

 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            +QK DYIHVRARRGQATD HSLAERARREKISKKMK LQDLVPGCN V GKAG+LDEIIN
Sbjct  173  IQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDLVPGCNTVTGKAGVLDEIIN  232

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            YVQSLQ+QVEFLSMKLA +NP LEF +++L  K+  AY  +FP
Sbjct  233  YVQSLQRQVEFLSMKLAVINPELEFAVEDLSVKQ--AYFTNFP  273



>ref|XP_009406341.1| PREDICTED: transcription factor bHLH62-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  327  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  386

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLAALNP+L+FNM+ L PK++   +G  P
Sbjct  387  LQRQVEFLSMKLAALNPQLDFNMEALLPKDMHQVLGQLP  425



>ref|XP_002869141.1| hypothetical protein ARALYDRAFT_491205 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45400.1| hypothetical protein ARALYDRAFT_491205 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   166 bits (421),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ++++K+DYIHVRARRGQATDSHS+AER RREKIS++MK LQDLVPGC+K+ GKAGMLDEI
Sbjct  159  KELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEI  218

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            INYVQSLQ+Q+EFLSMKLA +NPR +F+MD++F KE+
Sbjct  219  INYVQSLQRQIEFLSMKLAVVNPRPDFDMDDIFDKEV  255



>ref|XP_010548320.1| PREDICTED: transcription factor HBI1-like isoform X1 [Tarenaya 
hassleriana]
Length=371

 Score =   167 bits (423),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK D+IHVRARRGQATD HSLAERARREKISKKMK LQDLVPGC+KV GKAGMLDEII
Sbjct  188  EIQKPDFIHVRARRGQATDKHSLAERARREKISKKMKFLQDLVPGCSKVTGKAGMLDEII  247

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSF  996
            NYVQSLQ+QVEFLSMKLA LNP LEF++D++  K++ +    F
Sbjct  248  NYVQSLQRQVEFLSMKLAVLNPDLEFDVDDITGKQVTSLKSRF  290



>ref|XP_002886164.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62423.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  176  EIQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  235

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            NYVQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  236  NYVQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  275



>ref|XP_011025811.1| PREDICTED: transcription factor BEE 2 [Populus euphratica]
Length=388

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = +1

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             ++DYIHVRARRGQATDSHSLAERARR KISKKMKCLQDLVPGCNK+ G+AGMLDEIINYV
Sbjct  212   QTDYIHVRARRGQATDSHSLAERARRAKISKKMKCLQDLVPGCNKITGRAGMLDEIINYV  271

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYN  1056
             QSLQ+QVEF+SMKLA +N R +   DN+  KE PAY+ SFPA   +  +  +    L  N
Sbjct  272   QSLQRQVEFISMKLADINRRPD--TDNVSRKESPAYIASFPATTMSSTIANLPH--LQLN  327

Query  1057  PLQQFATAT  1083
              +QQ AT++
Sbjct  328   LVQQQATSS  336



>ref|XP_010907240.1| PREDICTED: transcription factor bHLH62 [Elaeis guineensis]
Length=547

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  350  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  409

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA +NPRL+FNM+NL PK++
Sbjct  410  LQRQVEFLSMKLATVNPRLDFNMENLLPKDM  440



>ref|XP_010548321.1| PREDICTED: transcription factor HBI1-like isoform X2 [Tarenaya 
hassleriana]
Length=339

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK D+IHVRARRGQATD HSLAERARREKISKKMK LQDLVPGC+KV GKAGMLDEII
Sbjct  188  EIQKPDFIHVRARRGQATDKHSLAERARREKISKKMKFLQDLVPGCSKVTGKAGMLDEII  247

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            NYVQSLQ+QVEFLSMKLA LNP LEF++D++  K+
Sbjct  248  NYVQSLQRQVEFLSMKLAVLNPDLEFDVDDITGKQ  282



>ref|XP_008810719.1| PREDICTED: transcription factor BEE 2-like isoform X2 [Phoenix 
dactylifera]
Length=334

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 110/178 (62%), Gaps = 31/178 (17%)
 Frame = +1

Query  703   DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
             DYIHVRARRGQATD HSLAER RREKIS++MK LQDLVPGCNK+ GKA MLDEIINYVQS
Sbjct  179   DYIHVRARRGQATDRHSLAERVRREKISERMKFLQDLVPGCNKITGKASMLDEIINYVQS  238

Query  883   LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL---------PAYMGSFPaaaaampleavn  1035
             LQKQVEFLSMKLA+ N  LE+N+D  F KE+         PA M   P A          
Sbjct  239   LQKQVEFLSMKLASANSTLEYNIDEFFSKEMDPVSSTTCPPAGMPCEPVA----------  288

Query  1036  aaFLHYNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDS  1209
                L Y P      A +RGG      DM     ++ L    R+  +   ++PEA++DS
Sbjct  289   ---LSYLPFNNSEQAVARGG-----LDMALDHPELAL----RRTMSAPAAVPEAFMDS  334



>ref|XP_004147655.1| PREDICTED: transcription factor bHLH78-like [Cucumis sativus]
 ref|XP_004169691.1| PREDICTED: transcription factor bHLH78-like [Cucumis sativus]
 gb|KGN57243.1| hypothetical protein Csa_3G172980 [Cucumis sativus]
Length=546

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 125/208 (60%), Gaps = 27/208 (13%)
 Frame = +1

Query  412  TGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEHCLEDKKWEGETT  591
            + + SRSS+   A      S  ++QN     G      T+TRKRK+          G+  
Sbjct  239  SNRFSRSSTPENAGDSREGSSVSEQNPIGESGLKGKAETNTRKRKSVQT-------GQAK  291

Query  592  DVQSEI--------TVKCERETsgssaskenkkssggsgEDVQK------------SDYI  711
            DV++ +         +K +  T       + K  +  SG+  QK             DYI
Sbjct  292  DVKAAVENHEPNGKKIKPDEVTKKEIDGAKGKAEAKSSGDANQKQNNDSSKPPEPPKDYI  351

Query  712  HVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQK  891
            HVRARRGQATDSHSLAER RREKISK+MK LQDLVPGCNKV GKA MLDEIINYVQSLQ+
Sbjct  352  HVRARRGQATDSHSLAERVRREKISKRMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQR  411

Query  892  QVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            QVEFLSMKLA +NPR++FNM+ L PK++
Sbjct  412  QVEFLSMKLATVNPRMDFNMETLVPKDI  439



>ref|XP_001780050.1| predicted protein [Physcomitrella patens]
 gb|EDQ55153.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +D+ K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+K+ GKA MLDEI
Sbjct  59   QDLSKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKITGKAVMLDEI  118

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNL  960
            INYVQSLQ+Q+EFLSMKLAA+NPRL+++ D L
Sbjct  119  INYVQSLQRQIEFLSMKLAAVNPRLDYSYDLL  150



>gb|AAM10953.1|AF488597_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=320

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEIINY
Sbjct  161  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINY  220

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            VQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  221  VQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  258



>ref|NP_849976.1| transcription factor bHLH64 [Arabidopsis thaliana]
 sp|Q9ZPW3.3|HBI1_ARATH RecName: Full=Transcription factor HBI1; AltName: Full=Basic 
helix-loop-helix protein 64; Short=AtbHLH64; Short=bHLH 64; 
AltName: Full=Protein HOMOLOG OF BEE2 INTERACTING WITH IBH1; 
AltName: Full=Transcription factor EN 79; AltName: Full=bHLH 
transcription factor bHLH064 [Arabidopsis thaliana]
 gb|AEC06753.1| transcription factor bHLH64 [Arabidopsis thaliana]
Length=337

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEIINY
Sbjct  178  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINY  237

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            VQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  238  VQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  275



>emb|CDY51216.1| BnaC09g09710D [Brassica napus]
Length=332

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +1

Query  691  VQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
            +QK DYIHVRARRG+ATD HSLAERARREKISKKMK LQDLVPGCN V GKAG+LDEIIN
Sbjct  173  IQKLDYIHVRARRGEATDRHSLAERARREKISKKMKYLQDLVPGCNTVTGKAGVLDEIIN  232

Query  871  YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFP  999
            YVQSLQ+QVEFLSMKLA +NP LE  +++L  K+   AY  +FP
Sbjct  233  YVQSLQRQVEFLSMKLAVINPELELGVEDLSVKQFQAAYFTNFP  276



>ref|XP_009403909.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=366

 Score =   165 bits (417),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 123/348 (35%), Positives = 175/348 (50%), Gaps = 32/348 (9%)
 Frame = +1

Query  205   DLSVLERQRAI---FQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEEN  375
             DLSVLERQ A    +Q+  +   + N   G      +  F AL  G           E+N
Sbjct  10    DLSVLERQGACLLNWQQQGREQSNYNPRGGGYCRQMQTSFQALPSG--------CGGEKN  61

Query  376   SPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
             + +   DVHG      S     +     P    AN +  +      N ++ S+RKRKA+ 
Sbjct  62    ANHG--DVHG-SIDCFSNGWPDLANIRYPVHGAANVEETSI----TNVSSNSSRKRKADK  114

Query  556   C--------LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYI  711
                          K +     ++ E       ET   +  +     +    +   K+D I
Sbjct  115   SPRSKEKENGGGGKGDSSCKRIKEETGGGATSETGQPNKKEAASGDASKKNDKPPKTDCI  174

Query  712   HVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQK  891
             HVRARRGQATDSHSLAER RRE+IS++MK LQDLVPGC+K+ GKAGMLDEIINYVQSLQ+
Sbjct  175   HVRARRGQATDSHSLAERVRRERISQRMKYLQDLVPGCSKITGKAGMLDEIINYVQSLQR  234

Query  892   QVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQF  1071
             QVEFLSMKLA  +P ++ N+DN+F +ELP  +   P+  +        ++ L      +F
Sbjct  235   QVEFLSMKLATASPLMDINIDNIFGRELPMLVQINPSCKSGSTAMIGMSSELLDQSYLRF  294

Query  1072  ATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
              +       + ++T M  SD+ +      R+  NP  ++P+A   SS+
Sbjct  295   DSLQHPHPCSGLDTFMDSSDLVL------RQNVNPPVAVPDASFGSSF  336



>ref|XP_008813505.1| PREDICTED: transcription factor bHLH62-like isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   168 bits (426),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  356  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  415

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPRL+F+M+NL PK++    G  P
Sbjct  416  LQRQVEFLSMKLATVNPRLDFHMENLLPKDMHQARGPMP  454



>emb|CDY20923.1| BnaC06g01430D [Brassica napus]
Length=341

 Score =   164 bits (415),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 115/168 (68%), Gaps = 10/168 (6%)
 Frame = +1

Query  514  NGTATSTRKRKAEHCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgE--  687
            N T +S  KRK+E     K+ E E T+ + ++  + E    G S+    + SS  S E  
Sbjct  117  NRTISSKNKRKSEV----KRREEERTEKKIKVEAETESNMKGKSSMSNTEASSDTSKETS  172

Query  688  ----DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGML  855
                ++ K DYIHVR+RR QATD HSLAERARREKISKKMK LQD+VPGC KV G+AGML
Sbjct  173  KGASEIHKLDYIHVRSRRSQATDRHSLAERARREKISKKMKYLQDIVPGCKKVTGQAGML  232

Query  856  DEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            DEIINYVQSLQ Q+EFLSMKLA LNP LE ++++L+ K+L  Y  + P
Sbjct  233  DEIINYVQSLQTQIEFLSMKLAFLNPELELSVEDLYVKQLQDYFTNLP  280



>ref|XP_008813504.1| PREDICTED: transcription factor bHLH62-like isoform X1 [Phoenix 
dactylifera]
Length=573

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  356  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  415

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPRL+F+M+NL PK++    G  P
Sbjct  416  LQRQVEFLSMKLATVNPRLDFHMENLLPKDMHQARGPMP  454



>ref|XP_008809650.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Phoenix 
dactylifera]
Length=557

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  350  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  409

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLAA+NP+L+FN++NL PK++
Sbjct  410  LQRQVEFLSMKLAAVNPQLDFNVENLLPKDM  440



>ref|XP_008809649.1| PREDICTED: transcription factor bHLH78-like isoform X1 [Phoenix 
dactylifera]
Length=560

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  350  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  409

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLAA+NP+L+FN++NL PK++
Sbjct  410  LQRQVEFLSMKLAAVNPQLDFNVENLLPKDM  440



>ref|NP_001189548.1| transcription factor bHLH64 [Arabidopsis thaliana]
 gb|AEC06754.1| transcription factor bHLH64 [Arabidopsis thaliana]
Length=364

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEIINY
Sbjct  178  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINY  237

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            VQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  238  VQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  275



>ref|XP_010468729.1| PREDICTED: transcription factor HBI1-like [Camelina sativa]
Length=302

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++ K DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  140  EIPKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  199

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            NYVQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  200  NYVQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  239



>emb|CBI17295.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  259  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  318

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR++FNM+ L  KE+    GS P
Sbjct  319  LQRQVEFLSMKLATVNPRMDFNMEALLSKEIFQSRGSLP  357



>ref|XP_002965357.1| hypothetical protein SELMODRAFT_439190 [Selaginella moellendorffii]
 gb|EFJ34195.1| hypothetical protein SELMODRAFT_439190 [Selaginella moellendorffii]
Length=730

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  369  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  428

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELP  978
            LQ+QVEFLSMKLAA+NPRLEFN+++L  KE+P
Sbjct  429  LQRQVEFLSMKLAAVNPRLEFNVESLLGKEVP  460



>ref|XP_008439060.1| PREDICTED: transcription factor bHLH62-like [Cucumis melo]
Length=540

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKISK+MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  345  DYIHVRARRGQATDSHSLAERVRREKISKRMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  404

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA +NPR++FNM+ L PK++
Sbjct  405  LQRQVEFLSMKLATVNPRMDFNMETLVPKDI  435



>ref|XP_008795935.1| PREDICTED: transcription factor bHLH63-like [Phoenix dactylifera]
Length=332

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K++YIHVRARRGQATDSHSLAER RRE+IS++MK LQDLVPGC K+ GKA MLDEIINYV
Sbjct  124  KTEYIHVRARRGQATDSHSLAERVRRERISERMKYLQDLVPGCKKITGKACMLDEIINYV  183

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            QSLQ+QVEFLSMKLAA+NPRL+FN+D+ F +E+
Sbjct  184  QSLQRQVEFLSMKLAAVNPRLDFNIDDFFGREI  216



>ref|XP_001783811.1| predicted protein [Physcomitrella patens]
 gb|EDQ51403.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +++ K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEI
Sbjct  63   QNLPKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEI  122

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNL  960
            INYVQSLQ+Q+EFLSMKLAA+NPRL++  D L
Sbjct  123  INYVQSLQRQIEFLSMKLAAVNPRLDYGFDVL  154



>ref|XP_006298096.1| hypothetical protein CARUB_v10014138mg [Capsella rubella]
 gb|EOA30994.1| hypothetical protein CARUB_v10014138mg [Capsella rubella]
Length=335

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++ K DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  173  EIPKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  232

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            NYVQ LQ+QVEFLSMKLA LNP LE  M++   K+  AY 
Sbjct  233  NYVQCLQRQVEFLSMKLAVLNPELELAMEDASVKQFQAYF  272



>ref|XP_010246667.1| PREDICTED: transcription factor bHLH78 [Nelumbo nucifera]
Length=605

 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  397  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  456

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPRL+FNM++L  K++    GS P
Sbjct  457  LQRQVEFLSMKLATVNPRLDFNMESLLSKDILQSRGSLP  495



>gb|KHG20666.1| Transcription factor bHLH62 -like protein [Gossypium arboreum]
Length=518

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQ+LVPGCNKV GKA MLDEIINYVQS
Sbjct  311  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQNLVPGCNKVTGKALMLDEIINYVQS  370

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA++N RL+FNMD+L PKE+
Sbjct  371  LQRQVEFLSMKLASVNTRLDFNMDSLMPKEM  401



>ref|XP_009403911.1| PREDICTED: transcription factor bHLH63-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=360

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 125/348 (36%), Positives = 177/348 (51%), Gaps = 38/348 (11%)
 Frame = +1

Query  205   DLSVLERQRAI---FQRLYQPIIHDNHLAGAGAPAPENPFPALLDGNLTNLASLWHAEEN  375
             DLSVLERQ A    +Q+  +   + N   G      +  F AL  G           E+N
Sbjct  10    DLSVLERQGACLLNWQQQGREQSNYNPRGGGYCRQMQTSFQALPSG--------CGGEKN  61

Query  376   SPNAVVDVHGRETGKLSRSSSSITAAAVPTSSKANDQNATPGGGRANGTATSTRKRKAEH  555
             + +   DVHG      S     +     P    AN +  +      N ++ S+RKRKA+ 
Sbjct  62    ANHG--DVHG-SIDCFSNGWPDLANIRYPVHGAANVEETSI----TNVSSNSSRKRKADK  114

Query  556   C--------LEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsgEDVQKSDYI  711
                          K +     ++ E       ET   +  +     +    +   K+D I
Sbjct  115   SPRSKEKENGGGGKGDSSCKRIKEETGGGATSETGQPNKKEAASGDASKKNDKPPKTDCI  174

Query  712   HVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQSLQK  891
             HVRARRGQATDSHSLAER RRE+IS++MK LQDLVPGC+K+ GKAGMLDEIINYVQSLQ+
Sbjct  175   HVRARRGQATDSHSLAERVRRERISQRMKYLQDLVPGCSKITGKAGMLDEIINYVQSLQR  234

Query  892   QVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPLQQF  1071
             QVEFLSMKLA  +P ++ N+DN+F +E+     S   A   M  E ++ ++L ++ LQ  
Sbjct  235   QVEFLSMKLATASPLMDINIDNIFGREINPSCKSGSTAMIGMSSELLDQSYLRFDSLQHP  294

Query  1072  ATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSY  1215
                +       ++T M  SD+ +      R+  NP  ++P+A   SS+
Sbjct  295   HPCS------GLDTFMDSSDLVL------RQNVNPPVAVPDASFGSSF  330



>ref|XP_006848450.1| hypothetical protein AMTR_s00013p00245920 [Amborella trichopoda]
 gb|ERN10031.1| hypothetical protein AMTR_s00013p00245920 [Amborella trichopoda]
Length=569

 Score =   166 bits (421),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  697  KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
            K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYV
Sbjct  379  KQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  438

Query  877  QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            QSLQ+QVEFLSMKLA +NPRL+FNM+ L  K++    G+ P
Sbjct  439  QSLQRQVEFLSMKLATVNPRLDFNMEGLLSKDMLQSRGASP  479



>emb|CAN73299.1| hypothetical protein VITISV_005183 [Vitis vinifera]
Length=569

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  368  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  427

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR++FNM+ L  KE+    GS P
Sbjct  428  LQRQVEFLSMKLATVNPRMDFNMEALLSKEIFQSRGSLP  466



>gb|KDP45272.1| hypothetical protein JCGZ_15137 [Jatropha curcas]
Length=566

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  361  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  420

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA++N RL+FNMD L PK++
Sbjct  421  LQRQVEFLSMKLASVNTRLDFNMDTLIPKDI  451



>ref|XP_010489535.1| PREDICTED: transcription factor HBI1-like isoform X1 [Camelina 
sativa]
Length=341

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++ K DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  179  EIPKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  238

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            NYVQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  239  NYVQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYF  278



>ref|XP_002264969.2| PREDICTED: transcription factor bHLH77-like [Vitis vinifera]
Length=569

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  368  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  427

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR++FNM+ L  KE+    GS P
Sbjct  428  LQRQVEFLSMKLATVNPRMDFNMEALLSKEIFQSRGSLP  466



>ref|XP_011084194.1| PREDICTED: transcription factor bHLH78-like [Sesamum indicum]
Length=519

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATD+HSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  325  DYIHVRARRGQATDAHSLAERVRREKISERMKVLQDLVPGCNKVTGKAVMLDEIINYVQS  384

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR++FNM+ L  K++    GS P
Sbjct  385  LQRQVEFLSMKLATVNPRMDFNMEALMSKDMFQSRGSLP  423



>ref|XP_010414188.1| PREDICTED: transcription factor HBI1 isoform X1 [Camelina sativa]
Length=344

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++ K DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  182  EIPKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  241

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM  987
            NYVQ LQ+QVEFLSMKLA LNP LE  ++++  K+  AY 
Sbjct  242  NYVQCLQRQVEFLSMKLAVLNPDLELAVEDVSVKQFQAYF  281



>ref|XP_010685111.1| PREDICTED: transcription factor bHLH78 [Beta vulgaris subsp. 
vulgaris]
Length=583

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  703   DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
             DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEIINYVQS
Sbjct  382   DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCDKVTGKALMLDEIINYVQS  441

Query  883   LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaF-LHYNP  1059
             LQ+QVEFLSMKL+++NPRLEFNM NLF K++     S P         A       H NP
Sbjct  442   LQRQVEFLSMKLSSVNPRLEFNMGNLFSKDVIQPNCSLPHPMYPPDSLAPTHYGQTHQNP  501

Query  1060  LQQFATATS  1086
             LQ   T T+
Sbjct  502   LQDSITTTA  510



>gb|ABR16552.1| unknown [Picea sitchensis]
Length=605

 Score =   166 bits (419),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEIINYVQS
Sbjct  400  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQS  459

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPRL+FNMD L  K++    GS P
Sbjct  460  LQRQVEFLSMKLATVNPRLDFNMDGLIAKDMLQSHGSSP  498



>emb|CDY29225.1| BnaA06g25320D [Brassica napus]
Length=346

 Score =   161 bits (407),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVR+RRGQATD HSLAERARREKISKKMK LQD+VPGC KV G+AGMLDEII
Sbjct  179  EIQKLDYIHVRSRRGQATDRHSLAERARREKISKKMKYLQDIVPGCKKVTGQAGMLDEII  238

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE---LPAYMGSFP  999
            NYVQSLQ QVEFLSMKLA LN  LE  +++L+ K+   L AY  + P
Sbjct  239  NYVQSLQTQVEFLSMKLAVLNSELELAVEDLYVKQDQTLHAYFTNLP  285



>emb|CAE00874.1| TA1 protein [Oryza sativa Japonica Group]
Length=204

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRG+ATDSHSLAER RREKIS++MK LQDLVPGCNKVVGKA MLDEIINYVQS
Sbjct  70   DYIHVRARRGEATDSHSLAERVRREKISQRMKLLQDLVPGCNKVVGKAVMLDEIINYVQS  129

Query  883  LQKQVEFLSMKLAALNPRLEF-NMDNLFPKEL  975
            LQ+QVEFLSMKLA +NP+L+F N+ NL  K++
Sbjct  130  LQRQVEFLSMKLATVNPQLDFNNLPNLLAKDM  161



>ref|XP_010542232.1| PREDICTED: transcription factor bHLH49-like, partial [Tarenaya 
hassleriana]
Length=191

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K  YIH+RARRGQAT+SHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEII
Sbjct  46   DPPKEGYIHMRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEII  105

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            NYVQSLQ+QVEFLSMKLA +NP+LE N+D L  KE
Sbjct  106  NYVQSLQRQVEFLSMKLATVNPQLELNLDGLMAKE  140



>ref|XP_009757727.1| PREDICTED: transcription factor bHLH62-like [Nicotiana sylvestris]
Length=490

 Score =   164 bits (415),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  292  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  351

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA++NP L+F  +NL PK++    GS P
Sbjct  352  LQRQVEFLSMKLASVNPSLDFPAENLLPKDICQPNGSLP  390



>gb|EYU37805.1| hypothetical protein MIMGU_mgv1a007881mg [Erythranthe guttata]
Length=392

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 127/194 (65%), Gaps = 19/194 (10%)
 Frame = +1

Query  697   KSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYV  876
             K+DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+K+ GKAGMLDEIINYV
Sbjct  212   KTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCDKITGKAGMLDEIINYV  271

Query  877   QSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE-LPAYMGSFPaaaaampleavnaaFLHY  1053
             QSLQ+QVEFLSMKLA +NPRL+F+++N   K+       S P      P E ++ + L +
Sbjct  272   QSLQRQVEFLSMKLAVINPRLDFDVENYHTKQNFTGCSSSVP--TIGTPSEMMDQSLLQF  329

Query  1054  NPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYF-PQLQ  1230
             N L Q  + +          +M+ + + + L    R+  +   S+P  +LDSS    Q+Q
Sbjct  330   NSLGQEVSGSI--------LEMLVNPMDVSL----RRTISAPVSVPHPFLDSSSLNQQIQ  377

Query  1231  --GWESECWQTPFN  1266
                WE E +Q  +N
Sbjct  378   HVTWEDE-FQNIYN  390



>gb|ABK24344.1| unknown [Picea sitchensis]
Length=467

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 114/185 (62%), Gaps = 30/185 (16%)
 Frame = +1

Query  694   QKSD-YIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIIN  870
             QK D YIHVRARRGQATDSHSLAER RREKI+++MK LQDLVP CNKV GKA MLDEIIN
Sbjct  288   QKDDNYIHVRARRGQATDSHSLAERVRREKINQRMKFLQDLVPTCNKVTGKAVMLDEIIN  347

Query  871   YVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLH  1050
             YVQSLQ QVEFLSMKLA +NP+L+FN+DN F KE+    GSF         + ++  + H
Sbjct  348   YVQSLQHQVEFLSMKLATVNPKLDFNIDNFFAKEMS---GSF-------SSKGMSPTYFH  397

Query  1051  YNPLQQFATATSRGGAASMETDMVRSDVQIMLPHHQRKENNPSESIPEAYLDSSYFPQLQ  1230
              + L+Q +  T     + + + M   D   M                    D + F + +
Sbjct  398   LDQLKQASLQTVPSPGSDIPSTMSSVDSAEM-------------------FDGTNFQRQE  438

Query  1231  GWESE  1245
             GW+SE
Sbjct  439   GWDSE  443



>emb|CDP03937.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +1

Query  703   DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
             DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  308   DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  367

Query  883   LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHYNPL  1062
             LQ+QVEFLSMKLA++NPRL+ NMDN+  K+L     S P     M         L+ NP 
Sbjct  368   LQRQVEFLSMKLASVNPRLD-NMDNILSKDLYQPNASVPPPLFPMDASEPA---LYKNPS  423

Query  1063  QQFATATSRGGAAS-METDMVRSDVQIMLPH  1152
             QQ     S  G+   ++T + R+ + + LPH
Sbjct  424   QQNQELQSNNGSVDQIDTALCRT-LGLQLPH  453



>ref|XP_007028903.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY09405.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=325

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ED +K  Y+HVRARRGQATDSHSLAERARREKI+ +MK LQ+LVPGCNK+ G A +LDEI
Sbjct  183  EDAEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCNKISGTALVLDEI  242

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM-GSFP  999
            IN+VQSLQ+QVEFLSM+LAA+NPR++FN+D++F  E  + M G+FP
Sbjct  243  INHVQSLQRQVEFLSMRLAAVNPRIDFNLDSIFTAESGSLMDGNFP  288



>ref|XP_011089038.1| PREDICTED: transcription factor bHLH62 isoform X2 [Sesamum indicum]
Length=537

 Score =   164 bits (416),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  349  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  408

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA++NP L+FNMDNL  K++
Sbjct  409  LQRQVEFLSMKLASVNPGLDFNMDNLLSKDM  439



>gb|KDO70234.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=225

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K +YIHVRARRGQAT+SHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEII
Sbjct  51   DPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEII  110

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLA +NPRL+FN++ L  K++
Sbjct  111  NYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDV  146



>gb|KDO70235.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=218

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K +YIHVRARRGQAT+SHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEII
Sbjct  51   DPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEII  110

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLA +NPRL+FN++ L  K++
Sbjct  111  NYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDV  146



>ref|XP_007028902.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY09404.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=329

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ED +K  Y+HVRARRGQATDSHSLAERARREKI+ +MK LQ+LVPGCNK+ G A +LDEI
Sbjct  183  EDAEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCNKISGTALVLDEI  242

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM-GSFP  999
            IN+VQSLQ+QVEFLSM+LAA+NPR++FN+D++F  E  + M G+FP
Sbjct  243  INHVQSLQRQVEFLSMRLAAVNPRIDFNLDSIFTAESGSLMDGNFP  288



>ref|XP_010913102.1| PREDICTED: transcription factor bHLH78-like isoform X1 [Elaeis 
guineensis]
Length=550

 Score =   164 bits (416),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  354  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  413

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA +NP+L+F+M+NL PK++
Sbjct  414  LQRQVEFLSMKLATVNPQLDFSMENLLPKDM  444



>ref|XP_006363573.1| PREDICTED: transcription factor bHLH49-like [Solanum tuberosum]
Length=463

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ED  K DYIH+RARRGQAT+SHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEI
Sbjct  292  EDPPKEDYIHIRARRGQATNSHSLAERLRREKISERMKFLQDLVPGCNKVTGKAVMLDEI  351

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            INYVQSLQ+QVEFLSMKLA +NPRL+FN+D L  K++
Sbjct  352  INYVQSLQRQVEFLSMKLATINPRLDFNIDALLAKDI  388



>ref|XP_009620571.1| PREDICTED: transcription factor bHLH48-like isoform X4 [Nicotiana 
tomentosiformis]
Length=243

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +D +K  Y+HVRARRGQATDSHSLAERARREKI+ +MK LQ+LVPGCNK+ G A +LDEI
Sbjct  145  DDAEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCNKISGTAMVLDEI  204

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            IN+VQSLQ+QVEFLSM+LAA+NPR++FN+DNLF  E
Sbjct  205  INHVQSLQRQVEFLSMRLAAVNPRVDFNLDNLFAPE  240



>ref|XP_003576061.2| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
Length=323

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ED  K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVP CNKV GKA MLDEI
Sbjct  135  EDPHK-DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPSCNKVTGKAVMLDEI  193

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            INYVQSLQ+QVEFLSMKL+ +NP++EF++DN  PK+
Sbjct  194  INYVQSLQRQVEFLSMKLSTVNPQMEFDVDNFLPKD  229



>ref|XP_009621297.1| PREDICTED: transcription factor bHLH78-like isoform X1 [Nicotiana 
tomentosiformis]
Length=500

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  301  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  360

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA++NP L+F  +NL PK++    GS P
Sbjct  361  LQRQVEFLSMKLASVNPSLDFPAENLLPKDICQPNGSLP  399



>ref|XP_010913103.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  354  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  413

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKLA +NP+L+F+M+NL PK++
Sbjct  414  LQRQVEFLSMKLATVNPQLDFSMENLLPKDV  444



>ref|XP_007028901.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY09403.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=359

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            ED +K  Y+HVRARRGQATDSHSLAERARREKI+ +MK LQ+LVPGCNK+ G A +LDEI
Sbjct  183  EDAEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCNKISGTALVLDEI  242

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYM-GSFP  999
            IN+VQSLQ+QVEFLSM+LAA+NPR++FN+D++F  E  + M G+FP
Sbjct  243  INHVQSLQRQVEFLSMRLAAVNPRIDFNLDSIFTAESGSLMDGNFP  288



>ref|XP_009621298.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Nicotiana 
tomentosiformis]
Length=500

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  301  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  360

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA++NP L+F  +NL PK++    GS P
Sbjct  361  LQRQVEFLSMKLASVNPSLDFPAENLLPKDICQPNGSLP  399



>ref|XP_009771720.1| PREDICTED: transcription factor bHLH78-like [Nicotiana sylvestris]
Length=466

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            D+IHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  317  DWIHVRARRGQATDSHSLAERVRREKISQRMKFLQDLVPGCNKVTGKALMLDEIINYVQS  376

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSF  996
            LQ+QVEFLSMKLA++NPR++F++DN   K++    GSF
Sbjct  377  LQRQVEFLSMKLASVNPRMDFHIDNFLSKDICQPNGSF  414



>ref|NP_565434.1| transcription factor bHLH64 [Arabidopsis thaliana]
 gb|AAL06552.1|AF412099_1 At2g18300/T30D6.19 [Arabidopsis thaliana]
 gb|AAL77731.1| At2g18300/T30D6.19 [Arabidopsis thaliana]
 gb|AAD15506.2| expressed protein [Arabidopsis thaliana]
 gb|AEC06752.1| transcription factor bHLH64 [Arabidopsis thaliana]
Length=335

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  694  QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
            QK DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEIINY
Sbjct  178  QKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINY  237

Query  874  VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            VQ LQ+QVEFLSMKLA LNP LE  ++++  K+
Sbjct  238  VQCLQRQVEFLSMKLAVLNPELELAVEDVSVKQ  270



>emb|CDP10270.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATD+HSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  268  DYIHVRARRGQATDAHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  327

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR+EFN + L  K++    GS P
Sbjct  328  LQRQVEFLSMKLATINPRMEFNAEALVSKDVLHSRGSLP  366



>ref|XP_010673318.1| PREDICTED: transcription factor bHLH78 [Beta vulgaris subsp. 
vulgaris]
Length=520

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA +LDEIINYVQS
Sbjct  312  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKATVLDEIINYVQS  371

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGS  993
            LQ+QVEFLSMKLA +NPR+EFNM+ L  KE+    GS
Sbjct  372  LQRQVEFLSMKLATVNPRMEFNMEALLSKEMFQSRGS  408



>ref|XP_011089037.1| PREDICTED: transcription factor bHLH62 isoform X1 [Sesamum indicum]
Length=538

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  349  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  408

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKE  972
            LQ+QVEFLSMKLA++NP L+FNMDNL  K+
Sbjct  409  LQRQVEFLSMKLASVNPGLDFNMDNLLSKD  438



>ref|XP_001775637.1| predicted protein [Physcomitrella patens]
 gb|EDQ59584.1| predicted protein [Physcomitrella patens]
Length=162

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +D+ K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEI
Sbjct  66   QDLPKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEI  125

Query  865  INYVQSLQKQVEFLSMKLAALN-PRLEFNMDNLFPKEL  975
            INYVQSLQ+Q+EFLSMKLAA+N PRL+ N D L  K++
Sbjct  126  INYVQSLQRQIEFLSMKLAAVNPPRLDHNYD-LLSKDM  162



>ref|XP_010926677.1| PREDICTED: transcription factor bHLH77-like [Elaeis guineensis]
Length=514

 Score =   163 bits (412),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 1/92 (1%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  307  DYIHVRARRGQATDSHSLAERVRREKISQRMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  366

Query  883  LQKQVEFLSMKLAALNPRLEF-NMDNLFPKEL  975
            LQ+QVEFLSMKLA +NPRL+F N+ NLFPK++
Sbjct  367  LQRQVEFLSMKLATVNPRLDFNNVANLFPKDM  398



>ref|XP_009108724.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Brassica 
rapa]
Length=281

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 94/130 (72%), Gaps = 14/130 (11%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK DYIHVRARRGQATDSHS+AERARREKIS++MK LQ LVPGC+K+  KAG LDEIINY
Sbjct  137   QKRDYIHVRARRGQATDSHSIAERARREKISERMKYLQALVPGCDKITSKAGKLDEIINY  196

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFPaaaaampleavnaaFLHY  1053
             V SLQ QVEFLSMKLAALN RL+F++D +     P  + S                +LH+
Sbjct  197   VLSLQTQVEFLSMKLAALNSRLDFHIDEMVNSVYPHEIVS--------------TGYLHF  242

Query  1054  NPLQQFATAT  1083
             NP+QQ  T++
Sbjct  243   NPMQQVITSS  252



>ref|XP_010243164.1| PREDICTED: transcription factor bHLH62-like [Nelumbo nucifera]
Length=598

 Score =   164 bits (415),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  390  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKATMLDEIINYVQS  449

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NPR++FNM++L  K++     S P
Sbjct  450  LQRQVEFLSMKLATVNPRMDFNMESLLSKDILQSRASLP  488



>ref|XP_010526758.1| PREDICTED: transcription factor HBI1-like [Tarenaya hassleriana]
Length=346

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 111/166 (67%), Gaps = 13/166 (8%)
 Frame = +1

Query  523  ATSTRKRKAE------HCLEDKKWEGETTDVQSEITVKCERETsgssaskenkkssggsg  684
            AT+  KRK+E      H  +  K E ET  ++   +     ETS  ++ + +K S     
Sbjct  121  ATALNKRKSELKTGEEHTDKKIKMEAETEPIKKGKSNISNAETSSDTSKETSKAS-----  175

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
             +V+K DYIHVRARRGQATD HSLAER RREKIS KMKCLQDLVPGC+K  GKAGMLDEI
Sbjct  176  -EVRKPDYIHVRARRGQATDRHSLAERVRREKISHKMKCLQDLVPGCDKATGKAGMLDEI  234

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL-PAYMGSFP  999
            INYVQSLQ+QVEFLSMKLA LNP  EF++     K+   AY  + P
Sbjct  235  INYVQSLQRQVEFLSMKLAVLNPEQEFDIVESSAKQFQQAYFTNLP  280



>ref|XP_004248023.1| PREDICTED: transcription factor bHLH62 [Solanum lycopersicum]
Length=431

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATD+HSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  230  DYIHVRARRGQATDAHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  289

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSF  996
            LQ+QVEFLSMKLA +NPR++FNM+ L  K++    GS 
Sbjct  290  LQRQVEFLSMKLATVNPRMDFNMEALLSKDMFQSRGSL  327



>gb|KDO70232.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=253

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K +YIHVRARRGQAT+SHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEII
Sbjct  51   DPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEII  110

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLA +NPRL+FN++ L  K++
Sbjct  111  NYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDV  146



>ref|XP_007201182.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica]
 gb|EMJ02381.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica]
Length=583

 Score =   164 bits (414),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  383  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  442

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA++N RL+FNMD L  KE+     S P
Sbjct  443  LQRQVEFLSMKLASVNTRLDFNMDALMSKEIFQQNNSLP  481



>gb|KDO70233.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=245

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K +YIHVRARRGQAT+SHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEII
Sbjct  51   DPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEII  110

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLA +NPRL+FN++ L  K++
Sbjct  111  NYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDV  146



>ref|XP_006358792.1| PREDICTED: transcription factor bHLH62-like [Solanum tuberosum]
Length=439

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATD+HSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  238  DYIHVRARRGQATDAHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYVQS  297

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSF  996
            LQ+QVEFLSMKLA +NPR++FNM+ L  K++    GS 
Sbjct  298  LQRQVEFLSMKLATVNPRMDFNMEALLSKDMFQSRGSL  335



>ref|XP_008244684.1| PREDICTED: transcription factor bHLH62 [Prunus mume]
Length=580

 Score =   163 bits (413),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  380  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  439

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA++N RL+FNMD L  KE+     S P
Sbjct  440  LQRQVEFLSMKLASVNTRLDFNMDALMSKEIFQQNNSLP  478



>ref|XP_001780480.1| predicted protein [Physcomitrella patens]
 gb|EDQ54681.1| predicted protein [Physcomitrella patens]
Length=221

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +D  K DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEI
Sbjct  54   QDFPKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEI  113

Query  865  INYVQSLQKQVEFLSMKLAALN-PRLEFNMDNLFPKELP  978
            INYVQSLQ+QVEFLSMKLA +N PRL+++ D L  KE+P
Sbjct  114  INYVQSLQRQVEFLSMKLATVNVPRLDYSYD-LLSKEMP  151



>ref|XP_006298095.1| hypothetical protein CARUB_v10014138mg [Capsella rubella]
 gb|EOA30993.1| hypothetical protein CARUB_v10014138mg [Capsella rubella]
Length=288

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++ K DYIHVRARRGQATD HSLAERARREKISKKMK LQD+VPGCNKV GKAGMLDEII
Sbjct  173  EIPKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEII  232

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAY  984
            NYVQ LQ+QVEFLSMKLA LNP LE  M++   K++  +
Sbjct  233  NYVQCLQRQVEFLSMKLAVLNPELELAMEDASVKQVKTH  271



>ref|XP_002320444.1| hypothetical protein POPTR_0014s14650g [Populus trichocarpa]
 gb|EEE98759.1| hypothetical protein POPTR_0014s14650g [Populus trichocarpa]
Length=568

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  365  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  424

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKL+++NPR+E NM+ L  K++    GS P
Sbjct  425  LQRQVEFLSMKLSSVNPRMEINMETLLSKDIFQSRGSMP  463



>ref|XP_011042744.1| PREDICTED: transcription factor bHLH77-like [Populus euphratica]
Length=566

 Score =   163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  360  DYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  419

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            LQ+QVEFLSMKLA +NP++E NM+    KE+    GS P
Sbjct  420  LQRQVEFLSMKLATVNPKMEINMETFLSKEIFQSRGSMP  458



>gb|AAM10951.1|AF488595_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=450

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  248  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  307

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKL+++N RL+FNMD L  K++
Sbjct  308  LQRQVEFLSMKLSSVNTRLDFNMDALLSKDI  338



>ref|XP_010451395.1| PREDICTED: transcription factor bHLH62-like [Camelina sativa]
Length=461

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  259  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  318

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKL+++N RLEFNMD    K+L
Sbjct  319  LQRQVEFLSMKLSSVNTRLEFNMDAFMSKDL  349



>ref|XP_009150738.1| PREDICTED: transcription factor HBI1-like isoform X2 [Brassica 
rapa]
Length=340

 Score =   159 bits (401),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 3/104 (3%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            ++QK DYIHVR+RRGQATD HSLAERARREKISKKMK LQD+VPGC KV G+AGMLDEII
Sbjct  179  EIQKLDYIHVRSRRGQATDRHSLAERARREKISKKMKYLQDIVPGCKKVTGQAGMLDEII  238

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKELPAYMGSFP  999
            NYVQSLQ QVEFLSMKLA LN  LE  +++L+   L AY  + P
Sbjct  239  NYVQSLQTQVEFLSMKLAVLNSELELAVEDLY---LHAYFTNLP  279



>ref|XP_004148863.1| PREDICTED: transcription factor bHLH62-like [Cucumis sativus]
Length=187

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 1/92 (1%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DY+HVRARRG+ATDSHSLAERARREKIS++MK LQ+LVPGCNK+ GKAGMLDEIINYVQS
Sbjct  2    DYVHVRARRGKATDSHSLAERARREKISERMKYLQNLVPGCNKIAGKAGMLDEIINYVQS  61

Query  883  LQKQVEFLSMKLAALNPRLEF-NMDNLFPKEL  975
            LQ+QVEFLSMK+AALN R++F N+D+L  K++
Sbjct  62   LQQQVEFLSMKVAALNHRVDFINVDDLLAKQM  93



>ref|XP_006647763.1| PREDICTED: transcription factor bHLH63-like [Oryza brachyantha]
Length=362

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 15/153 (10%)
 Frame = +1

Query  694   QKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINY  873
             QK+DYIHVRARRGQATDSHSLAER RRE+IS++M+ LQ+LVPGCNKV GKAGMLDEIINY
Sbjct  151   QKTDYIHVRARRGQATDSHSLAERVRRERISERMRYLQELVPGCNKVTGKAGMLDEIINY  210

Query  874   VQSLQKQVEFLSMKLAALNPRLEFNM-DNLFPKEL------PAYMGSFPaaaaampleav  1032
             VQSLQKQVEFLSMK+AA NP + FN+ ++LF ++L      PA + +       +P+E  
Sbjct  211   VQSLQKQVEFLSMKIAASNPVVNFNIVEDLFGRQLSQAACNPAALPAM-----TLPIEQG  265

Query  1033  naaFLHYNPLQQFATATSRGGAASMETDMVRSD  1131
               + L   PLQQ  T+    G++S   +MV S+
Sbjct  266   EPSCLQMGPLQQMQTSA---GSSSFGLNMVVSN  295



>ref|XP_009415543.1| PREDICTED: transcription factor bHLH49-like [Musa acuminata subsp. 
malaccensis]
Length=414

 Score =   160 bits (406),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  499  GGGRANGTATST-----RKRKAEHCLEDKKWEGETTDVQSEITVKCERETsgssaskenk  663
            GGG  N  ++S      ++R++   LE ++ + +        +V  + +   SS++ +  
Sbjct  173  GGGHENADSSSKDLAAKKRRRSSEELEAERGDPQMAAEAKTESVDTDHKAEQSSSTAKPN  232

Query  664  kssggsgEDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGK  843
                    +  K DYIHVRARRGQAT+SHSLAER RREKIS++MK LQ+LVPGC+KV GK
Sbjct  233  GKHDKDASEAPKEDYIHVRARRGQATNSHSLAERVRREKISQRMKLLQELVPGCSKVTGK  292

Query  844  AGMLDEIINYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            A MLDEIINYVQSLQ+QVEFLSMKLAA+NPRL+FN+++L  K+ 
Sbjct  293  AVMLDEIINYVQSLQQQVEFLSMKLAAVNPRLDFNIESLLSKDF  336



>ref|NP_187390.1| transcription factor bHLH62 [Arabidopsis thaliana]
 sp|Q9SRT2.1|BH062_ARATH RecName: Full=Transcription factor bHLH62; AltName: Full=Basic 
helix-loop-helix protein 62; Short=AtbHLH62; Short=bHLH 62; 
AltName: Full=Transcription factor EN 85; AltName: Full=bHLH 
transcription factor bHLH062 [Arabidopsis thaliana]
 gb|AAF02164.1|AC009853_24 unknown protein [Arabidopsis thaliana]
 dbj|BAD43132.1| putative bHLH transcription factor (bHLH062) [Arabidopsis thaliana]
 dbj|BAD43259.1| putative bHLH transcription factor (bHLH062) [Arabidopsis thaliana]
 gb|ABH04604.1| At3g07340 [Arabidopsis thaliana]
 gb|AEE74530.1| transcription factor bHLH62 [Arabidopsis thaliana]
Length=456

 Score =   161 bits (408),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  254  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  313

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKL+++N RL+FNMD L  K++
Sbjct  314  LQRQVEFLSMKLSSVNTRLDFNMDALLSKDI  344



>ref|XP_010943354.1| PREDICTED: transcription factor bHLH49 isoform X3 [Elaeis guineensis]
Length=489

 Score =   162 bits (409),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  688  DVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEII  867
            D  K DY+HVRARRGQAT+SHSLAER RREKIS++MK LQDLVPGC+KV GKA MLDEII
Sbjct  292  DAPKEDYVHVRARRGQATNSHSLAERVRREKISERMKLLQDLVPGCSKVTGKAVMLDEII  351

Query  868  NYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            NYVQSLQ+QVEFLSMKLAA+NPR++FN++ L  K+L
Sbjct  352  NYVQSLQRQVEFLSMKLAAVNPRVDFNVEGLLSKDL  387



>ref|XP_009620568.1| PREDICTED: transcription factor bHLH48-like isoform X2 [Nicotiana 
tomentosiformis]
Length=315

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  685  EDVQKSDYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEI  864
            +D +K  Y+HVRARRGQATDSHSLAERARREKI+ +MK LQ+LVPGCNK+ G A +LDEI
Sbjct  145  DDAEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCNKISGTAMVLDEI  204

Query  865  INYVQSLQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            IN+VQSLQ+QVEFLSM+LAA+NPR++FN+DNLF  EL
Sbjct  205  INHVQSLQRQVEFLSMRLAAVNPRVDFNLDNLFAPEL  241



>dbj|BAD44326.1| putative bHLH transcription factor (bHLH062) [Arabidopsis thaliana]
 dbj|BAD44426.1| putative bHLH transcription factor (bHLH062) [Arabidopsis thaliana]
Length=456

 Score =   161 bits (407),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKIS++MK LQDLVPGCNKV GKA MLDEIINYVQS
Sbjct  254  DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  313

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLFPKEL  975
            LQ+QVEFLSMKL+++N RL+FNMD L  K++
Sbjct  314  LQRQVEFLSMKLSSVNTRLDFNMDALLSKDI  344



>ref|XP_009392658.1| PREDICTED: transcription factor bHLH77 [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   157 bits (398),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  703  DYIHVRARRGQATDSHSLAERARREKISKKMKCLQDLVPGCNKVVGKAGMLDEIINYVQS  882
            DYIHVRARRGQATDSHSLAER RREKISK+MK LQDLVPGCNK+ GKA MLDEIINYVQS
Sbjct  127  DYIHVRARRGQATDSHSLAERVRREKISKRMKLLQDLVPGCNKITGKAMMLDEIINYVQS  186

Query  883  LQKQVEFLSMKLAALNPRLEFNMDNLF  963
            LQ+QVEFLSMKLA +NP+L+F+++ L 
Sbjct  187  LQRQVEFLSMKLATINPQLDFDLETLL  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4710246328932