BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15340_g1_i1 len=4506 path=[1:0-941 9000:942-942 @943@!:943-2851
2852:2852-2852 2853:2853-4505]

Length=4506
                                                                      Score     E

dbj|BAE79385.1|  unnamed protein product                               1222   0.0      Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                               1218   0.0      Ipomoea batatas [batate]
dbj|BAE79384.1|  unnamed protein product                               1206   0.0      Ipomoea batatas [batate]
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    776   0.0      
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    748   0.0      
emb|CCA66009.1|  hypothetical protein                                   753   0.0      
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764    749   0.0      
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...    711   0.0      
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase     700   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803    701   0.0      
emb|CCA65997.1|  hypothetical protein                                   687   0.0      
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    684   0.0      
gb|ABD28627.2|  RNA-directed DNA polymerase (Reverse transcriptas...    644   0.0      Medicago truncatula
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    633   0.0      
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    640   0.0      
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230    615   0.0      
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737    590   0.0      
ref|XP_010666276.1|  PREDICTED: uncharacterized protein LOC104883442    602   0.0      
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085    591   4e-179   
emb|CAB10337.1|  reverse transcriptase like protein                     553   6e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    567   1e-169   
emb|CCA65995.1|  hypothetical protein                                   558   5e-169   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    545   6e-166   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    550   1e-163   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    548   3e-162   
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937    535   1e-161   
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    535   1e-161   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     537   2e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    533   1e-160   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             542   3e-160   
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    531   7e-159   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764    526   1e-158   
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725    522   4e-157   
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275    518   6e-157   
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296    518   7e-157   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    537   2e-156   
emb|CCA66036.1|  hypothetical protein                                   522   4e-156   
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    521   5e-156   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    520   1e-155   
emb|CCA66050.1|  hypothetical protein                                   520   2e-155   
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             516   9e-155   
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg             509   2e-153   
gb|AFP55574.1|  non-ltr retroelement reverse transcriptase              520   3e-153   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    516   6e-153   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         519   6e-153   Oryza sativa Japonica Group [Japonica rice]
emb|CCA66040.1|  hypothetical protein                                   511   4e-152   
emb|CCA66044.1|  hypothetical protein                                   510   8e-152   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    509   1e-151   
ref|XP_007210729.1|  hypothetical protein PRUPE_ppa021798mg             504   2e-151   
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    508   2e-151   
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    500   2e-150   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    513   7e-150   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         504   7e-150   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    504   2e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    501   2e-149   
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852    503   7e-149   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         511   1e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159    507   1e-147   
ref|NP_001066197.2|  Os12g0156200                                       506   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    502   2e-147   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    496   3e-147   
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein               495   5e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    496   5e-147   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191    505   8e-147   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             487   1e-146   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    497   2e-146   
gb|AAQ19327.1|  bZIP-like protein                                       506   7e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    500   1e-145   
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    489   4e-145   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    491   8e-145
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574    498   1e-144   
ref|XP_010681283.1|  PREDICTED: uncharacterized protein LOC104896266    484   3e-144   
gb|EPS61425.1|  hypothetical protein M569_13371                         484   3e-143   
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    486   4e-143   
emb|CCA66054.1|  hypothetical protein                                   486   5e-143   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    491   2e-142   
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885    481   4e-142   
gb|ABW81175.1|  non-LTR retrotransposon transposase                     468   4e-142   Arabidopsis cebennensis
ref|XP_007020288.1|  Uncharacterized protein TCM_036737                 493   7e-142   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    482   7e-142   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    478   9e-142   
ref|XP_011085143.1|  PREDICTED: uncharacterized protein LOC105167219    479   1e-141   
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758    487   1e-141   
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    479   2e-141   
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    468   2e-141   
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    477   5e-141   
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622    475   1e-140   
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    469   1e-140   
gb|EEC84753.1|  hypothetical protein OsI_31756                          479   1e-140   Oryza sativa Indica Group [Indian rice]
gb|AAS55787.1|  hypothetical protein                                    482   3e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    477   5e-140   
gb|ABA96650.1|  retrotransposon protein, putative, unclassified         468   6e-139   Oryza sativa Japonica Group [Japonica rice]
gb|ABO80459.1|  RNA-directed DNA polymerase (Reverse transcriptas...    461   9e-139   Medicago truncatula
ref|XP_007008704.1|  Uncharacterized protein TCM_042330                 484   1e-138   
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase     479   2e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    469   3e-138   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    479   3e-138   
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    467   4e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     475   4e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794    479   5e-138   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743    467   2e-137   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    469   3e-137   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     476   3e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    466   4e-137   
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319    470   5e-137   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    467   6e-137   
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    462   9e-137   
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164    461   9e-137   
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364    467   9e-137   
gb|EPS72636.1|  hypothetical protein M569_02121                         471   1e-136   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187    475   1e-136   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    469   2e-136   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    457   4e-136   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    469   4e-136   
gb|EPS63383.1|  hypothetical protein M569_11401                         469   5e-136   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    469   5e-136   
ref|XP_010693613.1|  PREDICTED: uncharacterized protein LOC104906541    459   6e-136   
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    462   9e-136   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    459   1e-135   
ref|XP_007022832.1|  Uncharacterized protein TCM_026877                 476   1e-135   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752                 474   2e-135   
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    458   3e-135   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768    470   3e-135   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              469   1e-134   
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    468   2e-134   
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...    445   2e-134   
ref|XP_009150035.1|  PREDICTED: uncharacterized protein LOC103873375    460   3e-134   
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    467   6e-134   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    464   8e-134   
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    461   9e-134   
ref|XP_010671205.1|  PREDICTED: uncharacterized protein LOC104888072    464   9e-134   
gb|AAF97969.1|AC000103_19  F21J9.30                                     458   1e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    452   1e-133   
gb|ABA98898.1|  retrotransposon protein, putative, unclassified         456   1e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    457   2e-133   
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249    454   2e-133   
ref|XP_010513001.1|  PREDICTED: uncharacterized protein LOC104788939    463   2e-133   
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     456   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890    457   4e-133   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             449   5e-133   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509    455   5e-133   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    450   9e-133   
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...    440   1e-132   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254    452   1e-132   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    451   2e-132   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323    456   5e-132   
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase    438   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693635.1|  PREDICTED: uncharacterized protein LOC104906563    453   1e-131   
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    447   2e-131   
gb|EAZ20803.1|  hypothetical protein OsJ_36426                          438   3e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007046404.1|  Uncharacterized protein TCM_011923                 461   3e-131   
gb|EEE50824.1|  hypothetical protein OsJ_31232                          456   4e-131   Oryza sativa Japonica Group [Japonica rice]
emb|CCA66140.1|  hypothetical protein                                   452   6e-131   
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479    450   6e-131   
emb|CCA65974.1|  hypothetical protein                                   452   9e-131   
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...    449   1e-130
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075    449   2e-130   
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    438   3e-130   
emb|CCA66180.1|  hypothetical protein                                   451   3e-130   
ref|XP_007031312.1|  Uncharacterized protein TCM_016762                 459   3e-130   
emb|CCA66188.1|  hypothetical protein                                   450   4e-130   
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    446   6e-130   
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    452   7e-130   
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182    454   1e-129   
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             451   2e-129   
gb|AAG03119.1|AC004133_13  F5A9.24                                      446   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801646.1|  PREDICTED: uncharacterized protein LOC103715697    444   2e-129   
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...    436   3e-129   
gb|AEL30359.1|  RNA-directed DNA polymerase                             451   3e-129   
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719    449   3e-129   
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148    444   5e-129   
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880    445   6e-129   
gb|EEC68887.1|  hypothetical protein OsI_37529                          450   3e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_007031313.1|  Uncharacterized protein TCM_016763                 452   3e-128   
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219    441   4e-128   
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         432   5e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CCA66198.1|  hypothetical protein                                   444   9e-128   
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406    438   1e-127   
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg             436   1e-127   
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         433   2e-127   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61581.1|  hypothetical protein OsJ_15963                          445   2e-127   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79647.1|  hypothetical protein OsI_20882                          447   3e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_010674085.1|  PREDICTED: uncharacterized protein LOC104890338    445   3e-127   
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573    440   3e-126   
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...    424   3e-126   
ref|XP_009353199.1|  PREDICTED: uncharacterized protein LOC103944460    439   6e-126   
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...    442   6e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354602.1|  PREDICTED: uncharacterized protein LOC103418244    438   9e-126   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964    437   1e-125   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein         437   1e-125   
ref|XP_010687808.1|  PREDICTED: uncharacterized protein LOC104901884    434   1e-125   
gb|EEC75227.1|  hypothetical protein OsI_11496                          429   3e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...    425   4e-125   
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961    434   5e-125   
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    431   6e-125   
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...    427   7e-125   
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    429   7e-125   
emb|CCA66178.1|  hypothetical protein                                   434   2e-124   
ref|XP_010674186.1|  PREDICTED: uncharacterized protein LOC104890406    438   2e-124   
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890    438   3e-124   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526    423   6e-124   
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    422   6e-124   
emb|CAE04866.2|  OSJNBa0086O06.14                                       429   8e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010480950.1|  PREDICTED: uncharacterized protein LOC104759762    435   1e-123   
ref|XP_010058565.1|  PREDICTED: uncharacterized protein LOC104446406    434   3e-123   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    430   4e-123   
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             423   5e-123   
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896    425   6e-123   
ref|XP_004242524.1|  PREDICTED: uncharacterized protein LOC101258077    431   7e-123   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048    427   8e-123   
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    422   2e-122   
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    419   2e-122   
emb|CAB40051.1|  putative protein                                       426   3e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    432   3e-122   
ref|XP_010692491.1|  PREDICTED: uncharacterized protein LOC104905603    427   4e-122   
ref|XP_010058631.1|  PREDICTED: uncharacterized protein LOC104446483    431   1e-121   
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase     416   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357937.1|  PREDICTED: putative ribonuclease H protein A...    418   3e-121   
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    422   7e-121   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    426   2e-120   
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356    419   2e-120   
ref|XP_010473926.1|  PREDICTED: uncharacterized protein LOC104753360    409   3e-120   
gb|EEC83100.1|  hypothetical protein OsI_28249                          420   5e-120   Oryza sativa Indica Group [Indian rice]
emb|CAN78577.1|  hypothetical protein VITISV_020585                     426   6e-120   Vitis vinifera
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    421   7e-120   
ref|XP_008369981.1|  PREDICTED: uncharacterized protein LOC103433498    421   7e-120   
ref|XP_007212615.1|  hypothetical protein PRUPE_ppa017091mg             410   8e-120   
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    416   1e-119   
ref|XP_009114416.1|  PREDICTED: uncharacterized protein LOC103839673    417   4e-119   
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    414   4e-119   
ref|XP_008381797.1|  PREDICTED: uncharacterized protein LOC103444619    415   5e-119   
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    407   5e-119   
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285    413   6e-119   
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    417   7e-119   
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    408   1e-118   
gb|ABF95850.1|  retrotransposon protein, putative, unclassified         407   2e-118   Oryza sativa Japonica Group [Japonica rice]
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase     416   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg             416   3e-118   
gb|EEC83406.1|  hypothetical protein OsI_28856                          411   4e-118   Oryza sativa Indica Group [Indian rice]
emb|CCA66153.1|  hypothetical protein                                   416   6e-118   
ref|XP_010666661.1|  PREDICTED: uncharacterized protein LOC104883796    405   6e-118   
ref|XP_010673150.1|  PREDICTED: uncharacterized protein LOC104889591    414   7e-118   
ref|XP_010686872.1|  PREDICTED: uncharacterized protein LOC104901027    413   8e-118   
ref|XP_010034422.1|  PREDICTED: uncharacterized protein LOC104423658    419   8e-118   
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    407   8e-118   
ref|XP_009124577.1|  PREDICTED: uncharacterized protein LOC103849567    407   1e-117   
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...    399   1e-117   Medicago truncatula
emb|CCA66222.1|  hypothetical protein                                   415   1e-117   
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    409   1e-117   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...    405   1e-117   
gb|AAF69169.1|AC007915_21  F27F5.21                                     407   2e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CCA66235.1|  hypothetical protein                                   414   2e-117   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             404   2e-117   
emb|CAN75646.1|  hypothetical protein VITISV_031269                     417   3e-117   Vitis vinifera
emb|CAN77614.1|  hypothetical protein VITISV_035196                     415   4e-117   Vitis vinifera
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase     407   6e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CAB75484.1|  putative protein                                       400   8e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    403   9e-117   
ref|XP_008346905.1|  PREDICTED: uncharacterized protein LOC103409892    409   1e-116   
gb|EPS73861.1|  hypothetical protein M569_00896                         415   1e-116   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    404   2e-116   
ref|XP_010681744.1|  PREDICTED: uncharacterized protein LOC104896672    402   2e-116   
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990    404   2e-116   
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977    410   3e-116   
ref|XP_010481107.1|  PREDICTED: uncharacterized protein LOC104759943    414   4e-116   
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    401   4e-116   
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    401   5e-116   
emb|CAN80807.1|  hypothetical protein VITISV_023749                     407   5e-116   Vitis vinifera
ref|XP_010068169.1|  PREDICTED: uncharacterized protein LOC104455000    412   5e-116   
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    404   8e-116   
ref|XP_009349611.1|  PREDICTED: uncharacterized protein LOC103941142    395   9e-116   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified         413   9e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107743.1|  PREDICTED: uncharacterized protein LOC103833410    401   9e-116   
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    400   1e-115   
ref|XP_008348238.1|  PREDICTED: uncharacterized protein LOC103411380    409   1e-115   
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    412   1e-115   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...    395   1e-115   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    400   1e-115   
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    407   2e-115   
ref|XP_010468391.1|  PREDICTED: uncharacterized protein LOC104748447    395   3e-115   
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845    395   4e-115   
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    407   5e-115   
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               407   2e-114   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    396   2e-114   
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         407   2e-114   
emb|CCA66020.1|  hypothetical protein                                   405   2e-114   
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687    394   3e-114   
ref|XP_008798809.1|  PREDICTED: putative ribonuclease H protein A...    393   4e-114   
ref|XP_008791119.1|  PREDICTED: uncharacterized protein LOC103708118    398   6e-114   
emb|CAN67355.1|  hypothetical protein VITISV_002170                     404   8e-114   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160    403   1e-113   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588    401   1e-113   
ref|XP_010026295.1|  PREDICTED: uncharacterized protein LOC104416631    405   1e-113   
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298    405   2e-113   
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    392   2e-113   
emb|CAN70922.1|  hypothetical protein VITISV_016266                     393   3e-113   
emb|CAN81579.1|  hypothetical protein VITISV_023185                     398   6e-113   
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949    391   9e-113   
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135    392   1e-112   
emb|CAN82456.1|  hypothetical protein VITISV_010028                     407   2e-112   
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500    390   2e-112   
emb|CAN65298.1|  hypothetical protein VITISV_008130                     403   3e-112   
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089    394   3e-112   
ref|XP_010681601.1|  PREDICTED: uncharacterized protein LOC104896541    394   4e-112   
emb|CAN70538.1|  hypothetical protein VITISV_040070                     403   6e-112   
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    388   6e-112   
ref|XP_008342824.1|  PREDICTED: putative ribonuclease H protein A...    392   6e-112   
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             388   9e-112   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    395   1e-111   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    395   1e-111   
ref|XP_010668002.1|  PREDICTED: uncharacterized protein LOC104884990    399   1e-111   
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    395   1e-111   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    384   2e-111   
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    386   3e-111   
gb|EEE55133.1|  hypothetical protein OsJ_02920                          389   3e-111   
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    385   3e-111   
ref|XP_008362180.1|  PREDICTED: uncharacterized protein LOC103425857    395   4e-111   
ref|XP_010468497.1|  PREDICTED: uncharacterized protein LOC104748579    389   5e-111   
emb|CAN65484.1|  hypothetical protein VITISV_029474                     399   7e-111   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    387   9e-111   
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891    393   9e-111   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     399   9e-111   
ref|XP_010686886.1|  PREDICTED: uncharacterized protein LOC104901041    390   2e-110   
ref|XP_010472440.1|  PREDICTED: uncharacterized protein LOC104752070    389   2e-110   
ref|XP_010695571.1|  PREDICTED: uncharacterized protein LOC104908184    390   3e-110   
ref|XP_008800872.1|  PREDICTED: uncharacterized protein LOC103715119    387   3e-110   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    389   4e-110   
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339    383   4e-110   
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg             383   5e-110   
emb|CAN69430.1|  hypothetical protein VITISV_024658                     397   5e-110   
gb|EEE59033.1|  hypothetical protein OsJ_10782                          381   5e-110   
gb|AAD15377.1|  putative non-LTR retroelement reverse transcriptase     385   7e-110   
ref|XP_008356537.1|  PREDICTED: uncharacterized protein LOC103420255    390   7e-110   
ref|XP_010694896.1|  PREDICTED: uncharacterized protein LOC104907635    392   8e-110   
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431    389   1e-109   
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321    382   2e-109   
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282    390   2e-109   
ref|XP_008338514.1|  PREDICTED: uncharacterized protein LOC103401576    379   2e-109   
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515    387   5e-109   
emb|CAN74183.1|  hypothetical protein VITISV_034261                     386   5e-109   
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882    385   6e-109   
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    388   8e-109   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714    386   1e-108   
emb|CAN74843.1|  hypothetical protein VITISV_037042                     387   1e-108   
ref|XP_010645162.1|  PREDICTED: uncharacterized protein LOC104877807    390   1e-108   
emb|CAE02147.1|  OSJNBa0081G05.2                                        390   1e-108   
ref|XP_010692615.1|  PREDICTED: uncharacterized protein LOC104905704    381   3e-108   
ref|XP_010681460.1|  PREDICTED: uncharacterized protein LOC104896407    385   3e-108   
ref|XP_008802031.1|  PREDICTED: putative ribonuclease H protein A...    378   3e-108   
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg             377   5e-108   
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768    392   8e-108   
ref|XP_010675126.1|  PREDICTED: uncharacterized protein LOC104891166    385   1e-107   
emb|CAN79574.1|  hypothetical protein VITISV_017342                     385   1e-107   
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...    377   1e-107   
ref|XP_008808644.1|  PREDICTED: putative ribonuclease H protein A...    377   1e-107   
ref|XP_010672625.1|  PREDICTED: uncharacterized protein LOC104889168    387   1e-107   
emb|CAN82037.1|  hypothetical protein VITISV_033902                     380   2e-107   
emb|CAN68860.1|  hypothetical protein VITISV_023024                     387   2e-107   
emb|CAN75888.1|  hypothetical protein VITISV_023640                     391   2e-107   
ref|XP_010038572.1|  PREDICTED: uncharacterized protein LOC104427129    385   2e-107   
ref|XP_007031450.1|  LINE-type retrotransposon LIb DNA, Insertion...    366   2e-107   
ref|XP_010674286.1|  PREDICTED: uncharacterized protein LOC104890473    379   3e-107   
gb|EEE52912.1|  hypothetical protein OsJ_35521                          377   3e-107   
ref|XP_010681687.1|  PREDICTED: uncharacterized protein LOC104896616    379   1e-106   
emb|CAN77850.1|  hypothetical protein VITISV_020834                     386   1e-106   
ref|XP_009127062.1|  PREDICTED: uncharacterized protein LOC103851934    384   1e-106   
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    371   4e-106   
ref|XP_010679283.1|  PREDICTED: uncharacterized protein LOC104894690    380   5e-106   
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    370   5e-106   
emb|CAN69474.1|  hypothetical protein VITISV_014375                     380   6e-106   
ref|XP_008390125.1|  PREDICTED: uncharacterized protein LOC103452416    367   8e-106   
ref|XP_010675368.1|  PREDICTED: uncharacterized protein LOC104891381    376   1e-105   
ref|XP_010671909.1|  PREDICTED: uncharacterized protein LOC104888584    379   2e-105   
ref|XP_010684619.1|  PREDICTED: uncharacterized protein LOC104899180    380   3e-105   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    368   3e-105   
gb|AAM01179.2|AC113336_31  Putative retroelement                        381   3e-105   
ref|XP_002454941.1|  hypothetical protein SORBIDRAFT_03g001780          360   4e-105   
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795    370   8e-105   
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755    372   1e-104   
ref|XP_010692445.1|  PREDICTED: uncharacterized protein LOC104905555    378   2e-104   
ref|XP_002453763.1|  hypothetical protein SORBIDRAFT_04g014351          370   2e-104   
ref|NP_001057661.2|  Os06g0484800                                       367   2e-104   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    366   3e-104   
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579    365   3e-104   
ref|XP_010695270.1|  PREDICTED: uncharacterized protein LOC104907939    374   3e-104   
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...    366   3e-104   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...    363   4e-104   
emb|CAN71630.1|  hypothetical protein VITISV_015580                     377   4e-104   
ref|XP_010513448.1|  PREDICTED: uncharacterized protein LOC104789452    367   8e-104   
ref|XP_010694891.1|  PREDICTED: uncharacterized protein LOC104907631    374   1e-103   
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929    368   1e-103   
emb|CAN76026.1|  hypothetical protein VITISV_027817                     375   1e-103   
ref|XP_010682478.1|  PREDICTED: uncharacterized protein LOC104897316    370   1e-103   
ref|XP_010682494.1|  PREDICTED: uncharacterized protein LOC104897333    352   1e-103   
emb|CAN71912.1|  hypothetical protein VITISV_018965                     376   1e-103   
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832    368   2e-103   
emb|CAN68165.1|  hypothetical protein VITISV_008538                     375   3e-103   
ref|XP_009118886.1|  PREDICTED: uncharacterized protein LOC103843858    374   3e-103   
ref|XP_004305827.1|  PREDICTED: putative ribonuclease H protein A...    361   7e-103   
ref|XP_010674612.1|  PREDICTED: uncharacterized protein LOC104890735    370   7e-103   
ref|XP_007224290.1|  hypothetical protein PRUPE_ppa020085mg             367   7e-103   
ref|XP_010451093.1|  PREDICTED: uncharacterized protein LOC104733187    371   1e-102   
ref|XP_010669873.1|  PREDICTED: uncharacterized protein LOC104886993    371   1e-102   
gb|KHN27546.1|  LINE-1 reverse transcriptase like                       370   1e-102   
emb|CAN68112.1|  hypothetical protein VITISV_040983                     361   2e-102   
emb|CAN65100.1|  hypothetical protein VITISV_039725                     363   2e-102   
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816    362   2e-102   
gb|EAZ03196.1|  hypothetical protein OsI_25347                          359   3e-102   
ref|XP_010678549.1|  PREDICTED: uncharacterized protein LOC104894081    364   3e-102   
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg             357   3e-102   
ref|XP_010068552.1|  PREDICTED: uncharacterized protein LOC104455464    369   4e-102   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...    356   5e-102   
ref|XP_008806372.1|  PREDICTED: putative ribonuclease H protein A...    355   5e-102   
emb|CAN60595.1|  hypothetical protein VITISV_015221                     357   6e-102   
gb|KHN25562.1|  LINE-1 reverse transcriptase like                       361   1e-101   
ref|XP_010040552.1|  PREDICTED: uncharacterized protein LOC104429377    369   1e-101   
emb|CAN76892.1|  hypothetical protein VITISV_005356                     370   1e-101   
dbj|BAA97290.1|  non-LTR retroelement reverse transcriptase-like        362   2e-101   
dbj|BAF01687.1|  hypothetical protein                                   362   2e-101   
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...    358   4e-101   
ref|XP_010692677.1|  PREDICTED: uncharacterized protein LOC104905754    358   4e-101   
ref|XP_010501979.1|  PREDICTED: uncharacterized protein LOC104779321    356   4e-101   
ref|XP_010674016.1|  PREDICTED: uncharacterized protein LOC104890294    358   5e-101   
ref|XP_010676966.1|  PREDICTED: uncharacterized protein LOC104892675    357   5e-101   
ref|XP_007212886.1|  hypothetical protein PRUPE_ppa021750mg             357   5e-101   
ref|XP_007202950.1|  hypothetical protein PRUPE_ppa016504mg             362   6e-101   
ref|XP_010507511.1|  PREDICTED: uncharacterized protein LOC104784146    363   6e-101   
gb|ABD33126.2|  RNA-directed DNA polymerase (Reverse transcriptase)     348   1e-100   
ref|XP_007224079.1|  hypothetical protein PRUPE_ppa015473mg             364   1e-100   
ref|XP_009106506.1|  PREDICTED: uncharacterized protein LOC103832284    360   2e-100   
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270    364   2e-100   
emb|CAN68820.1|  hypothetical protein VITISV_009132                     367   2e-100   
ref|XP_010694673.1|  PREDICTED: uncharacterized protein LOC104907438    362   2e-100   
emb|CAN75028.1|  hypothetical protein VITISV_026823                     367   3e-100   
ref|XP_010549577.1|  PREDICTED: uncharacterized protein LOC104820715    367   3e-100   
ref|XP_010666096.1|  PREDICTED: uncharacterized protein LOC104883306    363   3e-100   
ref|XP_008795217.1|  PREDICTED: putative ribonuclease H protein A...    352   3e-100   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             353   3e-100   
ref|XP_008350747.1|  PREDICTED: uncharacterized protein LOC103414113    367   4e-100   
ref|XP_010682474.1|  PREDICTED: uncharacterized protein LOC104897312    358   4e-100   
emb|CAN72837.1|  hypothetical protein VITISV_031500                     355   5e-100   
emb|CAN77641.1|  hypothetical protein VITISV_007623                     360   9e-100   
gb|EEE51789.1|  hypothetical protein OsJ_33245                          350   9e-100   
ref|XP_011013113.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    362   1e-99    
ref|XP_010676026.1|  PREDICTED: uncharacterized protein LOC104891936    360   1e-99    
emb|CAN69754.1|  hypothetical protein VITISV_024938                     353   2e-99    
emb|CAN72097.1|  hypothetical protein VITISV_042083                     363   2e-99    
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg             352   2e-99    
ref|XP_009144152.1|  PREDICTED: uncharacterized protein LOC103867818    362   2e-99    
ref|XP_010669434.1|  PREDICTED: uncharacterized protein LOC104886665    353   4e-99    
emb|CAN79789.1|  hypothetical protein VITISV_039779                     360   5e-99    
ref|XP_010419021.1|  PREDICTED: uncharacterized protein LOC104704671    356   6e-99    
ref|XP_007214027.1|  hypothetical protein PRUPE_ppa016677mg             358   1e-98    
ref|XP_010677694.1|  PREDICTED: uncharacterized protein LOC104893292    357   2e-98    
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    347   2e-98    
emb|CAN68550.1|  hypothetical protein VITISV_027787                     344   2e-98    
emb|CAN77861.1|  hypothetical protein VITISV_005457                     347   3e-98    
gb|EEC75230.1|  hypothetical protein OsI_11503                          344   3e-98    
ref|XP_009103799.1|  PREDICTED: uncharacterized protein LOC103829866    358   3e-98    
gb|ABA91475.1|  retrotransposon protein, putative, unclassified         350   3e-98    
ref|XP_011102248.1|  PREDICTED: uncharacterized protein LOC105180271    352   4e-98    
emb|CAN81442.1|  hypothetical protein VITISV_011546                     346   4e-98    
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884    353   4e-98    
ref|XP_011004665.1|  PREDICTED: uncharacterized protein LOC105111104    358   5e-98    
gb|ABA91837.2|  retrotransposon protein, putative, unclassified         349   6e-98    
emb|CAN80166.1|  hypothetical protein VITISV_033619                     355   6e-98    
emb|CAN79190.1|  hypothetical protein VITISV_000232                     359   7e-98    
ref|XP_009140327.1|  PREDICTED: uncharacterized protein LOC103864320    357   7e-98    
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362    347   8e-98    
emb|CAN68838.1|  hypothetical protein VITISV_030956                     358   9e-98    
gb|AAX95129.1|  retrotransposon protein, putative, unclassified         349   9e-98    
ref|XP_010644016.1|  PREDICTED: uncharacterized protein LOC104877459    343   1e-97    
ref|XP_009112993.1|  PREDICTED: uncharacterized protein LOC103838310    356   1e-97    
ref|XP_004233579.1|  PREDICTED: uncharacterized protein LOC101260201    355   1e-97    
emb|CAN73982.1|  hypothetical protein VITISV_007640                     358   2e-97    
ref|XP_010676054.1|  PREDICTED: transposon TX1 uncharacterized 14...    346   2e-97    
ref|XP_010677875.1|  PREDICTED: uncharacterized protein LOC104893474    355   2e-97    
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)     336   2e-97    
ref|XP_010501912.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    348   3e-97    
ref|XP_010436306.1|  PREDICTED: uncharacterized protein LOC104720031    341   4e-97    
ref|XP_010677188.1|  PREDICTED: uncharacterized protein LOC104892865    349   4e-97    
emb|CAN77480.1|  hypothetical protein VITISV_021632                     358   4e-97    
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...    342   7e-97    
gb|AAC28221.1|  similar to reverse transcriptases (PFam: rvt.hmm,...    349   7e-97    
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...    348   8e-97    
emb|CAN72143.1|  hypothetical protein VITISV_036307                     340   1e-96    
ref|XP_010068160.1|  PREDICTED: uncharacterized protein LOC104454989    352   1e-96    
emb|CAN79138.1|  hypothetical protein VITISV_034815                     353   1e-96    
emb|CAN70803.1|  hypothetical protein VITISV_044067                     354   2e-96    
ref|XP_009790965.1|  PREDICTED: uncharacterized protein LOC104238338    350   2e-96    
emb|CCA65981.1|  hypothetical protein                                   347   2e-96    
emb|CAN77370.1|  hypothetical protein VITISV_033119                     348   3e-96    
emb|CAN71772.1|  hypothetical protein VITISV_002507                     345   3e-96    
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...    340   4e-96    
ref|XP_010521406.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    353   5e-96    
emb|CAN82440.1|  hypothetical protein VITISV_006122                     344   6e-96    
ref|XP_004306191.1|  PREDICTED: putative ribonuclease H protein A...    337   8e-96    
gb|AAX95804.1|  retrotransposon protein, putative, unclassified         340   9e-96    
ref|XP_010523549.1|  PREDICTED: uncharacterized protein LOC104801863    347   1e-95    
gb|AAT58873.1|  hypothetical protein                                    347   1e-95    



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =  1222 bits (3161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/1188 (51%), Positives = 812/1188 (68%), Gaps = 3/1188 (0%)
 Frame = +1

Query  949   WRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAP  1128
             W+ ++ N +VI + SQAIH L S    N  ++FAY+RPN  AK RFW  C   ++   +P
Sbjct  73    WKPAL-NLSVISHNSQAIHTLASHRLGNCFITFAYIRPNTFAKCRFWEYCKQLANSIQSP  131

Query  1129  WIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTV  1308
             W+++GD NDIA + EQWGSSS+N +   NFV+++S CGLLD G+SG +++W R  G R V
Sbjct  132   WMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGPNFTWCRFIGNRVV  191

Query  1309  QRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWL  1488
             QRR+LDR LWN+ AQ  FPEAK  +LPR  SDH+P+ FL EAGNPP R  RP RFE AWL
Sbjct  192   QRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPVRSLRPVRFEAAWL  251

Query  1489  TREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESV  1668
             T EDY+ IW         ++   I+ VT  S  WN+  FGNIF RK  ++ RI G+Q + 
Sbjct  252   TSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRNVFGNIFNRKRKIENRILGIQRAW  311

Query  1669  FYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRS  1848
              YNTS  LQ LE++L++ELNEVL QEE LWFQK+R  WI++GDRNT FYH+S LI+RNR+
Sbjct  312   NYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTTFYHRSALIKRNRN  371

Query  1849  RIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPND-MYCGPKLDTGQMHKLTR  2025
             R+R LK+ G W  D   +++HI NFF  LF R +     P   +    ++   Q   L R
Sbjct  372   RVRFLKLQGAWTDDADLLTEHIINFFSTLFCRVDRDSQPPRQGLPMDFQIPRDQASTLLR  431

Query  2026  EVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILE  2205
               ++ EVKKAVF MKK+GSPGPDGI A FYQ FW EV   +T  V     +G      L+
Sbjct  432   RASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTDMVNHAFENGSTYISQLQ  491

Query  2206  SFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRST  2385
             +F+TLIPKKD+PETA+DFRPITLLNVSFK+ISKV+VNR+RPIM N+IGP QNSFLPGRST
Sbjct  492   AFMTLIPKKDTPETAADFRPITLLNVSFKVISKVLVNRLRPIMSNIIGPHQNSFLPGRST  551

Query  2386  ADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIM  2565
              DN+ILTQE+VH M   + KK  M +K+DL KAYDS+ W++LE TL DFGFP+ LI LI+
Sbjct  552   MDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLEETLEDFGFPRRLIDLIL  611

Query  2566  FSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPI  2745
             FS++ESS+++LWNG +L PF+PGRGLRQGDPLAPYLF L MERL+ DIQ +V  + WKP+
Sbjct  612   FSLQESSLAILWNGGRLPPFKPGRGLRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPV  671

Query  2746  TLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNT  2925
              ++RGGTG+SHLFFA+DLMLF EASE Q +++ +CL  FS  SGL +N SKS +FCS N 
Sbjct  672   HITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSSNV  731

Query  2926  NSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLA  3105
             N+ +KR + ++  + V+++LGTYLGIP+L +RVS++TF  ++D M+ KL++WK + L++A
Sbjct  732   NAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLNMA  791

Query  3106  GRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKS  3285
             GRR LVQ++L+++P YTMQV  LP  TCN+ID+ CR+FLWG     +K+H V W +ICK 
Sbjct  792   GRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEICKP  851

Query  3286  KDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWG  3465
             ++ GGLGLR   DFN A L K+AWQ+ ++ DKLWVKV+REKYVKN +F      +N SWG
Sbjct  852   RNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKYVKNADFLHLQSQSNCSWG  911

Query  3466  WRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFIL  3645
             WRSIM+G+ ++     W +GNG  +NFW+DWW GD PLA   +       ++ KV D I 
Sbjct  912   WRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVEDLIT  971

Query  3646  PNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGND  3825
               R W+   L ++LP ++ID +RATPIA+  +  D L WP S TG  +V SA+S IAG+D
Sbjct  972   SQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSLIAGHD  1031

Query  3826  EDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
              D     W+W+   TE+ +LF+W +++  L+ N+ER R+G+ +   C  CG+ DET++H+
Sbjct  1032  GDDRSHDWIWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHL  1091

Query  4006  LMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWIN-GCPWGVTFIYTCWEIW  4182
                C  A+ CW     P++FQ S    + SW+K  C +      G  W + F Y  W +W
Sbjct  1092  FRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYILWNLW  1151

Query  4183  KARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFN  4362
             KARN+ +F+N  +AP DI+ R+   + +   +   +  +      WV W PP  G+ K N
Sbjct  1152  KARNRLVFDNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLN  1211

Query  4363  TDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
             +DGA K ++ LASAGGL R+  G W+ G++ NIG +NSF AELWGLRE
Sbjct  1212  SDGACKSHSHLASAGGLLRNENGLWVAGYICNIGTANSFLAELWGLRE  1259



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =  1218 bits (3152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/1189 (51%), Positives = 812/1189 (68%), Gaps = 5/1189 (0%)
 Frame = +1

Query  949   WRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAP  1128
             W+ ++ N +VI + SQAIH L S    N  ++FAY+RPN  AK RFW  C   ++   +P
Sbjct  73    WKPAL-NLSVISHNSQAIHTLASHRLGNCFITFAYIRPNTFAKCRFWEYCKQLANSIQSP  131

Query  1129  WIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTV  1308
             W+++GD NDIA + EQWGSSS+N +   NFV+++S CGLLD G+SG +++W R  G R V
Sbjct  132   WMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGPNFTWCRFIGNRVV  191

Query  1309  QRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWL  1488
             QRR+LDR LWN+ AQ  FPEAK  +LPR  SDH+P+ FL EAGNPP R  RP RFE AWL
Sbjct  192   QRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPVRSLRPVRFEAAWL  251

Query  1489  TREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESV  1668
             T EDY+ IW         ++   I+ VT  S  WN+  FGNIF RK  ++ RI G+Q + 
Sbjct  252   TSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRNVFGNIFNRKRKIENRILGIQRAW  311

Query  1669  FYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRS  1848
              YNTS  LQ LE++L++ELNEVL QEE LWFQK+R  WI++GDRNT FYH+S LI+RNR+
Sbjct  312   NYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTTFYHRSALIKRNRN  371

Query  1849  RIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPND-MYCGPKLDTGQMHKLTR  2025
             R+R LK+ G W  D   +++HI NFF  LF R +     P   +    ++   Q   L R
Sbjct  372   RVRFLKLQGAWTDDADLLTEHIINFFSTLFCRVDRDSQPPRQGLPMDFQIPRDQASTLLR  431

Query  2026  EVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILE  2205
               ++ EVKKAVF MKK+GSPGPDGI A FYQ FW EV   +T  V     +G      L+
Sbjct  432   RASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTDMVNHAFENGSTYISQLQ  491

Query  2206  SFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRST  2385
             +F+TLIPKKD+PETA+DFRPITLLN SFK+ISKV+VNR+RPIM N+IGP QNSFLPGRST
Sbjct  492   AFMTLIPKKDTPETAADFRPITLLNASFKVISKVLVNRLRPIMSNIIGPHQNSFLPGRST  551

Query  2386  ADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIM  2565
              DN+ILTQE+VH M   + KK  M +K+DL KAYDS+ W++LE TL DFGFP+ LI LI+
Sbjct  552   MDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLEETLEDFGFPRRLIDLIL  611

Query  2566  FSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPI  2745
             FS++ESS+++LWNG +L PF+PGRGLRQGDPLAPYLF L MERL+ DIQ +V  + WKP+
Sbjct  612   FSLQESSLAILWNGGRLPPFKPGRGLRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPV  671

Query  2746  TLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNT  2925
              ++RGGTG+SHLFFA+DLMLF EASE Q +++ +CL  FS  SGL +N SKS +FCS N 
Sbjct  672   HITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSSNV  731

Query  2926  NSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLA  3105
             N+ +KR + ++  + V+++LGTYLGIP+L +RVS++TF  ++D M+ KL++WK + L++A
Sbjct  732   NAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLNMA  791

Query  3106  GRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKS  3285
             GRR LVQ++L+++P YTMQV  LP  TCN+ID+ CR+FLWG     +K+H V W +ICK 
Sbjct  792   GRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEICKP  851

Query  3286  KDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWG  3465
             ++ GGLGLR   DFN A L K+AWQ+ ++ DKLWVKV+REKYVKN +F      +N SWG
Sbjct  852   RNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKYVKNADFLHLQSQSNCSWG  911

Query  3466  WRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFIL  3645
             WRSIM+G+ ++     W +GNG  +NFW+DWW GD PLA   +       ++ KV D I 
Sbjct  912   WRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVEDLIT  971

Query  3646  PNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGND  3825
               R W+   L ++LP ++ID +RATPIA+  +  D L WP S TG  +V SA+S IAG+D
Sbjct  972   SQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSLIAGHD  1031

Query  3826  EDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
              D     W+W+   TE+ +LF+W +++  L+ N+ER R+G+ +   C  CG+ DET++H+
Sbjct  1032  GDDRSHDWIWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHL  1091

Query  4006  LMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWING--CPWGVTFIYTCWEI  4179
                C  A+ CW     P++FQ S    + SW+K   C+S   +G    W + F Y  W +
Sbjct  1092  FRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMK-AACSSQQKDGYSTNWSLIFPYILWNL  1150

Query  4180  WKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKF  4359
             WKARN+ +F+N  +AP DI+ R+   + +   +   +  +      WV W PP  G+ K 
Sbjct  1151  WKARNRLVFDNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKL  1210

Query  4360  NTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
             N+DGA K ++ LASAGGL R+  G W+ G+  NIG +NSF AELWGLRE
Sbjct  1211  NSDGACKSHSHLASAGGLLRNENGLWVAGYTCNIGTANSFLAELWGLRE  1259



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1192 (50%), Positives = 805/1192 (68%), Gaps = 11/1192 (1%)
 Frame = +1

Query  949   WRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAP  1128
             W+ ++ N +VI + SQAIH L S    N  ++FAY+RPN  AK  FW  C   ++   +P
Sbjct  605   WKPAL-NLSVISHNSQAIHTLASHRLGNCFITFAYIRPNTFAKCGFWEYCKQLANSIQSP  663

Query  1129  WIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTV  1308
             W+++GD NDIA + EQWGSSS+N +   NFV+++S CGLLD G+SG +++W R  G R V
Sbjct  664   WMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGPNFTWCRFIGNRVV  723

Query  1309  QRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWL  1488
             QRR+LDR LWN+ AQ  FPEAK  +LPR  SDH+P+ FL EAGNPP R  RP RFE AWL
Sbjct  724   QRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPDRSLRPVRFEAAWL  783

Query  1489  TREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESV  1668
             T EDY+ IW         ++   I+  T  S  WN+  FGNIF RK  ++ RI G+Q + 
Sbjct  784   TSEDYKHIWKEATEREGSNLEDIIATATQKSLLWNRNVFGNIFNRKRKIENRILGIQRAW  843

Query  1669  FYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRS  1848
              YNTS  LQ LE++L++ELNEVL QEE LWFQK+R  WI++GDRNT FYH+S LI+RNR+
Sbjct  844   NYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTTFYHRSALIKRNRN  903

Query  1849  RIRMLKINGEWNSDFKTISDHISNFFIDLFGR-----KNIMDGSPNDMYCGPKLDTGQMH  2013
             R+R LK+ G W  D   +++HI NFF  LF R     +    G P D     ++   Q  
Sbjct  904   RVRFLKLQGAWTDDADLLTEHIINFFSTLFCRVDRDSQPPRQGLPMDF----QIPRDQAS  959

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              L R  ++ EVKKAVF MKK+GSPGPDGI A FYQ FW EV   +T  V     +G    
Sbjct  960   TLLRRASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTDMVNHAFENGSTYI  1019

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
               L++F+TLIPKKD+PETA+DFRPITL NVSFK+ISKV+VNR+RPIM N+IGP QNSFLP
Sbjct  1020  SQLQAFMTLIPKKDTPETAADFRPITLPNVSFKVISKVLVNRLRPIMSNIIGPHQNSFLP  1079

Query  2374  GRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             GRST DN+ILTQE+VH M   + KK  M +K+DL KAYDS+ W++LE TL DFGFP+ LI
Sbjct  1080  GRSTMDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLEETLEDFGFPRRLI  1139

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
              LI+FS++ESS+++LWNG +  PF+PGRGLRQGDPL PYLF L MERL+ DIQ +V  + 
Sbjct  1140  DLILFSLQESSLAILWNGGRPPPFKPGRGLRQGDPLVPYLFNLVMERLAHDIQTRVNART  1199

Query  2734  WKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC  2913
             WKP+ ++RGGTG+SHLFFA+DLMLF EASE Q +++ +CL  FS  SGL +N SKS +FC
Sbjct  1200  WKPVHITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSDASGLKVNFSKSLLFC  1259

Query  2914  SPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNM  3093
             S N N+ +KR + ++  + V+++LGTYLGIP+L +RVS++TF  ++D M+ KL++WK + 
Sbjct  1260  SSNVNAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASS  1319

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             L++AGRR LVQ++L+++P YTMQV  LP  TCN+ID+ CR+FLWG     +K+H V W +
Sbjct  1320  LNMAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAE  1379

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIAN  3453
             ICK ++ GGLGLR   DFN A L K+AWQ+ ++ DKLWVKV+REKYVKN +F      +N
Sbjct  1380  ICKPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKYVKNADFLHLQSQSN  1439

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVS  3633
              SWGWRSIM+G+ ++     W +GNG  +NFW+DWW GD PLA   +       ++ KV 
Sbjct  1440  CSWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVE  1499

Query  3634  DFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI  3813
             D     R W+   L ++LP ++ID +RATPIA+  +  D   WP S TG  +V SA+S I
Sbjct  1500  DLTTSQRRWDTGALHNILPINMIDMVRATPIAINSEQEDFPSWPHSTTGMVTVSSAYSLI  1559

Query  3814  AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDET  3993
             AG+D D     W+W+   TE+ +LF+W +++  L+ N+ER R+G+ +   C  CG+ DET
Sbjct  1560  AGHDGDGRSHDWIWRATCTEKIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDET  1619

Query  3994  MNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWIN-GCPWGVTFIYTC  4170
             ++H+   C  A+ CW     P++FQ S    + SW+K  C +      G  W + F Y  
Sbjct  1620  LDHLFRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYIL  1679

Query  4171  WEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGW  4350
             W +WKARN+ +F+N  +AP DI+ R+   + +   +   +  +      WV W PP  G+
Sbjct  1680  WNLWKARNRLVFDNNITAPSDILNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGF  1739

Query  4351  IKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
              K N+DGA K ++ LASAGGL R+  G W+ G+  NIG +NSF AELWGLRE
Sbjct  1740  TKLNSDGACKSHSHLASAGGLLRNENGLWVAGYTCNIGTANSFLAELWGLRE  1791



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/1202 (38%), Positives = 654/1202 (54%), Gaps = 49/1202 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               WR  +    V+ ++ Q IH         + +   Y  P    +   W          +
Sbjct  555   ILWRDQLGVITVLESSDQFIHVKGVFGTETLHIIAVYAAPTVSRRSGLWRQLKRVLENID  614

Query  1123  APWIMMGD-FNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
              P +M+GD  ND++                           L+DMG  G SY+W R +  
Sbjct  615   EP-VMVGDWINDLS---------------------------LVDMGFKGNSYTWKRGKDT  646

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             R    ++LDR L + + +  + EA+   LP   SDH PL    E         RPFRFE 
Sbjct  647   RNFVAKRLDRVLCSAQTRVRWQEAEVAHLPFLASDHAPLYVQLEPEQKGNPRRRPFRFEA  706

Query  1480  AWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
             AWL  + ++++    W N  +    A++ +    KKWNKE FG++  RK  L   IK VQ
Sbjct  707   AWLKHDGFKELLSASW-NREMSTSEALAALKVKLKKWNKEIFGDVHKRKEKLLCEIKEVQ  765

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
             E+V  N S  L + E  L  E + VL+QEE+LW+QKSR  WI  GDRNT +YH +T++RR
Sbjct  766   EAVERNPSDALLLREEALHKEFDVVLEQEEVLWYQKSREKWIVLGDRNTNYYHTTTIVRR  825

Query  1840  NRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNI-MDGSPNDMYCGPKLDTGQMH  2013
              R+RI MLK + G W    + +     N++  L+  ++I +D     M    +L   ++ 
Sbjct  826   KRNRIEMLKDDEGHWIEQPEQLEKLAMNYYKRLYSTEDISLDTEKLPMVGFTELTRDELE  885

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              L +  +  E++ +V  M KF +PGPDG Q  FYQ  W+ V   +T    +  R G +  
Sbjct  886   SLNKPFSAVEMEASVRSMGKFKAPGPDGFQPIFYQESWDVVGESVTRCGLEFFRTGVLQK  945

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
              + ++ + LIPK   PE    FRPI+L NV FK I+K +V R++ +M  LIGP Q SF+P
Sbjct  946   GMNDAMLVLIPKVLKPEKIMQFRPISLCNVLFKTITKAMVMRLKTLMSKLIGPAQASFIP  1005

Query  2374  GRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             GR + DNI++ QE VH MR KKGKKG M +KLDL KAYD I W+FLE TL     PQ  I
Sbjct  1006  GRLSTDNIVIVQEAVHSMRRKKGKKGWMLLKLDLEKAYDRIRWDFLEDTLHAAKLPQTWI  1065

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
             + IM  V    +SLLWNGE+   F P RGLRQGDPL+PYLF+L MERL   I+  V  K 
Sbjct  1066  TWIMECVTNPGMSLLWNGERTEAFIPQRGLRQGDPLSPYLFVLCMERLCHQIELSVANKE  1125

Query  2734  WKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC  2913
             WKPI LSRGG  VSH+ FA+DL++FAEAS  Q R+I   L+KF G SG  +++ KS IF 
Sbjct  1126  WKPIKLSRGGPSVSHICFADDLIMFAEASVAQIRVIRKVLEKFCGASGQKVSLEKSLIFF  1185

Query  2914  SPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNM  3093
             S N + ++   + + +GI  + +LG YLG+P+L KR++K TFG I++ M  KLA WK   
Sbjct  1186  SENVHRDLTTLISDESGIKATKDLGKYLGMPVLQKRINKETFGTIIERMSSKLAGWKRRF  1245

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             LSLAGR TL +S LSS+PV+TM    LP  T N +D+I R F+WG    ++K HLV W  
Sbjct  1246  LSLAGRITLTKSVLSSIPVHTMSSIALPMSTLNQLDKIARSFIWGSVDGDRKQHLVAWEK  1305

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIAN  3453
             +CK +  GGLG+R   + N ALLAKL W+++ +HD LWV+++R+K+   +   ++ ++  
Sbjct  1306  VCKPRREGGLGIRSAKEMNIALLAKLGWRVLNTHDDLWVQILRKKFRVGEIHESSWLVPK  1365

Query  3454  ASWG--WRSIMRG-RSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA  3624
              +W   WRSI+ G    V  G  W +G+G  + FW D W   +PL  +  V IP+   EA
Sbjct  1366  GTWSPTWRSIILGVGECVVPGTCWILGDGRRVRFWKDNWLMQEPLQSLSTVDIPEELLEA  1425

Query  3625  KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             K  D     R W +  +   +  +    + +  I       D + W  S  G FSV+SA+
Sbjct  1426  KARDLWQSGRGWLIQCIEPYISMEHRLCLASVVIDDVTGARDRMSWGGSKDGLFSVKSAY  1485

Query  3805  SHIAGNDEDAMDTSW----VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCAT  3972
             + +  +++   + +     VW++ V ER R+FLWL+    ++TNMER R+ ++++ +C  
Sbjct  1486  ALLTKDEKPRPNMNAFYDRVWRVIVPERVRVFLWLVSHQVIMTNMERKRRHLSDNGMCQL  1545

Query  3973  CGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGV  4152
             C  G+ET+ H L +C  +   WRR   P   Q      L  W+  N  ++   NG  W  
Sbjct  1546  CKSGNETILHTLRDCPASMGLWRRLVDPSRQQRFFDQSLLQWLYENLTSAQSANGERWPT  1605

Query  4153  TFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFL--NKKCVHVG----KM  4314
              F  T W  WK R   +F  T   P     R   +   T EV L  NK  +H+     + 
Sbjct  1606  MFALTVWWCWKWRCGYVFGETGKCP----DRVKFVKDKTQEVTLANNKLRLHLAVGLREE  1661

Query  4315  RWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELW  4494
             R + W+ P  GW K NTDGA + N GLA+AGG+ RD  GEW  GF  NIG+ ++  AELW
Sbjct  1662  RHIKWRRPSNGWCKLNTDGASRGNPGLATAGGVMRDENGEWQGGFAVNIGICSATLAELW  1721

Query  4495  GL  4500
             G+
Sbjct  1722  GV  1723



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/1103 (40%), Positives = 619/1103 (56%), Gaps = 29/1103 (3%)
 Frame = +1

Query  1243  LLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKF  1422
             L+DMG SG  ++W R +   T   ++LDR L   +++  + EA+   LP   SDH PL  
Sbjct  3     LIDMGFSGNQFTWKRGKSASTFVAKRLDRVLCCAQSRLKWQEARVTHLPFLASDHAPLYL  62

Query  1423  LCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKET  1602
                         RPFRFE AWL   +++++    W   + D   A+  +    KKWNKE 
Sbjct  63    QLTPEVQGNACRRPFRFEAAWLQHSEFQELLTVSWDRDI-DTREALVRLGLKLKKWNKEV  121

Query  1603  FGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMW  1782
             FGN+  RK  L   IK +QE +  + S  L V E +L+ E   VL+QEE++WFQKSR+ W
Sbjct  122   FGNVQQRKEKLVTEIKEIQEKIEEDLSDELLVKEGELLKEFEIVLEQEEVIWFQKSRKKW  181

Query  1783  IQDGDRNTAFYHKSTLIRRNRSRIRMLKING-EWNSDFKTISDHISNFFIDLFGRKNIMD  1959
             +  GD+NT F+H ST+IRR R+R+ ML+ +  +W +D K +     N+F  L+  +N+  
Sbjct  182   VAHGDKNTKFFHMSTVIRRRRNRVEMLRNDANQWLTDAKELEKLAVNYFKTLYSLENVDT  241

Query  1960  GSPNDMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEV  2136
                +    G    T Q H  L R  +  EV+ AV  M  F +PGPDG Q  FYQ  WE V
Sbjct  242   EVQSLPMSGFVRLTSQEHTSLNRPFSAEEVEIAVRKMGSFKAPGPDGFQPVFYQRCWETV  301

Query  2137  KSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVN  2316
                + +F+ +    G++P    ++ + LIPK   PE+ + FRPI+L NV FKII+K +V 
Sbjct  302   GPSVISFILRFFEVGKLPENTNDALVVLIPKVSKPESITQFRPISLCNVLFKIITKAMVG  361

Query  2317  RMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSI  2496
             R++ +MK LIGP Q+SF+PGR +ADNI++ QE VH MR KKG+KG M +KLDL KAYD +
Sbjct  362   RLKGVMKKLIGPAQSSFIPGRLSADNIVVVQEAVHSMRKKKGQKGWMLLKLDLEKAYDRL  421

Query  2497  DWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLF  2676
              W+FLE TL   G P+  +  IM  V   S+S+LWNGEK   F+P RGLRQGDPL+PYL 
Sbjct  422   RWDFLEDTLRAAGLPEGWVGRIMECVSGPSMSILWNGEKTDSFKPSRGLRQGDPLSPYLL  481

Query  2677  ILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLK  2856
             +L M RL   I   V  K WKPI LSRGG  ++H+ FA+DL+LFAEAS  Q R+I + L+
Sbjct  482   VLCMGRLCHMIDRAVMDKKWKPIKLSRGGPQLTHICFADDLILFAEASVSQVRVIRDVLE  541

Query  2857  KFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHT  3036
              F   SG  +++ KS IF S N   E    +   +GIS +  LG YLG+PIL KR++K T
Sbjct  542   TFCRASGQKVSLPKSKIFFSGNVTRERGELISRESGISSTRELGKYLGMPILQKRINKET  601

Query  3037  FGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRD  3216
             FG +L+ +  +L+ WK   LSLAGR T+ ++ LSS+PV++M    +P  T + +D + R 
Sbjct  602   FGEVLEKVASRLSGWKKQTLSLAGRVTMTKAVLSSIPVHSMSTIHMPVSTLDKLDSLSRS  661

Query  3217  FLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKV  3396
             F+WG        HL+ W+ +C+ K  GGLG+R   D N ALLAK+ W+L+   + LW +V
Sbjct  662   FVWGSGQ-----HLISWDRVCRPKADGGLGIRVSRDMNKALLAKVGWRLLNDKEGLWARV  716

Query  3397  MREKYVKNKNFFATPMIA--NASWGWRSIMRG-RSIVELGAAWRIGNGLSLNFWSDWWTG  3567
             +R KY       ++ M+A  N S  WRS++ G R +V  G +W IGNG  + FW+D W  
Sbjct  717   LRSKYSVGDMHDSSWMVAGSNVSSTWRSVVMGIREVVAKGHSWVIGNGREIKFWTDKWLS  776

Query  3568  DKPLAFMDEVT--IPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQ  3741
              +PL  M EV   +P+        +  L    W++ ++S  +P +      A  +     
Sbjct  777   RQPL--MGEVLGDLPEGYENITARELWLDGGGWDLSRISPYIPDERRLERVAVVVDTVSG  834

Query  3742  VSDSLYWPRSPTGAFSVRSAFSHIAGND--EDAMDTSW--VWKMRVTERCrlflwllmrg  3909
             V D L W   P G F+V++A+  I  ++     M+  +  +W++   ER R+FLWL+   
Sbjct  835   VKDRLAWGEVPNGQFTVKTAYDLITRDNTPRQQMENLFKSMWRVVAPERVRVFLWLVGNQ  894

Query  3910  rllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPL  4089
              ++TN ER+R+ ++   +C  C  G ET+ HVL +C   +  W R       Q     PL
Sbjct  895   AIMTNAERYRRHLSGTDVCQVCKGGVETILHVLRDCPAMEGIWSRFVPSTKRQAFFSMPL  954

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDT  4269
               W+  N   +D  N  PW  TF    W  WK R   +F +      D ++   NL    
Sbjct  955   LEWLYRNLYDNDAQNEIPWATTFALGVWWGWKWRCGNVFGDN-RLWRDRVKFLRNLAR--  1011

Query  4270  VEVFLNKKCVHVGKMR------WVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
              EV   KK     + R       V W PP  GW+K NTDGA   N GLASAGG+ RD +G
Sbjct  1012  -EVMRAKKTEEESRARVQRVEIMVGWTPPRGGWMKLNTDGASHGNPGLASAGGVLRDGEG  1070

Query  4432  EWLFGFMTNIGVSNSFAAELWGL  4500
             EW  GF  NIG  ++  AELWG+
Sbjct  1071  EWCGGFALNIGRCSAPLAELWGV  1093



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/1168 (38%), Positives = 646/1168 (55%), Gaps = 26/1168 (2%)
 Frame = +1

Query  1042  SFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGS-SSVNPSRCLNF  1218
             S  Y  P+   ++  W +     +++  PW++ GDFN+ +   E+ GS SS    RC +F
Sbjct  104   SAIYASPDSTLRKELWRELEQIKNQYTGPWLLAGDFNETSSLCERNGSESSEMQRRCKDF  163

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
                     L+D+G +G +++W R     T +  +LDR L N E +  F E     LP++ 
Sbjct  164   ANWIENNALIDLGFTGPAHTWSRGLSPTTFKSARLDRGLANSEWKLKFTEGVVRNLPKSQ  223

Query  1399  SDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNL  1578
             SDH P+        P  R  +PFRF+ AWL  + + +   + W N+   +V  +    + 
Sbjct  224   SDHCPILISTSGFAPVPRIIKPFRFQAAWLNHQVFCEFVRKNW-NADAPIVPFLKSFADK  282

Query  1579  SKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLW  1758
               KWNKE F NIF +K+ L ARI GVQ  +       L  LE KL  E++ VL  EE LW
Sbjct  283   LNKWNKEEFYNIFRKKSELWARISGVQALLSTGRQNHLIKLEAKLRREMDIVLDDEETLW  342

Query  1759  FQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDL  1935
             FQKSR   I DGDRNT ++H ST+IRR+R+RI ML+ N GEW S+   +   +  ++  L
Sbjct  343   FQKSRMEAICDGDRNTRYFHLSTVIRRSRNRIDMLQNNDGEWISNPMEVKAMVLGYWKHL  402

Query  1936  FGRKNIMDG---SPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQA  2106
             F   ++       P D +  P++      K+ R ++  EV  A+  MK F +PGPDG Q 
Sbjct  403   FSEDSVQSNFCHLPRDFF--PQITADDFEKMMRPLSEVEVTLALKSMKPFKAPGPDGFQP  460

Query  2107  AFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVS  2286
              FYQ FW+ VK ++   V ++L     P    ++FI LIPK D P+ A  FRPI L N+ 
Sbjct  461   LFYQRFWDLVKPNVMHLVSEILSGRDFPEGFNDTFIVLIPKMDIPQLAKHFRPIGLCNIV  520

Query  2287  FKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIK  2466
             +KI++KVI+NR++PI+ +LI P Q SF+P R   DN+I+ QE+ H MR K+GKKG MA+K
Sbjct  521   YKIVTKVIINRLKPILPSLISPTQCSFVPNRQITDNVIIVQEMFHSMRNKQGKKGFMAVK  580

Query  2467  LDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLR  2646
             +D  KAYD + W F+  +L++   PQ+L+ ++M  V  +++ +LWNGE +    P RGLR
Sbjct  581   IDFEKAYDRLRWTFIRESLMELRIPQHLVDIVMNCVSSANLQILWNGEPMEKICPTRGLR  640

Query  2647  QGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASED  2826
             QGDPL+PYL+++ MERL+  I ++V   NWKP+  SR G  +S+L FA+DL+LF+EAS +
Sbjct  641   QGDPLSPYLYVICMERLAHLIDQEVTNGNWKPVKASRNGPPISNLAFADDLILFSEASVE  700

Query  2827  QGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIP  3006
             Q +++  CL +F   SG  +N  KS I+ S NT+ +I+  + N   +  + + G YLG+P
Sbjct  701   QAQVMKWCLDRFCEASGSKVNEDKSKIYFSANTHLDIRDAVCNTLAMEATADFGKYLGVP  760

Query  3007  ILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGT  3186
              ++ R SK  + Y++D +  KLA WK   LS+AGR TL+QSA SS+P YTMQ  KLP  T
Sbjct  761   TINGRSSKREYQYLVDRINGKLAGWKTKTLSIAGRATLIQSAFSSIPYYTMQSTKLPRST  820

Query  3187  CNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLV  3366
             C+DIDR  R FLWG+    ++VHLV W +I KSK  GGLG+R     N+A L KL W+L+
Sbjct  821   CDDIDRKSRSFLWGEQEGKRRVHLVAWENISKSKKEGGLGIRSMRQANSAFLVKLGWRLL  880

Query  3367  TSHDKLWVKVMREKYVKNK---NFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
                  LW +++R KY  N+   + F     +NAS  WR I+    +V  G    +GNG  
Sbjct  881   AEPSSLWSRILRAKYCDNRCDIDMFKEK--SNASSTWRGILSSIDVVRKGINSAVGNGAK  938

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRA  3717
               FW   W   +PL  +     P    +A V +       W VD  ++ LP   +  I A
Sbjct  939   TLFWHHRWATSEPLISLASPIPPIELQDATVKEMWDLVSGWKVDVFANYLPEATLKLIAA  998

Query  3718  TPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDT----SWVWKMRVTERCrl  3885
               +   E+  D +YW  SP+G F++ SA +     +   MD     S VWK+   +R R 
Sbjct  999   HELIDDEEAIDDIYWNGSPSGGFTIGSAMNITRNAELANMDAHPKWSAVWKIPTPQRVRF  1058

Query  3886  flwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSF  4065
             F+WL ++ RL+TN  R+ + +T+D  C  CG+ +E  +H+L  C  A+  WR+       
Sbjct  1059  FIWLAIQDRLMTNSNRFLRRLTDDPRCLVCGEVEENTDHILRRCPVARILWRKLGMLGEH  1118

Query  4066  QYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMD----  4233
                 +  L SW+  N  A D + G  W   F  +CW +W+ RN R F    S P+D    
Sbjct  1119  NREEIN-LGSWITKNLSA-DTMMGSEWLRVFAVSCWWLWRWRNDRCFNRNPSIPIDQVSF  1176

Query  4234  IMRRANNLTLDTVEVFLNKKCVHVGKMR--WVCWQPPETGWIKFNTDGAFKRNTGLASAG  4407
             I  R   +  + ++     K  H G+ +   V WQ P+ GW+K NTDGA K N G A  G
Sbjct  1177  IFARVKEIK-EAMDRNDTNKSQHSGRRKEILVRWQCPKEGWVKLNTDGASKGNPGPAGGG  1235

Query  4408  GLARDHKGEWLFGFMTNIGVSNSFAAEL  4491
             GL R  +GE    F  N G      AEL
Sbjct  1236  GLIRGPRGEIHEVFAINCGSCTCTKAEL  1263



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/1194 (35%), Positives = 644/1194 (54%), Gaps = 14/1194 (1%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W + +    V+  +SQ I  +V        ++  Y  P    +   W      S+  N
Sbjct  67    LLWNNEVVKLTVVACSSQTITAVVMDGQIQWMLTVVYASPCPRVRSHLWPYLDGVSAASN  126

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW++ GDFN++  + E+ G   VN +  L    + ++  L+D+G  G  ++W ++    
Sbjct  127   MPWLIAGDFNELMHSSEKKGGRPVNKNSGLGNWSARNS--LVDLGFIGAKFTWSKKNEHG  184

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +   +LDR L N+  ++LF EA    L +  SDH PL     + + P  + + FRF+  
Sbjct  185   EIVWERLDRGLCNIAWRHLFSEAYVRHLAKVKSDHCPLLIGLHSNHIPNPDLKAFRFQAM  244

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
             W+   ++       WS++  D       +++  + WN   FG IF +K  L ARI G+Q+
Sbjct  245   WMLHPEFEPFVNDTWSSAQGDASCKTIFLSSELQSWNHNVFGCIFQKKRRLLARICGIQK  304

Query  1663  SVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRN  1842
             ++       L  LE++L TE + +L+QEEL W QKSR  W+++GD+NT F+H S ++RR 
Sbjct  305   ALCICHVPYLFDLEKQLTTEYSTILEQEELFWLQKSRNTWLREGDKNTKFFHLSAVVRRR  364

Query  1843  RSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKL  2019
             ++++  L    G W  D +T+   + N+F DLF  +       N  +  P L    +  L
Sbjct  365   KNKLEGLNNSEGVWTEDKETLKSIVVNYFKDLFSFRITTTTMENLPHLFPCLIDEDLFVL  424

Query  2020  TREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKI  2199
               EVT  E+K  +F +    +PGPDGI A FYQ FW      +   VK      ++P  I
Sbjct  425   NGEVTDDEIKACMFAIGGLKAPGPDGIPARFYQKFWHLCGKDVCDMVKVCFNTTQLPDNI  484

Query  2200  LESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGR  2379
               +FI+LIPK D+P + +  RPI+L +  +K+ISK++V ++RP++  L+ P Q SF+PGR
Sbjct  485   NNTFISLIPKVDNPTSMTQLRPISLCSTLYKVISKILVGKLRPLLHKLVSPTQVSFVPGR  544

Query  2380  STADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISL  2559
                DN+I+ QEI+H  R  KGKKG +A K+DL KAYD + W F+   L + G    ++ L
Sbjct  545   QIIDNVIVAQEILHKYRNTKGKKGFIAWKIDLSKAYDRLQWSFIRDVLWEIGLRGKMLEL  604

Query  2560  IMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWK  2739
             IM  V   +   + NGE    F P  G+RQGDPL+PYLF+L ME+LS  I   +  K WK
Sbjct  605   IMQCVTTVNYQAIVNGELTDSFSPQCGIRQGDPLSPYLFVLCMEKLSHIINGCITTKKWK  664

Query  2740  PITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSP  2919
             P+ LSR G  VSHLFFA+DL+LFAEAS  Q +++ +CL  F   SG  +N  KS I+CSP
Sbjct  665   PVKLSRYGPPVSHLFFADDLILFAEASSTQAKLLKDCLDIFCAVSGQQVNFDKSCIYCSP  724

Query  2920  NTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLS  3099
             N +      + N+ G  ++ +LG YLG+P+LH RV+K T+G I++ ++R+L+ WK N LS
Sbjct  725   NISRSKAIEIANICGSPLTSDLGQYLGVPLLHSRVNKETYGNIVEKVQRRLSAWKSNTLS  784

Query  3100  LAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDIC  3279
             +AGR   +QS  S++P+Y+MQ  +LP   C+ ID++ R+FLWG +    KVHLV W  + 
Sbjct  785   MAGRLVYLQSVASAIPIYSMQSTRLPISICDKIDKLNRNFLWGHTEDKSKVHLVKWETVS  844

Query  3280  KSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA--TPMIAN  3453
               K  GGLGL+     N ALLAK  W+L+     LW +V++ KY+K+ +     +    N
Sbjct  845   TPKSMGGLGLKDTHAMNQALLAKTGWKLMQRDPGLWAQVLKGKYLKHHDMVGACSAKFTN  904

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVS  3633
              S  WR I+ G  I+  G  WR+G+G  ++FW D W     L     + +     E  V 
Sbjct  905   CSHTWRGILFGAQIIPNGMRWRVGSGSQIHFWKDNWLESGVLENFATIPLSADMLEWSVD  964

Query  3634  DFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI  3813
             DF L +  WNV+ L S LP DI++ I +  + +     D + W  + +G FSV++A+  +
Sbjct  965   DF-LTDDGWNVELLYSCLPPDIVEHIFSLHVGIANHREDKVIWSLTNSGTFSVKTAYLSL  1023

Query  3814  AGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGD  3987
              G D+D +   W  +WK+++  +   FLW +  G++LTN++R R+G T +  C  C + +
Sbjct  1024  FG-DDDIIPWKWNFIWKLKLPPKLVTFLWTIGHGKILTNVQRARRGFTNNPCCPICPNIE  1082

Query  3988  ETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNC---CASDWINGCPWGVTF  4158
             E+M+H+   C  +   W     P    +S     +SW+  N    C++  I+G PW + F
Sbjct  1083  ESMDHIFRSCKQSPFFWNGVGIPPEVAHSFALDFQSWMAINLRTQCST--IHGLPWNLIF  1140

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPP  4338
               T W  WK RN  +F +    P+   +       D  +   +       ++  + W  P
Sbjct  1141  ASTLWYCWKGRNNLVFNDGQQPPVSPQKFIFQFARDWYDANKSTSSKPPRQIISIHWIHP  1200

Query  4339  ETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
               G  K NTDG+        SAGGL R+ +G+W+ GF  N+G      AELWG+
Sbjct  1201  PIGRYKINTDGSCNDPFRHISAGGLIRNSEGDWIKGFAANLGRGTIMEAELWGV  1254



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/1167 (36%), Positives = 620/1167 (53%), Gaps = 64/1167 (5%)
 Frame = +1

Query  1048  AYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVES  1227
              Y  P    +   W          + P ++ GDFN I    E+ G +       L F + 
Sbjct  6     VYAAPTVSRRSGLWGQLKRVLENIDEPVMVGGDFNTILRLDERTGGNGRLSPDSLAFGDW  65

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
              +   L+DMG  G +++W R +  +    ++LDR   N +A+  + EA    LP   SDH
Sbjct  66    INELALVDMGFRGNTFTWRRGKETQNFVAKRLDRVFCNAQARVRWQEAVVSHLPFLASDH  125

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK  1587
              P+    E     + +                      ++ N +      + E+ ++ +K
Sbjct  126   APVYVQLEPEKKEKLKKWNKE-----------------IFGNVMKRKEKLLGEIKDIQEK  168

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQK  1767
               +    ++  R++ LQ                           EL+  L+QEE+LW+QK
Sbjct  169   LEQNPRDDLLLRESVLQ--------------------------KELDVALEQEEVLWYQK  202

Query  1768  SRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGR  1944
             SR  W+  GDRNT +YH ST++RR R+RI ML+  +G W    + +     +++  L+  
Sbjct  203   SREKWVVLGDRNTKYYHTSTIVRRKRNRIEMLRDEDGRWIDQSEELEKLAISYYKRLYST  262

Query  1945  KNI-MDGS--PNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFY  2115
             +++ +D    P   + G   +  Q+  L    +  E++ +V  M KF +PGPDG Q  FY
Sbjct  263   EDLNLDTRKLPQQGFTGFTREEVQI--LDEPFSEVEIEASVKSMGKFKAPGPDGFQPVFY  320

Query  2116  QTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKI  2295
             Q  WE V + +T F  +    G +   + ++ + LIPK   PE    FRPI+L NV FKI
Sbjct  321   QDSWEVVGASVTRFGLEFFESGVLTEGMNDALVVLIPKVLKPERIMQFRPISLCNVLFKI  380

Query  2296  ISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDL  2475
             I+K +V R++ +M  LIGP Q SF+PGR ++DNI++ QE VH MR KKG++G M +KLDL
Sbjct  381   ITKTMVLRLKKLMSKLIGPSQASFIPGRLSSDNIVIVQEAVHSMRRKKGRRGWMLLKLDL  440

Query  2476  HKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGD  2655
              KAYD I W+FLE TL     P   I  IM  V    +SLLWNGE+   F+P RGLRQGD
Sbjct  441   EKAYDRIRWDFLEDTLNAARLPPVWIKWIMECVTNPGMSLLWNGERTEAFKPQRGLRQGD  500

Query  2656  PLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGR  2835
             PL+PYLF+L MERL   I+  V  ++WKPI LSRGG  +SH+ FA+DL+LFAEAS  Q R
Sbjct  501   PLSPYLFVLCMERLCHQIEFAVAKEDWKPIKLSRGGPALSHICFADDLILFAEASVSQVR  560

Query  2836  MIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILH  3015
             +I   L+ F   SG  +++ KS IF S N + ++   + N +GI  +  LG YLG+P+L 
Sbjct  561   VIRKVLENFCEASGQKVSLEKSVIFFSENVHRDLATLISNESGIKGTKELGKYLGMPVLQ  620

Query  3016  KRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCND  3195
             K+++K TFG +++ +  KLA WK   LSLAGR TL +S +SS+PV+TM    LPA T   
Sbjct  621   KKINKETFGEVVEKVSSKLAGWKRKFLSLAGRITLTKSVISSIPVHTMSTIALPASTLGQ  680

Query  3196  IDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSH  3375
             +D+I R F+WG S  N+K HL+ W  IC  K  GGLG+RK  + N ALL KL W+L+ +H
Sbjct  681   LDKIARSFIWGSSEGNRKQHLIAWEKICTPKREGGLGIRKAKEMNVALLGKLGWRLLNTH  740

Query  3376  DKLWVKVMREKYVKNKNFFATPMIANASWG--WRSIMRG-RSIVELGAAWRIGNGLSLNF  3546
             D LWV+++++K+   + +    M++  +W   WRS++ G R +V  G  W +G+G  + F
Sbjct  741   DALWVRILQKKFRVGELYDPCWMVSRGNWSPTWRSLILGIREVVVPGTCWILGDGRRVRF  800

Query  3547  WSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPI  3726
             W D W  D+PL  +    IP+   EAK  D       W    +   +     + +R   +
Sbjct  801   WRDNWLLDQPLYELSTADIPEEIIEAKARDLWQHGTGWLTQLMEPYMSTH--NSLRLASV  858

Query  3727  AVCEQVS--DSLYWPRSPTGAFSVRSAFSHIAGN--DEDAMDTSW--VWKMRVTERCrlf  3888
              + E     D + W  S  G FSV+SA++ +  N      M+  +  VW++ V ER R+F
Sbjct  859   VIDEVTGARDRMSWSGSNDGQFSVKSAYTFLTKNVVPRQNMEALYRRVWRVAVPERTRVF  918

Query  3889  lwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ  4068
             LWL+    ++TNMER R+ +++ ++C  C +GDET+ HVL +C  A   W R   P   Q
Sbjct  919   LWLVSHQVIMTNMERKRRHLSDSSVCLLCKNGDETILHVLRDCPAAAGLWLRIVTPSRRQ  978

Query  4069  YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRA  4248
                  PL  W+  N  +   ++G  W   F  T W  WK R   +F        D +   
Sbjct  979   RFFELPLLEWLYENLASDSSVSGDQWPTLFALTVWWCWKWRCGYVFGEVGKC-RDRVEFV  1037

Query  4249  NNLTLDTVEVFLNKKCVHVGKMR---WVCWQPPETGWIKFNTDGAFKRNTGLASAGGLAR  4419
              +   + +  + N +    G +R    + W  PE+ W+K NTDGA + N GLA+AGG+ R
Sbjct  1038  RDKAKEVLAAYKNLRVHSPGGLRVEKQIAWHRPESNWVKLNTDGAARGNPGLATAGGVVR  1097

Query  4420  DHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             D  G W  GF  NIG+ ++  AELWG+
Sbjct  1098  DEYGTWRGGFAINIGICSAPLAELWGV  1124



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/1175 (37%), Positives = 622/1175 (53%), Gaps = 86/1175 (7%)
 Frame = +1

Query  1048  AYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVES  1227
              Y  P+   +   W +     +    P ++ GDFN I    E+ G +       L F + 
Sbjct  6     VYAAPSVSRRSGLWGELKDVVNGLEGPLLIGGDFNTILWVDERMGGNGRLSPDSLAFGDW  65

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
              +   L+D+G  G  ++W R     TV  ++LDR      A+  + EA    LP   SDH
Sbjct  66    INELSLIDLGFKGNKFTWRRGRQESTVVAKRLDRVFVCAHARLKWQEAVVSHLPFMASDH  125

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK  1587
              PL    E                  L +   R                          K
Sbjct  126   APLYVQLEP-----------------LQQRKLR--------------------------K  142

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQK  1767
             WN+E FG+I  RK  L A IK VQ+ +    S  L   E  L+ E++ VL+QEE LWFQK
Sbjct  143   WNREVFGDIHVRKEKLVADIKEVQDLLGVVLSDDLLAKEEVLLKEMDLVLEQEETLWFQK  202

Query  1768  SRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGR  1944
             SR  +I+ GDRNT F+H ST+IRR R+RI  LK + + W +D   +      ++  L+  
Sbjct  203   SREKYIELGDRNTTFFHTSTIIRRRRNRIESLKGDDDRWVTDKVELEAMALTYYKRLYSL  262

Query  1945  KNIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQ  2118
             +++ +   N +  G    +   +   L +  T  EV  AV  M +F +PGPDG Q  FYQ
Sbjct  263   EDVSE-VRNMLPTGGFASISEAEKAALLQAFTKAEVVSAVKSMGRFKAPGPDGYQPVFYQ  321

Query  2119  TFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKII  2298
               WE V   +T FV +    G +P    ++ + LI K   PE    FRP++L NV FKII
Sbjct  322   QCWETVGPSVTRFVLEFFETGVLPASTNDALLVLIAKVAKPERIQQFRPVSLCNVLFKII  381

Query  2299  SKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLH  2478
             +K++V R++ ++  LIGP Q SF+PGR + DNI+L QE VH MR KKG+KG M +KLDL 
Sbjct  382   TKMMVTRLKNVISKLIGPAQASFIPGRLSIDNIVLVQEAVHSMRRKKGRKGWMLLKLDLE  441

Query  2479  KAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDP  2658
             KAYD + W+FL+ TL   G  +   S IM  V + S+S+LWNGE+   F P RGLRQGDP
Sbjct  442   KAYDRVRWDFLQETLEAAGLSEGWTSRIMAGVTDPSMSVLWNGERTDSFVPARGLRQGDP  501

Query  2659  LAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRM  2838
             L+PYLF+L +ERL   I+  V  + WKPI +S GG+ +SH+ FA+DL+LFAEAS  Q R+
Sbjct  502   LSPYLFVLCLERLCHLIEASVGKREWKPIAVSCGGSKLSHVCFADDLILFAEASVAQIRI  561

Query  2839  IMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHK  3018
             I   L++F   SG  +++ KS IF S N + E+++ +   +GI  +  LG YLG+PIL K
Sbjct  562   IRRVLERFCEASGQKVSLEKSKIFFSHNVSREMEQLISEESGIGCTKELGKYLGMPILQK  621

Query  3019  RVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDI  3198
             R++K TFG +L+ +  +LA WKG  LSLAGR TL ++ LSS+PV+ M    LP  T + +
Sbjct  622   RMNKETFGEVLERVSARLAGWKGRSLSLAGRITLTKAVLSSIPVHVMSAILLPVSTLDTL  681

Query  3199  DRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHD  3378
             DR  R FLWG + + KK HL+ W  ICK K  GG+GLR   D N AL+AK+ W+L+   +
Sbjct  682   DRYSRTFLWGSTMEKKKQHLLSWRKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKE  741

Query  3379  KLWVKVMREKYVKNKNFFATPMIANASWG--WRSIMRG-RSIVELGAAWRIGNGLSLNFW  3549
              LW +V+R+KY        + +     W   WRS+  G R +V  G  W  G+G ++ FW
Sbjct  742   SLWARVVRKKYKVGGVQDTSWLKPQPRWSSTWRSVAVGLREVVVKGVGWVPGDGCTIRFW  801

Query  3550  SDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIA  3729
              D W   +PL  +    IP+ +     +D+ LP   WN++ L   LP  +   + +  + 
Sbjct  802   LDRWLLQEPLVELGTDMIPEGERIKVAADYWLPGSGWNLEILGLYLPETVKRRLLSVVVQ  861

Query  3730  VCEQVSDSLYWPRSPTGAFSVRSAFSHIAGN--DEDAMDTSW--VWKMRVTERCrlflwl  3897
             V     D + W  +  GAF+VRSA+S + G+  D   M + +  +WK+   ER R+F+WL
Sbjct  862   VFLGNGDEISWKGTQDGAFTVRSAYSLLQGDVGDRPNMGSFFNRIWKLITPERVRVFIWL  921

Query  3898  lmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRT-----HHPVS  4062
             + +  ++TN+ER R+ ++E+ +C+ C   +ET+ HVL +C   +  WRR      HH   
Sbjct  922   VSQNVIMTNVERVRRHLSENAICSVCNGAEETILHVLRDCPAMEPIWRRLLPLRRHHEF-  980

Query  4063  FQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMR  4242
             F  SL+     W+  N    D + G  W   F    W  WK R   +F         I R
Sbjct  981   FSQSLL----EWLFTNM---DPVKGI-WPTLFGMGIWWAWKWRCCDVF-----GERKICR  1027

Query  4243  RANNLTLDTVEVFLNKKCVHVGKM----------RWVCWQPPETGWIKFNTDGAFKRNTG  4392
                    D  E     + VHVG +          R + WQ P  GW+K  TDGA + N G
Sbjct  1028  DRLKFIKDMAE---EVRRVHVGAVGNRPNGVRVERMIRWQVPSDGWVKITTDGASRGNHG  1084

Query  4393  LASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWG  4497
             LA+AGG  R+ +GEWL GF  NIG   +  AELWG
Sbjct  1085  LAAAGGAIRNGQGEWLGGFALNIGSCAAPLAELWG  1119



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/1196 (33%), Positives = 609/1196 (51%), Gaps = 78/1196 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W + +    V+  +SQ I  +V    +   ++  Y  P    +   W      S+  N
Sbjct  195   LLWNNEVVKLTVVACSSQTITAVVLDGQTQWMLTVVYASPCPRVRSHLWPYLDGVSAASN  254

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCL-NFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
              PW++ GDFN++  + E+ G   VN +  L N++   S   L+D+G  G  ++W ++   
Sbjct  255   MPWLIAGDFNELIHSSEKKGGRPVNKNSGLGNWISRNS---LVDLGFIGAKFTWSKKNEY  311

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
               +   +LDR L N+  ++L+ EA    L + +SDH PL     + + P  + + FRF+ 
Sbjct  312   GDIVWERLDRGLCNIAWRHLYSEAYVRHLAKVNSDHCPLLIGLXSXHIPXPDLKAFRFQA  371

Query  1480  AWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
              W+  +++       W+++  D       +++  + WN   FG IF +K    ARI G+Q
Sbjct  372   MWMLHQEFEXFVNDTWNSAQGDASCKSITLSSALQSWNHNVFGCIFQKKRRXLARICGIQ  431

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
             +++       L  LE +L  E N +L+QEEL W QKSR  W+++GD+NT F+H S ++RR
Sbjct  432   KALCVRHVPYLFALENQLTNEYNTILEQEELFWLQKSRNTWLREGDKNTKFFHLSAVVRR  491

Query  1840  NRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK  2016
              ++++       G W  + + +   + N+F DLF  +       +  +  P L    +  
Sbjct  492   RKNKLEGXNNSEGVWTBEKENLKSIVVNYFKDLFSFRITTTXMESLPHLFPCLSGEDLAI  551

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             L  EVT  E+K  +F +    +PGPDGI A FYQ FW      I+  VK      ++P  
Sbjct  552   LNGEVTDDEIKDCMFAIGGLKAPGPDGIXARFYQKFWHLCGKDISDMVKVCFNSTQLPDN  611

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
             I  +FI+LIPK D+P + +  RPI+L +  +K+ISK++V ++RP+   L+ P Q SF+PG
Sbjct  612   INNTFISLIPKVDNPTSMTQLRPISLCSTLYKVISKILVGKLRPLXHKLVSPTQVSFVPG  671

Query  2377  RSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLIS  2556
             R   D +I+ QEI+H  R  KGKKG +A K+DL KAYD + W F+   L + G    ++ 
Sbjct  672   RQIIDXVIVAQEILHKYRNTKGKKGFIAWKIDLSKAYDRLQWSFIRDVLWEIGLRGKVLE  731

Query  2557  LIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNW  2736
             LIM  V       + NGE    F P  G+RQGDPL+PYLF+L ME+L   I   +  K W
Sbjct  732   LIMQCVTTVKYQAIVNGEITDSFSPHCGIRQGDPLSPYLFVLCMEKLXHIIXGCITTKKW  791

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
             KP+ L R G  VSHLFFA+DL+LFAEAS  Q R++ +CL  F   SG  +N  KS I+CS
Sbjct  792   KPVKLXRNGPSVSHLFFADDLILFAEASSTQARILKDCLDIFCDVSGQQVNFDKSCIYCS  851

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
             PN +      + N+ G  ++ +LG YLG+P+LH RV+K T+G I++ ++R+L+ WK N L
Sbjct  852   PNISRSKAXEIANICGSPLTSDLGHYLGVPLLHSRVNKETYGNIVEKVQRRLSAWKSNTL  911

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S+AGR   +QS  S++P+Y+MQ  +L    C+ ID++ R+FLWG + +N KVHLV W  +
Sbjct  912   SMAGRLVYLQSVXSAIPIYSMQSTRLXISICDKIDKLNRNFLWGHTEENSKVHLVKWETV  971

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA--TPMIA  3450
             C  K  GGLGL+     N ALLAK  W+L+      W +V++ KY+K+ +  +  +    
Sbjct  972   CTPKFMGGLGLKDTHVMNQALLAKTXWKLMQRDSGJWAQVLKGKYLKHYDXVSACSAKYT  1031

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKV  3630
             N S  W  I+ G  I+  G  WR+G+G  ++FW D W     L     +++ D   +  V
Sbjct  1032  NCSHTWXGILFGAQILPNGMRWRVGSGSQIHFWKDNWLECGVLXDFXTISLSDDMLDXTV  1091

Query  3631  SDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSH  3810
              DF L +  WNVD L S LP D+++ I                        FS+      
Sbjct  1092  EDF-LTBSGWNVDLLYSCLPPDVVEHI------------------------FSLHVG---  1123

Query  3811  IAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDE  3990
             IA + ED                                +R ++G T D  C  C   +E
Sbjct  1124  IANHRED--------------------------------KRAKRGFTNDPCCPICPTVEE  1151

Query  3991  TMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNC---CASDWINGCPWGVTFI  4161
             + +H+   C  +   W     P+   +S     +SW+  N    C++  I+G PW + F 
Sbjct  1152  SXDHIFRYCRHSPSFWNNVGIPLEVAHSFALDFQSWMAINLRTHCST--IHGLPWNLIFA  1209

Query  4162  YTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVC---WQ  4332
              T W  WK RN   F N    P+  ++       D  +     KC      R +    W 
Sbjct  1210  STLWYCWKRRNNFXFNNGQQPPVSPLKVIFQFARDWYDA---NKCXSSKPPRQIISIHWI  1266

Query  4333  PPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
              P  G  K NTDG+ K      SAGGL R+ +G+W+ GF  N+G      AELWG+
Sbjct  1267  RPPIGRYKINTDGSCKDXFSHISAGGLIRNSEGDWIXGFAANLGRGTXMEAELWGV  1322



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/1185 (34%), Positives = 615/1185 (52%), Gaps = 25/1185 (2%)
 Frame = +1

Query  973   AVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFN  1152
             A+ +  S     L++G H+   VS          + ++W D    S     PW++ GD N
Sbjct  91    ALFKLRSDIPEVLLTGMHAPSVVS---------ERNKYWVDLTEDSPPRGTPWLVAGDMN  141

Query  1153  DIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRA  1332
             ++    E+ G   V   +     +  +A  LLD+G  G  ++W     G ++ + +LDRA
Sbjct  142   EVLHGNEKMGGRQVGKEQGKQCKDWIAANALLDLGFQGPKFTWTNGRTGGSLIKERLDRA  201

Query  1333  LWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI  1512
             L N E  +LFP+ K I LPRT SDH PL  L              +    W    D+ ++
Sbjct  202   LVNSEWLDLFPDTKVIHLPRTFSDHCPLLILFNENPRSESFPFRCKE--VWAYHPDFTNV  259

Query  1513  WGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGL  1692
                 W +     V A     +  K W+K  FG+IF +K  + AR+ G+Q+S+  + S  L
Sbjct  260   IEETWGSHHNSYVAARDLFLSSVKSWSKYVFGSIFQKKKRILARLGGIQKSLSIHPSVFL  319

Query  1693  QVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-I  1869
               LE  L+ ELNE+ KQE + W QK+     + GD NT ++H    IR  + +I  LK  
Sbjct  320   SKLEIDLLVELNELSKQERVFWAQKAGIDRAKLGDMNTKYFHTLAKIRTCKRKISCLKND  379

Query  1870  NGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVK  2049
             N +W S+ + +   + + F  +F          N      ++      +L R V   E+K
Sbjct  380   NHDWVSNNEDLKKMMMSHFEKIFTTSMYSHQRNNSFRGECRISDEWNKRLARRVEEDEIK  439

Query  2050  KAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPK  2229
             +A+  M    SPGPDGIQA F++ +WE++   + + + +   + R+P  + +SF+ LIPK
Sbjct  440   EALAQMAPLKSPGPDGIQAFFFKKYWEQMGPSVVSLIIRAFENNRIPSGLSDSFLALIPK  499

Query  2230  KDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQ  2409
              +SP    DFRPI L N  +K+I+KVI NR++PI+  LI P Q SF+PGR+  +NII+ +
Sbjct  500   IESPVCCKDFRPIGLCNTVYKMITKVIANRIKPILGELIHPSQTSFVPGRNIQENIIIAK  559

Query  2410  EIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSI  2589
             E+    +    K+ +MA+K+DL KAYDS++W F+  TL  F FPQ+LI+LIM  +   +I
Sbjct  560   EMAFLFKKSNPKRNIMALKIDLSKAYDSLEWGFIRETLQGFNFPQSLIALIMDCISSPAI  619

Query  2590  SLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTG  2769
             SL+WNGE    F P RG+RQGDPL+PY+F+L MERLS  I +++R  +WKPI +S    G
Sbjct  620   SLIWNGEVTQSFSPSRGIRQGDPLSPYIFVLCMERLSMLISDRIRDGSWKPIKIS-SDLG  678

Query  2770  VSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGL  2949
             VSH+F+A+D+ LF +AS   G +I N L++F   SGL +N+SKS     P  N + +R L
Sbjct  679   VSHIFYADDVFLFGQASVRNGGVIQNVLEEFGNISGLRVNMSKSLAIFPPKMNPQRRRML  738

Query  2950  KNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQS  3129
              +   +  S + G YLG  IL  ++ +  +  +L+ +K  +  W+   L++AGR TL++S
Sbjct  739   ADFLTMKGSTSFGKYLGCNILPNKLRRGDYDGLLEKVKSAINGWQAKYLNMAGRCTLIKS  798

Query  3130  ALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGL  3309
              +SS PVY MQ   LP    N+I++ CR FLW    ++  +  + W+ IC     GGLG 
Sbjct  799   VVSSFPVYGMQSSLLPVSVMNEIEKDCRKFLWNKMDKSHYLARMSWDRICSPTGKGGLGF  858

Query  3310  RKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGR  3489
             R+  ++N A +AKL W ++    KLWV++++ +Y +  +F +     + S  WR I++GR
Sbjct  859   RRLHNWNLAFMAKLGWMIIKDETKLWVRILKARYWERGSFLSAVGKNHHSPIWRDIVKGR  918

Query  3490  SIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVD  3669
              ++E G   RIGNG S + W  WW G  PL  +    IP+  S  +VS+ I   R W+  
Sbjct  919   ELLEKGLVRRIGNGRSTSLWYHWWVGGGPLVDVMGSNIPEFMSHWQVSNIIKRGR-WDTK  977

Query  3670  KLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDED-AMDTS  3846
             K+S LLP DI+  I+  P+A   +V D   W     G FSV+SA+  I   +E+     S
Sbjct  978   KISHLLPPDILKQIKEIPLASMSEVEDDFTWNFEKNGTFSVKSAYYLINRREEETGGKGS  1037

Query  3847  W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECS  4020
             W  +W+  +  + +L +W  +   L T +   ++    +  C  C    E M H+  +C 
Sbjct  1038  WRGLWRKNIPFKYKLLIWNGIHNILPTALFLAKRIHNFNPQCVACDHPIEDMIHLFRDCC  1097

Query  4021  FAKDCW---RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKAR  4191
              A   W    + H P +         + W+  N    D+     W   F    W IW +R
Sbjct  1098  VASSVWIEILKHHKPNNQNLFFNLEWEEWIDFNLNQHDY-----WVTKFTTAFWHIWCSR  1152

Query  4192  NQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDG  4371
             N+ +FE   + P     R        +  F        G    + W+PP  G++K NTDG
Sbjct  1153  NKTVFECAVNHPKFTYNRVVADFFTNIRAFQVNNTQGNGSKVVLRWKPPHQGFLKLNTDG  1212

Query  4372  AFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
             A+K +   A  GG+ RD  G W  GF   +   +  AAEL  +RE
Sbjct  1213  AWKADWENAGIGGVFRDAVGNWELGFAKRVDAGSPEAAELMAIRE  1257



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/1156 (36%), Positives = 602/1156 (52%), Gaps = 62/1156 (5%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               WR       ++ ++ Q IH  V      + +   Y  P    +   W    +   + +
Sbjct  526   LLWRDQACAITIVGSSDQYIHARVVIGTELIHIIAVYAAPTVSRRSGLWGQLKAVLEDID  585

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              P ++                                   L+DMG  G +++W R +   
Sbjct  586   EPVLV----------------------------------ALVDMGFKGSTFTWRRGKESH  611

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
                 ++LDR L N + +  + EA    L    SDH P+    E         RPFRFE A
Sbjct  612   NFVAKRLDRVLCNAQTRVRWQEAVVSHLLFLASDHTPIYVQLEPVRKGNPRRRPFRFEAA  671

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
             WL  + ++++    W N  +    A+  +    KKWNKE FGN+  RK  L   IK +QE
Sbjct  672   WLKHDGFKELLLASW-NGEMSTPEALVSLKEKLKKWNKEIFGNVTIRKEKLLGEIKEIQE  730

Query  1663  SVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRN  1842
              +  N +  L   E  L  E + VL+QEE+LW+QKSR  WI  GDRNT FYH +T++RR 
Sbjct  731   ELERNPNDMLIARETVLQKEFDIVLEQEEVLWYQKSREKWIVLGDRNTKFYHTTTIVRRK  790

Query  1843  RSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNI-MDGSPNDMYCGPKLDTGQMHK  2016
             R+RI MLK  NG W    + +      ++  L+  ++I MD           L + ++  
Sbjct  791   RNRIEMLKDENGRWIEQSEELEKLAIEYYKRLYSTQDISMDTDKLPQQGFTDLKSDELEC  850

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             L +  +  +++ +   M K+ +PGPDG Q  FYQ  W+ V   +  F  +    G++   
Sbjct  851   LIKPFSAADMEASARSMGKYKAPGPDGFQPVFYQDSWDVVGESVARFGLEFFESGKLTEG  910

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
             + ++ + LIPK   PE  + FRPI+L NV FKII+K +V R++ +M  LIGP Q SF+PG
Sbjct  911   MNDAMVVLIPKVLKPERIAQFRPISLCNVLFKIITKAMVLRLKSLMPVLIGPAQASFIPG  970

Query  2377  RSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLIS  2556
             R + DNI++ QE VH MR KKG+KG M +KLDL KAYD I W+FLE TL     PQ  I 
Sbjct  971   RLSTDNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRIRWDFLEDTLYAAKLPQVWIK  1030

Query  2557  LIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNW  2736
              IM  V    +SLLWNGE+   F P RGLRQGDPL+PYLF+L MERL   I+  V  K W
Sbjct  1031  WIMECVMNPGMSLLWNGERTEAFTPQRGLRQGDPLSPYLFVLCMERLCHLIEFSVAKKEW  1090

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
             KPI LSRGG  +SH+ FA+DL+LFAEAS  Q R+I   L+ F G SG  +++ KS IF S
Sbjct  1091  KPIRLSRGGPSLSHICFADDLILFAEASISQIRVIRKVLESFCGASGQKVSLEKSLIFFS  1150

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
              N + ++   + + +GI  + +LG YLG+P+L KR++K TFG +++ +  KLA WK   L
Sbjct  1151  ENVHRDLASAISHESGIKGTKDLGKYLGMPVLQKRINKETFGAVIEKVSSKLAGWKRRFL  1210

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             SLAGR TL +S LSS+PV+TM    LP+ T N +D+I R F+WG     +K HLV W  I
Sbjct  1211  SLAGRITLTKSVLSSVPVHTMSTIALPSSTLNQLDKIARAFIWGSIDGTRKQHLVSWEKI  1270

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANA  3456
             CK K  GGLG+R   + N ALLAKL W+++ + D LWV ++ +K+   +   A+ ++   
Sbjct  1271  CKPKREGGLGIRLAKEMNVALLAKLGWRMLNTEDGLWVNILCKKFRVGELDDASWLVPQG  1330

Query  3457  SWG--WRSIMRG-RSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              W   WRS++ G R +V  G +W +G+G  + FW D W   +PL  +  + IP+   EAK
Sbjct  1331  RWSPTWRSLVMGIREVVAPGVSWILGDGRRVRFWRDRWLLKEPLEALSLIDIPEELEEAK  1390

Query  3628  VSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVS---DSLYWPRSPTGAFSVRS  3798
               D       W + ++    P+  +         V ++V+   D + W  +  G FSV++
Sbjct  1391  TRDLWQQGIGWILQQIE---PYTSLQNRLQLASLVIDEVTGARDRMSWGEAKDGLFSVKA  1447

Query  3799  AFSHIAG------NDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDT  3960
             A++ +        N ED    S VW++   ER R+FLWL+    ++TNMER R+ ++E+ 
Sbjct  1448  AYAFLTKDAVPRPNMEDLY--SRVWRVTAPERVRVFLWLVTHQVIMTNMERKRRHISENG  1505

Query  3961  LCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGC  4140
              C  C  GDET+ HVL +C  A   WR+   P   Q      L  W+  N      +NG 
Sbjct  1506  TCPLCKSGDETILHVLRDCPAAAGLWRKLVLPTRQQRFFNLTLFEWLYENLANDKSVNGD  1565

Query  4141  PWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKM--  4314
              W   F  T W  WK R   +F        D +R   +   + ++   NKK      +  
Sbjct  1566  QWPSLFALTVWWCWKWRCGYVFGEIGKC-RDRVRFVKDKAQEVIKA--NKKVREPSAIGG  1622

Query  4315  ---RWVCWQPPETGWI  4353
                R + W  PE GW+
Sbjct  1623  HVERPIAWVVPENGWV  1638



>gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease 
H [Medicago truncatula]
Length=1296

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/828 (42%), Positives = 491/828 (59%), Gaps = 4/828 (0%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  PN   +   WN  ++ +     PW+++GDFN+     EQ G +  + +R   F    
Sbjct  106   YASPNYSMRPNLWNYLVNINDTITGPWMLIGDFNETHLPSEQRGGT-FHHNRAATFSNFM  164

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
             + C LLD+ T+G  ++W +   G  +  +KLDR + N++ +  FPEA   +L R HSDH+
Sbjct  165   NNCNLLDLTTTGGRFTWHKNNNGIRILSKKLDRGMANVDWRLSFPEAFVEVLCRLHSDHN  224

Query  1411  PLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKW  1590
             PL  L   G P  R  RPFRFE AW+   DY ++  R WS    +   ++ +V   S  +
Sbjct  225   PL-LLRFGGLPLTRGPRPFRFEAAWIDHYDYGNVVKRSWSTHTHNPTASLIKVMENSIIF  283

Query  1591  NKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKS  1770
             N + FGNIF RK+ ++ R+KGVQ  +    S    +LE++L  E N +L QEE+LW+QKS
Sbjct  284   NHDVFGNIFQRKSRVEWRLKGVQSYLERVDSYRHTLLEKELQDEYNHILFQEEMLWYQKS  343

Query  1771  RRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHISNFFIDLFGRK  1947
             R  W++ GD+NTAF+H  T+IRR  ++I  L++ NG   SD   + +    +F   F   
Sbjct  344   REQWVKLGDKNTAFFHAQTVIRRKWNKIHKLQLPNGISTSDSNILQEEALKYFKKFFCGS  403

Query  1948  NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFW  2127
              I      +    P LD      LT  +T  EV  A+  MK + +PGPDG    F++ +W
Sbjct  404   QIPYSRFFNEGRHPALDDTGKTSLTSPITKKEVFAALNSMKPYKAPGPDGFHCIFFKQYW  463

Query  2128  EEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKV  2307
               V   +   V+     G   P I  + I LIPK DSP T  DFRPI+L N  +KII+KV
Sbjct  464   HIVGDDVFHLVRSAFLTGHFDPAISNTLIALIPKIDSPNTYKDFRPISLCNTLYKIITKV  523

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAY  2487
             +V+R+RP + NLIGP+Q+SFLPGR TADN I+ QEI+H+M+  K KKG +A KLDL KA+
Sbjct  524   LVHRLRPFLNNLIGPYQSSFLPGRGTADNSIILQEILHFMKRSKRKKGYVAFKLDLEKAF  583

Query  2488  DSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAP  2667
             D+++W+FL S L+DFGFP  ++ LIM  V  ++ SLLWNG K+ PF+P  GLRQGDPL+P
Sbjct  584   DNVNWDFLNSCLLDFGFPDIIVKLIMHCVSSANYSLLWNGNKMPPFKPTHGLRQGDPLSP  643

Query  2668  YLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMN  2847
             YLFIL ME+LS  IQ+ V   +W+PI +   G  +SHL FA+D++LF +A   Q + I N
Sbjct  644   YLFILCMEKLSVAIQDAVLQGSWEPIHIINDGPQISHLLFADDVLLFTKAKSSQLQFITN  703

Query  2848  CLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVS  3027
                +FS  SGL IN+SKS  + S  T +     L  ++GI  +  LG YLG P+L  R  
Sbjct  704   LFDRFSRASGLKINISKSRAYYSSGTPNGKINNLTAISGIQSTTTLGKYLGFPMLQGRPK  763

Query  3028  KHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRI  3207
             +  F +IL+ M+ +LA+WK  +L+  GR TL  S LS++P Y MQ+  LP   C+ ID+ 
Sbjct  764   RSDFNFILEKMQTRLASWKNRLLNRTGRLTLATSVLSTIPTYYMQINWLPQNICDSIDQT  823

Query  3208  CRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLW  3387
              R+FLW  S  NK +HLV W  I + K  GGLG+R   D N  LL KL W +V S +KLW
Sbjct  824   ARNFLWKGS-NNKGIHLVNWKTITRPKSIGGLGIRSARDANICLLGKLVWDMVQSTNKLW  882

Query  3388  VKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNG  3531
             V ++ +KY    +     + +N+S  W SI+R + I++ G +WR G G
Sbjct  883   VNLLAKKYSSGTSLLEANVNSNSSPSWFSIIRAKDILKTGYSWRAGAG  930


 Score = 59.7 bits (143),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 95/242 (39%), Gaps = 10/242 (4%)
 Frame = +1

Query  3784  FSVRSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTL  3963
              +V+   + +  +  D++  SW+W++   E+ +L +WL       T      + M     
Sbjct  959   LTVKDVLTSVETSSNDSV-WSWIWQLTAPEKYKLLIWLACHNAAPTLSLLHHRKMAPAAT  1017

Query  3964  CATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCP  4143
             C+ CG+ DE+  H + +C  +   W +     +  +S V+ ++ W++N    S       
Sbjct  1018  CSRCGENDESFLHCVRDCKHSAAIWHKLGFVTAAFFS-VSSVQDWIRNFSSGSR------  1070

Query  4144  WGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWV  4323
               +TF+   W  W+ RN     N       I  R N+        F+    +     R V
Sbjct  1071  -AITFLAGLWWSWRHRNLMCLSNETWPLTRISFRINDSINAIRSAFVKSNVIQPDSARMV  1129

Query  4324  CWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNS-FAAELWGL  4500
              W          N DG+       A  GG+ R++ G +L G+   I  S     AEL  L
Sbjct  1130  KWNQGNHQCHILNVDGSCLGTPIRAGFGGIFRNNVGGYLSGYSGFISESTDILLAELTAL  1189

Query  4501  RE  4506
              +
Sbjct  1190  HQ  1191



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/906 (39%), Positives = 508/906 (56%), Gaps = 20/906 (2%)
 Frame = +1

Query  1822  STLIRRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNI---MDGSPNDMYCGP  1989
             ST+IRR R+R+ MLK N   W SD + + +   N+F  L+  +++   + G     +   
Sbjct  2     STVIRRRRNRVEMLKNNENRWVSDAQELEELAVNYFRKLYSLEDVDTDVQGLSERRFV--  59

Query  1990  KLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKV  2169
              L +     L +  ++ EV++AV DM  F +PGPDG Q  FYQ  WE V + +  F    
Sbjct  60    SLTSHDYELLNKTFSVEEVERAVRDMGSFKAPGPDGFQPVFYQRCWETVGNSVARFATLF  119

Query  2170  LRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIG  2349
                G++P    ++ + LIPK   PE+ + FRPI+L NV FKII+K +V R++ +MK LIG
Sbjct  120   FETGKLPEDTNDALVVLIPKVTKPESITQFRPISLCNVLFKIITKAMVGRLKGVMKKLIG  179

Query  2350  PFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
             P Q+SF+PGR +ADNI++ QE VH MR KKG+KG M +KLDL KAYD + W+FLE TL  
Sbjct  180   PAQSSFIPGRLSADNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRLRWDFLEDTLRA  239

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              G  +  +  +M  V   S+ +LWNGEK   F+P RGLRQGDPL+PYLF+L MERL   I
Sbjct  240   AGLSEVWVRRVMECVSGPSMCILWNGEKTESFKPSRGLRQGDPLSPYLFVLCMERLCHLI  299

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
             +E V  K WKPI LSRGG  +SH+ FA+DL+LFAEAS  Q R+I   L+KF   SG  ++
Sbjct  300   EEAVEEKRWKPIKLSRGGPELSHICFADDLILFAEASVTQVRVIRKVLEKFCKASGQKVS  359

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
             + KS IF S N  +E    +   +GI+ + +LG YLG+PIL KR++K TFG +L+ +  +
Sbjct  360   LPKSKIFFSNNVTTERGERISRASGIAATRDLGKYLGMPILQKRINKDTFGEVLEKVASR  419

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
             L+ WK   LSLAGR T+ ++ LSS+PV+TM    LP  T   +D + R F+WG       
Sbjct  420   LSGWKKQTLSLAGRVTMTKAVLSSIPVHTMSTINLPVSTLEKLDSLSRSFVWGSGQ----  475

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNK--  3423
              HLV W  ICK K  GGLG+R   D N AL+AK+ W+L+   + LW +V+R KY      
Sbjct  476   -HLVSWEKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVLRSKYNVGSIH  534

Query  3424  NFFATPMIANASWGWRSIMRG-RSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVT  3600
             +   T   +N S  W S++ G R +V  G +W IGNG  + FW+D W  ++PL+ +    
Sbjct  535   DLSWTGRRSNGSSTWSSVVLGIREVVMTGHSWAIGNGRDIKFWTDRWLSNQPLSSVTIGE  594

Query  3601  IPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTG  3780
             +P+   +  V +  +    W++  ++  +  +    + A  +       D L W ++  G
Sbjct  595   LPEGYEDVTVREMWVVGGGWDLAHIAPFVTDETRLELAAVVVDTVNDSEDRLAWSQTNNG  654

Query  3781  AFSVRSAFSHIAGNDEDAMDTSWV----WKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
              F+V+SA++ I  +D    +  ++    W +   ER R+FLWL+    ++TN ER+R+ +
Sbjct  655   QFTVKSAYALITRDDAPRPNMEYLFRRMWHVVAPERVRMFLWLVGNQAIMTNAERYRRHL  714

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDW  4128
             +   +C  C  G ET+ HVL +C   +  W R    V  Q     PL  W+  N   +  
Sbjct  715   SGTDVCQVCKGGIETILHVLRDCPAMRGIWDRFVPAVKRQTFFSMPLLEWLYKNLSDNGT  774

Query  4129  INGCPWGVTFIYTCWEIWKARNQRIFENTA--SAPMDIMRRANNLTLDTVEVFLNKKCVH  4302
              +  PW  TF    W  WK R   IF   +     +  +R      +   E       V 
Sbjct  775   GSEIPWPTTFALAVWWGWKWRCGNIFGKNSLWRDRVGFLRNLAKEVMSANEAEKGNSNVD  834

Query  4303  VGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFA  4482
                 R V W PP +GW+K NTDG+   N G A+AGG+ R+ +GEW  GF  NIG   +  
Sbjct  835   HRTERMVGWAPPRSGWMKLNTDGSSHGNPGAATAGGVLRNGEGEWCGGFALNIGRCGALL  894

Query  4483  AELWGL  4500
             AELWG+
Sbjct  895   AELWGV  900



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1162 (35%), Positives = 600/1162 (52%), Gaps = 87/1162 (7%)
 Frame = +1

Query  1048  AYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVES  1227
              Y  P+   +   W +   ++++ N PW++ GDFN+     E+  S S    R   F + 
Sbjct  120   VYASPDPTRRHDLWRELKEFAAQNNKPWLIAGDFNETRFPSERNTSCSETTRRSARFNDW  179

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
                  LL++   G SY+W R     T Q  +LDRA  N E      +A+   LP   SDH
Sbjct  180   VDEMDLLEIEFVGASYTWSRGLSPETRQCARLDRAFCNPEWGLQCSQARVKHLPAIASDH  239

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK  1587
              PL        P    N+PFRF+  WL  E +++     W +S   ++ ++  ++   + 
Sbjct  240   CPLLISPNGFVPLPSLNKPFRFQAMWLHHEKFQEFVQSKWKHSE-PIMSSLHSLSEALQD  298

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQK  1767
             WN++ F NIF RK  L ARI+GVQ+++ ++T RGL  LE KL  EL +VL++EE      
Sbjct  299   WNRDVFKNIFQRKRLLLARIEGVQKNIGFSTHRGLIKLESKLRRELEDVLQEEET-----  353

Query  1768  SRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRK  1947
                 W Q                  +SRI  LK             DH+           
Sbjct  354   ---YWFQ------------------KSRITWLKD-----------GDHLL----------  371

Query  1948  NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFW  2127
                   P+D             +LT+     E+++ V  +    +PGPDG Q  F+Q  W
Sbjct  372   ------PDDW-----------SRLTKPYNKLEIEEVVHSLGALKAPGPDGFQPLFFQKNW  414

Query  2128  EEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKV  2307
             + VK  +T  V + L    +P K+ E+FI L+PK D+PETA+ FRPI L NV +K+++KV
Sbjct  415   DLVKDDVTKAVTQALEGKGLPEKMNETFIALLPKVDNPETAAQFRPIGLCNVIYKVVTKV  474

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAY  2487
             +VNR++P++  LI   Q SF+PGR   DNII+ QE++H M+ K+G+KG MAIK+D  KAY
Sbjct  475   LVNRIKPVLPRLISNTQGSFVPGRQITDNIIIMQEVIHTMKRKQGRKGFMAIKIDFEKAY  534

Query  2488  DSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAP  2667
             D + W+F+  TL+    P  L+  IM  V  +S+ +LWNGE    F P RG+RQGDPL+P
Sbjct  535   DRLRWKFIRDTLLQMNLPILLVDTIMECVCSASMRVLWNGEPTDSFSPSRGIRQGDPLSP  594

Query  2668  YLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMN  2847
             YLF++ MERL   I+E +  K WKPI  SR G  +S+LFFA+D++LFAEAS DQ ++I +
Sbjct  595   YLFVMCMERLYQTIEEAIIAKKWKPIHASRNGPSLSNLFFADDIVLFAEASIDQAQVIQD  654

Query  2848  CLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVS  3027
              L++F   SG  +++ KS I+ S N   E+   + +  GI  +    T LG+P    R+S
Sbjct  655   VLRRFCKASGQKLSLPKSRIYFSQNVLPEVPAQICDAIGIGGT----TDLGMPTFTSRIS  710

Query  3028  KHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRI  3207
             + T  ++ + + R+LA  K   LSLAGR TL +S +SS+  Y+MQ  K+P   C+DIDR 
Sbjct  711   RETLNFLCEKIDRRLAGRKTKYLSLAGRITLAKSTVSSLAYYSMQTAKIPKTVCDDIDRK  770

Query  3208  CRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLW  3387
              R F+WG +   KKVHL+ W+ + + KD GGLGL      N A +AKL W+L+T  + LW
Sbjct  771   TRRFVWGGNEDTKKVHLIAWDALQRPKDQGGLGLHSASHANKAFMAKLGWRLLTEPNALW  830

Query  3388  VKVMREKYVKNK---NFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDW  3558
              +V+R KY K +   + F       AS  W  I    +I+  G    IGNG+   FW   
Sbjct  831   SRVLRTKYCKGRCDSDMFQPK--TGASNVWNRIAENSNILCEGIRSAIGNGIKTLFWDHK  888

Query  3559  WTGDKPLAFMDEVTIPDSQ--SEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAV  3732
             W  + PL  +D VT P     + A VS+       W  +  S  L  D +  I+A  +  
Sbjct  889   WMSNTPL--IDCVTQPPPTEIAGATVSEMWESGGGWKWEVFSPYLSEDSLKLIQAHVVID  946

Query  3733  CEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmr  3906
               +V D LYW   P G FS++SA   I     +  D  W  VWK  V +R R F+WL+  
Sbjct  947   DPEVEDLLYWDGDPKGKFSIKSAIRIIRKESTEFQDQLWNLVWKASVQQRVRAFMWLVCH  1006

Query  3907  grllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTP  4086
              RLL N  R+++ +T+D  C  CGD  E+  H+L +C  A+  WR+              
Sbjct  1007  DRLLGNANRFKRNLTDDPKCFVCGDFVESTLHILRDCPAARSVWRKVEGFALDPNFYRVD  1066

Query  4087  LKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI---MRRANNL  4257
             LK+W+ +N   +D      W   F    W +W+ RN  +F      P+D+   ++   + 
Sbjct  1067  LKNWISSNLEYNDQET---WPSFFAIIIWWLWRWRNMFVFGRGNEVPIDVGAFLKIRFDE  1123

Query  4258  TLDTVEVFLNKKCVHVGKM-RWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGE  4434
             T  ++   ++    +  ++ +++ W PP  GW   NTDGA +   G A  G + R+H G 
Sbjct  1124  TWRSLHGDMDTSGSNGHRVEKYIAWSPPPMGWYVLNTDGAARGTPGDAGGGVIIRNHSGM  1183

Query  4435  WLFGFMTNIGVSNSFAAELWGL  4500
             ++     N G   +F AE+  L
Sbjct  1184  FISALSLNFGRCCAFRAEVLAL  1205



>ref|XP_010668235.1| PREDICTED: uncharacterized protein LOC104885230 [Beta vulgaris 
subsp. vulgaris]
Length=1607

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/1194 (33%), Positives = 603/1194 (51%), Gaps = 27/1194 (2%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFA--YVRPNRMAKERFWNDCLSYSSE  1116
               W+S + +F VI   +Q ++G+V    SN+   F   Y  P    ++  W++  S++  
Sbjct  329   LMWKSHVLDFHVIGEGAQGVYGVVEVHASNLSFVFTAIYASPKFHIRKTLWHELESFAQN  388

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
              N PW+++GDFN++    E+ G    +  R   F  +   C L+D+G +G  ++W  +  
Sbjct  389   LNKPWLVLGDFNEVTCQNEKLGGRLASRKRMDLFANTMDNCNLIDLGFNGPRFTWTNKRK  448

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
                +  R LDR   N+E   +FP A    LPR  SDH P+  L     P     +PFRFE
Sbjct  449   LNPIMER-LDRGWVNMEWIQMFPNANLWHLPRITSDHCPI-LLKFQNVPFVHGEKPFRFE  506

Query  1477  gAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
               WL    +R+     W N    +  ++S       +WN  TFGN++ RK  L  R+KG 
Sbjct  507   PMWLLDSRFRESALPKWPNPSSSIQASLSTFRETLIEWNHSTFGNVYRRKRRLVGRLKGT  566

Query  1657  QESVFYNTSRGLQV-LERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLI  1833
             Q  +  + +    + LE +L  EL + L+QEE LW  KSR   I +G+RNT ++H+S LI
Sbjct  567   QLYLQDHPTSPFHLNLESELQQELMDTLQQEETLWKTKSRMSRIGEGERNTRYFHRSVLI  626

Query  1834  RRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNIMDG-SPNDMYCGPKLDTGQ  2007
             +RNRSRI  L+ N G    D   I D I  F+ DL+    +    + N       L+ G 
Sbjct  627   KRNRSRINSLRDNVGNEVRDQGGIHDLILAFYKDLYSTGKLFSQWNSNSPVPNLGLNVG-  685

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
                   E +  E+K A+F MK   +PGPDG    F+Q  W+ +   + + V+K  R  +V
Sbjct  686   -----FEPSPLEIKMAMFSMKPHKAPGPDGFHPIFFQKTWDVIGHDVCSDVQKWFRQSKV  740

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
             P  + ++ I LIPK++SPET   FRPI+L N  +K+++K++V R++P++ + I   QNSF
Sbjct  741   PEDLCQALICLIPKQNSPETVKQFRPISLCNTIYKLVTKILVTRLKPLIPDWISHNQNSF  800

Query  2368  LPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQN  2547
             + GR    N+++  E++H M+ K+GK G  A+K+DL KAYD ++W F+   L +    + 
Sbjct  801   IKGRGPDINLVVASEVLHSMQKKQGKWGWFALKIDLEKAYDRVEWAFVRECLQNLQLDRP  860

Query  2548  LISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRV  2727
              I LIM  + ++S  +L NG K   F+  RGLRQGDP++PYLF + +E L+  I E    
Sbjct  861   AIDLIMSCISQASSRVLINGCKSEEFKHSRGLRQGDPMSPYLFNICLEALTGRINESCHQ  920

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
               W P  + RG   +SHL FA+DL+LF    E     + + L +F   SG  IN +KS +
Sbjct  921   GEWTPFGVGRGQVPISHLLFADDLLLFGRVDESTAFAVRSVLDRFCRDSGERINEAKSKL  980

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
               SPNT S+ K        I  S NLG YLG+PI HKR ++    +I+D ++ +LA WK 
Sbjct  981   MFSPNTPSDHKVLFTETLNIVESPNLGVYLGLPISHKRPTRRQVQFIVDKVRARLATWKS  1040

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
               LS AGR  L+ S LS++P Y MQ   LP  T +D+D IC +FLWG+  + KK+HLV  
Sbjct  1041  KFLSRAGRLCLISSTLSTIPAYYMQAISLPISTLSDLDSICNNFLWGEEGEKKKMHLVNK  1100

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
                   K+ GGLG+R     N A +AKL W+L      L  + +R KY++N         
Sbjct  1101  QMTFLPKNKGGLGIRSQRIMNKAYMAKLGWKLAQDQPSLAQQCIRSKYLQNNRVTK---F  1157

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              N S  W+SI +G  +++  ++W +G+G  ++FW D W G  PL    +  +   ++  K
Sbjct  1158  RNGSVIWKSIGQGWDLIQDNSSWFLGDGKIISFWHDDWLGIGPLRGWVQGPMSMDENTRK  1217

Query  3628  VSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
             V       R W++  L+  +P D+ + I  T     E  +D L         F +  A+ 
Sbjct  1218  VHSLSHHGR-WDLTPLTIHIPSDLRNRILNTSPPTPESQADLLIPNFVDHRGFMLHRAYI  1276

Query  3808  HIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGD  3987
                 +  +  D SW+WK +   +   F+WL    RL        +G+  DT C  C    
Sbjct  1277  AQIPHSPNHDDLSWIWKGKCEPKLHFFIWLTWHDRLPHRNLLASRGLIVDTSCPRCHQHI  1336

Query  3988  ETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYT  4167
             E   H+L +C  ++  W      V          + W++ N  ++      PW   F Y 
Sbjct  1337  EHSAHILRDCHISERVWDH----VGMTLGPHDDFRLWIRENLHSNGKFRDLPWASVFPYI  1392

Query  4168  CWEIWKARNQRIFENT-ASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPET  4344
             C EIWK RNQ +F+N  AS+P  I  RA        E  L  + +    +  V   P E 
Sbjct  1393  CHEIWKDRNQCVFKNQKASSPQAICLRAMG---RVREFILATETITGNVIHPVFAHPNE-  1448

Query  4345  GWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
              ++  + D +F      A  GG+ R   G+W+ GF   I  +NSF AEL  + E
Sbjct  1449  -FLMIHVDASFIDILQGAGIGGVVRKPSGQWIGGFGKKIFTNNSFVAELTAIAE  1501



>ref|XP_010674616.1| PREDICTED: uncharacterized protein LOC104890737 [Beta vulgaris 
subsp. vulgaris]
Length=1149

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/978 (34%), Positives = 533/978 (54%), Gaps = 29/978 (3%)
 Frame = +1

Query  1621  RKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDR  1800
             +K  + AR+ G+Q+ + +  S  L  LE++L+ +LN +   E+ +W QK+   W ++GD 
Sbjct  81    QKNRIYARLNGIQKVLAFRNSSFLLNLEKQLLNDLNHIHLVEKRIWAQKAGFDWRRNGDL  140

Query  1801  NTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKN---IMDGSP  1968
             NT ++H    I++++ +   L+ +NG+W  D + + D     F ++    +   +++ S 
Sbjct  141   NTRYFHVIAKIKKSKGKFHALQNLNGDWEFDDRVLKDLARLTFRNILSTNHSFSLLNCSF  200

Query  1969  NDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHI  2148
             N +     L T +   L   V++ E+   V  M    SPGPD IQ  FYQ  W ++   I
Sbjct  201   NPLMT---LSTEEALSLASPVSIEELNIVVKSMYPIKSPGPDDIQPIFYQQCWADLHHSI  257

Query  2149  TTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRP  2328
             T FV K L +G +P  I +SFI LIPKK +P T +DFRPI L N   KI++K I  R+RP
Sbjct  258   TDFVNKCLTNGFIPENINKSFICLIPKKTAPITINDFRPIGLCNTILKILTKTIAMRLRP  317

Query  2329  IMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEF  2508
              M NL  P Q SF+ GR+  +NII+ +E+ H ++  K KK +MA+K+DL KA+D ++W F
Sbjct  318   FMVNLTSPLQTSFVKGRTIDENIIILKEVAHLVKRIKRKKSIMALKIDLTKAFDCLEWSF  377

Query  2509  LESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAM  2688
             +  TL+ F FP+ L++ IM  +   SIS+LWNGE    F+P RG+RQGDPL+PY+F+L M
Sbjct  378   IRETLIGFKFPKKLVATIMSVITTPSISVLWNGEITQEFKPSRGIRQGDPLSPYIFVLCM  437

Query  2689  ERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSG  2868
             ERLS  IQ+K+ +K WKP+ +++   G+SHLF+A+D+  F +AS     ++M  L  F  
Sbjct  438   ERLSLLIQQKLDLKLWKPLMITK-DIGLSHLFYADDVFSFGQASCANLDLMMEVLNDFGM  496

Query  2869  KSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYI  3048
             +SGL +N  KS I      +  +++ L + +G+++S + G YLG+ I   ++ +  +  +
Sbjct  497   QSGLFLNRLKSTIIVPKKLDHNVRQSLSSFSGLAISSDFGKYLGVHISPNKLKRSDYLDL  556

Query  3049  LDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWG  3228
             LD    ++  W+  +L++AGR TL++S L+S P+Y MQ   LP G  NDI +  + FLW 
Sbjct  557   LDKTTDRIRGWQAKLLNMAGRCTLIKSVLNSYPLYVMQTNILPIGVLNDIQKNVKRFLWN  616

Query  3229  DSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREK  3408
                Q   +    W+ +CK    GGLG+R    +N   +AKL W  +T   KLWV++++ K
Sbjct  617   KVGQRHYISRTSWDQVCKPMIEGGLGIRDLRHWNLCFMAKLGWTFLTQPSKLWVRILKSK  676

Query  3409  YVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFM  3588
               K  NF       + S  WR I++GR ++  G    +GNG  ++ W   W G +PL  +
Sbjct  677   NCKGSNFMDVIPNVSHSTIWRDILKGRDMLRQGLILNVGNGEDISLWFHHWVGKEPLYKL  736

Query  3589  DEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
              ++ IP+  +  +V+  I+ N+ WN+  +++LLP +I+D I A P+   ++V D L W  
Sbjct  737   KDLVIPEDIAHWRVAH-IIHNKEWNITHIANLLPQEIVDEICAIPLTKFDEVKDGLRWLF  795

Query  3769  SPTGAFSVRSAFSHIAGNDEDAMDT----SWVWKMRVTERCrlflwllmrgrllTNMERW  3936
             +  G FS+++A+ ++  ++   + +    S +W++ +  + R+  W ++   L T +   
Sbjct  796   TTDGEFSIKTAYRNLNPSNSRRIQSLKKWSKLWRIEIPFKYRMLFWNVVHEILPTAVNLQ  855

Query  3937  RKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCC  4116
             ++    DT C  C    ET  H+   C  A   W+          ++   +  +  N+  
Sbjct  856   KRIHAFDTTCQCCLLATETHLHLFRNCLHANLLWKFFFQNCHLARAI--DIHCFFNNDW-  912

Query  4117  ASDWIN-----GCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVE--  4275
               DWIN        W   F+   W IWK RN+ +FE   +       + N+  LD +   
Sbjct  913   -EDWINFNLDQSLEWLQMFVIALWHIWKNRNKVVFERAMARSSS---QFNHFFLDYLHNK  968

Query  4276  -VFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFM  4452
               F N+  V     +   W+PP  G++K NTDG++K N   AS GG+ R   G W  GF 
Sbjct  969   NAFQNQDKVAPNVQQITIWKPPVHGYLKLNTDGSWKANDK-ASGGGVIRRTDGSWFMGFS  1027

Query  4453  TNIGVSNSFAAELWGLRE  4506
                   N  AAEL  +RE
Sbjct  1028  IKFRAVNLAAAELITIRE  1045



>ref|XP_010666276.1| PREDICTED: uncharacterized protein LOC104883442 [Beta vulgaris 
subsp. vulgaris]
Length=1944

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/1203 (32%), Positives = 590/1203 (49%), Gaps = 52/1203 (4%)
 Frame = +1

Query  949   WRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFA--YVRPNRMAKERFWNDCLSYSSEFN  1122
             W S      ++  + Q +H LV          F+  Y  P    + + W++ + +++  N
Sbjct  582   WNSQRIKIHILGESKQGVHTLVEVSSHKTPFVFSAIYASPKYKVRNQLWDELIMFAANMN  641

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PWI+ GDFN++    E++G   +   R   +VE+   C L+D+G  G  ++W  +    
Sbjct  642   YPWIIAGDFNEVTCQSEKFGGRPIIKKRVEMYVETMDLCKLVDLGYVGSKFTWTNKRRRN  701

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              V  R LDR   N E  + FP A    LPR  SDH P+                      
Sbjct  702   PVLER-LDRGWANAEWLSCFPNASVTHLPRITSDHCPIHVTLNPSPKVHGSKPFRFEPM-  759

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
             WL+   + D+  + W     ++   +  V    ++WN+  FGN++ RK  + AR+KGVQ 
Sbjct  760   WLSDPSFNDVVTKAWGKEREEIELKLYNVGIELQEWNETNFGNVYKRKRRVLARLKGVQN  819

Query  1663  SVFYN-TSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
             ++  N TS     LE +L  E+  +L QEE LW  KSR  W+ +G+RNT+++HKS +I R
Sbjct  820   ALHDNPTSDFYHNLENELQNEMINILNQEEWLWKMKSRTKWLAEGERNTSYFHKSVIISR  879

Query  1840  NRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK  2016
             + +RI  L+ N GE   +   I + I+ FF DL+  + +   +   M       + Q  K
Sbjct  880   HANRILTLRNNSGEELHEPAQIVNLITTFFRDLYTSEFVYAKNNQSM-------SNQEIK  932

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             ++      E+ +A+  MK F +PGPDG    F+Q  W  V   +   + K   + RVP  
Sbjct  933   ISMRPDDEEIYRALVGMKPFKAPGPDGFHPIFFQEKWNVVGEEVCKNLGKWFEEKRVPET  992

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
             + ++ + LIPK+  PE     RPI+L N  +K+++K+IVNR++P++ N I   QNSF+ G
Sbjct  993   LCQALVCLIPKQPCPEVVKHLRPISLCNTMYKLVTKIIVNRLKPLIPNWISHNQNSFIKG  1052

Query  2377  RSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLIS  2556
             R    N+++  EI+H M  KKGK G  A+K+DL KAYD ++W+F++  L  F   +  +S
Sbjct  1053  RGPEVNMVVAAEILHSMHKKKGKWGWFALKVDLEKAYDRMEWQFIKRCLESFNLDEGSVS  1112

Query  2557  LIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNW  2736
              IM  V ++S S+L NG K   F   RGLRQGDP++PY+F L +E L+  +      K W
Sbjct  1113  FIMSCVSQASSSILVNGRKSVSFTHSRGLRQGDPMSPYIFNLCLEYLTTLVNIACETKQW  1172

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
              P  + R    +SHL FA+DL+LF    E     +   L  F G+SG  IN  KS +  S
Sbjct  1173  TPFWVGRKKVPISHLLFADDLLLFGRVDEQTAFKVREILDTFCGESGQKINEEKSRLIFS  1232

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
             PNT ++ K   +    +  ++NLGTYLG+PI HKR  K    +I++ +++KLANWK   L
Sbjct  1233  PNTPNDTKELFQEKISVKENENLGTYLGMPISHKRPRKGEVQFIVEKVRKKLANWKSKFL  1292

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S AGR  L+QS L+++P Y MQ   LP  T ND+DRIC +FLWG+     K+HLV     
Sbjct  1293  SRAGRLVLIQSTLNTIPNYYMQANFLPIATLNDLDRICNNFLWGEVEGKSKLHLVSKEVS  1352

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANA  3456
                K  GGLG+R   + N  L++KL W++   +  L  + ++ KYV +            
Sbjct  1353  FSPKTLGGLGIRSHRNLNTILMSKLGWKMCHGNPNLAQQCIQSKYVHSSYITK---FTKG  1409

Query  3457  SWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSD  3636
             S  W+ I RG  ++     W +GNG    FW D W G   L       +  ++ +  VS 
Sbjct  1410  SHIWQDIGRGWELLSRHCTWVLGNGKDTLFWEDNWLGLGSLRSQLYGPLNKNEDKITVSQ  1469

Query  3637  FILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS---  3807
               + N  WN D LS  LP +I D I        E+       P  P  +F   + FS   
Sbjct  1470  CRVLN-DWNFDILSFQLPVEIRDKIVGLVWVETEE-------PDYPCSSFVSDNQFSLKK  1521

Query  3808  -HIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDG  3984
              ++A  D    +   VW+     + R FLWLL + RL TN   W + +    +C  C   
Sbjct  1522  AYLALFDYSTTEHMNVWRNPSPPKLRFFLWLLWKDRLPTNKMLWSRKIVPFPVCPLCNRQ  1581

Query  3985  DETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIY  4164
             +E+  H + +C  A+  W     P+ ++ +       WV+ N           W   F +
Sbjct  1582  EESSYHAIKDCDHAQCVWECAAPPIVWKDN----DHVWVRENVLCYKESQNIEWATLFPF  1637

Query  4165  TCWEIWKARNQRIFE-NTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPE  4341
              C+EIWK RN  IFE      P+  +R+A     D +  +           + V  +P +
Sbjct  1638  ICYEIWKNRNLFIFEKQNVPQPLCTLRKAIYAARDFLTSY-----------KIVNLEPTQ  1686

Query  4342  TGWIKFN--------TDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWG  4497
              G I FN         D +F   + L    G+ R+HKGEWL GF  +I   +   AEL  
Sbjct  1687  PGNIIFNDPTCFYIHVDASFLAKSYLTGIAGVLRNHKGEWLGGFQKSIYAKDVLMAELLA  1746

Query  4498  LRE  4506
             + E
Sbjct  1747  ILE  1749



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score =   591 bits (1524),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 369/1028 (36%), Positives = 548/1028 (53%), Gaps = 82/1028 (8%)
 Frame = +1

Query  1264  GVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnp  1443
             G  Y+W R    + + R   ++A W L+     P A  + LP+  SDH P+    +  + 
Sbjct  675   GPKYTWSRGSLSKRLDRVVCNKA-WFLQN----PNASVLHLPKVASDHRPVLIRFDQNSR  729

Query  1444  prrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGR  1623
                  + FRF  AWLT   + D     W N +     A+SE     + WNK  FGNIF R
Sbjct  730   NNNFPKLFRFMAAWLTDSRFADFMKTHWQNGV-PYDRAVSEFIQQVQHWNKNIFGNIFQR  788

Query  1624  KASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRN  1803
             K  L ARI GVQ ++       L  LE KL  EL EVL QEELLW Q+SRR WI  GDRN
Sbjct  789   KKILLARIGGVQRALERRPLCSLYRLEIKLKKELEEVLMQEELLWLQRSRRDWILFGDRN  848

Query  1804  TAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMY  1980
             TA++H+ T+ RR+ +RI  ++  +G W  D + I    +NFF +L+  +    G      
Sbjct  849   TAYFHQKTITRRHHNRIDAIMAEDGRWFYDMEAIKQQATNFFSNLYTPEQ--GGYKPYQI  906

Query  1981  CGP--KLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITT  2154
             CG   ++D  ++  L  E+   E++ AVF+M    +PG DG+ A FYQ+ W  V      
Sbjct  907   CGAFLRVDDYRLKFLATEIEEEEIRHAVFNMSPLKAPGVDGLHAIFYQSQWHIVGESFCK  966

Query  2155  FVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIM  2334
              +K+V +   +P ++  + + LIPK + P + S +RPI+L  V +K I+K+I NR++ ++
Sbjct  967   AIKEVFQTQCLPAEVNRTVLVLIPKIEQPTSFSMYRPISLCTVMYKTITKIIANRLQELL  1026

Query  2335  KNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLE  2514
               LIGP Q SF+PGR   +NII+ QEI+H MR KKG+KG MAIK+DL KAYD + W F++
Sbjct  1027  PELIGPHQTSFVPGRHITENIIVAQEIIHSMRRKKGRKGFMAIKVDLGKAYDRLSWTFIQ  1086

Query  2515  STLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMER  2694
              TL +   P  LI+LIM  +  +++++LWNGE  + F PGRG+RQGDPL+PY+F+L +ER
Sbjct  1087  ETLQELNLPTMLINLIMECITTATMNVLWNGELSSEFCPGRGVRQGDPLSPYIFVLCIER  1146

Query  2695  LSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKS  2874
             LS  I   ++  +WKPI L+R GT +SHLFFA+DL+  +EAS  Q  +I   + +FS  S
Sbjct  1147  LSHGISRSIQQGHWKPIRLARMGTPLSHLFFADDLLFLSEASSQQAIIINKIIDEFSASS  1206

Query  2875  GLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILD  3054
             G  +N SK+ ++ S N ++     + +  G SV+DNLG YLG+P+ H R+SK T+  I+D
Sbjct  1207  GAKVNKSKTLVYFSANISAMEASRIGSDLGYSVTDNLGKYLGVPLCHSRISKQTYQSIVD  1266

Query  3055  GMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDS  3234
              + ++L+ W  + L+LAGR TL QS L ++ VY MQ  KLP      ID++CR F+W  S
Sbjct  1267  KIDQRLSGWNASHLTLAGRITLAQSVLQAISVYAMQTTKLPRSIKMKIDQLCRRFIWSGS  1326

Query  3235  AQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYV  3414
             A+++K+ LV W+ IC  K  GGLG +K    N+ALL K  W+L+T   KL  +V+  KY 
Sbjct  1327  AEHQKMSLVNWDMICTPKCKGGLGFKKLDIMNHALLMKNTWRLITEPTKLSNQVLLTKYG  1386

Query  3415  KNKNFFATPMIAN-ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMD  3591
              + + F T +     S  W+++        +G  W IG+G  + +               
Sbjct  1387  VHLDEFPTSLPTRYGSHLWKAMGSTWEQTRVGMCWNIGDGKRVRY---------------  1431

Query  3592  EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRS  3771
                                           LLP++I+  I +         +DS +W  S
Sbjct  1432  ------------------------------LLPNNILLKIASVHPPTASHGADSFFWGAS  1461

Query  3772  PTGAFSVRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKG  3945
               G FSV+SA+  +     +   + W  VW  +     R+FLWLL+ GRL T  E  R+ 
Sbjct  1462  SNGNFSVKSAYELLDDPIGNGDHSFWCLVWSWKGPHSIRVFLWLLLHGRLKTKKELNRRH  1521

Query  3946  MTEDTLCATCGDGDETMNHVLMECSFAKDCWRR---THHPVSFQYSLVTPLKSWV-----  4101
             + + T C  CG   E + H L +C  A+  W      ++P SF    + PL  W+     
Sbjct  1522  LIDSTQCDRCGGPVEDILHTLRDCVTARRVWSHLLPNNYPHSF---FLCPLSDWLQMNLM  1578

Query  4102  -KNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEV  4278
              K N  + ++     W V F    W +W  RN  +F + +     I   A ++   T E+
Sbjct  1579  RKKNNTSQEY-----WRVCFGVAVWRLWFWRNNFLFNHGSWESGFI---ATDIKARTKEI  1630

Query  4279  FLNKKCVH  4302
                 +C+H
Sbjct  1631  L---RCIH  1635



>emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana]
 emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana]
Length=929

 Score =   553 bits (1424),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 336/915 (37%), Positives = 503/915 (55%), Gaps = 63/915 (7%)
 Frame = +1

Query  1252  MGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCE  1431
             MG  G  ++W R     T   ++LDR L+   A+  + EA  ++ P  + D     F  E
Sbjct  1     MGFKGNRFTWRRGLVESTFVAKRLDRVLFCAHARLKWQEA--LLCPAQNVDARRRPFRFE  58

Query  1432  AgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGN  1611
             A               AWL+ E ++++    W   L   V A++ +    KKWNKE FGN
Sbjct  59    A---------------AWLSHEGFKELLTASWDTGLSTPV-ALNRLRWQLKKWNKEVFGN  102

Query  1612  IFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQD  1791
             I  RK  + + +K VQ+ +    +  L + E  L+ E + +L QEE LWFQKSR   +  
Sbjct  103   IHVRKEKVVSDLKAVQDLLEVVQTDDLLMKEDTLLKEFDVLLHQEETLWFQKSREKLLAL  162

Query  1792  GDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNI--MDG  1962
             GDRNT F+H ST+IRR R+RI MLK + + W ++ + +     +++  L+  +++  + G
Sbjct  163   GDRNTTFFHTSTVIRRRRNRIEMLKDSEDRWVTEKEALEKLAMDYYRKLYSLEDVSVVRG  222

Query  1963  S-PNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVK  2139
             + P + +  P+L   + + L R  T  EV  AV  M +F +PGPDG Q  FYQ  WE V 
Sbjct  223   TLPTEGF--PRLTREEKNNLNRPFTRDEVVVAVRSMGRFKAPGPDGYQPVFYQQCWETVG  280

Query  2140  SHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNR  2319
               ++ FV +    G +P    +  + L+ K   PE  + FRP++L NV FKII+K++V R
Sbjct  281   ESVSKFVMEFFESGVLPKSTNDVLLVLLAKVAKPERITQFRPVSLCNVLFKIITKMMVIR  340

Query  2320  MRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSID  2499
             ++ ++  LIGP Q SF+PGR + DNI++ QE VH MR KKG+KG M +KLDL KAYD I 
Sbjct  341   LKNVISKLIGPAQASFIPGRLSFDNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRIR  400

Query  2500  WEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFI  2679
             W+FL  TL   G  +  I  IM  V    +SLLWNGEK   F P RGLRQGDP++PYLF+
Sbjct  401   WDFLAETLEAAGLSEGWIKRIMECVAGPEMSLLWNGEKTDSFTPERGLRQGDPISPYLFV  460

Query  2680  LAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKK  2859
             L +ERL   I+  V   +WK I++S+GG  VSH+ FA+DL+LFAEAS  Q          
Sbjct  461   LCIERLCHQIETAVGRGDWKSISISQGGPKVSHVCFADDLILFAEASVAQ----------  510

Query  2860  FSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTF  3039
                     +++ KS IF S N + +++  +   TGI  +  LG YLG+P+L KR++K TF
Sbjct  511   -------KVSLEKSKIFFSNNVSRDLEGLITAETGIGSTRELGKYLGMPVLQKRINKDTF  563

Query  3040  GYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDF  3219
             G +L+ +  +L+ WK   LSLAGR TL ++ L S+P++TM    LPA     +D++ R+F
Sbjct  564   GEVLERVSSRLSGWKSRSLSLAGRITLTKAVLMSIPIHTMSSILLPASLLEQLDKVSRNF  623

Query  3220  LWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVM  3399
             LWG + + +K HL+ W  +C+ K AGGLGLR   D N ALLAK+ W+L+     LW +V+
Sbjct  624   LWGSTVEKRKQHLLSWKKVCRPKAAGGLGLRASKDMNRALLAKVGWRLLNDKVSLWARVL  683

Query  3400  REKYVKNKNFFATPMIANASWG--WRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDK  3573
             R KY       ++ ++  A+W   WRSI         G   R G        +  W   +
Sbjct  684   RRKYKVTDVHDSSWLVPKATWSSTWRSI---------GVGLREGV-------AKGWILHE  727

Query  3574  PLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDS  3753
             PL       +   +  A+V +F      W++ KL   LP  + D + A  I     + D 
Sbjct  728   PLCTRATCLLSPEELNARVEEFWTEGVGWDMVKLGQCLPRSVTDRLHAVVIKGVLGLRDR  787

Query  3754  LYWPRSPTGAFSVRSAFSHIAGNDED--AMDTSW--VWKMRVTERCrlflwllmrgrllT  3921
             + W  +  G F+V SA+  +   +E    M++ +  +W +   ER R+FLWL+ +  ++T
Sbjct  788   ISWQGTSDGDFTVGSAYVLLTQEEESKPCMESFFKRIWGVIAPERVRVFLWLVGQQVIMT  847

Query  3922  NMERWRKGMTEDTLC  3966
             N+ER R+ + +  +C
Sbjct  848   NVERVRRHIGDIEVC  862



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   567 bits (1462),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 361/1188 (30%), Positives = 588/1188 (49%), Gaps = 43/1188 (4%)
 Frame = +1

Query  1018  GPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVN  1197
             G     R S+ Y  P R  KE  W    S       PW+ +GDFND+  + E+ G   ++
Sbjct  116   GSGVRFRASWVYGSPYRDEKEACWGWLDSVLGSVVFPWLCIGDFNDMLWDFEKRGGRRLD  175

Query  1198  PSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKA  1377
              +R     E      L+D+G  G S++W        V + +LDR L N+  Q  +P + A
Sbjct  176   NNRRRYLQEFLDKKELVDLGYQGSSFTWRGTRADGVVVQERLDRGLINVPWQETWPNSHA  235

Query  1378  IILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-----SNSLL  1542
             I LP   SDH P+  L E       +   F     W +  + R++  R W     + S  
Sbjct  236   IHLPAVGSDHCPVLILTEINVRRGLKPFKFEAF--WASDPECREVVDRSWGLCSPAASCF  293

Query  1543  DVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTE  1722
                  +       K+W+   F N      +L + +  +Q     NT + ++ +ER     
Sbjct  294   SWDTKLGTCRTELKQWSDGKFKNNRIMATALLSDLDSLQRDWEENTVK-IKEVER----S  348

Query  1723  LNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKT  1899
             LN+V + EEL W Q+++  W++ GD NTAF+H  T+ +R R+ + R+  + G+W      
Sbjct  349   LNQVWRCEELYWKQRAKIQWLKHGDANTAFFHNCTIQKRRRNYLGRIRNLAGDWEMGEDH  408

Query  1900  ISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFG  2079
             +   I ++F +LF  +   D      +    +       L   ++  E++  VF M    
Sbjct  409   VRSIIEDYFKNLFTSEGPRDWGDILAFVPVVISDNINASLLAPISDEEIRITVFQMGALK  468

Query  2080  SPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDF  2259
             SPGPDG    FYQ +W  V + +   VK    +      +  + I LIPK   PE  + F
Sbjct  469   SPGPDGFSGIFYQKYWSIVGNDVCRLVKNFFSNTMSMETLNRTEIALIPKVPHPEWVTQF  528

Query  2260  RPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK  2439
             RPI+L N S+KIISK++ NR++P +  +I P Q +F+PGR   DN+++  E  H ++++K
Sbjct  529   RPISLCNYSYKIISKILANRLQPFLDKIISPQQCAFIPGRQIQDNVLVAHEAFHSLKIRK  588

Query  2440  GKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKL  2616
               K   M +KLD+ KAYD I+W+F+++ L+  GF +  +  ++  +     +++ NG+  
Sbjct  589   KTKIFEMGLKLDMSKAYDRIEWDFVQAVLLKMGFARQWVRWVLRCLSSVEFAVIVNGKVG  648

Query  2617  APFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAED  2796
             + F+P RGLRQGDPL+PYLF++  + LS  I + V     + +   RGG  +SHLFFA+D
Sbjct  649   SYFKPTRGLRQGDPLSPYLFLIVSDVLSSMINQAVTHGFIQGMKFGRGGPVLSHLFFADD  708

Query  2797  LMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVS  2976
              ++F +A+E+  R+I+  L  +   SG  +N  KSN+F SPNT  E+K  L+ +  +++S
Sbjct  709   SLMFLKATENNCRVIVRILDAYCTASGQLVNFEKSNMFFSPNTPLEVKDRLRAILNVTIS  768

Query  2977  DNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYT  3156
             ++ G YLG+P +  R  K    ++ D +  K+  WK  +LS AGR  L++S   ++P Y 
Sbjct  769   EDPGKYLGLPTIWGRSKKMALAFVKDKILGKIQGWKHGLLSQAGREVLIKSVAQAVPSYP  828

Query  3157  MQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNA  3336
             M VF  P G C +ID I  +F WG S Q+ K+H + W D+   K+ GG+G R   DFN A
Sbjct  829   MSVFLFPNGFCQEIDSILANFWWGQSQQSNKIHWISWKDLGMPKNEGGMGFRNLKDFNVA  888

Query  3337  LLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAW  3516
             LLAK  W++VT     W ++++ KY  N +F      A +SW W S++ GR+I+  GA W
Sbjct  889   LLAKQGWRMVTEPQAFWAQLLKSKYFPNCDFLRAGKGAKSSWAWSSLLVGRNIIMNGARW  948

Query  3517  RIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLLPH  3693
             ++ +G  ++ W+D W        +    +     EAKV   I   +R WN++ +  +   
Sbjct  949   QVLDGSRVHLWTDKWIPGCTEHALQPSHLSQVDLEAKVETIIDCHSREWNLEAIGGMFSP  1008

Query  3694  DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS--HIAGNDEDAMDTS-------  3846
             +    I+A P+    +  D L WP + TG+++V+S ++  H+A  D     +S       
Sbjct  1009  NAAKIIKAMPLGDGWE-KDRLIWPLNQTGSYTVKSGYNMIHMAHLDTSVRPSSSRILDKA  1067

Query  3847  -W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMEC  4017
              W  +W  ++  +   F W L+RG L T    +R+ +    LC  CG+  E++ H+ + C
Sbjct  1068  LWKLIWGSQMVPKLMNFWWRLVRGCLPTRDALFRRHLGTSPLCPICGEFPESVEHLFLLC  1127

Query  4018  SFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWIN-GCPWGVTFI-YTCWEIWKAR  4191
             ++ +  W             +T +  W+      S  +     W ++ I Y+CW IWK+R
Sbjct  1128  NWVRPVWFGGPLNYRINRQSITSMSDWLMQILKFSQGLGYDRKWLISQIFYSCWSIWKSR  1187

Query  4192  NQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKM---------RWVCWQPPET  4344
                IF++ +  P + +  A  L  D    F    C H   +         R V W PP T
Sbjct  1188  CSAIFDDISVCPRNTLLVAKKLMND----FNLVGCPHGDAILEEDIDDGHRVVRWSPPPT  1243

Query  4345  GWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAE  4488
                K N D ++   T  A  G + R+  G ++ G       S++  AE
Sbjct  1244  SVYKINIDASWVSCTLQAGLGVVVRNSAGIFMGGCCGPRLASSAIEAE  1291



>emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1389

 Score =   558 bits (1438),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 378/1226 (31%), Positives = 595/1226 (49%), Gaps = 50/1226 (4%)
 Frame = +1

Query  943   FFWRSSI---FNFAVIRNTSQAIHGLVSGPHSNVRVS--FAYVRPNRMAKERFWNDCLSY  1107
              FWR  I   F+  VI  + + I   ++  + N++    F Y    +  K  FW++ ++Y
Sbjct  70    LFWRDCILNPFSLVVIYKSVRFIACSINLLNQNLQFVAIFIYAPAQKEFKSSFWDELIAY  129

Query  1108  SSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFR  1287
              S  + P+I++GDFN+I    ++ G +  + SR       FS     ++  +G  ++W +
Sbjct  130   VSSLSFPFIILGDFNEINSPSDKLGGAPFSSSRAYYMQNLFSQVDCTEISFTGQIFTWRK  189

Query  1288  QEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpf  1467
             ++ G      +LDR + +     LFP A       T SDH  +    E     + +  PF
Sbjct  190   KKDGPNNIHERLDRGVASTSWLMLFPHAFLKHHIFTSSDHCQISL--EYLANNKSKAPPF  247

Query  1468  rfegAWLTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKAS  1632
             RFE  W TR+DY  +  R W      + + + V     V   SK+WNK  FGNIF +   
Sbjct  248   RFEKMWCTRKDYDSLVKRTWCTKFYGSHMFNFVQKCKLVKINSKEWNKTQFGNIFRQLRQ  307

Query  1633  LQARIKGVQESVFYN-TSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTA  1809
             +  R++ +Q ++  +  +  L+  +   + + N++L+     W QK +  ++  GD N+ 
Sbjct  308   VDERLEEIQRNLLIDHNNTSLKTQQELFLAKRNKLLEYNTTYWKQKCKSDFMVLGDTNSK  367

Query  1810  FYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMY--  1980
             FYH    IR+ R++I+  +  N +  +    I   I+  F   F        + N  +  
Sbjct  368   FYHTHASIRKYRNQIKEFIPDNAQPITQPDLIEKEITLAFKKRFISNPACKFNQNVDFNL  427

Query  1981  CGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFV  2160
               P +       LT  V+  E+K AVFD+    SPGPDG    F+Q +W  +   +   V
Sbjct  428   LSPIVSEADNAYLTSAVSPEEIKNAVFDLAPDKSPGPDGFPPYFFQKYWTLIGKSVCRAV  487

Query  2161  KKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKN  2340
             +     G +  ++  +F+ LIPK D P  A+ FRPI+L +  +K+ISK+I NR++  +  
Sbjct  488   QAFFHSGYMLKEVNHTFLALIPKVDKPVNANHFRPISLCSTIYKVISKIITNRLKITLGK  547

Query  2341  LIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLEST  2520
             +I P Q +F+P R   DNI++  E+ H  + K G+ G +AIKLD+ KAYD ++W+++ +T
Sbjct  548   IIHPLQGAFIPERLIQDNILIAHEVFHSFKNKTGRGGWIAIKLDMEKAYDRLEWKYIYTT  607

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             +   GF    I  I   +  +S S+L NG     F P RG+RQGDPL+PYLFIL  E L+
Sbjct  608   MDKMGFSPIWIEWIRSCISSASFSVLVNGIPGERFFPSRGIRQGDPLSPYLFILCAELLA  667

Query  2701  WDIQEKVRVK-NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSG  2877
              +  +          + + R  T +  L FA+D M+FA+A+E     I   L K+   SG
Sbjct  668   REFSKACHEPGKLIGVPIGRTRTRIPFLTFADDTMIFAKATEASCHKIRQILDKYCLMSG  727

Query  2878  LNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDG  3057
               +N  KS   CSPN     K    ++ G+  S  LG YLG PI++ RV+K TF  ++  
Sbjct  728   QLVNYHKSAFQCSPNVRDIDKVNFASILGMQESSELGDYLGCPIINSRVTKETFAGVISK  787

Query  3058  MKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSA  3237
               ++L  WK N LS AGR  L+QS L+S   + MQ F LP      +D   R+F W    
Sbjct  788   TVQQLPKWKANSLSQAGRTVLIQSNLASKASFQMQSFTLPKKVLTTLDTTYRNFFWNKDP  847

Query  3238  QNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVK  3417
               K  + +GWN IC+ K  GG+G RK    N AL  KL W+++ S D +WVK++ +KY+K
Sbjct  848   AAKSANFIGWNKICQPKSVGGVGFRKAEVTNIALQMKLLWKIMVSKDNIWVKLVTQKYLK  907

Query  3418  NKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEV  3597
              +N     + +NASW W++++R R+    G  W IG+G  ++FW+D W    PL   +  
Sbjct  908   EQNLLVCKIPSNASWQWKNLLRHRNFFSKGLRWLIGDGQDISFWTDNWIFQYPL---NSK  964

Query  3598  TIPDSQSE-AKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSP  3774
              +P   SE  KV++       W++ KL +L+P +I+  I +  I    Q  D L W  +P
Sbjct  965   YVPTVGSENIKVAECFNGLGGWDIPKLLTLVPPNIVKAISSVFIPSSSQ-QDRLLWGLTP  1023

Query  3775  TGAFSVRSAFS---HIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKG  3945
             TG +SV+S  S    + G   + ++ +W+W +    + + FLW      L T     R  
Sbjct  1024  TGQYSVKSGASLIREVNGGTIEKVEFNWIWGIHAPPKIKNFLWKACNDGLATTSRLERSH  1083

Query  3946  MTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCAS-  4122
             +     C  C    ET+ H+  +C F  D +  +H    FQ+       SW      +S 
Sbjct  1084  IFVPQNCCFCDCPSETICHLCFQCPFTLDIY--SHLEDKFQWP---AYPSWFSTLQLSSF  1138

Query  4123  -DWINGCPWGVTFIYTC------WEIWKARNQRIFENTAS----APMDIMR-----RANN  4254
                +  C   +T  Y        W +W  RN+ IF N ++    A   I          N
Sbjct  1139  RSVLEACHINLTLEYLTKLSIVWWHVWYFRNKLIFNNESTSFSQASFIIHSFMGKWEKAN  1198

Query  4255  LTLDTVEVFLNKKC-VHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
             L + +    L K C + V   + + W PP    +K N DG+ K + G A+ G + R+  G
Sbjct  1199  LEIPSFNTPLPKDCKLPVRSGKNLIWSPPNEDVLKVNFDGS-KLDNGQAAYGFVIRNSNG  1257

Query  4432  EWLFGFMTNIGVSNS-FAAELWGLRE  4506
             E L      +GV  S   AE  GL E
Sbjct  1258  EVLMARAKALGVYPSILMAEAMGLLE  1283



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score =   545 bits (1404),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 344/1096 (31%), Positives = 543/1096 (50%), Gaps = 42/1096 (4%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +SF Y  P    + + W+      S    PW M+GDFN+++ N E+ G +    S  + F
Sbjct  1     MSFIYGDPVPQNRVKVWDKLSDIGSFRVDPWFMIGDFNELSGNHEKRGGALRPASSFVPF  60

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
                   CG+L+    G   SW        V R +LDRAL N + Q  FP +K   L    
Sbjct  61    NSMIRHCGMLEFPCYGEHLSWRGNRCNNQVVRCRLDRALGNEDWQGFFPNSKVDYLDMIG  120

Query  1399  SDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWSNSLLDVVGAISE  1566
             SDH P+   C       + NR FRF+  WL ++         W R  +      V  I  
Sbjct  121   SDHCPILATC--LKTHIKRNRQFRFDKCWLGKDGLSGAVESGWNRTINFRPTGFVDKIKN  178

Query  1567  VTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQE  1746
               N    W K    NIF     + +    +QE+   ++    ++  R +  +L E  + E
Sbjct  179   CRNSISWWRK---NNIFSGPRLISSLKAALQEAKMDDSISQEEI--RGIERKLKEAYRDE  233

Query  1747  ELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNF  1923
             EL W QKSR+ W++ GD+NT F+  ST  RR R+RI  +   +  WN     + +  + +
Sbjct  234   ELYWQQKSRKFWLRVGDKNTKFFQASTKQRRVRNRIIGLFDTDNVWNESASGMENIATKY  293

Query  1924  FIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQ  2103
             F DLF   +    S       P +       L R+++  EV+KA+F M    +PGPDG+ 
Sbjct  294   FEDLFRNSDAQGVSEMLQEVTPLISDTMNRDLIRDISEAEVRKALFAMHPEKTPGPDGMT  353

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNV  2283
             A F+Q FW  +K  +   V++  R GR  P + E+ I LIPK D P+  ++FRPI+L NV
Sbjct  354   ALFFQRFWSSLKGDLVALVREFFRSGRFDPCLNETNICLIPKVDRPQRMAEFRPISLCNV  413

Query  2284  SFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMA  2460
             S+KIISK++  R++  + +L+   Q++F+ GR   DNI++ QE+ H +    + K   +A
Sbjct  414   SYKIISKILCFRLKRFLPSLVSETQSAFVSGRLITDNILVAQEMFHGLNTNNRCKSEFLA  473

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
              K D+ KAYD ++W FLE+ +V  GF +N IS IM+ V   S  +L NG+     +P RG
Sbjct  474   FKTDMSKAYDRVEWAFLEAVMVKLGFDRNWISWIMWCVSSVSYQVLLNGQPRGFIKPQRG  533

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEAS  2820
             LRQGDPL+PYLFIL  E L  +I++  R K    IT++R    +SHL FA+D + F +A 
Sbjct  534   LRQGDPLSPYLFILCTEVLIANIKKAEREKKVTGITIARDSPTISHLLFADDSLFFCKAE  593

Query  2821  EDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLG  3000
               + + +M  ++ +   SG  +N+ KS+I       +EI+  LK++ GI+    +G+YLG
Sbjct  594   ATECQTVMEIIRNYGKASGQEVNLEKSSIMFGKKVPTEIRDQLKSVIGITKEGGMGSYLG  653

Query  3001  IPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPA  3180
             IP   +      FGY+ D +  ++  W   +LS  G+  +++S   ++P + M  +KLP 
Sbjct  654   IPESLQGSKNKVFGYVKDRLDDRVNGWNAKLLSKGGKEIMIKSVALALPTHVMSCYKLPQ  713

Query  3181  GTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQ  3360
                + +      F W  + +   +H V W+ +CK K  GGLG R    FN+A+LAK  W+
Sbjct  714   ELTSKLTSAISTFWWKSNDKAHGLHWVAWDKLCKDKCDGGLGFRALEQFNDAMLAKQYWR  773

Query  3361  LVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSL  3540
             L+     L  +V++ +Y  NK+       +N S+ WRSI   + +VE GA W +G+G S+
Sbjct  774   LIQHPTSLMARVLKGRYFSNKHPLMAKKPSNPSFAWRSIFSTKDLVEYGARWAVGSGSSI  833

Query  3541  NFWSDWWTGD---KPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDG  3708
             + W D W  D   +P      + +P       V+  I P  + W++  L   L    I  
Sbjct  834   SVWRDPWIPDIRPRPANGRGRLWLP----SLMVNHLINPVTKDWHLPTLEEFLDPGDIPI  889

Query  3709  IRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF-------SHIAGNDEDAMDTSWVWKMRV  3867
             IR   ++  +Q  D L W  + +G ++V+S +       + +          + VWK+ V
Sbjct  890   IRRMSVSKVQQ-RDRLVWHFTKSGKYTVKSGYRLARELMTEVEYGPTCMALRAQVWKLDV  948

Query  3868  TERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRR-  4044
               + + F W +  G L        +G+  DTLC  CG   ET+NH L EC  + D W   
Sbjct  949   PPKVQHFFWQIASGTLPVLERLAYRGIRCDTLCKRCGAAPETINHALFECPRSLDVWELS  1008

Query  4045  --THHPVSFQYSLVTPLKSWV----KNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
               +  P  F ++ +     ++     +    SD  N  PW        W +WK RN+++F
Sbjct  1009  LVSLVPDGFPFASIYANLDFIFWRAASQSGDSDVANRLPW------ILWTLWKDRNKKVF  1062

Query  4207  ENTASAPMDIMRRANN  4254
             +   + P +I+ +ANN
Sbjct  1063  QGLQAEPTEILHQANN  1078



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score =   550 bits (1416),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 356/1185 (30%), Positives = 588/1185 (50%), Gaps = 50/1185 (4%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
             +R++  +   +   ++  W +    S     PWI  GDFNDI    E+ G  SV P R  
Sbjct  420   MRITCLHAPYSYHMRQLLWQEIRLISISNTWPWICTGDFNDILYPWEKVGRRSVAPFRLS  479

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
             +F    + C L+++ + G  ++W  +  G  + + +LDR L     + L+P A    LP 
Sbjct  480   SFHSFINDCSLMEVESKGCRFTWTNKRVGDDLIKERLDRVLCTSNWRVLYPTAVVFALPA  539

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS-----LLDVVGA  1557
               SDH PL  L +    P +  R F +E  W    + + I  R W++S     + D    
Sbjct  540   VGSDHSPL--LLDTIGTPAKNRRQFVYEAYWNRDPECQHIVQRHWNSSRHHQSMFD--HK  595

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             I  VT   + W++E F N   R  +L  ++  +  +   +++        ++  E+  + 
Sbjct  596   IQVVTRALQAWSREKFQNGHQRINALYQQLTDLNNTPSLHSNDTEDA--SQIRDEIRNLW  653

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHI  1914
             +QEEL W  +SR  W++ GD+N+ F+H ST+ RR R+RI ML+  N EW  D + + +  
Sbjct  654   QQEELFWAMRSRINWLRSGDKNSKFFHASTIQRRQRNRIIMLQDGNEEWVRDPQALREMT  713

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPD  2094
             ++FF  L+  +   + +P    C   +     ++LT  VTM EV+KA F +    +PGPD
Sbjct  714   TDFFSQLYTSERARNYNPVLDQCPSVVTLDMNNQLTASVTMEEVQKATFQLGISKAPGPD  773

Query  2095  GIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITL  2274
             G+   FYQ  WE +K  +   V+     G +P ++ ++ I LIPK + P++   +RPI+L
Sbjct  774   GLNGLFYQNHWEIIKYDLLRLVEDFFNSGSLPRQLNKTIIALIPKTNHPQSLEQYRPISL  833

Query  2275  LNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKK-G  2451
              N ++KIISKV+ NR++P + NLI   Q +F+ GR   DN+++ QE++H  + +K K+  
Sbjct  834   CNYAYKIISKVLANRLKPWLPNLIAKEQAAFVSGRHIQDNVLILQEVMHQFKARKWKRRH  893

Query  2452  LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQP  2631
              + +K D+HKAYD ++W+FL+  L+  GF    +  +M  V  +S+ L +NG  L   QP
Sbjct  894   KILVKTDMHKAYDRVEWDFLKDYLLKLGFHHRWVLWVMQCVTTTSLGLRFNGATLPYIQP  953

Query  2632  GRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFA  2811
              RGLRQGDPL+PYLF+L    LS  I + V     K I  +R    +SHLFFA+D + F 
Sbjct  954   TRGLRQGDPLSPYLFVLVANVLSTLITQAVSSGYLKGIKFARSCPTLSHLFFADDSVFFL  1013

Query  2812  EASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGT  2991
             + +  + + + N L ++   +G  IN +KS + CS      ++  L     + V    G 
Sbjct  1014  DGTITECQNMSNILNQYCIATGQTINRNKSGMICSKYCPISLQEHLAREFRVPVLQRFGK  1073

Query  2992  YLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFK  3171
             YLGIP    R  +  F +I+  +  K+  WK ++LS  G+  L+++ + ++P Y M VF+
Sbjct  1074  YLGIPSDWGRSKRDMFSWIVARVSSKMEGWKESLLSKGGKEVLLKAVVQAIPQYAMSVFQ  1133

Query  3172  LPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKL  3351
             LP   C  +++    F W +    + VH   WN +  SK +GGLG R  + FN ALL K 
Sbjct  1134  LPQSICKTLEQRIAQFWWRNDVSRRGVHWHPWNALKISKHSGGLGFRDLMVFNKALLGKQ  1193

Query  3352  AWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNG  3531
             AW+LV S   LW ++ +  Y  N +F    +    SWGWRS++ GR  +     W +G+G
Sbjct  1194  AWKLVQSPLSLWSQLFKGLYFPNGSFLRAEIGYRPSWGWRSLLAGREAILPNLRWSVGDG  1253

Query  3532  LSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILP-NRTWNVDKLSSLLPHDIID  3705
               ++   D W        +  +  P ++ E + V+D I P  +TWN+  L       I+ 
Sbjct  1254  KRISIRQDQWLP------IGSIPGPLARDEPQIVADLIDPLLQTWNLPLLQRHYDDCIVR  1307

Query  3706  GIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI-------------AGNDEDAMDTS  3846
              +   PI      SD L W  S  G +SV+S +  +             + N +D++   
Sbjct  1308  EVIKIPIRPLF-TSDQLIWAASKDGIYSVKSNYQSLHFSEVPRSVNGASSSNSQDSLIWK  1366

Query  3847  WVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCG-DGDETMNHVLMECSF  4023
              +W M    + R+FLW +    L T    +R+ +T D +C  C     ET+ H+   CS+
Sbjct  1367  RIWTMSTEPKVRMFLWSVFHNALATKDNLFRRHITSDPICDLCNQQTPETIEHIFFSCSW  1426

Query  4024  AKDCWRRTHHPVSFQYSLVTPLKS---WVKNNCCASDWINGCPWGVTFI-YTCWEIWKAR  4191
              K+ W+   HP     ++ T + S   W+         +     G+ FI Y  W+IW+ R
Sbjct  1427  TKEIWK---HPDLIALNIQTTVHSIAGWIATQVRQKSSVP----GLAFIAYVLWQIWRGR  1479

Query  4192  NQRIFENTASAPMDIM--RRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNT  4365
             N  +F +       ++   RA   + D +     K   +     ++ W+PP+ G IK N 
Sbjct  1480  NSFVFRHKQPKSHFVVPDARAQLNSYDRINPRRKKPQSNALYSEFL-WRPPDRGAIKCNI  1538

Query  4366  DGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             DGA+++     S   ++RD KG     +  +   +++  +E+  L
Sbjct  1539  DGAYQQGCNKGSMACISRDFKGRLTDVYSADFPANSALQSEVQAL  1583



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score =   548 bits (1411),  Expect(2) = 3e-162, Method: Compositional matrix adjust.
 Identities = 365/1179 (31%), Positives = 578/1179 (49%), Gaps = 70/1179 (6%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R +  Y  P R+ K  FW   ++Y +  + PWI  GDFN+   + E+ G   V  +R   
Sbjct  537   RFTGVYGTPYRVEKNLFWEWMVNYFTPTDIPWICGGDFNEFLWDHEKSGGVEVLYNRPRF  596

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
               E  S+  L+D+G +G +++W     G  V+ R LDR + N + Q L+P ++ +     
Sbjct  597   LEEFLSSSQLIDLGFNGPAFTWRGMRKGDWVEER-LDRVMANEKWQQLWPHSQVMHETVL  655

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWSNSLLDV-VGAI  1560
              SDH P+  +  +    ++  + FRFE  W+  E+ +++    W R  + S ++  V ++
Sbjct  656   ASDHCPVILI--SNIEEQKGRKMFRFEAYWVAEEECKNLVEKCWDRRHNGSPVNRWVRSL  713

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLE-RKLVTELNEVL  1737
             ++      +WN+  F    GR + +      + +        G    E R++   ++E+ 
Sbjct  714   NDCRYRLSRWNRTKF---MGRGSRIHDL---LSQLDLLQRDWGPNYDEIREISRRIDELR  767

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHI  1914
              QEE  W Q+SR  W+++GD NT F+H STL RR R++I  L+  NG W      +   +
Sbjct  768   LQEESYWCQRSRVKWLREGDANTQFFHSSTLQRRRRNKIVKLRDENGNWVESPAQVRHLV  827

Query  1915  SNFFIDLFGRKNIMD-GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGP  2091
              N F  +F      + GS  D    P +       L   VT  E+K A  +M    +PGP
Sbjct  828   DNHFTSVFSSAGDRNWGSLLDCI-NPSVSPEMNEVLIAPVTEEEIKAAAGNMGGLKAPGP  886

Query  2092  DGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPIT  2271
             DG Q  FYQT+WE V+  ++  V+ +++D      I ++ + LIPK  +PE  S FRPI+
Sbjct  887   DGFQGIFYQTYWEIVREGVSALVRDLIQDAAGSRLINQTHVVLIPKVPNPEFVSQFRPIS  946

Query  2272  LLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG  2451
             L N S+KI+SK++ NR++ ++  +I P QN+F+PGR   D I +  E+ HY++ +K +  
Sbjct  947   LCNYSYKILSKILANRLKVLLPKIISPSQNAFVPGRQIQDCIGIAHEMFHYLKGRKAQNR  1006

Query  2452  L-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQ  2628
               M IKLD+ KAYD ++W+FL++ +   GF  +  SLI   V     ++L NG+    F 
Sbjct  1007  FEMGIKLDMQKAYDRVEWDFLDAVMERMGFCSSWRSLIGGCVSSVKFAVLLNGQAGKSFA  1066

Query  2629  PGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLF  2808
             P RGLRQGDP++PYLFIL  E LS  IQ  V     + + +   G  +SHLFFA+D +LF
Sbjct  1067  PSRGLRQGDPISPYLFILVGEVLSKLIQGAVDQGRLEGVKIGGSGPVISHLFFADDTLLF  1126

Query  2809  AEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLG  2988
               A  +    + N L +F   SG  +N+ KS++F   N        + N  G+ V  N G
Sbjct  1127  LRADMENCGNLRNLLDRFCVASGQKVNLEKSSVFFGANVPKVNVEQMGNALGMKVVINPG  1186

Query  2989  TYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVF  3168
             TYLG+P +  R  K    Y+   +  KL  WK N LS AG+  L+++ + ++P Y M +F
Sbjct  1187  TYLGVPTIWGRSKKRGLAYVKGRVMEKLQGWKQNTLSRAGKEVLIKAVIQAIPAYPMCIF  1246

Query  3169  KLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAK  3348
             K P   C ++D +   F WG      K+H V    +   KD GGLG R   +FN ALLAK
Sbjct  1247  KFPGAVCKELDALVAGFWWGCKEGAHKIHWVSKGVLGLPKDMGGLGFRNFQEFNEALLAK  1306

Query  3349  LAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGN  3528
               W+L+T  D LW KV++ +Y  + + +       ASW W S++ GR +V  G+ W+I  
Sbjct  1307  QCWRLITEPDSLWAKVIKARYFPHSSIWDAKKGGRASWAWSSLICGRGLVREGSHWQILG  1366

Query  3529  GLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLLPHDIID  3705
             G  +  W D W    PL   + V         +VS  I P    WN++ L   +  + + 
Sbjct  1367  GQEVRVWQDRWLPSLPLGHPEPVGQVAVTPSLRVSALICPESGRWNINFLQPFISEEAMQ  1426

Query  3706  GIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS-----------W-  3849
              I  TP+    +  D L W  S  GA+SV+S +  + G      D             W 
Sbjct  1427  AIEETPLGDLSR-KDRLIWDTSKNGAYSVKSGYRWLQGRSLVRRDLRRPSVRGVPKAFWK  1485

Query  3850  -VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFA  4026
              +WK+ V  + R FLWL +   L T    +R+  ++ + C  C   DET+ H+ + CS+ 
Sbjct  1486  GIWKLEVPPKLRHFLWLTVHNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCSWV  1545

Query  4027  KDCWRRTHHPVSFQYSLVTP-LKSWVKNNCCASDWINGC-----------PWGVTFI-YT  4167
             +  W       +  Y +  P L SW       SDWI G             W  ++I +T
Sbjct  1546  EPIW----FGGALGYKMDRPSLPSW-------SDWIQGVFSPNLCNSGDIMWRQSYIVFT  1594

Query  4168  CWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKC--------VHVGKMRWV  4323
             CW IWKAR   +F+     P+ ++   +    + V  F++ K               +  
Sbjct  1595  CWCIWKARCDFVFKEVPINPLKVLAAIS----EAVRSFISAKAKDGERGGGEGRRNSQVT  1650

Query  4324  CWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWL  4440
              W  P   ++K N D ++ + + +   G + RD + +++
Sbjct  1651  RWCAPTYPFVKINVDASWSKASKMGFVGVIVRDMESKFV  1689


 Score = 55.8 bits (133),  Expect(2) = 3e-162, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +3

Query  720  PDVSMIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDK  899
            P +S IF  WNCRG+G+  TV     L+R  +   I   ETK  +  RI  +  +LG+  
Sbjct  434  PAMSYIF--WNCRGLGSNTTVRALHGLIRKKRPSMIFLSETKMKD-HRILGVRRRLGYVH  490

Query  900  LFNVDPLGFAGGLTLFLE  953
             F+V P+G AGGL+L+ E
Sbjct  491  GFDVSPIGSAGGLSLWWE  508



>ref|XP_010676027.1| PREDICTED: uncharacterized protein LOC104891937 [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score =   535 bits (1377),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 372/1186 (31%), Positives = 586/1186 (49%), Gaps = 94/1186 (8%)
 Frame = +1

Query  1126  PWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRT  1305
             P+I++GDFN+I+++ ++ G S    +R LN    F++   +++  SG  Y+W +++GG  
Sbjct  7     PYIILGDFNEISNSSDKLGGSPPVMARFLNMQNLFNSLPCIEIPFSGSIYTWRKKKGGAD  66

Query  1306  VQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAW  1485
                 +LDR + +++  +LFP+AK      T SDH   +         + +  PF+FE  W
Sbjct  67    NIHERLDRGVASIDWLSLFPQAKISHNIFTSSDH--CQITLNYIPFQKAKAPPFKFEKMW  124

Query  1486  LTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
              +R DY  +  + W      + +  +      +   SK WN+  FGNIF        +++
Sbjct  125   CSRRDYDTLVKKTWCTHFIGSHMFRLTQKCKLLKEKSKIWNQSQFGNIF-------RQLR  177

Query  1651  GVQESVFYNTSRGLQVLERKLVTE-LNEVL--KQEELL-------------WFQKSRRMW  1782
              V E         LQ L+  L+TE LN +L  KQ+  L             W QK +  +
Sbjct  178   KVDEK--------LQSLQLLLITEPLNHLLLSKQDTFLQKRSNLLSFSYEYWKQKCKVDY  229

Query  1783  IQDGDRNTAFYHKSTLIRRNRSRIRML-KINGEWNSDFKTISDHISNFFIDLFGRKN-IM  1956
             +  GD N++FYH    IRRNR+ I+ L K + +  S+   IS  ++  F++ F   +   
Sbjct  230   LLLGDTNSSFYHAHASIRRNRNAIKELSKADNDTISNPDIISQELTRAFMERFTSDSRTC  289

Query  1957  DGSPNDM-YCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEE  2133
               S ND       +       LT  VT  E+K A F +    SPGPDG    F+Q +W  
Sbjct  290   FNSANDFSLLEAIISVDDNTYLTSLVTCDEIKSATFSLAPDKSPGPDGFPPFFFQKYWTL  349

Query  2134  VKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIV  2313
             V + +   V+      R+  +I  +F+ LIPK D+P +A+ FRPI+L +  +KIISK++ 
Sbjct  350   VGNSVIRAVQAFFHSSRILKEINHTFLALIPKIDNPTSANHFRPISLCSTIYKIISKIMT  409

Query  2314  NRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDS  2493
             +R++ +M ++I P Q +F+P R   DNI++  E+    + K G  G +AIKLD+ KAYD 
Sbjct  410   SRLKIVMGHIIHPLQGAFVPDRLIQDNILIAHEVFQSFKNKSGASGWIAIKLDMEKAYDR  469

Query  2494  IDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYL  2673
             ++W ++ +TL   GF    ++ +   +  +S S+L NG     F P RG+RQGDPL+P+L
Sbjct  470   LEWNYIFTTLEKLGFAAQWVNWVKACITSTSFSVLVNGIPGEKFSPSRGIRQGDPLSPFL  529

Query  2674  FILAMERLSWDIQEKVRVKNWKPI--TLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMN  2847
             FIL  E L+  +         KPI   + R G  V  L FA+D M+FA+A+     +I  
Sbjct  530   FILCAELLARLLSSAASGPT-KPIGVPIGRSGVKVPFLTFADDTMIFAKATNYSCLVIRQ  588

Query  2848  CLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVS  3027
              L K+   SG  +N  KS+  C+ N + + K    ++  +S + +LG YLG PI+H +V+
Sbjct  589   ILDKYCAMSGQLVNYHKSSFQCTANISEDDKANFASILQMSETFDLGEYLGCPIIHSKVT  648

Query  3028  KHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRI  3207
             K TF  +++    +L  WK N LS AGR  L++S L+S   Y MQ F LP    + +D+ 
Sbjct  649   KETFSSVINKTVGQLPKWKANALSQAGRSILIKSNLASKASYQMQSFLLPNSILSSLDKT  708

Query  3208  CRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLW  3387
              R+F W      K  +L+GW+ ICK K AGGLG RK    N AL  KL W++V +   LW
Sbjct  709   YRNFFWNKDPNAKSPNLIGWDKICKPKVAGGLGFRKAEVNNQALQMKLLWRIVKNDTNLW  768

Query  3388  VKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTG  3567
             V ++R++Y+KN++ F   +  +ASW WR+++  R + + G  W+IG+G  + FWSD W  
Sbjct  769   VNLVRKRYLKNRSLFTIKVSKSASWQWRNLLSLRDLFKKGLRWQIGDGSCVRFWSDNWAF  828

Query  3568  DKPLAFMDEVTIPDSQS-EAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQV  3744
               PL   D +  P  ++    V D +  N  WN   L SL+P +I+  I +  +    Q 
Sbjct  829   QYPL---DSIITPTPETINFLVKDCLTANGNWNTQLLLSLVPPNIVSHISSIYLPSSPQ-  884

Query  3745  SDSLYWPRSPTGAFSVRSAFSHIAG---NDEDAMDTSWVWKMRVTERCrlflwllmrgrl  3915
              D+L W  +  G +SV+S      G    + D ++  W+W + +  + + FLW      L
Sbjct  885   QDTLIWGLTSDGEYSVKSGALLAQGLISAELDTVEYKWIWNLIIPPKIKNFLWKACNDGL  944

Query  3916  lTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKS  4095
              T +   R  +     C  C +  E++ H+   C F  D +  +H   SF + L      
Sbjct  945   PTKVRLERSHVFLPQQCVFCSNASESIGHLCFACPFTLDVF--SHLKASFDWPL------  996

Query  4096  WVKNNCCASDWIN------------GCPWGVT-FIYTCWEIWKARNQRIFEN----TASA  4224
                N C AS  +              C   VT F +  W IW  RN+ IF N    +  A
Sbjct  997   --PNRCLASIDLTSFRSALEACLSLACKSEVTKFSFVWWFIWFFRNKLIFNNEVVSSRKA  1054

Query  4225  PMDIMRR----ANNLTLDT-------VEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDG  4371
                I +     +  LT DT           +  +    G   +  W PP   + K N DG
Sbjct  1055  SAIIAKYYVDWSKALTSDTRHPSTSISHCPIISRSPRSGPASF--WSPPPQNYFKLNFDG  1112

Query  4372  AFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNS-FAAELWGLRE  4506
             + K ++   + G + R+  GE +     ++G S S   AE W L+E
Sbjct  1113  S-KLSSNSTALGFVIRNVAGEAMVAGSKSLGYSTSVLQAEAWALKE  1157



>ref|XP_009118883.1| PREDICTED: uncharacterized protein LOC103843855 [Brassica rapa]
Length=1293

 Score =   535 bits (1379),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 372/1211 (31%), Positives = 580/1211 (48%), Gaps = 44/1211 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               WRS + N  V+ +T   I   VS   +    +F Y  P    ++  WN     S   N
Sbjct  19    LLWRSDV-NLQVLTSTPHYIDTSVSFKGAAFFSTFVYGAPEIQHRQGVWNLLSDISLNRN  77

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
               W + GDFN+I DN E+ G      S    F    S+C L D+  +G   SW  +    
Sbjct  78    GAWYLTGDFNEITDNSEKSGGRERPESSFSAFRTFLSSCDLFDIKHTGNFLSWRGRRSTH  137

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              V  R LDRA+ N    ++FP  ++  L    SDH P+  L    +  ++ +R FR++  
Sbjct  138   LVHCR-LDRAMANSAWSDMFPNGRSHYLQFEGSDHRPV--LSTFDSKKKKTSRLFRYDRR  194

Query  1483  WLTREDYRDIWGRVW-SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
                  + + +    W S + L V   IS   +    W+K+++ N   R   L+  +    
Sbjct  195   LRDNPEIKLLVDATWTSGAHLTVAERISRCRHAIATWSKKSYVNSQKRIVELKESLDQAM  254

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
              +   + S  + ++ R L+    +  K EE  W Q+SR++W+  GDRNT F+H +T  RR
Sbjct  255   TATIVDDSY-ISLINRDLL----QAYKAEEEFWKQRSRQLWLSLGDRNTGFFHAATKGRR  309

Query  1840  NRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK  2016
              R+RI +++  +G    +   I   I+ +F  +F   +       +    P +       
Sbjct  310   ARNRISVIEDTSGNPIFEEDEIGKVIAEYFRKIFTSSDPAAVDIVNKAITPCITLETNES  369

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             LT   +  E+++A+F +    +PGPDG  A+F+Q+ W+ V   IT  ++     G +P  
Sbjct  370   LTTTPSALEIREAMFAIHPDKAPGPDGFSASFFQSNWDVVGPAITKEIQGFFISGALPYS  429

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
             I  + I LIPK  SP+  SD+RPI L NV +K ISK++  R++P++ +++   Q++F+P 
Sbjct  430   INSTHIRLIPKIQSPKQVSDYRPIALCNVYYKTISKILSIRLKPVLHDIVSANQSAFVPD  489

Query  2377  RSTADNIILTQEIVHYMRLKKGK-KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             R+  DN+++T E++HY++         MA+K D+ KAYD ++W F+ + L   GF    +
Sbjct  490   RAIQDNVLITHEMLHYLKASGATIHCSMAVKTDISKAYDRLEWSFIRAVLERLGFNDTFV  549

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
             + +M  +   S S L N E +    P RG+RQGDPL+PY+FI+  E LS   +       
Sbjct  550   NWMMECISTVSYSFLLNNEVVGEVHPQRGIRQGDPLSPYIFIICAEVLSGLCRTAQENGT  609

Query  2734  WKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC  2913
                + +SR G  V+HL FA+D M+F +        ++  L+ +   SG  IN  KS+I  
Sbjct  610   LPGVRVSRYGPKVNHLLFADDTMIFTKTDPLSCTTLVEILQSYEKASGQMINAQKSSISF  669

Query  2914  SPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNM  3093
             S  T +EI+  +K   GI     +G YLG+P    R  K  F  I+D M++K A+W    
Sbjct  670   SSKTPAEIRSRVKEKLGIDKEGGVGKYLGLPEHFGRRKKDLFASIVDSMRQKAASWSTQF  729

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             LS AG+ T++QS LS+ P + M  F LP   C  I  I   F W D    KK+    W  
Sbjct  730   LSTAGKATMIQSVLSAKPNFAMSSFLLPVSLCKQIQTILTRFWWDDKDGEKKICWKSWES  789

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIAN  3453
             +   K  GGLG R    FN ALLAK+AW+++T  D L  KV+  KY     F      + 
Sbjct  790   LTHPKSLGGLGFRDVQAFNEALLAKIAWRILTKPDSLLAKVLLSKYCYKTTFTKVIAGSA  849

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEV-TIPDSQSEAKV  3630
              S GWR I+ GR ++       IGNG + N W+D W    P++ +  +  +P  + +  V
Sbjct  850   ISHGWRGILTGRDLLLRHLGRAIGNGETTNLWADSWI--DPISNLRPIGPVPLQEKDLMV  907

Query  3631  SDFIL-PNRTWNVDKLSSLLP--HDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSA  3801
             +D +    + WN  ++  LLP   D I  I+ + +       DS  WP   TG ++V++ 
Sbjct  908   ADILTRETKEWNTGRIRQLLPELEDHILNIKPSVLG----TGDSYIWPLQKTGEYTVKTG  963

Query  3802  FSHIAGNDEDAM-----DTSWVWKMRV-----TERCrlflwllmrgrllTNMERWRKGMT  3951
             +  I   D  +      D  W WK  +       + R FLW +    L T      +G+ 
Sbjct  964   YYAIHSLDFQSTSLLEEDNMWSWKKHIWNPPLLPKLRFFLWKIATNSLPTGANLQTRGLL  1023

Query  3952  EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWI  4131
              +T C  CG+  ET++H+L  C+FAK  W         +   +   K  ++    + +WI
Sbjct  1024  VNTSCPRCGEV-ETIDHILFHCAFAKKVWTFGLWSTPREAGDLMTFKDTLR---ASFNWI  1079

Query  4132  NGCPWGVT---FIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD-TVEVFLNKKCV  4299
             N  P GVT   F + CW +W ARN R FEN   +P +++ +A   + +  V    N+   
Sbjct  1080  NLPPMGVTTNLFPWICWNLWTARNLRTFENRTISPQEVVLKAIRASKEWEVAQPCNRPTP  1139

Query  4300  HVG-KMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG-EWLFGFMTNIGVSN  4473
                   R     PP T  I  NTD A+K +T  A  G +  D  G E   G      VS+
Sbjct  1140  SPSTTQRHAAETPPMT--IFCNTDAAWKSDTKAAGLGWIFTDENGHELTRGSSAQHHVSS  1197

Query  4474  SFAAELWGLRE  4506
             +  AE   +RE
Sbjct  1198  ALMAETLAVRE  1208



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   537 bits (1383),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 354/1214 (29%), Positives = 579/1214 (48%), Gaps = 77/1214 (6%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W+ S+    V+++  + I  L+        ++  Y  P +  +   W          +
Sbjct  70    LMWKDSV-QIKVLQSDKRLIDALLIWQDKEFYLTCIYGEPVQAERGELWERLTRLGLSRS  128

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW++ GDFN++ D  E+ G  +   S CL F +  ++CGL ++  SG  +SW+      
Sbjct  129   GPWMLTGDFNELVDPSEKIGGPARKESSCLEFRQMLNSCGLWEVNHSGYQFSWYGNRNDE  188

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              VQ R LDR + N     LFP+AKA  L +  SDH PL  +        R+   F+++  
Sbjct  189   LVQCR-LDRTVANQAWMELFPQAKATYLQKICSDHSPL--INNLVGDNWRKWAGFKYDKR  245

Query  1483  WLTREDYRDIWGRVWS------NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
             W+ RE ++D+    WS      N+L+  +  I+       KW + +  +   R   LQ +
Sbjct  246   WVQREGFKDLLCNFWSQQSTKTNALM--MEKIASCRREISKWKRVSKPSSAVRIQELQFK  303

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +    + + ++  R L  L+++L  E N     EE  W +KSR MW+++GDRNT ++H +
Sbjct  304   LDAATKQIPFD-RRELARLKKELSQEYN----NEEQFWQEKSRIMWMRNGDRNTKYFHAA  358

Query  1825  TLIRRNRSRIRML--KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLD  1998
             T  RR ++RI+ L  +   EW SD + +      +F  LF  +++           P + 
Sbjct  359   TKNRRAQNRIQKLIDEEGREWTSD-EDLGRVAEAYFKKLFASEDVGYTVEELENLTPLVS  417

Query  1999  TGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRD  2178
                 + L   +T  EV++A F +     PGPDG+    YQ FWE +   IT  V+   R 
Sbjct  418   DQMNNNLLAPITKEEVQRATFSINPHKCPGPDGMNGFLYQQFWETMGDQITEMVQAFFRS  477

Query  2179  GRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQ  2358
             G +   + ++ I LIPK    E  +DFRPI+L NV +K+I K++ NR++ I+ +LI   Q
Sbjct  478   GSIEEGMNKTNICLIPKILKAEKMTDFRPISLCNVIYKVIGKLMANRLKKILPSLISETQ  537

Query  2359  NSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFG  2535
              +F+ GR  +DNI++  E++H +    K  +  +AIK D+ KAYD ++W FLE  +   G
Sbjct  538   AAFVKGRLISDNILIAHELLHALSSNNKCSEEFIAIKTDISKAYDRVEWPFLEKAMRGLG  597

Query  2536  FPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQE  2715
             F  + I LIM  V+     +L NG       P RGLRQGDPL+PYLF++  E L   +Q 
Sbjct  598   FADHWIRLIMECVKSVRYQVLINGTPHGEIIPSRGLRQGDPLSPYLFVICTEMLVKMLQS  657

Query  2716  KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVS  2895
               +      + ++RG   +SHL FA+D M + + +++    I+  ++++S  SG  +N  
Sbjct  658   AEQKNQITGLKVARGAPPISHLLFADDSMFYCKVNDEALGQIIRIIEEYSLASGQRVNYL  717

Query  2896  KSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLA  3075
             KS+I+   + + E +  +K   GI      G YLG+P   +     T  Y+ D + +K+ 
Sbjct  718   KSSIYFGKHISEERRCLVKRKLGIEREGGEGVYLGLPESFQGSKVATLSYLKDRLGKKVL  777

Query  3076  NWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVH  3255
              W+ N LS  G+  L+++   ++P YTM  FK+P   C  I+ +  +F W +  + + +H
Sbjct  778   GWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMAEFWWKNKKEGRGLH  837

Query  3256  LVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA  3435
                W  + + K  GGLG ++   FN ALL K  W+++T  D L  KV + +Y    +   
Sbjct  838   WKAWCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMITEKDSLMAKVFKSRYFSKSDPLN  897

Query  3436  TPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPD--  3609
              P+ +  S+ W+SI   + +++ G    IGNG ++N W+D W G KP      V      
Sbjct  898   APLGSRPSFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWIGAKPAKAAQAVKRSHLV  957

Query  3610  SQSEAK----VSDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSP  3774
             SQ  A     V D +LP+ R WN + +S L P +  + I A      ++  D   W  S 
Sbjct  958   SQYAANSIHVVKDLLLPDGRDWNWNLVSLLFPDNTQENILALRPG-GKETRDRFTWEYSR  1016

Query  3775  TGAFSVRSAFSHIA------GNDEDAMDTSW------VWKMRVTERCrlflwllmrgrll  3918
             +G +SV+S +  +        N ++ +  S       +WK+ V  +   FLW  +   L 
Sbjct  1017  SGHYSVKSGYWVMTEIINQRNNPQEVLQPSLDPIFQQIWKLDVPPKIHHFLWRCVNNCLS  1076

Query  3919  TNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW------------------RR  4044
                    + +  +  C  C    ET+NH+L +C FA+  W                  R 
Sbjct  1077  VASNLAYRHLAREKSCVRCPSHGETVNHLLFKCPFARLTWAISPLPAPPGGEWAESLFRN  1136

Query  4045  THHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTA-S  4221
              HH +S             K+    SD     PW        W +WK RN  +F+    +
Sbjct  1137  MHHVLSVH-----------KSQPEESDHHALIPW------ILWRLWKNRNDLVFKGREFT  1179

Query  4222  APMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLAS  4401
             AP  I++   ++           +     + R V WQPP  GW+K NTDGA+ ++ G   
Sbjct  1180  APQVILKATEDMDAWNNRKEPQPQVTSSTRDRCVKWQPPSHGWVKCNTDGAWSKDLGNCG  1239

Query  4402  AGGLARDHKGEWLF  4443
              G + R+H G  L+
Sbjct  1240  VGWVLRNHTGRLLW  1253



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   533 bits (1374),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 360/1204 (30%), Positives = 593/1204 (49%), Gaps = 68/1204 (6%)
 Frame = +1

Query  1018  GPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVN  1197
             G H  VRV+  Y  P R  K  FWN   +Y S  + PW+   DFN+   + E+ G S V 
Sbjct  46    GAHRWVRVTGVYGTPYRCDKVEFWNWMSNYFSPSDMPWLCAXDFNEFLWDSEKAGGSQVX  105

Query  1198  PSRCLNFVESF-SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAK  1374
              +R   ++ESF S   LLD+  +G +++W     G  V+ R LD+ L N   Q+++P   
Sbjct  106   YNRP-RYLESFLSTSELLDLDFNGPAFTWRGMRNGSLVEER-LDKGLCNRIWQDVWPNTT  163

Query  1375  AIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-----SNSL  1539
                     SDH P+  + +     RR  + FRFE  W    D +++  + W       + 
Sbjct  164   VTHGTXLGSDHCPI--IIQTEPDARRGRKLFRFEAXWAKEVDCKEVVRKSWDCREEGGAQ  221

Query  1540  LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVT  1719
             +  +  I++  +   +W++  F     +   L  ++  +Q++  +   R  ++LE+  + 
Sbjct  222   VRWLKKINDCRSQLIRWSRNKFKMRSYQIDYLLEQLGELQKN--WGPHR-XEILEKSRL-  277

Query  1720  ELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFK  1896
              ++ +  QEE  W Q+SR  W+++GD NT F+H++TL  R R+++ ++    G+W  +  
Sbjct  278   -IDTLWAQEESFWHQRSRVKWLKEGDANTKFFHQTTLQXRRRNKVLKIRNSTGDWVDNPN  336

Query  1897  TISDHISNFFIDLFGRKNIMD-GSPNDMYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMK  2070
              +   +   F+  F  +   + G+  D  C   + TG+M+  L   V   E+K A  +M 
Sbjct  337   QVRXLVDEHFLTSFRSEGDRNWGTTLD--CLTPMVTGEMNAALMXPVLEEEIKXAALNMG  394

Query  2071  KFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETA  2250
                +PGPDG Q  FY TF E +   +   V+ ++     P K+  + I LIPK  +PE  
Sbjct  395   GLKAPGPDGFQGVFYHTFXENIVGDVNDLVRSMIMGQDXPRKLNSTHIVLIPKVQNPEMV  454

Query  2251  SDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMR  2430
             S  R I+L N S+KI+SKV+ NR++PI+  +I P QN+F+ GR   DNI +  E+ H+++
Sbjct  455   SQXRXISLCNYSYKILSKVLANRLKPILTEIISPMQNAFVAGRQIQDNIGIAHEVFHFLK  514

Query  2431  LKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNG  2607
             + K K+   + IKLD+ KAYD ++W+FL++ +   GF  +   LIM  V   + ++L NG
Sbjct  515   IXKAKRRFEVGIKLDMQKAYDRVEWDFLDAVMEXMGFGSSWRKLIMGCVSSVNFAVLLNG  574

Query  2608  EKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFF  2787
             +    F P RGLRQGDPL+PYLF+L  E LS  IQ  V  +    + L+  G  +SH+FF
Sbjct  575   QPGEKFAPSRGLRQGDPLSPYLFLLVGEVLSKMIQGAVXXRQLDGVKLNGAGPVISHIFF  634

Query  2788  AEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGI  2967
             A+D ++F +A       ++  L+ +   SG  IN+ KS++F   N  S +   L N+ G+
Sbjct  635   ADDTLIFLKADRKNCNNLVVLLQDYCNASGQAINMQKSSVFFGNNVQSFLSEELGNILGM  694

Query  2968  SVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMP  3147
             +V DN G+YLG+P +  ++ K    Y+   +  KL  WK  MLS AG+  L+++ + ++P
Sbjct  695   TVVDNPGSYLGVPTIWGQLKKLGLAYVKGRILGKLQGWKQXMLSRAGKEVLIKAVVQAIP  754

Query  3148  VYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDF  3327
              Y M +FK PA  C ++D +   F W DS   +K+H V    +   K  GG+G R   +F
Sbjct  755   AYPMNIFKFPATLCKELDALIAKFWWDDSGVRRKIHWVSMETLGLPKHLGGMGFRNFQEF  814

Query  3328  NNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELG  3507
             N+ALLAK  W+L+   D LW +VM+ +Y  N +F        ASW W S++ GR ++  G
Sbjct  815   NDALLAKQCWRLIAEPDSLWAQVMKARYFPNCSFLDASKGGRASWAWSSLLVGRDLILKG  874

Query  3508  AAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSL  3684
             A W+I  G  +  W D W           +         +VS  I P +RTW+++ L   
Sbjct  875   AHWQIMGGEEVRLWVDRWLPALXSGHPSPLGEVAVTRNTRVSXIICPSSRTWDLEFLLPF  934

Query  3685  LPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF-----------SHIAGNDED  3831
             L       I  TPI    +  D L W  +  G +SV+  +            H +     
Sbjct  935   LSAGECAAICDTPIGNPRR-KDRLIWASTRNGIYSVKXGYLWLQLHSLSLRBHCSPXSRS  993

Query  3832  AMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
               +  W  +W+++V  + R FLW  +   L T    +++  +   +   C   +E++ H+
Sbjct  994   VPELLWKGIWRIKVPAKVRNFLWSSLHNALATVAVLFQRRSSLTPIXPICLCQEESIVHL  1053

Query  4006  LMECSFAKDCWRRTHHPVSFQYS-LVTPLKSWVK----------NNCCASDWINGCPWGV  4152
              + C +    W       + +Y+ LV  L SW             +  + +W+       
Sbjct  1054  FLSCPWVISIWSGG----ALKYNILVGSLSSWGAWLHDVFTSNLGSSASKEWVR------  1103

Query  4153  TFI-YTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNK------KCVHVGK  4311
             T++ +TCW IWK+R   +F      P  I+     + L   E  + +      + V  G+
Sbjct  1104  TYVAFTCWHIWKSRCDYVFNQVHIIPSKILM---GIDLXVAEFLIARSTPEISRAVDHGR  1160

Query  4312  MRWVC-WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAE  4488
             +R  C W PP + ++K N D ++ R +    A   ARD +G+++      I  S    AE
Sbjct  1161  VRQPCRWTPPVSPFVKLNVDASWSRVSKAGFAAVXARDARGDFIAAVRYPIFASCVAMAE  1220

Query  4489  LWGL  4500
             +  L
Sbjct  1221  VLAL  1224



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   542 bits (1396),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 363/1189 (31%), Positives = 592/1189 (50%), Gaps = 94/1189 (8%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R++  Y  P    +E+ W            PW+ +GDFN+I    E+ G    N  +   
Sbjct  513   RLTVFYGFPAVQDREKSWILLDQLGHHNQLPWLCVGDFNEILSTDEKEGGPLRNNRQMQG  572

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F       G  D+G +G  ++W  + G   V R +LDRAL     QNLFP      L  +
Sbjct  573   FRNIVDKLGFRDLGFNGYKFTWKCRFGDGFV-RVRLDRALATTSWQNLFPGFSVQHLDPS  631

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN--SLLDVVG---AI  1560
              SDH P+          +   R F FE  W T  D      +VW +  +L  +VG    I
Sbjct  632   RSDHLPILVRIRHATCQKSRYRRFHFEAMWTTHVDCEKTIKQVWESVGNLDPMVGLDKKI  691

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
              ++T + ++W+K TFG+I      L+A++  + ++ +   S  ++   R +   L+E+L 
Sbjct  692   KQMTWVLQRWSKSTFGHIKEETRVLRAKLASLFQAPY---SERVEEDRRVVQKSLDELLA  748

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             + EL W Q+SR  W++ GD+NT+++H+    RR R+ I+ L+  NG W +  + I+  + 
Sbjct  749   KNELYWCQRSRENWLKAGDKNTSYFHQKATNRRRRNIIKGLEDSNGCWRTSRQGITSIVI  808

Query  1918  NFFIDLF--GRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGP  2091
             ++F DLF     ++M+   + +   PK+       L  + +  E+K AVF M+   +PGP
Sbjct  809   DYFGDLFRSSGSSMMEEILSALE--PKVTADMQQVLIADFSYQEIKDAVFQMQPSKAPGP  866

Query  2092  DGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPIT  2271
             DG+   FYQ +W  V   +   V+  L+   +  ++  +F+TLIPK   P T +  RPI+
Sbjct  867   DGLPPLFYQKYWRIVGDDVVAAVRAFLQSNEMLRQLNHTFVTLIPKVKEPRTMAQLRPIS  926

Query  2272  LLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-GKK  2448
             L NV ++I +K + NRM+ +M+++I   Q++F+PGR   DN I+  EI H+++ ++ G+K
Sbjct  927   LCNVLYRIGAKTLANRMKFVMQSVISESQSAFVPGRLITDNSIVAFEIAHFLKQRRRGRK  986

Query  2449  GLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQ  2628
             G +A+KLD+ KAYD ++WEFLE  ++  GFP   + ++M  V   S S L NGE      
Sbjct  987   GSLALKLDMSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILY  1046

Query  2629  PGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLF  2808
             P RGLRQGDPL+PYLF+L  E  +  + +  R    + I + RG   VSHLFFA+D  +F
Sbjct  1047  PTRGLRQGDPLSPYLFLLCAEGFTTLLSKAERQGQLQGIVICRGAPTVSHLFFADDSFVF  1106

Query  2809  AEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLG  2988
             A+A+++   ++ +  + +   SG  IN  KS +  S N + + +  L ++ G+   D+  
Sbjct  1107  AKATDNNCGVLKHIFEVYEHASGQQINCQKSCVAFSANIHMDTQSRLASVLGVPRVDSHA  1166

Query  2989  TYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVF  3168
             TYLG+P++  R     F Y+ + + +KL  W+   LS+AG+  L++    S+P+Y M  F
Sbjct  1167  TYLGLPMMLGRNKTVCFRYLKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCF  1226

Query  3169  KLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAK  3348
              LP G C++I+++   F WG   +N+K+H + W  +CK+K  GG+G R    FN A+LAK
Sbjct  1227  LLPQGLCHEIEQMMARFWWGQQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAK  1286

Query  3349  LAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGN  3528
               W+LV +   L  ++++ KY    NF+   + +  S  W+SI   R ++E+G+ ++IG+
Sbjct  1287  QGWRLVHNPHSLASRLLKAKYFPQTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGD  1346

Query  3529  GLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRT--WNVDKLSSL-LPHDI  3699
             G S+  W D W   +P  F    +  D     KVS+ I    +  W++ KL++L LP D+
Sbjct  1347  GKSVRIWGDKWV-PRPATFAVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDV  1405

Query  3700  IDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF------------SHIAGNDEDAMDT  3843
             +D +R  P+++     D + W     G F+V+SA+               + N +  M  
Sbjct  1406  VDIVR-IPLSI-RAPPDRIVWNYDKHGLFTVKSAYRVALRVTSGDEDESSSSNSDTGMLW  1463

Query  3844  SWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSF  4023
               +W   V  + ++F W +    L T     +KG+    +C  CGD  E+  HVL  C F
Sbjct  1464  RHIWNATVPTKLKIFAWRVAHDILPTKANLIKKGVDMQDMCMFCGDITESALHVLAMCPF  1523

Query  4024  AKDCW------RRTHHPVSFQ-YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIW  4182
             A   W      R  H  V    + +V   + +V     A+D                   
Sbjct  1524  AVATWNISLLTRHAHQGVQRSPHEVVGFAQQYVHEFITAND-------------------  1564

Query  4183  KARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFN  4362
                       T S   D +R       D V                  W  P +G +KFN
Sbjct  1565  ----------TPSKVTDRVR-------DPVR-----------------WAAPPSGRLKFN  1590

Query  4363  TDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIG-VSNSFAAELWGLRE  4506
              DGAF   +G  + G +ARD  G ++     ++G V ++  AE+   RE
Sbjct  1591  FDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAARE  1639



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   531 bits (1368),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 339/1000 (34%), Positives = 514/1000 (51%), Gaps = 45/1000 (5%)
 Frame = +1

Query  1555  AISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNT-SRGLQVLERKLVTELNE  1731
             +IS++   +  WN  TFGN++ RK  + AR+ G Q+++     S  L  LE+ L  EL +
Sbjct  342   SISDLAVGAADWNINTFGNVYKRKRKVLARLHGAQKALHDKPYSNFLHELEKDLQNELIQ  401

Query  1732  VLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISD  1908
             +L QEE LW  K++   I++G+RNT F+H+S +I+RN SRI  L+   G    D   +  
Sbjct  402   ILMQEEALWAAKNKSERIREGERNTRFFHRSVMIKRNASRIFSLRNEVGLDIHDPDQLRS  461

Query  1909  HISNFFIDLFGRKNIMDGSPNDMYC--GPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGS  2082
             H+  FF  L+        S     C  G     G +  +    +  E++ ++  MK   +
Sbjct  462   HVQCFFESLY--------STEHKKCDWGTNASRGLI-DIAYPPSDEEIRASLKQMKPIKA  512

Query  2083  PGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFR  2262
             PGPDG    F+Q  W+ V   +   ++      +VP ++ ++ I LIPK++ PET    R
Sbjct  513   PGPDGFHPVFFQKMWDIVGKDVCENIRSWFYHRKVPQEMCQAVICLIPKQNPPETVKHLR  572

Query  2263  PITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG  2442
             PI+L N  +K+ +KVIVNR++P++   I P QNSF+ GR    N+++  EI+H M  KKG
Sbjct  573   PISLCNTLYKLTTKVIVNRLKPLIPYWISPNQNSFIKGRGPDVNLVVATEILHSMNKKKG  632

Query  2443  KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAP  2622
             K G  A+K+DL KAYD I+W F+ + L +       I LIM  V +SS S+L NG +   
Sbjct  633   KWGWFALKIDLEKAYDRIEWSFVRTCLQNLDLNDQSIDLIMSCVSQSSSSILMNGRRSNT  692

Query  2623  FQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLM  2802
             F+  RGLRQGDP++PYLF + +E LS  I +    K W P  + +    VSHL FA+DL+
Sbjct  693   FKHSRGLRQGDPMSPYLFNICLESLSHMINQATIDKTWAPFWVGKDRVPVSHLMFADDLL  752

Query  2803  LFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDN  2982
             +F    E     +   L+ F   SG  IN SKS +  SPNT++E +   +    I  + N
Sbjct  753   IFGRVDESTTFAVRETLRAFCEISGQKINESKSRLIFSPNTSTEHRSLFQQTLNIEENAN  812

Query  2983  LGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQ  3162
             LGTYLG+P+ HKR SK+   +++D +K+KLANWK   LS AGR  L+ S LS++P Y MQ
Sbjct  813   LGTYLGLPLSHKRPSKNQVQFVVDKVKKKLANWKTKYLSRAGRLCLISSTLSTIPAYYMQ  872

Query  3163  VFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALL  3342
                LPA T  D+DR+C +FLWGD    K++HLVG     + K  GGLG+R     N A +
Sbjct  873   AMALPAATLKDLDRVCNNFLWGDVENQKRIHLVGMERTFRPKTMGGLGVRNQTLMNKAYM  932

Query  3343  AKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRI  3522
             AKL W+L    + L  K +  KY+ N    +    A  S  W+SI +G  ++   + W +
Sbjct  933   AKLGWKLSQGPENLAQKCITSKYIHNHYVTS---FAKGSPIWQSIGKGWDLLTKDSQWIL  989

Query  3523  GNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA--KVSDFILPNRTWNVDKLSSLLPHD  3696
             GNG  ++FW D W G   +    ++  P +Q E   KV D +     W +++LS  LP  
Sbjct  990   GNGADIDFWEDNWLGIGNI--RSQIAGPLNQYEETYKVRD-VTGGGVWKLERLSLTLPAH  1046

Query  3697  IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW-----VWKM  3861
             I+  I        E   D     R+P   F     FS     +E  +D +      +WK+
Sbjct  1047  IVSRILCLEPPHPEDQKDI----RAPI--FLEPQGFSLALAYNEQFLDHNTENLGELWKI  1100

Query  3862  RVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWR  4041
               + + + FLWL+   RL  N     + +T++  C  C    E  NH+L  C  ++  W 
Sbjct  1101  NTSPKIQFFLWLVCLDRLPHNKMLRDRHLTQEARCPRCASDVEDTNHILRLCPTSQRIWD  1160

Query  4042  RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTAS  4221
             +     ++  +    +K+WV  N  +     G  W V F + C+EIWK+RN  +F+   +
Sbjct  1161  QVD---TYTSTHNQNMKAWVGENIKSRRDYRGLEWAVVFPFLCFEIWKSRNHSVFKPNLN  1217

Query  4222  AP-MDIMRRANNLTLDTVEVFLNKKCVHVGK-----MRWVCWQPPETGWIKFNTDGAFKR  4383
              P  D++ +   L       F+  K  H  +     +  +    P + W   + D AFK 
Sbjct  1218  HPGPDVVLQ---LAWKNARDFIQAKGPHEAQPEKTTINHLAHHTP-SNWTMLSVDAAFKD  1273

Query  4384  NTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLR  4503
              T     GG+ R  +G W+ GF       ++  AEL G++
Sbjct  1274  QTRTCGLGGIFRTSEGLWVLGFTKTAYARDALGAELQGIQ  1313



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score =   526 bits (1356),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 359/1159 (31%), Positives = 558/1159 (48%), Gaps = 56/1159 (5%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  P    K + W+       E + P +M GDFN+I    E+ G +     +   F E+ 
Sbjct  69    YGWPEAENKYKTWDLMRRLHGEGSLPTVMFGDFNEIVSMAEKEGGAIRGERQMDAFREAI  128

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
               C + D+G  G  ++W R     T+ R +LDR +     + +FP    I LP   SDH 
Sbjct  129   DDCAMSDLGFHGSCFTWKRGNSSATLIRERLDRFMGCARWREVFPWWHVIHLPIYKSDHA  188

Query  1411  PLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKK  1587
             P+       +P     R F+FE  WL+R+D   +    W   L  D+   I+ V     K
Sbjct  189   PILLKAGLRDPRISGGRSFKFESLWLSRDDCEQVVAESWRGGLGEDIERRIASVATDLSK  248

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLER--KLVTELNEVLKQEELLWF  1761
             W   TFGNI  +    ++++K  Q     N      + +R  +L  +L+E+ + EE  WF
Sbjct  249   WAASTFGNIKKKIKVTESQLKAAQ-----NNLPDAAMFDRCKELSAKLDELHRMEESYWF  303

Query  1762  QKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRML-KINGEWNSDFKTISDHISNFFIDLF  1938
              ++R   ++DGD+NT+++H     RR R+RI  L   N  W +D  +I + I  +F DLF
Sbjct  304   ARARANELRDGDKNTSYFHHKASQRRKRNRISGLWDANNTWQTDDDSIKEIIHAYFDDLF  363

Query  1939  GRKNIMDGSPN---DMYCGPK-LDTGQMHKLTREVTMCE-VKKAVFDMKKFGSPGPDGIQ  2103
                    GSP    D   G +   T  M+++   V   E ++ A+F M    +PGPDG+ 
Sbjct  364   -----TGGSPTGFADATAGLRSCVTSNMNQVLDAVPNGEEIRLALFQMHPNKAPGPDGMH  418

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNV  2283
             A F+Q FW  +   + +FV+      R   +I ++ I LIPK   P+   DFRPI+L NV
Sbjct  419   ALFFQKFWHVIGQDVISFVQNWWEGNRDLSEINKTCIVLIPKCAEPKCMGDFRPISLCNV  478

Query  2284  SFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYM-RLKKGKKGLMA  2460
              +KI+SKV+ N+++  + ++I   Q++F+P R   DN ++  EI H M R  +G +G +A
Sbjct  479   LYKIVSKVMANKLKQFLGDIISLQQSAFVPKRLITDNALVAFEIFHAMKRRTEGAEGSIA  538

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
             +KLD+ KAYD ++W+FL   +   GF    I  I   +  +S +   NG       P RG
Sbjct  539   LKLDMSKAYDRVEWDFLVCVMSKLGFSDAWIHRIRMLLESTSFTFKINGRVDGFLVPKRG  598

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEAS  2820
             LRQGDP++PYLF+L  +  S  I +  R +    + + RG   VSHLFFA+D +LFA+A+
Sbjct  599   LRQGDPISPYLFLLCADAFSMLIDKAARERAIHGVMVCRGAPRVSHLFFADDSILFAKAT  658

Query  2821  EDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLG  3000
               +   + + +  +   SG  +N+SK+ +  S N  +E ++ +    G+   D    YLG
Sbjct  659   LQECSRVADIISTYERASGQKVNLSKTEVAFSTNVPAERRKDIVETLGVREVDRHEKYLG  718

Query  3001  IPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPA  3180
             +P +  R  K  F  + + + +KL  WK  +LS  G+  ++++   ++P Y M +FK+P 
Sbjct  719   LPTIIGRSKKAVFACLKERIWKKLQGWKEKLLSRPGKEIMIKAVAQAIPTYMMSIFKIPD  778

Query  3181  GTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQ  3360
             G  ++I  +   F WG +  ++K+H   W D+C  K  GGLG R    FN ALLAK  W+
Sbjct  779   GLIDEIHSLFARFWWGSTGSHRKLHWHKWEDLCLPKAMGGLGFRDLKSFNAALLAKQGWR  838

Query  3361  LVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSL  3540
             L+     L  K+++ +Y KN +F   P   N S+ WRS+   + ++  G  WR+GNG  +
Sbjct  839   LIHGTGTLLHKILKARYFKNCSFLEAPCGFNPSYSWRSLWGVKDLLMEGTKWRVGNGTQI  898

Query  3541  NFWSDWWTGDKPLAFMDEVTIPDSQSEAK--VSDFI-LPNRTWNVDKLSSLLPHDIIDGI  3711
               W D W    P      V  P + S A   VS+ I   +  WNV+KL+          I
Sbjct  899   RVWEDAWL---PGHGSHLVPTPMAHSTADLLVSNLICFESGKWNVEKLNVTFGAHDRRLI  955

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAF----------SHIAGNDEDAMDTSWVWKM  3861
             R  P++     SD +YW  +  G FSVRS +            +    E+      VW++
Sbjct  956   RDIPLSQ-PWSSDVMYWWPNKDGVFSVRSGYWLARKGCIRSWQLQHGMEELDRWRHVWQV  1014

Query  3862  RVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWR  4041
                 +   FLW   RG L        + + E+T C  CG  +ET+ H L  C++AK+ W 
Sbjct  1015  EGPPKLLHFLWRACRGSLAVRERLKHRHIIEETSCPICGAAEETITHSLFHCTYAKEIWE  1074

Query  4042  RT---HHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFEN  4212
              +      V   YS    +  W     C +D++        F+  CW  W ARN  +FE 
Sbjct  1075  SSKLYELVVQAPYSSFATVFEWFHAKVCKADFL-------IFVSLCWAAWYARNIAVFEQ  1127

Query  4213  TASAPMDIMRRANNLTLDTVE----VFLNKKCVHVGKMRWVC-WQPPETGWIKFNTDGAF  4377
                  + I      L  D +E    VF  +    + +   VC W PP   +IK N D A 
Sbjct  1128  ITPNSLSIASGFMKLVHDYLEYAHKVFDPRS---MARPSAVCRWSPPPDNFIKLNVD-AH  1183

Query  4378  KRNTGLASAGGLARDHKGE  4434
               +      G +ARD  G+
Sbjct  1184  VMDGVGVGLGVVARDSGGQ  1202



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score =   522 bits (1345),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 336/1096 (31%), Positives = 545/1096 (50%), Gaps = 42/1096 (4%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +SF Y  P    +++ W       S    PW ++GDFN++  N E+ G +  + S  ++F
Sbjct  1     MSFIYGDPVPQHRDKVWEKLTDIGSFRIDPWFLIGDFNELTGNHEKQGGALRSASSFVSF  60

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
                   CG+L+    G   SW        V R +LDRAL N + Q  FP ++   L    
Sbjct  61    NSMLRHCGMLEFPCYGEQLSWRGNRCNNQVVRCRLDRALGNEDWQGFFPNSRVDYLEMIG  120

Query  1399  SDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWSNSLLDVVGAISE  1566
             SDH P+   C      RR +R FRF+  WL +E    +    W R  +  +   V  I  
Sbjct  121   SDHSPILATC--LKTARRCHRQFRFDKRWLGKEGITAVVESGWNRTKNFRIPGFVDKIRN  178

Query  1567  VTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQE  1746
               N    W K    +     +SL+  ++  +     +T   ++V+ERKL     E  + E
Sbjct  179   CRNSLSWWRKNNINSGPSTISSLKEALQEAKMDDLISTDE-IRVIERKL----KEAYRDE  233

Query  1747  ELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNF  1923
             E+ W QKSR+ W++ GD+NT ++  ST  RR R+RI  +   +  W      + +  + +
Sbjct  234   EIYWQQKSRKFWLRVGDKNTKYFQASTKQRRVRNRIIGLFGDDDAWIESPSGMENIATKY  293

Query  1924  FIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQ  2103
             F  LF + +    S       P +       LTR+++  EV+KA+F M    +PGPDG+ 
Sbjct  294   FEGLFKKVDGGGISEVLQEIKPLVTDNINRDLTRDISEAEVRKALFAMHPEKTPGPDGMT  353

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNV  2283
             A F+Q FW  +K  +   V++  R G   P++ E+ I LIPK  +P+  ++FRPI+L NV
Sbjct  354   ALFFQRFWASLKGDLVALVREFFRTGCFDPRLNETNICLIPKVANPQRMANFRPISLCNV  413

Query  2284  SFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGLMA  2460
             S+KIISKV+  R+R ++  L+   Q++F+ GR   DNI++ QE+ H +   ++ K   +A
Sbjct  414   SYKIISKVLCFRLRRVLPLLVSETQSAFVSGRLITDNILVAQEMFHGLNTNRRCKSEFLA  473

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
              K D+ KAYD ++W+FLE+ LV FGF Q  IS IM+ V   +  +L NG+      P RG
Sbjct  474   FKTDMSKAYDRVEWDFLEAVLVKFGFAQKWISWIMWCVSSVTYQVLMNGQPRGSIIPQRG  533

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEAS  2820
             LRQGDPL+PYLFIL  E L  +I++  R K    I+++R    VSHL FA+D + F +A 
Sbjct  534   LRQGDPLSPYLFILCTEVLIANIKKAERDKKLTGISIARDSPSVSHLLFADDSLFFCKAE  593

Query  2821  EDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLG  3000
             E + R +++ +  +   SG  +N++KS+I        EI+  LK++ GIS    +G+YLG
Sbjct  594   ESECRTVISIIGNYGKASGQEVNLTKSSIMFGKKVPPEIRAQLKSVIGISQEGGMGSYLG  653

Query  3001  IPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPA  3180
             IP   +      F Y+ D +  ++  W   +LS  G+  +++S   ++P + M  +KL  
Sbjct  654   IPENLQGSKTKVFSYVKDRLDDRVNGWSAKLLSKGGKEVMIKSVALALPTHVMSCYKLTQ  713

Query  3181  GTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQ  3360
                + +      F W  + + + +H + W+ +CK K  GGLG R    FN+A+LAK  W+
Sbjct  714   DLTSKLTSAISSFWWKSNDKARGMHWLAWDKMCKEKCDGGLGFRALEQFNDAMLAKQYWR  773

Query  3361  LVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSL  3540
             L+   D L  +VM+ +Y +N++        N S+ WRSI   + +VE GA W +G+G+S+
Sbjct  774   LIHYPDSLMARVMKGRYFRNQHPIMAKKSYNPSFAWRSIYSTKDLVEEGARWTVGSGVSI  833

Query  3541  NFWSDWWTGD---KPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDG  3708
             + W D W  D   +P      +  P+      V+  I P  + W++  L   +    I  
Sbjct  834   SVWRDPWLPDVRPRPANGRGRLLHPN----LMVNHLINPITKDWHLPILEEFMDPVDIQL  889

Query  3709  IRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF-------SHIAGNDEDAMDTSWVWKMRV  3867
             IR   ++   +  D L W  + +G +SV++ +       + +          +  W++ V
Sbjct  890   IRNMAVSKTNR-PDRLVWHFTKSGKYSVKTGYRVARELVAEVEYGPTCTALRAQSWELDV  948

Query  3868  TERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRT  4047
               +   F W +  G L        +G+  DT C  C    ET+NH L EC  ++  W  T
Sbjct  949   PPKIPHFFWQIASGTLPVLERLAHRGIRCDTRCKRCDLTAETINHALFECPRSRQIWELT  1008

Query  4048  H---HPVSFQYSLVTPLKSWV----KNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
                  P  F Y+ +     ++     +    +D     PW +      W +WK RN+++F
Sbjct  1009  PVSLDPQRFPYASIYANLDFIFWRASSQSGVTDIALQLPWII------WSLWKDRNKKVF  1062

Query  4207  ENTASAPMDIMRRANN  4254
             +   + P DI+ +A N
Sbjct  1063  QGIEAEPNDILGQAAN  1078



>ref|XP_010673997.1| PREDICTED: uncharacterized protein LOC104890275 [Beta vulgaris 
subsp. vulgaris]
Length=1098

 Score =   518 bits (1333),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 338/1051 (32%), Positives = 525/1051 (50%), Gaps = 61/1051 (6%)
 Frame = +1

Query  1483  WLTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARI  1647
             W  R+DY  +  + W      + +  +V     + + SK WNK  FGNIF +   +  R+
Sbjct  2     WCLRKDYDTLVKKTWCTHFDGSHMFRLVKKCKLLKDKSKHWNKSQFGNIFRQLRKVDERL  61

Query  1648  KGVQESVFYNTSR-GLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             + +Q  +  N S    Q  +   + + + +L      W QKS+  ++  GD N+++YH  
Sbjct  62    QEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNEFWKQKSKTDYLILGDSNSSYYHTH  121

Query  1825  TLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
               IRRNR++I+ ++   GE  ++   IS  +SN F   F        S + +Y  P  D 
Sbjct  122   ASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARFS-------SDSSVYFHPDYDF  174

Query  2002  GQMHK---------LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITT  2154
               +           LT  V+  E+K A FD+    SPGPDG    F+Q +W  V + +  
Sbjct  175   SLLDNIISEENNAFLTSPVSGDEIKAATFDLAPDKSPGPDGFPPFFFQKYWTLVGNSVIR  234

Query  2155  FVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIM  2334
              V+     G++  +I  +F+ LIPK D+P +A+ FRPI+L +  +KIISK+I NR++ +M
Sbjct  235   AVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLCSTIYKIISKIITNRLKEVM  294

Query  2335  KNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLE  2514
               +I P Q +F+P R   DNI++  EI    + K G  G +AIKLD+ KAYD ++W ++ 
Sbjct  295   SQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWIAIKLDMEKAYDRLEWNYIF  354

Query  2515  STLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMER  2694
             STL   GF    I  I   V  +S S+L NG     F   RG+RQGDPL+PYLFIL  E 
Sbjct  355   STLDKLGFCPQWIGWIKECVSSTSFSVLVNGLPGEKFSSSRGIRQGDPLSPYLFILCAEL  414

Query  2695  LSWDIQEKVRVKNWKPITLSRGGTG--VSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSG  2868
             L+  +         KPI +  G TG  +  L FA+D M+FA+A+     +I   L K+  
Sbjct  415   LARLLSSAASGPT-KPIGVPIGKTGMRIPFLTFADDTMIFAKATNYSCLIIRQILDKYCS  473

Query  2869  KSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYI  3048
              SG  +N  KS+  C+ N     K    ++  +  +++LG YLG PI+H +V+K TF  +
Sbjct  474   MSGQLVNYHKSSFQCTANIPEAEKCNFASILQMQETNDLGDYLGCPIIHSKVTKETFSSV  533

Query  3049  LDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWG  3228
             +     +L  WK N LS AGR  L+QS L++   Y MQ F LP     ++DR  R+F W 
Sbjct  534   VSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFWN  593

Query  3229  DSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREK  3408
                 NK  +L+GW+ ICK K AGGLG RK    N AL  KL W++V + + LWVK++R++
Sbjct  594   KETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVKLVRKR  653

Query  3409  YVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFM  3588
             Y+KNK+ F+     +ASW WR+++  R I + G  W+IGNG S+NFW D W     L  +
Sbjct  654   YIKNKSIFSIKASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYSLKSI  713

Query  3589  DEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
                 IP +++   V+  I+P+  W+   L SL+P  I+  I +  I   E   D+L W  
Sbjct  714   IS-PIPGTEN-LTVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIP-SESQPDNLIWGL  770

Query  3769  SPTGAFSVRSAFSHIAG---NDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWR  3939
             +  G +SV+S      G   +  + ++ +W+WK+ +  + + FLW      + T +   +
Sbjct  771   TADGEYSVKSGALLAQGMLPSSLEKVEFNWIWKLNIPPKIKNFLWKACNDGIPTKLRLEK  830

Query  3940  KGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL---------VTPLK  4092
               +     C  C +  E++ H+   C F  D +  +H   SF +           +T  +
Sbjct  831   SHIFLPQQCVFCNNAGESIGHICFACPFTLDIF--SHLKASFDWPSPPSCLANIDLTSFR  888

Query  4093  SWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD--  4266
             S ++   C S  ++       F +  W +W  RN+ +F +   +        +N      
Sbjct  889   SVLE--ACLS--LSSKSEISLFSFVWWFVWFFRNKLVFNDEVVSSRKASFIISNFATSWS  944

Query  4267  ---TVEVFLNKKCVHVGKMR-------WVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
                  E   +K  +     R          W PP  G+ K N DG+ K N G A+ G + 
Sbjct  945   KALNSEEMGSKPILAANTKRDKPRTGPGSVWSPPAPGFCKLNFDGS-KLNNGNAALGFVI  1003

Query  4417  RDHKGEWLFGFMTNIGVSNS-FAAELWGLRE  4506
             RD  G+ L     ++G + S   AE WGL+E
Sbjct  1004  RDSSGDALMAGARSLGSNISILQAEAWGLKE  1034



>ref|XP_010684763.1| PREDICTED: uncharacterized protein LOC104899296 [Beta vulgaris 
subsp. vulgaris]
Length=1107

 Score =   518 bits (1333),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 338/1051 (32%), Positives = 525/1051 (50%), Gaps = 61/1051 (6%)
 Frame = +1

Query  1483  WLTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARI  1647
             W  R+DY  +  + W      + +  +V     + + SK WNK  FGNIF +   +  R+
Sbjct  2     WCLRKDYDTLVKKTWCTHFDGSHMFRLVKKCKLLKDKSKHWNKSQFGNIFRQLRKVDERL  61

Query  1648  KGVQESVFYNTSR-GLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             + +Q  +  N S    Q  +   + + + +L      W QKS+  ++  GD N+++YH  
Sbjct  62    QEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNEFWKQKSKTDYLILGDSNSSYYHTH  121

Query  1825  TLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
               IRRNR++I+ ++   GE  ++   IS  +SN F   F        S + +Y  P  D 
Sbjct  122   ASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARFS-------SDSSVYFHPDYDF  174

Query  2002  GQMHK---------LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITT  2154
               +           LT  V+  E+K A FD+    SPGPDG    F+Q +W  V + +  
Sbjct  175   SLLDNIISEENNAFLTSPVSGDEIKAATFDLAPDKSPGPDGFPPFFFQKYWTLVGNSVIR  234

Query  2155  FVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIM  2334
              V+     G++  +I  +F+ LIPK D+P +A+ FRPI+L +  +KIISK+I NR++ +M
Sbjct  235   AVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLCSTIYKIISKIITNRLKEVM  294

Query  2335  KNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLE  2514
               +I P Q +F+P R   DNI++  EI    + K G  G +AIKLD+ KAYD ++W ++ 
Sbjct  295   SQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWIAIKLDMEKAYDRLEWNYIF  354

Query  2515  STLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMER  2694
             STL   GF    I  I   V  +S S+L NG     F   RG+RQGDPL+PYLFIL  E 
Sbjct  355   STLDKLGFCPQWIGWIKECVSSTSFSVLVNGLPGEKFSSSRGIRQGDPLSPYLFILCAEL  414

Query  2695  LSWDIQEKVRVKNWKPITLSRGGTG--VSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSG  2868
             L+  +         KPI +  G TG  +  L FA+D M+FA+A+     +I   L K+  
Sbjct  415   LARLLSSAASGPT-KPIGVPIGKTGMRIPFLTFADDTMIFAKATNYSCLIIRQILDKYCS  473

Query  2869  KSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYI  3048
              SG  +N  KS+  C+ N     K    ++  +  +++LG YLG PI+H +V+K TF  +
Sbjct  474   MSGQLVNYHKSSFQCTANIPEAEKCNFASILQMQETNDLGDYLGCPIIHSKVTKETFSSV  533

Query  3049  LDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWG  3228
             +     +L  WK N LS AGR  L+QS L++   Y MQ F LP     ++DR  R+F W 
Sbjct  534   VSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFWN  593

Query  3229  DSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREK  3408
                 NK  +L+GW+ ICK K AGGLG RK    N AL  KL W++V + + LWVK++R++
Sbjct  594   KETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVKLVRKR  653

Query  3409  YVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFM  3588
             Y+KNK+ F+     +ASW WR+++  R I + G  W+IGNG S+NFW D W     L  +
Sbjct  654   YIKNKSIFSIKASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYSLKSI  713

Query  3589  DEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
                 IP +++   V+  I+P+  W+   L SL+P  I+  I +  I   E   D+L W  
Sbjct  714   IS-PIPGTEN-LTVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIP-SESQPDNLIWGL  770

Query  3769  SPTGAFSVRSAFSHIAG---NDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWR  3939
             +  G +SV+S      G   +  + ++ +W+WK+ +  + + FLW      + T +   +
Sbjct  771   TADGEYSVKSGALLAQGMLPSSLEKVEFNWIWKLNIPPKIKNFLWKACNDGIPTKLRLEK  830

Query  3940  KGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL---------VTPLK  4092
               +     C  C +  E++ H+   C F  D +  +H   SF +           +T  +
Sbjct  831   SHIFLPQQCVFCNNAGESIGHICFACPFTLDIF--SHLKASFDWPSPPSCLANIDLTSFR  888

Query  4093  SWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD--  4266
             S ++   C S  ++       F +  W +W  RN+ +F +   +        +N      
Sbjct  889   SVLE--ACLS--LSSKSEISLFSFVWWFVWFFRNKLVFNDEVVSSRKASFIISNFATSWS  944

Query  4267  ---TVEVFLNKKCVHVGKMR-------WVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
                  E   +K  +     R          W PP  G+ K N DG+ K N G A+ G + 
Sbjct  945   KALNSEEMGSKPILAANTKRDKPRTGPGSVWSPPAPGFCKLNFDGS-KLNNGNAALGFVI  1003

Query  4417  RDHKGEWLFGFMTNIGVSNS-FAAELWGLRE  4506
             RD  G+ L     ++G + S   AE WGL+E
Sbjct  1004  RDSSGDALMAGARSLGSNISILQAEAWGLKE  1034



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score =   537 bits (1383),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 362/1232 (29%), Positives = 590/1232 (48%), Gaps = 69/1232 (6%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNV-RVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              FW S++    +   +   I  LV   +  V R +  Y  P    K   W      +  F
Sbjct  32    LFWTSNV-EVEIKSYSLHHIDALVKTGNGKVWRCTGVYGHPETNQKHNTWTLLKRLAGIF  90

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             + PW   GDFN+I + QE+ G +  N    + F E+  AC L+D+G  G  ++W  +  G
Sbjct  91    SYPWCCFGDFNEILNLQEKSGGNEKNIDMVVQFREAVQACNLVDVGYRGHPFTWSNRRYG  150

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             +     +LDR L + +    F +  A  L    SDH P+  L E     +  +   +   
Sbjct  151   QHFIEERLDRFLCSNDWSENFHDMAATNLVNWVSDHCPI--LMEVRERSKDRSHGKKS--  206

Query  1480  AWLTREDYRDIWGRVWSNSLLDVV---------------------GAISEVTNLSKKWNK  1596
               + RE Y D+W      +  ++V                      A + + NL K W+K
Sbjct  207   --IHREHYEDMWSSY--EACKNIVRNEWASMGRGARENPVKHFQQAAKNSLANL-KIWSK  261

Query  1597  ETFGNIFGRKASLQARIKGVQESVFYNTSR--GLQVLERKLVTELNEVLKQEELLWFQKS  1770
               F +   RK      I  +  +   +  R  G Q+  R++  ++N +L  EE+ W Q+S
Sbjct  262   SEFAD---RKKKQDQLINQLIHAKHGSAQRMNGDQI--RRIENQINGMLMDEEIYWRQRS  316

Query  1771  RRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRK  1947
             R  W+++GDRNT ++H     RR +++I  +   +G+W  D + +      +F +LF   
Sbjct  317   RAEWLKEGDRNTKYFHSKASARRRKNKIWGIENSHGQWTEDQREVEKEFCEYFQNLFTTS  376

Query  1948  NIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQT  2121
             +       D   G  PK+ T   H+L    T  E+ +A+  M    +PGPDG+ AAF+Q 
Sbjct  377   SPNQSQIQDALDGISPKVTTNMNHQLEEPFTEEEIVEALHQMSPTKAPGPDGLPAAFFQK  436

Query  2122  FWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIIS  2301
              W+ V+S +      +L +G     +  +FI LIPK   P+  ++FRPI+L NV ++I++
Sbjct  437   HWQTVRSSVIGTCMHILNEGGNLSALNHTFIALIPKTTKPKKVTEFRPISLCNVIYRIVA  496

Query  2302  KVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKK-GLMAIKLDLH  2478
             K I NR++PI+  +I P Q++F+P R  +DN+I+  E +H +R  +GKK GL+A+KLD+ 
Sbjct  497   KTIANRLKPILSQIISPTQSAFIPNRLISDNVIIGYECLHKIRHSQGKKKGLVALKLDIS  556

Query  2479  KAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDP  2658
             KAYD ++W FL+ T+   GF +  + LIM  +   S S++ NG     F P RGLRQG P
Sbjct  557   KAYDRVEWTFLKQTMKKLGFSRKWLELIMGCITSVSFSVIINGTPKGFFHPERGLRQGCP  616

Query  2659  LAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRM  2838
             L+PYLFI+  E  S  + +    K    +  +   T +SHL FA+D ++F+ AS  + + 
Sbjct  617   LSPYLFIICTEVFSSLLLQAETKKRISGLRFAEDVT-ISHLLFADDSLVFSTASVAECKH  675

Query  2839  IMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHK  3018
             +     +++  SG   N  KS++F       E K  ++N+  ++V      YLG+P +  
Sbjct  676   LKGIFDRYAKASGQIFNFEKSSMFFGGKIPEEQKAAIRNIFNLNVVSKYEKYLGLPSMIG  735

Query  3019  RVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDI  3198
             R     F  +   +  K+ NW+  M S  G+  L+++   ++P Y M VFKLP G C +I
Sbjct  736   RKKTSFFREVKLRVLSKINNWQHKMFSSGGKEILIKAVAQAVPAYAMSVFKLPKGLCEEI  795

Query  3199  DRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHD  3378
                   F WG     + +H   W+ +  +K  GGLG R  + FN A++AK  W+L+   +
Sbjct  796   QSEIAKFWWGSKKDKRGIHWARWDKLSCAKSRGGLGFRDFISFNQAMVAKQGWRLIQFPN  855

Query  3379  KLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDW  3558
              L  KV+R +Y K+ +F      +N S+ WRSI+ GR +++ GA WRIGNG ++  + D 
Sbjct  856   SLVSKVLRARYFKSCSFLDAKPGSNPSFIWRSILWGRQVIQKGARWRIGNGSNILVYKDN  915

Query  3559  WTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCE  3738
             W   +P  F   ++ P    +  V + +     WNV KL+     +  + I   P+   +
Sbjct  916   WI-PRPDTF-KPISPPTLPIDTTVGELMDDENNWNVAKLNQHFMQEDTEAILKIPLPRSQ  973

Query  3739  QVSDSLYWPRSPTGAFSVRSAFS---HIAGNDEDAMDTS----W--VWKMRVTERCrlfl  3891
             +V D + W     G +SV+S +     +   DE +   S    W  VW M + E+ ++F+
Sbjct  974   KV-DEMMWHYDKHGEYSVKSGYQIALKLKAPDEPSNSGSNSKRWKAVWSMELPEKMKIFM  1032

Query  3892  wllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQY  4071
             W   R  L T    W++   +D +C  C    ET+ H L++C  A+  W      V    
Sbjct  1033  WRAARNLLPTAENLWKRKCLKDPICQGCNREVETVRHALLDCKAARKIWYHATSSVQISN  1092

Query  4072  SLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRAN  4251
             +    +  ++      S W  G       I  CW IW ARN+RIFE   S P     +A 
Sbjct  1093  AQNQDILEFIYE--VWSTW--GKTKAEQTIAFCWAIWFARNKRIFEGKKSDPRASAAKAE  1148

Query  4252  NLTLDTVEVFLNKKCVHVGKMRWVC---WQPPETGWIKFNTDGAFKRNTGLASAGGLARD  4422
             +L L+           H+  ++ +    W+PP   ++K N D A      +A  G + +D
Sbjct  1149  SL-LEAYHRARKPDASHIHNVKRIVQKKWEPPPGNFLKVNVDAAINNRDQVAGLGAVIKD  1207

Query  4423  HKGEWLFGFMTNI----GVSNSFAAEL-WGLR  4503
               G+ +      +    GVS + A  + WGL+
Sbjct  1208  PSGKIVAAGTKQVPLREGVSFAEAEAMEWGLQ  1239



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score =   522 bits (1345),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 348/1185 (29%), Positives = 563/1185 (48%), Gaps = 28/1185 (2%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLV-SGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
               WRS I    V+  +S  I  +V        R +  Y  P    K++      + +   
Sbjct  75    MLWRSEI-KVQVMSMSSNHIDIVVGEEAQGEWRFTGIYGYPEEEHKDKTGALLSALARAS  133

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               PW+  GDFN +    E+ G    N      F  +   C  +D+G  G  ++W    GG
Sbjct  134   RRPWLCGGDFNLMLVASEKKGGDGFNSREADIFRNAMEECHFMDLGFVGYEFTWTNNRGG  193

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrf--  1473
                 + +LDR + N   +  FP +    LP+  SDH P+    +         +  +   
Sbjct  194   DANIQERLDRFVANDLWKIKFPGSFVSHLPKRKSDHVPIVASVKGAQSAATRTKKSKRFR  253

Query  1474  -egAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
              E  WL   +  ++    W     D    ++   N    W+K+ FG++       Q ++K
Sbjct  254   FEAMWLREGESDEVVKETWMRGT-DAGINLARTANKLLSWSKQKFGHVAKEIRMCQHQMK  312

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
              + ES     S    +  R L   ++E+ K+EE+ W Q+SR+ WI+ GD+NT F+H+   
Sbjct  313   VLMES---EPSEDNIMHMRALDARMDELEKREEVYWHQRSRQDWIKSGDKNTKFFHQKAS  369

Query  1831  IRRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQ  2007
              R  R+ +R ++   GEW  D   +++  +++F +LF   N  +  P      P++    
Sbjct  370   HREQRNNVRRIRNEAGEWFEDEDDVTECFAHYFENLFQSGNNCEMDPILNIVKPQITDEL  429

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
               +L       EV  A+  M    +PGPDG+ A FYQ FW+ +   +TT V  +L +   
Sbjct  430   GTQLDAPFRREEVSAALAQMHPNKAPGPDGMNALFYQHFWDTIGEDVTTKVLNMLNNVDN  489

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
                + ++ I LIPKK   E+  DFRPI+L NV +KI++KV+ NRM+ ++  +I   Q+ F
Sbjct  490   IGAVNQTHIVLIPKKKHCESPVDFRPISLCNVLYKIVAKVLANRMKMVLPMVIHESQSGF  549

Query  2368  LPGRSTADNIILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             +PGR   DN+++  E  H++R KK GKKG + +KLD+ KAYD ++W FLE+ ++  GFP 
Sbjct  550   VPGRLITDNVLVAYECFHFLRKKKTGKKGYLGLKLDMSKAYDRVEWCFLENMMLKLGFPT  609

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
                 L+M  V  +  S+L NG+    F P RGLRQGDPL+P+LF++  E LS  +++   
Sbjct  610   RYTKLVMNCVTSARFSVLVNGQPSRNFFPSRGLRQGDPLSPFLFVVCAEGLSTLLRDAEE  669

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
              K    + +    + +SHLFFA+D +LF  A+E++   +M+ L  +   SG  +N+ KS 
Sbjct  670   KKVIHGVKIGHRVSPISHLFFADDSLLFIRATEEEVENVMDILSTYEAASGQKLNMEKSE  729

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             +  S N   +    L+        +    YLG+P       K  F  I D + +KL  WK
Sbjct  730   MSYSRNLEPDKINTLQMKLAFKTVEGHEKYLGLPTFIGSSKKRVFQAIQDRVWKKLKGWK  789

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
             G  LS AGR  L+++   ++P Y MQ F +P    + I+++CR+F WG   + ++V  V 
Sbjct  790   GKYLSQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFWGQKEEERRVAWVA  849

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  +   K  GGLG+R    FN ALLAK AW+++T  D L  +V++ KY    NF    +
Sbjct  850   WEKLFLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVIKGKYFPRSNFLEARV  909

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGD-KPLAFMDEVTIPDSQSE  3621
               N S+  +SI+  R++++ G    IG+G     W D W    +  +      + +    
Sbjct  910   SPNMSFTCKSILSARAVIQKGMCRVIGDGRDTTIWGDPWVPSLERYSIAATEGVSEDDGP  969

Query  3622  AKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSA  3801
              KV + I  +R WNV+ L++L        I+  P+A+ ++  D   W  S  G F+VRSA
Sbjct  970   QKVCELISNDR-WNVELLNTLFQPWESTAIQRIPVAL-QKKPDQWMWMMSKNGQFTVRSA  1027

Query  3802  FSHIAGNDEDAMDTS--------W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMT  3951
             + H    D     ++        W  +WK ++  + +LF W  +   L       ++GM 
Sbjct  1028  YYHELLEDRKTGPSTSRGPNLKLWQKIWKAKIPPKVKLFSWKAIHNGLAVYTNMRKRGMN  1087

Query  3952  EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWI  4131
              D  C  CG+ +ET  H++  C  +   W  +   +          + WV++     D  
Sbjct  1088  IDGACPRCGEKEETTEHLIWGCDESSRAWYISPLRIHTGNIEAGSFRIWVES---LLDTH  1144

Query  4132  NGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGK  4311
                 W   F   CW IW  RN+ +FE    A  +++ RA    ++  E   +   V    
Sbjct  1145  KDTEWWALFWMICWNIWLGRNKWVFEKKKLAFQEVVERAVRGVMEFEEECAHTSPVETLN  1204

Query  4312  MRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
                  W  P  G +K N D A  ++ G+   GG+ RD +G+ L  
Sbjct  1205  THENGWSVPPVGMVKLNVDAAVFKHVGIG-MGGVVRDAEGDVLLA  1248



>ref|XP_009103763.1| PREDICTED: uncharacterized protein LOC103829818 [Brassica rapa]
Length=1304

 Score =   521 bits (1341),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 348/1137 (31%), Positives = 544/1137 (48%), Gaps = 61/1137 (5%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAY---VRPNRMAKERFWNDCLSYSS  1113
              FW+  I    ++ +++  I   +         SF Y   V P R A    W   +  S+
Sbjct  49    LFWKQEI-KIQILSSSANCIDTSIEFEGKQFFASFIYADTVIPKRRA---LWASLIEQST  104

Query  1114  EFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQE  1293
               +APW + GDFND+ +N E+ G  +       +    +S   L D+  SG   SW R  
Sbjct  105   RRDAPWFLTGDFNDLLNNAEKVGGPARTEGSFTDMRTFYSEGDLYDLRHSGDCLSW-RGT  163

Query  1294  GGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrf  1473
              G  + R +LDRA  N     LFP A++  L    SDH P+    E     RR    +  
Sbjct  164   RGDYLVRCRLDRAAANSYWAELFPNARSQYLTYEGSDHKPILSFFEPDKKKRRGLFRYDR  223

Query  1474  egAWLTREDYRDIWGRVWSNSLLDVVG-AISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
                     + + +  + W ++    V   I EV     +W+K+ + N   R+   Q R +
Sbjct  224   RLK--NNPEAKVLIKQAWDSAPYSSVNDRIKEVRTALIQWSKQQYKN--SREQIEQKRFE  279

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
                E+   + +   +++ R +  ELN+    EE  W Q+SR +W+  GDRNT F+H +  
Sbjct  280   --LEAALTDPTNDTELISR-VSNELNDAYNSEEEYWRQRSRLLWLSLGDRNTGFFHATA-  335

Query  1831  IRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRK-NIMDGSPNDMY---CGPKLD  1998
               +NR R     +  +   +     D I    ++ F      +DG+  +       P + 
Sbjct  336   --KNRKRANAFTVIEDAEGNMVYQEDQIGRVIVEYFHELFKTIDGNREETVMHALSPMVS  393

Query  1999  TGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRD  2178
                  +L       E+K+A+F +    +PGPDG  A+FY T W+ V   I   ++     
Sbjct  394   AETNEQLIAVPAAVEIKEALFSIHADKAPGPDGFSASFYHTNWDTVGPEIVREIQDFFIT  453

Query  2179  GRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQ  2358
              R+P +I E+ I LIPK  SP+  +++RPI L NV +KIISK++  R++P++ N++   Q
Sbjct  454   DRLPERINETHIRLIPKVPSPQQVTEYRPIALCNVYYKIISKILTKRLQPLLSNIVSENQ  513

Query  2359  NSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFG  2535
             ++F+PGR  +DN+++T E++HY++     K+  MA+K D+ KAYD ++WEF+       G
Sbjct  514   SAFVPGRMISDNVLITHEVLHYLKNSDAEKRCAMAVKTDMSKAYDRLEWEFIRLVFQRLG  573

Query  2536  FPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQE  2715
             F    IS I+  V   + S L NG       P RG+RQGDPL+PY+FIL  E LS    +
Sbjct  574   FHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCSK  633

Query  2716  KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVS  2895
                  + K I +SRG   ++HL FA+D M F  AS+D    +   LK +   SG +IN  
Sbjct  634   AQEEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTKVLKLYEEASGQSINAD  693

Query  2896  KSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLA  3075
             KS+I  S  T + +K  + +   I     +G YLG+P    R     F  I+D +K+K  
Sbjct  694   KSSITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKKCDLFSSIIDRIKQKAK  753

Query  3076  NWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVH  3255
              W    LS AG+ T+++S LS +P + M  F+LP   C  I      F W DS   KK+ 
Sbjct  754   GWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWWDDSMGRKKMS  813

Query  3256  LVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA  3435
              + WN + + KD GGL  R    FN A LAKLAW+++ + DKL  +++  KY  N+ F A
Sbjct  814   WIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRILLGKYCHNEPFLA  873

Query  3436  TPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWW---------TGDKPLAFM  3588
               +    S GWR ++ GR IV   A+W +GNG S+N W+  W          G  PL ++
Sbjct  874   VDVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWLSCEVQESPMGPAPLQYL  933

Query  3589  DEVTIPDSQSEAKVSDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWP  3765
             +            VSDF LPN R WNVD +  +LP +    +   P        D L W 
Sbjct  934   N----------LTVSDFFLPNSREWNVDMIRLVLPMEEQKILAIKPSVT--GAPDKLSWL  981

Query  3766  RSPTGAFSVRSAFSHIAGNDEDAMDTS-------W---VWKMRVTERCrlflwllmrgrl  3915
              + +G+++ +S ++       D MDTS       W   VW ++ + + +LF+W  + G +
Sbjct  982   GAKSGSYTTKSGYATALSTRTDPMDTSIADQSFDWKKAVWTLKTSPKTKLFVWKALHGAI  1041

Query  3916  lTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPV--SFQYSLVTPL  4089
                     + +  D  C  C +  ET++H+   C FAK  W  T  PV  S +Y+    L
Sbjct  1042  PAGEALRARQINVDGKCKRC-NLPETIDHLFFHCPFAKQVW--TSAPVFPSIEYNGSIVL  1098

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLT  4260
             ++   N     +       G    +  W IW ARN  +F +  ++  + + +A +L 
Sbjct  1099  RNQWINLISRKNLPPTGVEGQLAPWILWGIWTARNNLVFNDKLTSATETLSKAISLA  1155



>ref|XP_009118875.1| PREDICTED: uncharacterized protein LOC103843847 [Brassica rapa]
Length=1319

 Score =   520 bits (1339),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 348/1137 (31%), Positives = 545/1137 (48%), Gaps = 61/1137 (5%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAY---VRPNRMAKERFWNDCLSYSS  1113
              FW+  I    ++ +++  I   +         SF Y   V P R A    W   +  S+
Sbjct  49    LFWKEEI-KIQILSSSANCIDTSIEFEGKQFFASFIYADTVIPKRRA---LWASLIEQST  104

Query  1114  EFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQE  1293
               +APW + GDFND+ +N E+ G  +       +    +S   L D+  SG   SW R  
Sbjct  105   RRDAPWFLTGDFNDLLNNAEKVGGPARTEGSFTDMRTFYSEGDLYDLRHSGDCLSW-RGT  163

Query  1294  GGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrf  1473
              G  + R +LDRA  N     LFP A++  L    SDH P+    E     RR    +  
Sbjct  164   RGDYLVRCRLDRAAANSYWAELFPNARSQYLTYEGSDHKPILSFFEPDKKKRRGLFRYDR  223

Query  1474  egAWLTREDYRDIWGRVWSNSLLDVVG-AISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
                     + + +  + W ++    V   I EV     +W+K+ + N   R+   Q R +
Sbjct  224   RLK--NNPEAKVLIKQAWDSAPYSSVNDRIKEVRTALIQWSKQQYKN--SREQIEQKRFE  279

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
                E+   + +   +++ R +  ELN+    EE  W Q+SR +W+  GDRNT F+H +  
Sbjct  280   --LEAALTDPTNDTELISR-VSNELNDAYNSEEEYWRQRSRLLWLSLGDRNTGFFHATA-  335

Query  1831  IRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRK-NIMDGSPNDMY---CGPKLD  1998
               +NR R     +  +   +     D I    ++ F      +DG+  +       P + 
Sbjct  336   --KNRKRANAFTVIEDAEGNMVYQEDQIGRVIVEYFHELFKTIDGNREETVMHALSPMVS  393

Query  1999  TGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRD  2178
                  +L       E+K+A+F +    +PGPDG  A+FY T W+ V   I   ++     
Sbjct  394   AETNEQLIAVPAAVEIKEALFSIHADKAPGPDGFSASFYHTNWDTVGPEIVREIQDFFIT  453

Query  2179  GRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQ  2358
              R+P +I E+ I LIPK  SP+  +++RPI L NV +KIISK++  R++P++ N++   Q
Sbjct  454   DRLPERINETHIRLIPKVPSPQQVTEYRPIALCNVYYKIISKILTKRLQPLLSNIVSENQ  513

Query  2359  NSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFG  2535
             ++F+PGR  +DN+++T E++HY++     K+  MA+K D+ KAYD ++WEF+       G
Sbjct  514   SAFVPGRMISDNVLITHEVLHYLKNSDAEKRCAMAVKTDMSKAYDRLEWEFIRLVFQRLG  573

Query  2536  FPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQE  2715
             F    IS I+  V   + S L NG       P RG+RQGDPL+PY+FIL  E LS    +
Sbjct  574   FHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCSK  633

Query  2716  KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVS  2895
                  + K I +SRG   ++HL FA+D M F  AS+D    +   LK +   SG +IN +
Sbjct  634   AQEEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTKVLKLYEEASGQSINAN  693

Query  2896  KSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLA  3075
             KS+I  S  T + +K  + +   I     +G YLG+P    R     F  I+D +K+K  
Sbjct  694   KSSITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKKCDLFSSIIDRIKQKAK  753

Query  3076  NWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVH  3255
              W    LS AG+ T+++S LS +P + M  F+LP   C  I      F W DS   KK+ 
Sbjct  754   GWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWWDDSMGRKKMS  813

Query  3256  LVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA  3435
              + WN + + KD GGL  R    FN A LAKLAW+++ + DKL  +++  KY  N+ F A
Sbjct  814   WIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRILLGKYCHNEPFLA  873

Query  3436  TPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWW---------TGDKPLAFM  3588
               +    S GWR ++ GR IV   A+W +GNG S+N W+  W          G  PL ++
Sbjct  874   VDVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWLSCEVQESPMGPAPLQYL  933

Query  3589  DEVTIPDSQSEAKVSDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWP  3765
             +            VSDF LPN R WNVD +  +LP +    +   P        D L W 
Sbjct  934   N----------LTVSDFFLPNSREWNVDMIRLVLPMEEQKILAIKPSVT--GAPDKLSWL  981

Query  3766  RSPTGAFSVRSAFSHIAGNDEDAMDTS-------W---VWKMRVTERCrlflwllmrgrl  3915
              + +G+++ +S ++       D MDTS       W   VW ++ + + +LF+W  + G +
Sbjct  982   GAKSGSYTTKSGYATALSTRTDPMDTSIADQSFDWKKAVWTLKTSPKTKLFVWKALHGAI  1041

Query  3916  lTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPV--SFQYSLVTPL  4089
                     + +  D  C  C +  ET++H+   C FAK  W  T  PV  S +Y+    L
Sbjct  1042  PAGEALRARQINVDGKCKRC-NLPETIDHLFFHCPFAKQVW--TSAPVFPSIEYNGSIVL  1098

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLT  4260
             ++   N     +       G    +  W IW ARN  +F +  ++  + + +A +L 
Sbjct  1099  RNQWINLISRKNLPPTGVEGQLAPWILWGIWTARNNLVFNDKLTSATETLSKAISLA  1155



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   520 bits (1340),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 359/1193 (30%), Positives = 555/1193 (47%), Gaps = 51/1193 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFA--YVRPNRMAKERFWNDCLSYSSE  1116
              FW+    +F ++  +   I G V G + +VR  F   Y  P    K + W        E
Sbjct  70    MFWKEETISFRMVSFSQNHICGDV-GSNGDVRWRFVGIYGWPEEENKHKTWALIKGLCDE  128

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
             +  P +  GDFN+I    E+ G +S      + F      C L D+   G  ++W R   
Sbjct  129   YEGPIVFGGDFNEILSYDEKEGGASRERRAIVGFRNVMDDCSLGDLRFVGQWHTWERGRS  188

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfr-f  1473
               +  R +LDR + +    +LFPEA      R  SDH  +   C       R       F
Sbjct  189   PESRIRERLDRFIVSRSWLHLFPEAFIDHQVRYCSDHAAIVLRCLGNEGMPRRRAGGFWF  248

Query  1474  egAWL----TREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQA  1641
             E  WL      E  R  W       + + +GA++      + W+K+TFG++  +  +++ 
Sbjct  249   ETFWLLDDTCEEVVRGAWNAAEGGRICEKLGAVAREL---QGWSKKTFGSLRKKIEAVEK  305

Query  1642  RIKGVQ-ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYH  1818
             ++   Q E+   ++      LER    EL+E+  + E  W+ +SR   ++DGDRNT+++H
Sbjct  306   KLHAAQGEATSIDSWERCVGLER----ELDELHAKNEAYWYLRSRVAEVKDGDRNTSYFH  361

Query  1819  KSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKL  1995
                  R+ R+ I  +    G W ++ + I   +  +F ++F           ++    K 
Sbjct  362   HKASQRKKRNLIHGIFDGGGRWQTEGEEIECVVERYFQEIFTSSEPSSNDFQEVLQHVKR  421

Query  1996  DTGQMHK--LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKV  2169
                Q +   L +  +  E+  A+ DM    +PGPDG+ A FYQ FW  +   +  FV  +
Sbjct  422   SVTQEYNDILLKPYSKEEIFAALSDMHPCKAPGPDGMHAIFYQRFWHIIGDEVFNFVSSI  481

Query  2170  LRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIG  2349
             L +   P  +  + I LIPK  SP   S+FRPI+L NV +KI SK IV R++  +  +  
Sbjct  482   LHNYSCPGNVNCTNIALIPKVKSPTVVSEFRPISLCNVLYKIASKAIVLRLKRFLPCIAT  541

Query  2350  PFQNSFLPGRSTADNIILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLV  2526
               Q++F+PGR  +DN ++  EI H M+ +   +KGLMA+KLD+ KAYD ++W FL   L+
Sbjct  542   ENQSAFVPGRLISDNSLIALEIFHTMKKRNNSRKGLMAMKLDMSKAYDRVEWGFLRKLLL  601

Query  2527  DFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWD  2706
               GF    ++L+M  V   S S + NG       P RGLRQGDPL+P+LFIL  +  S  
Sbjct  602   TMGFDGRWVNLVMSCVATVSYSFIINGRVCGSVTPSRGLRQGDPLSPFLFILVADAFSQM  661

Query  2707  IQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNI  2886
             +++KV  K       SR G  +SHL FA+D +LF  A+  +   I++ L K+   SG  I
Sbjct  662   VKQKVVSKEIHGAKASRNGPEISHLLFADDSLLFTRATRQECLTIVDILNKYEAASGQKI  721

Query  2887  NVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKR  3066
             N  KS +  S   + E K  L  L  +   D    YLGIP L  R  K  F  +LD M +
Sbjct  722   NYEKSEVSFSRGVSCEKKEELITLLHMRQVDRHQKYLGIPALCGRSKKVLFRELLDRMWK  781

Query  3067  KLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNK  3246
             KL  WK  +LS AG+  L+++ + ++P Y M V+KLP     +I      F WG     +
Sbjct  782   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQEIHSAMARFWWGGKGDER  841

Query  3247  KVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKN  3426
             K+H + W  +CK K  GG+G +    FN+ALL K  W+L+ + + L  +VM  KY  + +
Sbjct  842   KMHWLSWEKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNKESLLSRVMSAKYYPHGD  901

Query  3427  FFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIP  3606
                  +  + S+ WRSI   +S+V  G  WR+G+G  ++ WS  W GD+   F+    + 
Sbjct  902   VRYARLGYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARVE  961

Query  3607  DSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAV-CEQVSDSLYWPRSPTGA  3783
               +    + D  +  + WNV+ +           I A P++  C Q  D L W  S  G 
Sbjct  962   GLEVVGDLMD--VERKEWNVELIERHFNERDQQCILAIPLSTRCLQ--DELTWAYSKDGT  1017

Query  3784  FSVRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTED  3957
             +SV++A+    G + D     W  +W + V+ + R FLW      L       R+ + ++
Sbjct  1018  YSVKTAYMLGKGGNLDDFHRVWNILWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDE  1077

Query  3958  TLCATCGDGDETMNHVLMECSFAKDCWRRTHH----PVSFQYSLVTPLKSWVKNNCCASD  4125
               C  C   DET  H+   C  +   W         P     ++   L  W + +  A  
Sbjct  1078  AGCPCCAREDETQFHLFYRCPMSLKLWEELGSYILLPGIEDEAMCDTLVRWSQMD--AKV  1135

Query  4126  WINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHV  4305
                GC       Y  W +W  RN+R+FE+T+     + +R     +  VE F N      
Sbjct  1136  VQKGC-------YILWNVWVERNRRVFEHTSQPATVVGQR----IMRQVEDFNNYAVKIY  1184

Query  4306  GKMRWVC------WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
             G MR         W  P  G IK NTD +     G    G +ARD +G+  F 
Sbjct  1185  GGMRSSAALSPSRWYAPPVGAIKLNTDASLAEE-GWVGLGVIARDSEGKVCFA  1236



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score =   516 bits (1329),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 352/1187 (30%), Positives = 571/1187 (48%), Gaps = 116/1187 (10%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R++  Y  P    +E+ W            PW+ +GDFN+I    E+ G    N  +   
Sbjct  59    RLTVFYGFPAVQDREKSWILLDQLGHHNQLPWLCVGDFNEILSTDEKEGGPLRNNRQMQG  118

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F       G  D+G +G  ++W +   G    R +LDRAL     QNLFP      L  +
Sbjct  119   FRNIVDKLGFRDLGFNGYKFTW-KCRFGDGFVRVRLDRALATTSWQNLFPGFSVQHLDPS  177

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN--SLLDVVG---AI  1560
              SDH P+          +     F FE  W T  D      +VW +   L  +VG    I
Sbjct  178   RSDHLPILVRIRHATCQKSRYHRFHFEAMWTTHVDCEKTIKQVWESVGDLDPMVGLDKKI  237

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
              ++T + ++W+K TFG+I      L+A++  + ++ +   S  ++   R +   L+E+L 
Sbjct  238   KQMTWVLQRWSKSTFGHIKEETRVLRAKLASLFQAPY---SERVEEDRRVVQKSLDELLA  294

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             + EL W Q+SR  W++ GD+NT+++H+    RR R+ I+ L+  NG W +  + I+  + 
Sbjct  295   KNELYWCQRSRENWLKAGDKNTSYFHQKATNRRRRNIIKGLEDSNGCWRTSRQGITSIVI  354

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
             ++F DLF                PK+       L  + +  E+K AVF M+   +PGPDG
Sbjct  355   DYFGDLFRSSGSSMMEEILSALEPKVTADMQQVLIADFSYQEIKDAVFQMQPSKAPGPDG  414

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
             +   FYQ +W  V   +   V+  L+   +  ++  +F+TLIPK   P T +  RPI+L 
Sbjct  415   LPPLFYQKYWRIVGDDVVAAVRAFLQSNEMLRQLNHTFVTLIPKVKEPRTMAQLRPISLC  474

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-GKKGL  2454
             NV ++I +K + NRM+ +M+++I   Q++F+PGR   DN I+  EI H+++ ++ G+KG 
Sbjct  475   NVLYRIGAKTLANRMKFVMQSVISESQSAFVPGRLIIDNSIVAFEIAHFLKQRRRGRKGS  534

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
             +A+KLD+ KAYD ++WEFLE  ++  GFP   + ++M  V   S S L NGE      P 
Sbjct  535   LALKLDMSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPT  594

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RGLRQGDPL+PYLF+L  E  +  + +  R    + I + RG   VSHLFFA+D  +FA+
Sbjct  595   RGLRQGDPLSPYLFLLCAEGFTTLLSKAERQGQLQGIVICRGAPTVSHLFFADDSFVFAK  654

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A+++      NC                       N + + +  L ++ G+   D+  TY
Sbjct  655   ATDN------NC--------------------GVANIHMDTQSRLASVLGVPRVDSHATY  688

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG+P++  R     F Y+ + + +KL  W+   LS+AG+  L++    S+P+Y M  F L
Sbjct  689   LGLPMMLGRNKTVCFRYLKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLL  748

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P G C++I+++   F WG   +N+K+H + W  +CK+K  GG+G R    FN A+LAK  
Sbjct  749   PQGLCHEIEQMMARFWWGQQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQG  808

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+LV +   L  ++++ KY    NF+   + +  S  W+SI   R ++E+G+ ++IG+G 
Sbjct  809   WRLVHNPHSLASRLLKAKYFPQTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGK  868

Query  3535  SLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRT--WNVDKLSSL-LPHDIID  3705
             S+  W D W   +P  F    +  D     KVS+ I    +  W++ KL++L LP D++D
Sbjct  869   SVRIWGDKWV-PRPATFAVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVD  927

Query  3706  GIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF------------SHIAGNDEDAMDTSW  3849
              +R  P+++     D + W     G F+V+SA+               + N +  M    
Sbjct  928   IVR-IPLSI-RAPPDRIVWNYDKHGLFTVKSAYRVALRVTSGDEDESSSSNSDTGMLWRH  985

Query  3850  VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAK  4029
             +W   V  + ++F W +    L T     +KG+    +C  CGD  E+  HVL  C FA 
Sbjct  986   IWNATVPTKLKIFAWRVAHDILPTKANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAV  1045

Query  4030  DCW------RRTHHPVSFQ-YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKA  4188
               W      R  H  V    + +V   + +V     A+D                     
Sbjct  1046  ATWNISLLTRHAHQGVQRSPHEVVGFAQQYVHEFITAND---------------------  1084

Query  4189  RNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTD  4368
                         P  +  R  +                   +RW     P +G +KFN D
Sbjct  1085  -----------TPSKVTDRVRD------------------PVRWAA---PPSGRLKFNFD  1112

Query  4369  GAFKRNTGLASAGGLARDHKGEWLFGFMTNIG-VSNSFAAELWGLRE  4506
             GAF   +G  + G +ARD  G ++     ++G V ++  AE+   RE
Sbjct  1113  GAFDPTSGREAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILVARE  1159



>ref|XP_007207581.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
 gb|EMJ08780.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
Length=1146

 Score =   509 bits (1311),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 337/1082 (31%), Positives = 523/1082 (48%), Gaps = 75/1082 (7%)
 Frame = +1

Query  1060  PNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSAC  1239
             P R  K  FW +  +++   + PW+ +GD N+I  N E+ G       R           
Sbjct  15    PYREEKASFWENLANFAMVDSPPWLCIGDMNEILGNDEKEGGIPWPWGRTRYLRSFMDTN  74

Query  1240  GLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLK  1419
             GLL++ ++   Y+W  Q    ++ R KLDR L N +   L+P+    + PR  SDH PL 
Sbjct  75    GLLELRSTSQFYTWENQHDPVSLIRMKLDRGLINDQWLFLWPDLCVHVEPRVGSDHSPLV  134

Query  1420  FLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLL-DVVGAISEVTNLSK----  1584
                      R     F     W    D   I  R W N ++ D   A+S    + +    
Sbjct  135   LYFAPKIQRRAGGFKFEAY--WADEHDCGTIIQRGWKNDIVGDSFAALSANLGVCREELQ  192

Query  1585  KWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQ  1764
             KW+KE F N   R   L   +  +Q        R     E  +  E++ +  +EE  W Q
Sbjct  193   KWSKEKFPNNLSRINLLMKSLSNLQSGPLEENYRHQ---ESAIWDEMSVLWSREETYWKQ  249

Query  1765  KSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLF-  1938
             +SR  W+  GD NT F+H +TL RR R++I  +LK  G   S  + I +    FF +LF 
Sbjct  250   RSRLNWLSAGDANTKFFHTTTLQRRQRNKIETLLKSEGNCISGDQAIREEFGIFFGNLFK  309

Query  1939  -GRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFY  2115
              G      G  N ++    +   Q  +LT   +M EV+ AV  +    +PGPDG    FY
Sbjct  310   SGGPRNWGGILNCVHA--SITEAQNKRLTDPFSMEEVRTAVKQLGSLKAPGPDGFPGLFY  367

Query  2116  QTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKI  2295
               FWE +++ +   V            +  + I LIPK   P + + FRPI+L N S+KI
Sbjct  368   DRFWEIIQNFVNNLVTDFFLGNSRLELLNHTHIVLIPKIPKPTSVNHFRPISLCNNSYKI  427

Query  2296  ISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL-MAIKLD  2472
             +SK++ NR++ ++  LI   QN+F+PGR   DNI+L  E  HY+RLK  KK   + +KLD
Sbjct  428   LSKLLANRLKTLLPMLISQHQNAFVPGRQIQDNILLAHEAFHYLRLKSSKKSFELGLKLD  487

Query  2473  LHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQG  2652
             ++KAYD ++W+FLE+TL  F F    + L+M  V+  + SL+ NG   +PF P RGLRQG
Sbjct  488   MNKAYDRVEWDFLEATLCKFSFDNRWVELVMLCVKTITFSLVLNGSPGSPFSPSRGLRQG  547

Query  2653  DPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQG  2832
             DPL+PYLF+L  E LS +I         + I LSRGG  +SHLFFA+D + F +A+    
Sbjct  548   DPLSPYLFLLVSEVLSLNIINSTDTGMLRGIKLSRGGPELSHLFFADDSLFFLQATPPNC  607

Query  2833  RMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL  3012
               + + ++ +   SG  +N +KS+++ SPNT++    G +N  G+             IL
Sbjct  608   SALKSIIECYCSASGQEVNFNKSSLYFSPNTDT----GTRNQFGL-------------IL  650

Query  3013  HKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCN  3192
               R       Y+ D +  K+A WK  +LS A R  L++S  +++P + M  F LPA  CN
Sbjct  651   GGRSKVEALAYVRDRINSKIAGWKLKLLSQAVREVLIKSVAAAIPAHPMSCFLLPATICN  710

Query  3193  DIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTS  3372
              I+     F                         GG+G      FN +LLAK  W+++ +
Sbjct  711   SINTDLARFC-----------------------GGGMGFLDLQAFNRSLLAKQCWRIMRN  747

Query  3373  HDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWS  3552
              + LW ++++ +Y    +F        ASW   S++ GR I+E GA W+IGNG S++ W 
Sbjct  748   PNALWARILKARYFPECSFLDAKKGGRASWALSSLLVGRDIIEKGAYWQIGNGRSVSVWK  807

Query  3553  DWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIA  3729
             D W        +  +   +  +   V+D I + NR+WN+  +   +P      IR+TPI 
Sbjct  808   DRWLMGYGSGKISPLPSSNRFTPLLVADLIDVGNRSWNISHIEPFIPPSEAMLIRSTPIG  867

Query  3730  VCEQVSDSLYWPRSPTGAFSVRSAFSH-IAGNDEDAMDTS----------W--VWKMRVT  3870
                   D L WP    G ++V+S + H I  +  D  D +          W  +W+  +T
Sbjct  868   SL-ATRDPLVWPAVKNGDYTVKSGYYHAINVSPPDPCDRASSSHAVNSDVWKVIWRAHIT  926

Query  3871  ERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTH  4050
              + R F+W  +   + T    + + +     C  CG   ET+ H+L+ CS+ +  W    
Sbjct  927   PKIRNFMWRALTNSIPTCANLFGRKLARSPTCRLCGLFPETVEHLLLLCSWTRAVWFGCP  986

Query  4051  HPVSFQYSLVTPLKSWVKNNCCASDWINGCP--WGVT-FIYTCWEIWKARNQRIFENTAS  4221
                +   + +T L SW+ ++   S + +G    WG++ F++  WEIWKAR + IF +   
Sbjct  987   FGYAPNLASITTLDSWL-SSFLRSSFADGDQRDWGISLFMFCSWEIWKARCKAIFNDIRP  1045

Query  4222  AP  4227
             +P
Sbjct  1046  SP  1047



>gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1656

 Score =   520 bits (1340),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 313/939 (33%), Positives = 491/939 (52%), Gaps = 35/939 (4%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             ++++ Y  P+   K  FW    S     + PW+++GDFN++ D  E+WG     P R   
Sbjct  706   KITWMYGNPHDNEKRAFWRLMYSRFPVQSLPWLVLGDFNEVLDPSEKWGGGPPLPWRIKL  765

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F +  +   L D+   G  +SWF    GR   + +LDRAL N+   +  P  + + LP+ 
Sbjct  766   FRDFLNNGHLRDLHFKGPGFSWFAMRHGRVFIKERLDRALGNIAWSSSQPNTQILHLPKI  825

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WG--------RVWSNSL  1539
              SDH PL  L ++      + R FRFE  W T E+Y D+    W         R W+ +L
Sbjct  826   GSDHRPL--LLDSNPKMLNKTRLFRFEQMWTTHEEYSDVIQRSWPPAFGGSAMRSWNRNL  883

Query  1540  LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVT  1719
             L    A+       K W+KE F N   + A L + I+ + +S   +    + +L      
Sbjct  884   LSCGKAL-------KMWSKEKFSNPSVQVADLLSDIEKLHQSNPPDAHHQINIL----TD  932

Query  1720  ELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFK  1896
             ++ ++  Q+E+ W Q+SR  W++ GD+N++F+H++T+ RR  ++I  LK + G W     
Sbjct  933   QVTKLWTQDEMYWHQRSRVNWLKLGDQNSSFFHQTTIQRRQYNKIVRLKDDHGNWLDSEA  992

Query  1897  TISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMKK  2073
              ++    ++F  L+             +    + T +M+K L+  V++ EVKKAVFD+  
Sbjct  993   DVALQFLDYFTALYQSNGPQQWEEVLDFVDTAV-TAEMNKILSSPVSLLEVKKAVFDLGA  1051

Query  2074  FGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETAS  2253
               +PGPDG    FYQ  WE V+S I     +      +   +  + + LIPK  +P   S
Sbjct  1052  TKAPGPDGFSGIFYQNQWEWVQSIIHESALQHQTSSSLLQVMNRTHLALIPKVKAPTHPS  1111

Query  2254  DFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL  2433
              +RPI L N S+KI++K+I +R++P M  LI   Q++F+  R   DN+I+  EI H+++L
Sbjct  1112  HYRPIALCNFSYKILTKIIASRLQPFMSELISDNQSAFVSNRQIQDNVIIAHEIYHHLKL  1171

Query  2434  KKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGE  2610
              +    G   +KLD++KAYD ++W FLE+ L   GF  + I L+M  V  SS+S+L NG+
Sbjct  1172  TRSCNNGAFGLKLDMNKAYDRVEWNFLEAVLRKMGFVDSWIGLVMSCVTTSSLSVLINGK  1231

Query  2611  KLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFA  2790
                 F P RGLRQGDPL+P+LF+   + LS  I +  +     P+T+      VSHLFFA
Sbjct  1232  PGPSFLPSRGLRQGDPLSPFLFLFVNDVLSRMINKMCQDSLLTPVTIGPNNLPVSHLFFA  1291

Query  2791  EDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGIS  2970
             +D + F  A+      + + L  +   SG  INV KS+IF SPNT  EI   L ++  I 
Sbjct  1292  DDSLFFLRATLQNCETLSDLLHTYCIASGQLINVEKSSIFFSPNTPPEIAHLLSSIMQIP  1351

Query  2971  VSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPV  3150
             V  + GTYLG+P    R  K   G+I D + RK+  WK   LS AG+  L+++  +++P 
Sbjct  1352  VVSDPGTYLGLPTFWHRSKKKALGFIKDSILRKVKGWKQATLSQAGKEVLIKAVATAIPA  1411

Query  3151  YTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFN  3330
             Y M  FK P+  C +++ I  DF WG+    + +H   W+ + + K  GG+G R   DFN
Sbjct  1412  YPMGCFKFPSTLCKELNGILADFWWGN-VDTRGIHWKSWDFLARPKKDGGMGFRNLEDFN  1470

Query  3331  NALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGA  3510
             N+LLAK AW+L  +   LW +V+ + Y    +F   P   N SW W S++ GR+ +   A
Sbjct  1471  NSLLAKQAWRLHQNPFALWARVLEQLYYPRSSFLEAPKGPNPSWIWNSLLIGRNFIHKEA  1530

Query  3511  AWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLL  3687
              W IGNG S+N   D W    P +    V++P ++  ++V + I    ++W +D  +  +
Sbjct  1531  LWNIGNGFSVNIVGDNWIPSIPPS---TVSLPLNEDNSRVCELINWDTKSWELDHFAETI  1587

Query  3688  PHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
                    I A PI       D+L WP +  G +SV+S +
Sbjct  1588  TPTQRLLISAIPITSLA-APDTLIWPYTKDGVYSVKSGY  1625



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   516 bits (1330),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 336/1173 (29%), Positives = 564/1173 (48%), Gaps = 51/1173 (4%)
 Frame = +1

Query  1069  MAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLL  1248
             +   +FW+     +   ++PW+ +GDFN+   + E+ G    +  R  +F E    C L+
Sbjct  246   LVNPQFWDVLRRIAGSNSSPWLCVGDFNEATYHWEKVGRKLADFHRMSSFREVLHDCSLI  305

Query  1249  DMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLC  1428
             DM + G +Y+W     G  + + +LDR L  L+ +  FP A+        SDH PL  L 
Sbjct  306   DMESKGCAYTWMSNRQGEDIIKERLDRCLCTLDWRIAFPNAEVCAFLAVGSDHSPL--LL  363

Query  1429  EAgnpprrenrpfrfegAWLTREDYRDIWGRVW---SNSLLDVVGAISEVTNLSKKWNKE  1599
                 P  R  +PF FE  WL   D + I   VW   S    ++   + +V+     W++ 
Sbjct  364   NTDAPQTRRRQPFTFEAFWLQHPDCKKIISDVWKQASTVAHNLPYLLKKVSLALTLWSRR  423

Query  1600  TFGNIFGRKASLQARIKGV--QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSR  1773
             TF N   R   LQ  ++ +  +  + Y+      +      +E+ ++ +QEE  W  KSR
Sbjct  424   TFSNAKERITELQYELQQIANRSDIPYDRETATTI-----KSEIQQLWQQEEQFWAMKSR  478

Query  1774  RMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKN  1950
               W+  GD+NT F+H +T+ RR R+RI ML    + W  D   +      FF +L+    
Sbjct  479   ISWLNWGDKNTKFFHATTIQRRQRNRITMLLDEEQGWVRDAAILKVKTQTFFSNLYKSVG  538

Query  1951  IMDGSPNDMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFW  2127
               D +P    C P L T +++  LT  VT  E++ A F +    + GPDG+   FYQ+ W
Sbjct  539   SRDFAPILDQC-PCLVTPEINTALTAMVTKDEIQAATFQLGANKASGPDGLNGLFYQSNW  597

Query  2128  EEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKV  2307
             + ++  +   V +    G +P  + ++ + L+PK   P++   +RPI+L N  +KIIS+V
Sbjct  598   DTLQEEVFFSVHQFFTSGLMPLDLNKTDVVLVPKIPLPQSLDHYRPISLCNFGYKIISRV  657

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAI-KLDLHKA  2484
             +VNR++PI+  LI   Q++ + GR   DNI++TQEI+H +++ K ++   AI K+D+ KA
Sbjct  658   LVNRLKPILPQLISTEQSASVSGRQIQDNILVTQEIIHQIKISKRRRNFPAILKMDMQKA  717

Query  2485  YDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLA  2664
             YD ++W+FL + L+  GF    +  I   +  +SIS+ +NG+++  F P RGLRQGDPL+
Sbjct  718   YDRVEWDFLTAYLLKLGFHPRWVQWIYQCISSASISIKFNGQQMDYFNPTRGLRQGDPLS  777

Query  2665  PYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIM  2844
             PYLFIL    LS  I + + + + +   +SR    +SHLFFA+D + F  A+  + + + 
Sbjct  778   PYLFILVTNLLSSLIHQAIDIGHLQGFKVSRYSPTLSHLFFADDAIFFLTATTTECQNLA  837

Query  2845  NCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRV  3024
             + L ++   +G +IN +KS IF        +K  L +   I V D +G YLGIP      
Sbjct  838   SILSQYCLATGQSINRNKSGIFLGKYCPRCLKENLASELRIPVLDRMGKYLGIPSDWGSS  897

Query  3025  SKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDR  3204
                 F +IL  +  K+  WK N++S  G+  L+++ + ++P Y M VFK+P   C  I++
Sbjct  898   KGEMFSWILGRVNSKMEGWKENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEK  957

Query  3205  ICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKL  3384
                 F W +  +   +H   W+ +  +K  GGLG R  + FN A+L K AW+L+     L
Sbjct  958   KIARFWWQNDCRKAGIHWKQWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSL  1017

Query  3385  WVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWT  3564
             W K+ +  Y   ++F         SWGW+S++  R ++     W +G+G ++N   D W 
Sbjct  1018  WSKLFKAIYFPAQDFRYAHKGVRPSWGWQSLLSSREVILPNLQWSVGDGKNINIREDRWL  1077

Query  3565  GDKPLAFMDEVTIPDSQSEAK-VSDFILPNRT-WNVDKLSSLLPHDIIDGIRATPIAVCE  3738
                P      V  P ++ E   V++ ++ N   WN+  L++         I   P+    
Sbjct  1078  ---PRGI---VGGPANREEPSLVAELLVQNSNHWNLATLNNFYDEQTTAEILRIPVRR-N  1130

Query  3739  QVSDSLYWPRSPTGAFSVRSAFSHI-----------AGNDEDAMDTSW--VWKMRVTERC  3879
                D L W  +  G +++RSA+  +           A +        W  +W +++  + 
Sbjct  1131  LTQDKLVWTETTNGQYTIRSAYHSVRKASICKLTRQASSSYQQPPQLWKCIWSVKLPPKL  1190

Query  3880  rlflwllmrgrllTNMERWRKGMTEDTLCATCG-DGDETMNHVLMECSFAKDCWRRTHHP  4056
             ++F W +    L T    +R+ +T D +C  C  +  E++ H+ + C +    W      
Sbjct  1191  KVFFWSVCHNALPTKENLFRRRITPDPICPLCTLNQPESIEHLFLLCPWTTAIWSHPTIN  1250

Query  4057  VSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI  4236
             +    + V  +  W+ +           P    FI  CW++WKARN  IF      P   
Sbjct  1251  IHIDTTTVRRIDEWIVDRILHK---KSKPDLELFIAVCWQVWKARNGAIFSKHQPDPHFG  1307

Query  4237  MRRA-----NNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLAS  4401
             +  A     +    D   +   K+ V +G      WQPP  G ++ N DGA+       S
Sbjct  1308  VHAAFAQVRSAAICDHSLMTKPKQSVDLGHF----WQPPAPGTLRINIDGAYTSGHTEGS  1363

Query  4402  AGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
                + RD  G    G   ++  +++   E   L
Sbjct  1364  IAFICRDKSGCLQEGLTRSVQAASALQTEAQAL  1396



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   519 bits (1336),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 356/1184 (30%), Positives = 566/1184 (48%), Gaps = 59/1184 (5%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y   +   K R W            PW+M GDFN+I  + E+ G      S    F  + 
Sbjct  352   YGDAHSETKHRTWTTMRGLIDNPTTPWLMAGDFNEILFSHEKQGGRMKAQSAMDEFRHAL  411

Query  1231  SACGLLDMGTSGVSYSW----FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
             + CGL D+G  G +++W      QEG     R +LDRA+ N E + +FP A+ I     H
Sbjct  412   TDCGLDDLGFEGDAFTWRNHSHSQEG---YIRERLDRAVANPEWRAMFPAARVINGDPRH  468

Query  1399  SDHHPLKFLCEAgnpprrenrpfrf---egAWLTREDYRDIWGRVWSNSL----LDVVGA  1557
             SDH P+    E  N   R          E AWL  E ++++    W  S     L V  +
Sbjct  469   SDHRPVIIELEGKNKGVRGRNGHNDFRFEAAWLEEEKFKEVVKEAWDVSAGLQGLPVHAS  528

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             ++ V      W+    G++  R   ++  ++  +       SR   V E  L   L ++ 
Sbjct  529   LAGVAAGLSSWSSNVLGDLEKRVKKVKKELETCRRQPI---SRDQVVREEVLRYRLEKLE  585

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHI  1914
             +Q ++ W Q++   W+  GDRNT+F+H S   RR R+RI ++ + +G W    +     I
Sbjct  586   QQVDIYWKQRAHTNWLNKGDRNTSFFHASCSERRRRNRINKLRREDGSWVEREEDKRAMI  645

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLD---TGQMHKLTR-EVTMCEVKKAVFDMKKFGS  2082
               FF  LF      +G  N       +D   +G M++  R E T  EVK+A+  +    +
Sbjct  646   IEFFKQLF----TSNGGQNSQKLLDVVDRKVSGAMNESLRAEFTREEVKEALDAIGDLKA  701

Query  2083  PGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFR  2262
             PGPDG+ A FY+  W+ V   +T  V +VLR G +P    +  I LIPK   PE   D R
Sbjct  702   PGPDGMPAGFYKACWDVVGEKVTDEVLEVLRGGAIPEGWNDITIVLIPKVKKPELIKDLR  761

Query  2263  PITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-  2439
             PI+L NV +K++SKV+ NR++ I+ ++I P Q++F+PGR  +DNI++  E+ HYMR K+ 
Sbjct  762   PISLCNVCYKLVSKVLANRLKKILPDVISPAQSAFVPGRLISDNILIADEMTHYMRNKRS  821

Query  2440  GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLA  2619
             G+ G  A KLD+ KAYD ++W FL   ++  GF  + ++LIM  V   +  +  NGE   
Sbjct  822   GQVGYAAFKLDMSKAYDRVEWSFLHDMILKLGFHTDWVNLIMKCVSTVTYRIRVNGELSE  881

Query  2620  PFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDL  2799
              F PGRGLRQGDPL+PYLF+L  E  S  + +         I + +G   VSHL FA+D 
Sbjct  882   SFSPGRGLRQGDPLSPYLFLLCAEGFSALLSKTEEEGRLHGIRICQGAPSVSHLLFADDS  941

Query  2800  MLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSD  2979
             ++   A+  + + +   L+ +   SG  IN  KS +  SPNT+S  KR +     +    
Sbjct  942   LILCRANGGEAQQLQTILQIYEECSGQVINKDKSAVMFSPNTSSLEKRAVMAALNMQRET  1001

Query  2980  NLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTM  3159
                 YLG+P+   R     F Y+ + + +++  WK  +LS AG+  L+++   ++P + M
Sbjct  1002  TNERYLGLPVFVGRSRTKIFSYLKERIWQRIQGWKEKLLSRAGKEILIKAVAQAIPTFAM  1061

Query  3160  QVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNAL  3339
               F+L    C+ I ++   + W +  ++ K+H + WN +   K+ GGLG R    FN A+
Sbjct  1062  GCFELTKDLCDQISKMIAKYWWSNQEKDNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAM  1121

Query  3340  LAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWR  3519
             LAK  W+L+   D L  +V+R KY    + F     +N S+ WRSI +G  +++ G  WR
Sbjct  1122  LAKQGWRLIQDPDSLCSRVLRAKYFPLGDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWR  1181

Query  3520  IGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQS-EAKVSDFILP-NRTWNVDKLSSLLPH  3693
             +G+G  +N W+D W    P  +  +   P   +   KV + I P   TW+ D LS     
Sbjct  1182  VGDGSKINIWADPWI---PRGWSRKPMTPRGANLVTKVEELIDPYTGTWDEDLLSQTFWE  1238

Query  3694  DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS--------------HIAGNDED  3831
             + +  I++ P+ V  ++ D L W     G F+V+SA+                   N E 
Sbjct  1239  EDVAAIKSIPVHV--EMEDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWES  1296

Query  3832  AMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
               D  W  +WK+ V  + + FLW +    L        +GM  DT C  CG  +E   H+
Sbjct  1297  GDDDFWKKLWKLGVPGKIKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHL  1356

Query  4006  LMECSFAKDCWRRTH-HPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIW  4182
               +C   K  W+  +   +       T  K+ +++  C  +         + I   W+ W
Sbjct  1357  FFKCKPVKKVWQALNLEELRSMLEQQTSGKNVLQSIYCRPENER-----TSAIVCLWQWW  1411

Query  4183  KARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFN  4362
             K RN+        +P ++     +   + V + + +K    G+     W+ P   ++K N
Sbjct  1412  KERNEVREGGIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTGEC--AVWRRPPLNFVKIN  1469

Query  4363  TDGAFKRNTGLASAGGLARDHKGEWL-FGFMTNIGVSNSFAAEL  4491
             TDGA+  N      G + +D  G  L  G      + ++F AE+
Sbjct  1470  TDGAYSSNMKQGGWGFVIKDQTGAVLQAGAGPAAYLQDAFHAEV  1513



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   511 bits (1316),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 360/1160 (31%), Positives = 556/1160 (48%), Gaps = 61/1160 (5%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  P    K   W+       + + P +  GDFN+I   +E+ G +         F E  
Sbjct  106   YGWPETSNKHLTWSLLRRLKQQCSLPVLFFGDFNEITSIEEKEGGAPRCERVMDAFREVI  165

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
               C + D+G  G  ++W R     T+ R +LDR L N E  + FP  + + LPR  SDH 
Sbjct  166   DDCAVKDLGYVGNRFTWQRGNSPSTLIRERLDRMLANDEWCDNFPSWEVVHLPRYRSDHA  225

Query  1411  PLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKK  1587
             PL       +  RR N+ F+FE  WL++E+   I    W+ S   D+   + EV+     
Sbjct  226   PLLLKTGVNDSFRRGNKLFKFEAMWLSKEECGKIVEEAWNGSAGEDITNRLDEVSRSLST  285

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLE--RKLVTELNEVLKQEELLWF  1761
             W  +TFGN+  RK      + G+Q+            LE  R +  +L+E+ + EE  W 
Sbjct  286   WATKTFGNLKKRKKEALTLLNGLQQR-----DPDASTLEQCRIVSGDLDEIHRLEESYWH  340

Query  1762  QKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLF  1938
              ++R   I+DGD+NT ++H     R+ R+ I  +L  NG W    + I   + ++F  LF
Sbjct  341   ARARANEIRDGDKNTKYFHHKASQRKRRNTINELLDENGVWKKGREEICGVVQHYFEGLF  400

Query  1939  GRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMC--------EVKKAVFDMKKFGSPGPD  2094
                     SP +M    +   G  H ++ ++           EVK+A+F M    +PG D
Sbjct  401   ATD-----SPVNMELALE---GLSHCVSTDMNTALLMLPSGDEVKEALFAMHPNKAPGID  452

Query  2095  GIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITL  2274
             G+ A F+Q FW  + S + +FV+   R       + ++ I LIPK D P++  DFRPI+L
Sbjct  453   GLHALFFQKFWHILGSDVISFVQSWWRGMGDLGVVNKTCIVLIPKCDHPQSMKDFRPISL  512

Query  2275  LNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKK-G  2451
               V +KI+SK + NR++ I+  +I P Q++F+P R   DN ++  EI H M+ K   K G
Sbjct  513   CTVLYKILSKTLANRLKVILPAIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDANKNG  572

Query  2452  LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQP  2631
             + A+KLD+ KAYD ++W FLE  +   GF    I  +M  +   S +   NG       P
Sbjct  573   VCALKLDMSKAYDRVEWCFLERVMKKMGFCDGWIDRVMACISSVSFTFNVNGVVEGSLSP  632

Query  2632  GRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFA  2811
              RGLRQGDP++PYLF+L  +  S  + +    K      + RG   VSHLFFA+D +LF 
Sbjct  633   SRGLRQGDPISPYLFLLCADAFSTLLSKAASEKKIHGAQICRGAPVVSHLFFADDSILFT  692

Query  2812  EASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGT  2991
             +AS  +  M+ + + K+   SG  +N+SK+ +  S + + E +  + N+ G+   D    
Sbjct  693   KASVQECSMVADIISKYERASGQQVNLSKTEVVFSRSVDRERRSAIVNVLGVKEVDRQEK  752

Query  2992  YLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFK  3171
             YLG+P +  R  K TF  I + + +KL  WK  +LS  G+  L++S   ++P Y M VF 
Sbjct  753   YLGLPTIIGRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEVLIKSVAQAIPTYMMSVFS  812

Query  3172  LPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKL  3351
             LP+G  ++I  +   F WG S  N+K+H   W+ +C  K  GGLG R    FN +LLAK 
Sbjct  813   LPSGLIDEIHSLLARFWWGSSDTNRKMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQ  872

Query  3352  AWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNG  3531
             AW+L T    L  ++++ +Y K+          N S+ WRSI   +S++  G  W +G+G
Sbjct  873   AWRLCTGDQTLLYRLLQARYFKSSELLEARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSG  932

Query  3532  LSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLLPHDIIDG  3708
               +  W D W   +  A M      DS  + KV D I   R  WN++ +      +  + 
Sbjct  933   ERIRVWEDAWILGEG-AHMVPTPQADSNLDLKVCDLIDVARGAWNIESVQQTFVEEEWEL  991

Query  3709  IRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF----------SHIAGNDEDAMDTSWVWK  3858
             + + P++         +WP S  G FSVRS +            +   + +      VW+
Sbjct  992   VLSIPLSRFLPDDHRYWWP-SRNGIFSVRSCYWLGRLGPVRTWQLQHGERETELWRRVWQ  1050

Query  3859  MRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
             ++   +   FLW   +G L      + + ++ D  C+ CGD DE++NH L +C+FA+  W
Sbjct  1051  LQGPPKLSHFLWRACKGSLAVKGRLFSRHISVDATCSVCGDPDESINHALFDCTFARAIW  1110

Query  4039  RRTHHPVSFQYSLV--TPLKSWVKNNCCASDWINGCPWGVTFIYTC---WEIWKARNQRI  4203
             +     VS   SL+   PL S+ +      +W+        F   C   W  W  RN+ I
Sbjct  1111  Q-----VSGFASLMMNAPLSSFSER----LEWLAKHATKEEFRTMCSFMWAGWFCRNKLI  1161

Query  4204  FENTASAPMDIMRRANNLTLDTVE----VFLNKKCVHVGKMRWVCWQPPETGWIKFNTDG  4371
             FEN  S    + +R + L  D  E    VF   +    G      W PP TG  K N D 
Sbjct  1162  FENELSDAPLVAKRFSKLVADYCEYAGSVF---RGSGGGCGSSALWSPPPTGMFKVNFDA  1218

Query  4372  AFKRNTGLASAGGLARDHKG  4431
                 N G    G + R + G
Sbjct  1219  HLSPN-GEVGLGVVIRANDG  1237



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   510 bits (1313),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 356/1193 (30%), Positives = 561/1193 (47%), Gaps = 46/1193 (4%)
 Frame = +1

Query  946   FWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNA  1125
             FWR  + +F+++  +   I G +       R    Y       K   W+       + + 
Sbjct  71    FWREEL-SFSLVSFSQHHICGDIDDGAKKWRFVGIYGWAKEEEKHHTWSLMRFLCEDLSR  129

Query  1126  PWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRT  1305
             P +M GDFN+I   +E+ G +         F E+     L D+G +GV ++W R     T
Sbjct  130   PILMGGDFNEIMSYEEKEGGADRVRRGMYQFRETMDDLFLRDLGYNGVWHTWERGNSLST  189

Query  1306  VQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAW  1485
               R +LDR + +     ++P        R  SDH  +         P  + R F FE +W
Sbjct  190   CIRERLDRFVCSPSWATMYPNTIVDHSMRYKSDHLAICLRSNRTRRPTSKQRRFFFETSW  249

Query  1486  L----TREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNI---FGRKASLQAR  1644
             L      E  RD W     +SL    G +  +    K W+ E  GNI    GR  S   R
Sbjct  250   LLDPTCEETIRDAWTDSAGDSL---TGRLDLLALKLKSWSSEKGGNIGKQLGRVESDLCR  306

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             ++  Q+ +          LE+KL    +E+  ++E  W+ +SR M ++DGDRNT ++H  
Sbjct  307   LQ--QQPISSANCEARLTLEKKL----DELHAKQEARWYLRSRAMEVRDGDRNTKYFHHK  360

Query  1825  TLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYC--GPKL  1995
                R+ R+ ++ +   +G W  +   I    +++F  +F   N  D   ND+ C   P +
Sbjct  361   ASQRKKRNFVKGLFDASGTWCEEVDDIECVFTDYFTSIFTSTNPSDVQLNDVLCCVDPVV  420

Query  1996  DTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLR  2175
                    L +  +  E+  A+  M    +PGPDG+ A FYQ FW  +   +T FV  +L 
Sbjct  421   TEECNTWLLKPFSKEELYVALSQMHPCKAPGPDGMHAIFYQKFWHIIGDDVTQFVSSILH  480

Query  2176  DGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPF  2355
                 P  I  + I LIPK  +P T ++FRPI L NV +K++SK +V R++  +  L+   
Sbjct  481   GSISPSCINHTNIALIPKVKNPTTPAEFRPIALCNVVYKLVSKALVIRLKDFLPRLVSEN  540

Query  2356  QNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDF  2532
             Q++F+PGR   DN ++  E+ H M+ + + +KG +A+KLD+ KAYD ++W FL   L+  
Sbjct  541   QSAFVPGRLITDNALIAMEVFHSMKHRNRSRKGTIAMKLDMSKAYDRVEWGFLRKLLLTM  600

Query  2533  GFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQ  2712
             GF    ++LIM  V   S S + NG       P RGLR GDPL+PYLFIL  +  S  IQ
Sbjct  601   GFDGRWVNLIMSCVSSVSYSFIINGGVCGSVTPARGLRHGDPLSPYLFILIADAFSKMIQ  660

Query  2713  EKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINV  2892
             +KV+ K       SR G  +SHLFFA+  +LF  AS  +  +I+  L  +   SG  IN 
Sbjct  661   KKVQEKQLHGAKASRSGPVISHLFFADVSLLFTRASRQECAIIVEILNLYEQASGQKINY  720

Query  2893  SKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKL  3072
              KS +  S   +   K  L N+  +   +    YLGIP +  R     F  ++D + +KL
Sbjct  721   DKSEVSFSKGVSIAQKEELSNILQMKQVERHMKYLGIPSITGRSRTAIFDSLMDRIWKKL  780

Query  3073  ANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKV  3252
               WK  +LS AG+  L++S + ++P Y M V+KLP      I      F WG S   +++
Sbjct  781   QGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWWGSSDTQRRI  840

Query  3253  HLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFF  3432
             H   W+ +C  K  GG+G R    FN+ALL + AW+LV     L  +VM+ KY  N +F 
Sbjct  841   HWKNWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVMKAKYYSNHDFL  900

Query  3433  ATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDS  3612
               P+  + S+ WRSI   +++++ G  WRIGNG ++  W D W  D+   F   +T    
Sbjct  901   DAPLGVSTSYSWRSIWSSKALLKEGMVWRIGNGTNVRIWEDPWVLDELGRF---ITSEKH  957

Query  3613  QSEAKVSDFILPNRT-WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
              +   VS+ I  +R  W V  + ++     I  I + P++    + D L W  +    +S
Sbjct  958   GNLNMVSELIDFDRMEWKVSLIETVFNERDIKCILSIPLSSLP-LKDELTWAFTKNAHYS  1016

Query  3790  VRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTL  3963
             V++A+    G + D+   +W  +W M V+ + + FLW L    L        + M +D L
Sbjct  1017  VKTAYMLGKGGNLDSFHQAWIDIWSMEVSPKVKHFLWRLGTNTLPVRSLLKHRHMLDDDL  1076

Query  3964  CAT-CGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNN--CCASDWIN  4134
             C   CG+  E+  H +  C F +D W  +        +  T +   + N+    AS    
Sbjct  1077  CPRGCGE-PESQFHAIFGCPFIRDLWVDSGCDNFRALTTDTAMTEALVNSHGLDASVRTK  1135

Query  4135  GCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD----TVEVFLNKKCVH  4302
             G        +  W +W  RN  +F  +++ P  ++ R + L  +    T  ++ N+ C  
Sbjct  1136  GA-------FMAWVLWSERNSIVFNQSSTPPHILLARVSRLVEEHGTYTARIYPNRNCCA  1188

Query  4303  VGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNI  4461
             +   R     PPE   IK N D +   + G      +ARD  G  LF  +  +
Sbjct  1189  IPSARVWAAPPPEV--IKLNVDASLA-SAGWVGLSVIARDSHGTVLFAAVRKV  1238



>ref|XP_010412448.1| PREDICTED: uncharacterized protein LOC104698743 [Camelina sativa]
Length=1329

 Score =   509 bits (1311),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 339/1127 (30%), Positives = 551/1127 (49%), Gaps = 41/1127 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              F+  + FN  ++  +++ I          + ++F Y  P    ++  W   L      +
Sbjct  36    LFYSQADFNVTILFESNRLIDIEAVYKGRVIYLTFVYGDPVPKNRDMVWERLLRIGVSRS  95

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             +PW  +GDFN++  N E+ G    +PS  L F      CG L+    G   SW      +
Sbjct  96    SPWFTVGDFNELTGNHEKRGGKLRHPSSFLPFNGMIQDCGFLEFPFLGDCLSWRGWRDKK  155

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              + R +LDRAL N +  +LFP+     LP   SDH P+  +   G    R  R F F+  
Sbjct  156   PI-RCRLDRALGNEDWHDLFPDTVLEYLPMIASDHKPV--VVNIGAKRPRGKRRFMFDPR  212

Query  1483  WLTREDYRDIWGRVW----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKA--SLQAR  1644
             W+ +E   +     W      S  + +  I        +W K+     FGR+    L+ +
Sbjct  213   WIGKEGLMEAIEAGWVGGTPQSSPNFLDKIVICRRAISRWRKDHVP--FGRETIEDLKCQ  270

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +   Q     + +  L V+   L   L E  K EE+ W+ KSR  W+Q GD+N+ ++H  
Sbjct  271   LSVAQA----DDATPLSVIA-DLNARLWEAYKDEEVYWYLKSRNKWMQMGDQNSKYFHAL  325

Query  1825  TLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
             T  RR R+RI  L    E W+++ + I +   ++F DLF   +  +         P +  
Sbjct  326   TKQRRARNRIIGLYDKNEIWSTEDEDICNIAVSYFADLFTTLHPTNFDEVLREVHPVITA  385

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                 +LT  VT  EV+ A+F M    +PGPDG+ A FYQ  W+ VK  + + V     +G
Sbjct  386   EANAQLTARVTESEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGDLVSLVNGFFEEG  445

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
                  +  + I LIPK   P   ++ RPI+L NV +KIISK++  R++ ++ +LI   Q+
Sbjct  446   VFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLKKLLPDLISETQS  505

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+PGR  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++WEF++  L   GF
Sbjct  506   AFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWEFIDKLLHKMGF  565

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
              +  I  IMF V      +L NG+      P RGLRQGDPL+PYLFIL  E L  +I++ 
Sbjct  566   DEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKA  625

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
                K    I ++     ++HL FA+D + F + ++DQ   I+  L+ +   SG  IN +K
Sbjct  626   EAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAK  685

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
             S+I        + K  ++ + GI+    +G+YLG+P          F ++ + ++ +   
Sbjct  686   SSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFSFVRERLQGRTTG  745

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W   +LS  G+  +++S  +++P + M  F+LP    + +     +F W    +   +H 
Sbjct  746   WSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSDGRTGGMHW  805

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
             + W  +C SK  GGLG R   DFN+ALLAK  W+L+   D L+ ++++ +Y +N +    
Sbjct  806   LAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSDPMEP  865

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQ  3615
                 + S+GWRSI+  RS+V+ G   R+G+G S++ W+D W     P   + +    D  
Sbjct  866   IRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPFKDPS  925

Query  3616  SEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSV  3792
                K+S  I    R+W +D LS       +  I A P+  C +  D+L W  +  G ++V
Sbjct  926   --LKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPK-DDTLGWHFTKNGRYTV  982

Query  3793  RSAFSHIA-------------GNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMER  3933
             +S + H+A             G +  ++  S VWK+R   +   F+W ++ G +  +   
Sbjct  983   KSGY-HVARLTKTGPFKAVGVGPEITSLLAS-VWKVRCPPKLHHFMWQVLSGCIPVSRNL  1040

Query  3934  WRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNC  4113
              ++G++ D  C+ CG  +ET+NHVL  C  A+  W  +  PV  Q     P++S   N  
Sbjct  1041  RKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQVPVGSQ---CFPVESVFANMD  1097

Query  4114  CASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN  4254
                D  +       F +  W +WKARN ++FEN    P + +R A  
Sbjct  1098  HLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEG  1144



>ref|XP_007210729.1| hypothetical protein PRUPE_ppa021798mg [Prunus persica]
 gb|EMJ11928.1| hypothetical protein PRUPE_ppa021798mg [Prunus persica]
Length=1171

 Score =   504 bits (1299),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 348/1173 (30%), Positives = 541/1173 (46%), Gaps = 175/1173 (15%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVR--VSFAYVRPNRMAKERFWNDCLSYSSE  1116
               W  +IFN +++      I+  +    +N     +F Y  P +  +   W + +S    
Sbjct  161   LMWNPAIFNISILNYHECYINCELQDITTNKSWTTTFIYAYPQKAKQSNLWREIVSLKPT  220

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
              N PW+M+GDFN I    E+ G S        NF +    C ++ +  +GV ++W     
Sbjct  221   NNHPWLMLGDFNSICSMNEKVGGSFETSQAMRNFNKVIDDCEVVSLAATGVPFTWCNGHH  280

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
               T+   +LDRAL N +   L P ++   LP   SDH P+   C   +    +   F   
Sbjct  281   DNTIIYERLDRALANPDWMRLLPHSELQNLPIVRSDHGPIFLKCNQISRRIPKTFKFEAM  340

Query  1477  gAWLTREDYRDIWGRVWS-----NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQA  1641
               WL  +++  +  +VW+     N+   +    +   +  K WN+  FG++F +      
Sbjct  341   --WLAHKNFDQVVSQVWNCSYVGNAAQQIQTCCNTFKHQLKNWNRSVFGDLFHK------  392

Query  1642  RIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHK  1821
              ++  QE++                         EE+ + +K+R  W+Q GD+NT ++H 
Sbjct  393   -LRITQENL-------------------------EEVFYARKARANWLQLGDKNTKYFHT  426

Query  1822  STLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
               LIRR R++I  ++       D   I                          C   LD 
Sbjct  427   QALIRRKRNQILRVR-------DLNVIEP------------------------CVTSLDN  455

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                  L   ++  E++ A+  +    SPGPDG+QA FYQ  W + K  I           
Sbjct  456   ---ENLLAPISDLELECALKSIGPLKSPGPDGLQAIFYQKCWNKTKHLIKCL--------  504

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
                  I  + I  IPK  SPE+ + FRPI+  NVS+KII+K+IV+R+RPI+   I   Q 
Sbjct  505   ----DINHTNIAFIPKVASPESVNHFRPISFCNVSYKIITKIIVSRLRPILAKSISKNQG  560

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
             +F PGRS  DNI++T E+ H  + K G +G MAIK+DL KAYD +DW+++   L  FGF 
Sbjct  561   AFAPGRSIFDNILITHELFHDFKHKNGSRGAMAIKIDLEKAYDLLDWKYIRGCLNQFGFS  620

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
              +           +S S+L NG     F+  RG+RQGDPL+PY+FIL ME          
Sbjct  621   NDY----------TSFSMLINGSPYGHFKASRGIRQGDPLSPYIFILCMEPFIRHFNLLA  670

Query  2722  R-VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
             +  K    +  S+GG  +S+L FA+D ++FA+++    R I   L  F+  SG  IN+ K
Sbjct  671   QNSKTHVGLLSSQGGDRISNLVFADDCLIFAKSTAMAARNINCLLDNFAKVSGQRINLHK  730

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
             S ++ S N +S+ +  L NL  I     LG YLGI  +           ++D ++ K A 
Sbjct  731   STVYFSGNVHSQARNALSNLLQIQHKTTLGRYLGIHNIIFWKDPANAKMMIDRIRSKFAG  790

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             WK   LS AGR TL++++++S+P +T+  FK               F WG+S    KV  
Sbjct  791   WKAQTLSRAGRLTLIKASVTSVPNHTLSCFK--------------RFFWGNSI---KVPP  833

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
             V W DIC  +  GGLG+R    FN   LAKL W  +T     W ++M +KY+KN+    T
Sbjct  834   VAWKDICLPQSLGGLGVRSAALFNKTALAKLGWICLTDSSNWWAQIMLKKYLKNEGSLVT  893

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQS  3618
                 + S  W++I+  R ++  G  W +GNG S+ FW+  W    PL  +    IP    
Sbjct  894   AKKTSHSSTWKAILEARYVLHKGIRWIVGNGQSIPFWTANWVFPFPLLDL----IPVFLL  949

Query  3619  EAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRS  3798
              AKVSDFI  N+ WN DKLS ++  D+I+ I   P+ +   + D L W  +P   FS+  
Sbjct  950   NAKVSDFI-QNQAWNYDKLSQVIDDDVIEKILTIPLPL-YPLQDKLIWGPAPNRNFSI--  1005

Query  3799  AFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCG  3978
                                K++V                 +++ ++   +  +  C  C 
Sbjct  1006  -------------------KLQV----------------RSHLYKFLPNINPE--CPMCK  1028

Query  3979  DGDETMNHVLMECSFAKDCWRRTHH-----PVSFQYSLVTPLKSWVKNNCCASDWINGCP  4143
             +  ET+NH+  EC FA + WR T+        +F    +  L  + K    A+D  N   
Sbjct  1029  NHIETINHLFFECQFAVNIWRCTYFFPNYADQNFDGIELLALLPYTK----AADGPNVLS  1084

Query  4144  WGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWV  4323
               +     CW+IW+ARN  IF++    P+ ++  A  + LD  ++          K+  +
Sbjct  1085  KALLL---CWQIWEARNNCIFKDIDPHPVRVLNVAGRIGLDYWKINSCPPQKSTKKVN-I  1140

Query  4324  CWQPPETGWIKFNTDGAFKRNTGLASAGGLARD  4422
              W+PP   WIK N DG+ + N  LA+ G +  D
Sbjct  1141  KWEPPPLDWIKVNFDGSVRGN--LAATGFVILD  1171



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   508 bits (1307),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 339/1177 (29%), Positives = 557/1177 (47%), Gaps = 75/1177 (6%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
              RV++ Y    R  K  FW          N  W+  GDFN+I  + E+ G +S+N +R  
Sbjct  51    ARVTWVYGTAYRSEKLDFWRGMKERFRPTNILWLCGGDFNEILWDFEKSGGASLNYNRPR  110

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
                E  +   L+D+  +G  ++W     G+ V+ R LDR L N + Q+ +P    I    
Sbjct  111   YLEEFLNGTELMDLDFNGPCFTWRGMRNGQLVEER-LDRGLANRQWQDCWPNTMVIHETA  169

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVT  1572
               SDH P+  + +      +  + FRFE  W   E  +D          LD  G I+ + 
Sbjct  170   IGSDHIPI--IIQGHPRAVKTKKLFRFEAYWAKEERCKDTVEFKARGRELD--GLINRLG  225

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
              L   W K                     E +   ++R         +  L E+   EE 
Sbjct  226   VLQNNWRKN-------------------WEEIKRVSAR---------IDRLGEI---EEQ  254

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHISNFFI  1929
              W Q+SR  W+++GD NTAF+H+STL RR R+++  +K  NG+W  +   +  +I + F 
Sbjct  255   FWQQRSRVKWLKEGDANTAFFHQSTLQRRRRNKLVKIKDGNGDWIDNPSEVQKYIEDHFK  314

Query  1930  DLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAA  2109
             +LF      +         PK+       L + V++ E++ A   M    +PGPDG Q  
Sbjct  315   NLFSTSGSREWGRTLDCLQPKVSDEMNSGLIKPVSLEEIQTAALQMGGLKAPGPDGFQGI  374

Query  2110  FYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSF  2289
             FY +FW  +   +   V+  +     P ++  + I L+PK  +P++   FRPI+L N S+
Sbjct  375   FYHSFWNSLMDDVNGIVQDYMLGVSDPQRLNSTHIVLVPKISNPDSVGQFRPISLCNYSY  434

Query  2290  KIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGK-KGLMAIK  2466
             KI+SK++ NR++P++  +I P Q++F+ GR   DNI +  E+ H+++L+K K K  M +K
Sbjct  435   KIVSKILANRLKPLLSEIISPTQSAFVMGRQIQDNIGIAHEMFHFLKLRKAKSKFEMGVK  494

Query  2467  LDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLR  2646
             LD+HKAYD ++W+FLE+ +   GF     +L+M  V+    +++ NG+    F P RG+R
Sbjct  495   LDMHKAYDRVEWDFLEAVMEKLGFCSQWRNLVMGYVKTVEFAIILNGQPGKQFIPTRGIR  554

Query  2647  QGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASED  2826
             QGDPL+PYLFIL  E L   IQ+ V  +    I  + G   +SHLFFA+D ++F  A + 
Sbjct  555   QGDPLSPYLFILVGEVLDKLIQQAVERRMLMGIQPNYGCPIISHLFFADDTLIFMRADKK  614

Query  2827  QGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIP  3006
                 +   L  +   SG  +N  KS +F   N    +   L +  GI +++  G YLG+P
Sbjct  615   NCNSLKKILADYCSASGQLVNYQKSCLFFGANVPRCLSIELGHFVGIPLAEEPGKYLGLP  674

Query  3007  ILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGT  3186
                 R  K    ++ + +  K+  WK   LS AG+  ++++ + ++P Y M +FK P   
Sbjct  675   SFWGRSKKQGLAFVKERILAKVQGWKQYTLSQAGKEIMIKAVIQAIPAYPMHLFKFPTTL  734

Query  3187  CNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLV  3366
             C+D D +  +F WG S   K +H V    +   K   G+G R    FN+ALLAK  W+L+
Sbjct  735   CSDFDALIAEFWWGKSGGQKGIHWVSRGILGYPKQEEGMGFRNFQAFNDALLAKQCWRLI  794

Query  3367  TSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNF  3546
                + LW ++++ +Y  + +F    +   ASWGW S++ GR I+  GA W+I NG S+  
Sbjct  795   HDPNSLWAQLLKARYFPHCSFLDDSLGGRASWGWSSLLVGREILLRGAHWQIMNGRSIRL  854

Query  3547  WSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATP  3723
             W D W    P      V         +V+  I   + TWN++ +   +  +  + I  T 
Sbjct  855   WHDRWVPSIPAGKPTAVGGVRVSRNMRVNTLINDVSGTWNIEAIRPFISLEDFEAILDTS  914

Query  3724  IAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAM-----------DTSW--VWKMR  3864
             I    +  D L WP +  G +SV+S +     N    +              W  +W ++
Sbjct  915   IGDGLR-DDRLIWPATRNGVYSVKSGYHWKHANSSSMIGRPSASSSVIPGNVWKCIWHLK  973

Query  3865  VTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRR  4044
                + R F+W  +   L T    +++  +    C  C   DE++ H+L+ C + +  W  
Sbjct  974   TPPKVRNFMWRALSRALATMENLFKRRCSPSPCCPICLVQDESVEHMLLLCLWVEPIW--  1031

Query  4045  THHPVSFQYSLVTPLK--SWV----KNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
                P++++ +    L   +WV     ++  + D I      V F  TCW IWK R   ++
Sbjct  1032  FGGPLNYRVNRANILNFPAWVLSSLGSDLGSKDEIARILMNVAF--TCWFIWKTRCSFVY  1089

Query  4207  ENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRW--------VCWQPPETGWIKFN  4362
             +N    P  ++   +     +V  FL       G  +          CW PP   ++K N
Sbjct  1090  DNRGIYPNQVILSISK----SVNGFLEASVASEGHPQRNLSRPDPPACWGPPGHPFLKVN  1145

Query  4363  TDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSN  4473
              D +++ ++    AG + RDH G+++      IG SN
Sbjct  1146  VDASWEASSKSGFAGVVIRDHAGKFVAARRGWIGASN  1182



>ref|XP_010451822.1| PREDICTED: uncharacterized protein LOC104734004 [Camelina sativa]
Length=1120

 Score =   500 bits (1288),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 332/1079 (31%), Positives = 532/1079 (49%), Gaps = 41/1079 (4%)
 Frame = +1

Query  1087  WNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSG  1266
             W   L      ++PW  +GDFN++  N E+ G    +PS  L F      CG L+    G
Sbjct  3     WERLLRIGVSRSSPWFTVGDFNELTGNHEKRGGKLRHPSSFLPFNGMIQDCGFLEFPFLG  62

Query  1267  VSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpp  1446
                SW      + + R +LDRAL N +  +LFP+     LP   SDH P+  +   G   
Sbjct  63    DCLSWRGWRDKKPI-RCRLDRALGNEDWHDLFPDTVLEYLPMIASDHKPV--VVNIGAKR  119

Query  1447  rrenrpfrfegAWLTREDYRDIWGRVW----SNSLLDVVGAISEVTNLSKKWNKETFGNI  1614
              R  R F F+  W+ +E   +     W      S  + +  I        +W K+     
Sbjct  120   PRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPNFLDKIVICRRAISRWRKDHVP--  177

Query  1615  FGRKA--SLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQ  1788
             FGR+    L+ ++   Q     + +  L V+   L   L E  K EE+ W+ KSR  W+Q
Sbjct  178   FGRETIEDLKCQLSVAQA----DDATPLSVIA-DLNARLWEAYKDEEVYWYLKSRNKWMQ  232

Query  1789  DGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMDGS  1965
              GD+N+ ++H  T  RR R+RI  L    E W+++ + I +   ++F DLF   +  +  
Sbjct  233   MGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDEDICNIAVSYFADLFTTLHPTNFD  292

Query  1966  PNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSH  2145
                    P +      +LT  VT  EV+ A+F M    +PGPDG+ A FYQ  W+ VK  
Sbjct  293   EVLREVHPVITAEANAQLTARVTESEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGD  352

Query  2146  ITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMR  2325
             + + V     +G     +  + I LIPK   P   ++ RPI+L NV +KIISK++  R++
Sbjct  353   LVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLK  412

Query  2326  PIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDW  2502
              ++ +LI   Q++F+PGR  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++W
Sbjct  413   KLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEW  472

Query  2503  EFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFIL  2682
             EF++  L   GF +  I  IMF V      +L NG+      P RGLRQGDPL+PYLFIL
Sbjct  473   EFIDKLLHKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFIL  532

Query  2683  AMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKF  2862
               E L  +I++    K    I ++     ++HL FA+D + F + ++DQ   I+  L+ +
Sbjct  533   CTEVLIANIRKAEAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNY  592

Query  2863  SGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFG  3042
                SG  IN +KS+I        + K  ++ + GI+    +G+YLG+P          F 
Sbjct  593   EAASGQQINFAKSSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFS  652

Query  3043  YILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFL  3222
             ++ + ++ +   W   +LS  G+  +++S  +++P + M  F+LP    + +     +F 
Sbjct  653   FVRERLQGRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFW  712

Query  3223  WGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMR  3402
             W    +   +H + W  +C SK  GGLG R   DFN+ALLAK  W+L+   D L+ ++++
Sbjct  713   WSSDGRTGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILK  772

Query  3403  EKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPL  3579
              +Y +N +        + S+GWRSI+  RS+V+ G   R+G+G S++ W+D W     P 
Sbjct  773   GRYYRNSDPMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPR  832

Query  3580  AFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSL  3756
               + +    D     K+S  I    R+W +D LS       +  I A P+  C +  D+L
Sbjct  833   PALSKGPFKDPS--LKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPK-DDTL  889

Query  3757  YWPRSPTGAFSVRSAFSHIA-------------GNDEDAMDTSWVWKMRVTERCrlflwl  3897
              W  +  G ++V+S + H+A             G +  ++  S VWK+R   +   F+W 
Sbjct  890   GWHFTKNGRYTVKSGY-HVARLTKTGPFKAVGVGPEITSLLAS-VWKVRCPPKLHHFMWQ  947

Query  3898  lmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL  4077
             ++ G +  +    ++G++ D  C+ CG  +ET+NHVL  C  A+  W  +  PV  Q   
Sbjct  948   VLSGCIPVSRNLRKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQVPVGSQ---  1004

Query  4078  VTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN  4254
               P++S   N     D  +       F +  W +WKARN ++FEN    P + +R A  
Sbjct  1005  CFPVESVFANMDHLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEG  1063



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score =   513 bits (1320),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 339/1140 (30%), Positives = 542/1140 (48%), Gaps = 40/1140 (4%)
 Frame = +1

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             + P ++ GDFN+I    E++G +     +   F  +   C LLD+G  G  Y+W R    
Sbjct  335   HTPTVVFGDFNEIVSLTEKFGGAVRGERQMDAFRTTIDDCRLLDLGYKGSIYTWQRGISM  394

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
              T+ + +LDR L N E   +FP  + +  P   SDH P+            + + FRFE 
Sbjct  395   DTLVKERLDRYLANNEWCTMFPYREVLHYPIFKSDHAPILLKFGKDKTRYAKGKLFRFES  454

Query  1480  AWLTREDYRDIWGRVWSNSLL-DVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
              WL++ +   +  R W   +  D++  +  V      W K TFG++  R    + R+  +
Sbjct  455   LWLSKVECEQVVSRAWKAQVTEDIMARVEHVAGSLATWAKTTFGDVQKRIKDAERRLHNL  514

Query  1657  QESVFYNTSRGLQVLE-RKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLI  1833
             Q         G  + + R + +EL+E+   +E  W  ++R   ++DGDRNT+++H     
Sbjct  515   QA----KPPDGFILQQCRAIASELDELYNLKESYWHARARANELRDGDRNTSYFHHKASQ  570

Query  1834  RRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQM  2010
             RR R+ I+ +   +G W +  + +   I+ +F +LF   N  +         PK+ +   
Sbjct  571   RRKRNSIKGLFDRDGVWRTSKEELEGIITQYFDELFAAGNPCEMEAAVAGIEPKVTSRMN  630

Query  2011  HKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVP  2190
               L  E    E+K A+F+M    +PG DG+ A F+Q FW  V   +  FV+K  R     
Sbjct  631   QDLLNEPNGEEIKAALFEMHPNKAPGVDGMHALFFQKFWHVVGIDVINFVQKWWRGELEL  690

Query  2191  PKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFL  2370
               + ++ I LIPK  +P+  ++FRPI+L NV +KI+SK + N+++  +++LI   Q++F+
Sbjct  691   AGVNQTCIVLIPKCANPKYMTEFRPISLCNVIYKIVSKTMANKLKKCLESLISINQSAFV  750

Query  2371  PGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQN  2547
             P R   DN ++  EI HYM+ K +GK G +A+KLD+ KAYD ++W FLE  ++ FGF   
Sbjct  751   PKRLITDNALIAFEIFHYMKRKGEGKDGTVALKLDMSKAYDRVEWSFLEKVMLKFGFDVG  810

Query  2548  LISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRV  2727
              I  IM+ ++  S S   N        PGRGLRQGDP++PYLF+L  +  S  + +  R 
Sbjct  811   WIQKIMWCLQSVSFSFKLNNTVCGHVVPGRGLRQGDPISPYLFLLCADAFSMLLDKAARE  870

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
             +    + + RG   +SHLFFA+D +LFA A+  +   I + +K +   SG  +N+SK+++
Sbjct  871   RAIHGVRICRGAPRISHLFFADDSILFARANLRECSQIADIIKLYERASGQKVNLSKTDV  930

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
               S   +   +  + +  G+   D    YLG+P +  R  K  F  + + + +KL  WK 
Sbjct  931   AFSKKVSVARREEIVDTLGVREVDRHEKYLGLPTIIGRSKKAVFACLKERIWKKLTGWKE  990

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
              +LS  G+  L+++   ++P Y M +F+LP G  ++I  +   F WG +   KK+H   W
Sbjct  991   KLLSRPGKEVLIKAVAQAIPTYMMSIFRLPDGLIDEIHALFAKFWWGSNDVEKKMHWHNW  1050

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
               +C  K  GG+G R    FN A+LAK  W+L  +   L  KV + +Y K+  F      
Sbjct  1051  ESLCLPKAMGGMGFRDLKCFNQAMLAKQCWRLFENPHSLLYKVFKARYFKHDEFLTAHRG  1110

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              + S+ WRSI   +S++  G  WR+GNG+S+  W + W  D      ++V  P + +E  
Sbjct  1111  FDPSYSWRSIWGAKSLLLEGLRWRVGNGVSIKVWDEAWLADDD---ANKVPTPTAAAEPH  1167

Query  3628  --VSDFILPNRTW-NVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRS  3798
               VS+ I     W N  K+   +     D +   P++      D  +WP S TG + V+S
Sbjct  1168  ILVSELIDHELGWWNEAKVREQMVEADADRVLNIPLSKFWPRDDKFWWP-SKTGVYEVKS  1226

Query  3799  AF---------SHIAGNDEDAMDT-SWVWKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
              +         +   G     MD    VW +    + + F+W   +G L      + + +
Sbjct  1227  GYWMGRLGKTRAWQWGAGLIEMDLWKHVWAIEGPNKLKHFVWRACKGSLAVKERLFYRHI  1286

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ---YSLVTPLKSWVKNNCCA  4119
             T D LC  CG G ET+ H L  C  A + WR +      Q   +     L  W+      
Sbjct  1287  TPDNLCQICG-GIETIIHSLFYCKHAVEMWRHSRFRDEIQAAPHDSFAELFRWMITMLSK  1345

Query  4120  SDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKC-  4296
              D          F    W  W  RN  IFE T  +P  +      +  D  E   N  C 
Sbjct  1346  EDL-------RIFSTLAWAAWTCRNHEIFELTPPSPSHVATGYCKMVRDWCEHAANTSCP  1398

Query  4297  --VHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVS  4470
               +  G    V W  P+ GW+K N D     N  +   G + RD  G  L    T + V 
Sbjct  1399  GRLQSGIPSSVGWHKPDVGWVKVNVDAYVGPNR-VVGLGAVFRDSAGTLLMAAATRMNVE  1457



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   504 bits (1299),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 338/1180 (29%), Positives = 563/1180 (48%), Gaps = 69/1180 (6%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R+SF Y  P R  +  FWN       ++  PW+  GDFN++    E  G    +     +
Sbjct  63    RISFVYGEPKRELRHFFWNLLRRLHDQWRGPWLCCGDFNEVLCLDEHLGMRERSEPHMQH  122

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F      CGL+D+G  G  ++W  ++   +  + +LDRA+ N E    F +     +  T
Sbjct  123   FRSCLDDCGLIDLGFVGPKFTWSNKQDANSNSKVRLDRAVANGEFSRYFEDCLVENVITT  182

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrf---egAWLTREDYRDIWGRVWSNSLLDVVG----  1554
              SDH+ +       N  +R     +    E AWL  EDYR++    W  S    VG    
Sbjct  183   SSDHYAISIDLSRRNHGQRRIPIQQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRGV  242

Query  1555  --AISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLV-TEL  1725
                + +V    K W+K +FG++  +   ++ ++K +++S   +    + + E KL+  +L
Sbjct  243   WSVLQQVAVSLKDWSKASFGSVRRKILKMERKLKSLRQSPVND----VVIQEEKLIEQQL  298

Query  1726  NEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTI  1902
              E+ ++EE++  Q+SR  W+++GDRNTAF+H     RR  +RI+ +++ +G      + I
Sbjct  299   CELFEKEEIMARQRSRVDWLREGDRNTAFFHARASARRRTNRIKELVRDDGSRCISQEGI  358

Query  1903  SDHISNFFIDLFGRK------NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFD  2064
                   F+ +LF  +       ++D  PN      K+      +L ++ T  E+K A+F 
Sbjct  359   KRMAEVFYENLFSSEPCDSMEEVLDAIPN------KVGDFINGELGKQYTNEEIKTALFQ  412

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             M    +PGPDG  A FYQT W  ++ HI   V+  L    +P  + +S + LIPK ++  
Sbjct  413   MGSTKAPGPDGFPALFYQTHWGILEEHICNAVRGFLLGEEIPEGLCDSVVVLIPKVNNAS  472

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
               S FRPI+L NV +KI SKV+ NR++P + +++  FQ++F+PGR   D+ ++  E +H 
Sbjct  473   HLSKFRPISLCNVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRLITDSALVAYECLHT  532

Query  2425  MRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWN  2604
             +R +  K    A+K+D+ KAYD ++W +L   L   GF Q+ I+ +M  V     ++  N
Sbjct  533   IRKQHNKNPFFALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKIN  592

Query  2605  GEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLF  2784
             GE   P  P RG+RQGDP++PYLF+L  E LS  + +K      + I   R G  +SHL 
Sbjct  593   GELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLL  652

Query  2785  FAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTG  2964
             FA+D + FA+A     + + N L+ +   SG  IN+ KS+IF        +K  +K+   
Sbjct  653   FADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQ  712

Query  2965  ISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSM  3144
             +       +YLG+P      + + F ++ + + +++  W    LS AG  T++++   ++
Sbjct  713   VDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAI  772

Query  3145  PVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLD  3324
             P Y M  F++P   C  +     D  WG     KK+H   W+ +   K  GG+G R+   
Sbjct  773   PNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTT  832

Query  3325  FNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVEL  3504
             FN A+L +  W+L+T  D L  +V++ +Y  N +F+      + S+ WRS++ GR ++  
Sbjct  833   FNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQPKSPSFTWRSLLFGRELLAK  892

Query  3505  GAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RTWNVDKLS  3678
             G  W +G+G ++  +SD W  G +P         P   ++A VS  +  + R W+ D + 
Sbjct  893   GVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFP---TDATVSCLMNEDARCWDGDLIR  949

Query  3679  SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGND-----------  3825
             SL P DI   I   PI+     +D   WP    G +SVRSA+ ++A ++           
Sbjct  950   SLFPVDIAKEILQIPISR-HGDADFASWPHDKLGLYSVRSAY-NLARSEAFFADQSNSGR  1007

Query  3826  -------EDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDG  3984
                    E   D   +WK+    + ++ LW      L T  +  R+ +     C  C + 
Sbjct  1008  GMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECLATGFQLRRRHIPSTDGCVFC-NR  1066

Query  3985  DETMNHVLMECSFAKDCWR--RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTF  4158
             D+T+ HV + C FA   W   +    V    +  + ++ W+ +              VTF
Sbjct  1067  DDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTMRQWIFDFLKRGSSHANTLLAVTF  1126

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMR------W  4320
                 W IW+ARN     N    P  ++ +     L  V++ L      V   R       
Sbjct  1127  ----WHIWEARNNTKNNNGTVHPQRVVIK----ILSYVDMILKHNTKTVDGQRGGNTQAI  1178

Query  4321  VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWL  4440
               WQPP       N+D A   ++     G L RD+ G+ L
Sbjct  1179  PRWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCL  1218



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   504 bits (1299),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 338/1180 (29%), Positives = 563/1180 (48%), Gaps = 69/1180 (6%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R+SF Y  P R  +  FWN       ++  PW+  GDFN++    E  G    +     +
Sbjct  106   RISFVYGEPKRELRHFFWNLLRRLHDQWRGPWLCCGDFNEVLCLDEHLGMRERSEPHMQH  165

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F      CGL+D+G  G  ++W  ++   +  + +LDRA+ N E    F +     +  T
Sbjct  166   FRSCLDDCGLIDLGFVGPKFTWSNKQDANSNSKVRLDRAVANGEFSRYFEDCLVENVITT  225

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrf---egAWLTREDYRDIWGRVWSNSLLDVVG----  1554
              SDH+ +       N  +R     +    E AWL  EDYR++    W  S    VG    
Sbjct  226   SSDHYAISIDLSRRNHGQRRIPIQQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRGV  285

Query  1555  --AISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLV-TEL  1725
                + +V    K W+K +FG++  +   ++ ++K +++S   +    + + E KL+  +L
Sbjct  286   WSVLQQVAVSLKDWSKASFGSVRRKILKMERKLKSLRQSPVND----VVIQEEKLIEQQL  341

Query  1726  NEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTI  1902
              E+ ++EE++  Q+SR  W+++GDRNTAF+H     RR  +RI+ +++ +G      + I
Sbjct  342   CELFEKEEIMARQRSRVDWLREGDRNTAFFHARASARRRTNRIKELVRDDGSRCISQEGI  401

Query  1903  SDHISNFFIDLFGRK------NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFD  2064
                   F+ +LF  +       ++D  PN      K+      +L ++ T  E+K A+F 
Sbjct  402   KRMAEVFYENLFSSEPCDSMEEVLDAIPN------KVGDFINGELGKQYTNEEIKTALFQ  455

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             M    +PGPDG  A FYQT W  ++ HI   V+  L    +P  + +S + LIPK ++  
Sbjct  456   MGSTKAPGPDGFPALFYQTHWGILEEHICNAVRGFLLGEEIPEGLCDSVVVLIPKVNNAS  515

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
               S FRPI+L NV +KI SKV+ NR++P + +++  FQ++F+PGR   D+ ++  E +H 
Sbjct  516   HLSKFRPISLCNVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRLITDSALVAYECLHT  575

Query  2425  MRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWN  2604
             +R +  K    A+K+D+ KAYD ++W +L   L   GF Q+ I+ +M  V     ++  N
Sbjct  576   IRKQHNKNPFFALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKIN  635

Query  2605  GEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLF  2784
             GE   P  P RG+RQGDP++PYLF+L  E LS  + +K      + I   R G  +SHL 
Sbjct  636   GELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLL  695

Query  2785  FAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTG  2964
             FA+D + FA+A     + + N L+ +   SG  IN+ KS+IF        +K  +K+   
Sbjct  696   FADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQ  755

Query  2965  ISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSM  3144
             +       +YLG+P      + + F ++ + + +++  W    LS AG  T++++   ++
Sbjct  756   VDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAI  815

Query  3145  PVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLD  3324
             P Y M  F++P   C  +     D  WG     KK+H   W+ +   K  GG+G R+   
Sbjct  816   PNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTT  875

Query  3325  FNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVEL  3504
             FN A+L +  W+L+T  D L  +V++ +Y  N +F+      + S+ WRS++ GR ++  
Sbjct  876   FNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQPKSPSFTWRSLLFGRELLAK  935

Query  3505  GAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RTWNVDKLS  3678
             G  W +G+G ++  +SD W  G +P         P   ++A VS  +  + R W+ D + 
Sbjct  936   GVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFP---TDATVSCLMNEDARCWDGDLIR  992

Query  3679  SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGND-----------  3825
             SL P DI   I   PI+     +D   WP    G +SVRSA+ ++A ++           
Sbjct  993   SLFPVDIAKEILQIPISR-HGDADFASWPHDKLGLYSVRSAY-NLARSEAFFADQSNSGR  1050

Query  3826  -------EDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDG  3984
                    E   D   +WK+    + ++ LW      L T  +  R+ +     C  C + 
Sbjct  1051  GMASRLLESQKDWKGLWKINAPGKMKITLWRAAHECLATGFQLRRRHIPSTDGCVFC-NR  1109

Query  3985  DETMNHVLMECSFAKDCWR--RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTF  4158
             D+T+ HV + C FA   W   +    V    +  + ++ W+ +              VTF
Sbjct  1110  DDTVEHVFLFCPFAAQIWEEIKGKCAVKLGRNGFSTMRQWIFDFLKRGSSHANTLLAVTF  1169

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMR------W  4320
                 W IW+ARN     N    P  ++ +     L  V++ L      V   R       
Sbjct  1170  ----WHIWEARNNTKNNNGTVHPQRVVIK----ILSYVDMILKHNTKTVDGQRGGNTQAI  1221

Query  4321  VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWL  4440
               WQPP       N+D A   ++     G L RD+ G+ L
Sbjct  1222  PRWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCL  1261



>ref|XP_010506884.1| PREDICTED: uncharacterized protein LOC104783422 [Camelina sativa]
Length=1248

 Score =   501 bits (1290),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 332/1079 (31%), Positives = 532/1079 (49%), Gaps = 41/1079 (4%)
 Frame = +1

Query  1087  WNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSG  1266
             W   L      ++PW  +GDFN++  N E+ G    +PS  L F      CG L+    G
Sbjct  3     WERLLRIGVSRSSPWFTVGDFNELTGNHEKRGGKLRHPSSFLPFNGMIQDCGFLEFPFLG  62

Query  1267  VSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpp  1446
                SW      + + R +LDRAL N +  +LFP+     LP   SDH P+  +   G   
Sbjct  63    DCLSWRGWRDKKPI-RCRLDRALGNEDWHDLFPDTVLEYLPMIASDHKPV--VVNIGAKR  119

Query  1447  rrenrpfrfegAWLTREDYRDIWGRVW----SNSLLDVVGAISEVTNLSKKWNKETFGNI  1614
              R  R F F+  W+ +E   +     W      S  + +  I        +W K+     
Sbjct  120   PRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPNFLDKIVICRRAISRWRKDHVP--  177

Query  1615  FGRKA--SLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQ  1788
             FGR+    L+ ++   Q     + +  L V+   L   L E  K EE+ W+ KSR  W+Q
Sbjct  178   FGRETIEDLKCQLSVAQA----DDATPLSVIA-DLNARLWEAYKDEEVYWYLKSRNKWMQ  232

Query  1789  DGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMDGS  1965
              GD+N+ ++H  T  RR R+RI  L    E W+++ + I +   ++F DLF   +  +  
Sbjct  233   MGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDEDICNIAVSYFADLFTTLHPTNFD  292

Query  1966  PNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSH  2145
                    P +      +LT  VT  EV+ A+F M    +PGPDG+ A FYQ  W+ VK  
Sbjct  293   EVLREVHPVITAEANAQLTARVTESEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGD  352

Query  2146  ITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMR  2325
             + + V     +G     +  + I LIPK   P   ++ RPI+L NV +KIISK++  R++
Sbjct  353   LVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLK  412

Query  2326  PIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDW  2502
              ++ +LI   Q++F+PGR  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++W
Sbjct  413   KLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEW  472

Query  2503  EFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFIL  2682
             EF++  L   GF +  I  IMF V      +L NG+      P RGLRQGDPL+PYLFIL
Sbjct  473   EFIDKLLHKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFIL  532

Query  2683  AMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKF  2862
               E L  +I++    K    I ++     ++HL FA+D + F + ++DQ   I+  L+ +
Sbjct  533   CTEVLIANIRKAEAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNY  592

Query  2863  SGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFG  3042
                SG  IN +KS+I        + K  ++ + GI+    +G+YLG+P          F 
Sbjct  593   EAASGQQINFAKSSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFS  652

Query  3043  YILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFL  3222
             ++ + ++ +   W   +LS  G+  +++S  +++P + M  F+LP    + +     +F 
Sbjct  653   FVRERLQGRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFW  712

Query  3223  WGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMR  3402
             W    +   +H + W  +C SK  GGLG R   DFN+ALLAK  W+L+   D L+ ++++
Sbjct  713   WSSDGRTGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILK  772

Query  3403  EKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPL  3579
              +Y +N +        + S+GWRSI+  RS+V+ G   R+G+G S++ W+D W     P 
Sbjct  773   GRYYRNSDPMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPR  832

Query  3580  AFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSL  3756
               + +    D     K+S  I    R+W +D LS       +  I A P+  C +  D+L
Sbjct  833   PALSKGPFKDPS--LKISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPK-DDTL  889

Query  3757  YWPRSPTGAFSVRSAFSHIA-------------GNDEDAMDTSWVWKMRVTERCrlflwl  3897
              W  +  G ++V+S + H+A             G +  ++  S VWK+R   +   F+W 
Sbjct  890   GWHFTKNGRYTVKSGY-HVARLTKTGPFKAVGVGPEITSLLAS-VWKVRCPPKLHHFMWQ  947

Query  3898  lmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL  4077
             ++ G +  +    ++G++ D  C+ CG  +ET+NHVL  C  A+  W  +  PV  Q   
Sbjct  948   VLSGCIPVSRNLRKRGISCDLSCSRCGAEEETVNHVLFLCPPARQVWALSQVPVGSQ---  1004

Query  4078  VTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN  4254
               P++S   N     D  +       F +  W +WKARN ++FEN    P + +R A  
Sbjct  1005  CFPVESVFANMDHLLDPNSPGSHVSAFPWILWYLWKARNAKVFENITERPEETVRIAEG  1063



>ref|XP_009103791.1| PREDICTED: uncharacterized protein LOC103829852 [Brassica rapa]
Length=1374

 Score =   503 bits (1294),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 346/1176 (29%), Positives = 551/1176 (47%), Gaps = 69/1176 (6%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +SF Y  P    KE  W   + Y    NA W  +GDFN+I  N E+ G  S +     +F
Sbjct  103   MSFVYGVPGHSGKEIVWERLMRYGVSRNAGWSWVGDFNEILHNGEKIGGPSRSDGSFDSF  162

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
              +  S CG+ ++   G S++W      + +Q  KLDR   N E +  FP A  + L R  
Sbjct  163   RDCVSVCGMTELSGWGDSFTWSGVRCKKYIQS-KLDRCFGNTEWKRNFPLATQVFLERLG  221

Query  1399  SDHHPL--KFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVT  1572
             SDH P+  +       P        R  G    RE   + W R   N    +      V 
Sbjct  222   SDHKPVLVRLFGHQSGPRGSFKFDKRMVGKQKVRECIMEAWKRQNGNDQRSLSERFGCVR  281

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
                 +W +E   N   R   L+  ++    S   +  +      + L  E+++  + EE 
Sbjct  282   RSLGRWKRECSNNSKERLCGLRYDLEAEYSSGVPDWGK-----IKFLKLEISQAFRDEEE  336

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFI  1929
              W QKSR  W+  GD NT+F+H S    R R++I +++  +G+  ++ + +      +F 
Sbjct  337   FWRQKSRDKWLVAGDNNTSFFHASVKDTRLRNQISKLIDDSGQEATNTEAMGQVAVEYFT  396

Query  1930  DLFGRKNIMDGSPNDMYCG-PKLDTGQMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQ  2103
              LF   +   G P+D++ G P   T +M++ L REV+  E++ AVF +K   +PG DG+ 
Sbjct  397   SLFS--SGAGGDPSDIFDGFPARVTAEMNRTLLREVSDAEIRDAVFGIKSSSAPGWDGLN  454

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNV  2283
               F+Q +W+ +   I   +K    DG  P     + + LIPK  +PE   D RPI+L  +
Sbjct  455   GLFFQKYWDIIGLDIGKEIKTFFSDGSFPRDWNVTQLCLIPKVINPERMVDLRPISLCTI  514

Query  2284  SFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMA  2460
              +KIIS+++V+R++P+++ ++ P Q++F+P R  +DNII+  E+VH +R  +      +A
Sbjct  515   MYKIISRILVSRLKPMLETVVSPTQSAFVPERLISDNIIIAHEVVHGLRTHQAISSEFIA  574

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
             IK D+ KAYD I+W +LE+ L   GF +  +  IMF V   + S+L NGE+     P RG
Sbjct  575   IKTDMSKAYDRIEWRYLENLLTALGFDKKFVDWIMFCVTSVTYSVLINGEEKGNINPKRG  634

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEAS  2820
             LRQGDPL+P+LF L  E LS+ + +   +   + I  S  G  + HLFFA+D  L  +AS
Sbjct  635   LRQGDPLSPFLFDLCTEGLSYLLNKAESMGEIEGIKFSAEGPVIHHLFFADDSFLMVKAS  694

Query  2821  EDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLG  3000
             ++Q   + + LK +   SG  I+++KS+I          K  +K + GI      G YLG
Sbjct  695   DEQCTKLRSILKVYEENSGQMISLTKSSITFGAKIAPSRKVKIKEILGIEAEGGTGKYLG  754

Query  3001  IPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPA  3180
             +P            YI + MK +   W G  LS  G+  L+++   +MPV+ M VFKLP 
Sbjct  755   LPECFSGSKVEMLQYIQEKMKSRFHGWYGRFLSAGGKDILLKTVAMAMPVFAMSVFKLPK  814

Query  3181  GTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQ  3360
              TC ++      F W       K+H + W  +C  K+ GG+G R    FN ALLAK  W+
Sbjct  815   TTCKNLTSAMSKFWWDVQEGKSKIHWISWEKLCLGKNQGGMGFRDIEKFNQALLAKQGWR  874

Query  3361  LVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSL  3540
             L+   + L  + +R +Y  N  F    + A  S+ WRSI+ GR ++E G    IG+G   
Sbjct  875   LLMDSESLCARFLRSRYYPNGKFMEASLGARPSYAWRSILFGRQLLEKGLRRTIGSGEDT  934

Query  3541  NFWSD-WWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RTWNVDKLS-SLLPHDIIDGI  3711
             + W D W   + P+A + +      + + +VS+ I P  ++W+  KL  +  P D+   +
Sbjct  935   SVWWDKWLFSESPMAPLRKPIF--FEVDLRVSELINPQTKSWDRGKLEDNFFPPDVERIL  992

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW------------VW  3855
             +  P+       DS  W  +  G ++V+S +   +  D                    VW
Sbjct  993   KQRPVW---GEKDSYEWVHTHWGGYTVKSGYWLASCLDSSETRRECLAQPSIHGLLEKVW  1049

Query  3856  KMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDC  4035
             K++   + R+F+W  +   L  N     +G+  D  C  CG   E++NHVL  C  A+  
Sbjct  1050  KVKTVPKIRVFMWKALSNALSVNDGLLARGLKIDPRCQRCGMEGESINHVLFTCPAARLV  1109

Query  4036  WRRTHHPV------------SFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEI  4179
             W +++ P             +F Y L  P    V +             G  F +  W I
Sbjct  1110  WAQSNFPFPRRGFENMTLFENFNYLLFLPRYLQVPDEI-----------GRMFPWILWTI  1158

Query  4180  WKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVH--------VGKMRWVCWQP  4335
             WK RN  +FE       D M +      D+   F  ++C+           + R   W+ 
Sbjct  1159  WKNRNLFLFEGKEFTAEDTMAKVFE---DSGHWFAAQRCLEEEDEAENRASRAR-DKWEG  1214

Query  4336  PETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
             P +G++K N    + +      A  + R+  GE L 
Sbjct  1215  PSSGFLKCNVGLQWSKREKALGAAWVLRNEGGETLL  1250



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score =   511 bits (1316),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 354/1236 (29%), Positives = 571/1236 (46%), Gaps = 99/1236 (8%)
 Frame = +1

Query  943   FFWRSSIF-NFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              FW  SIF +   +       +  +S       V+F Y  P    + R W+  L      
Sbjct  671   LFWHESIFMDVKSVNERYVDAYMRLSPEDPLCHVTFVYGEPRVENRHRLWSRLLDLKQSS  730

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               PW+++GDFN+     E +  S    ++   F +    C L+D+G SGV Y++  +  G
Sbjct  731   PLPWMIIGDFNETLWQFEHFSVSKRGEAQMRAFRDVLQICELVDLGFSGVPYTYDNRREG  790

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             R+  + +LDRAL +   ++++  ++ + L  + SDH P+     A +      + F +E 
Sbjct  791   RSNVKVRLDRALADNSWRDIYSNSQVVHLTSSCSDHCPILLKFAADSRQSNRKKCFHYEI  850

Query  1480  AWLTREDYRDIWGRVWSN-----SLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
              W       ++    W+      +L D+   + +V    + W+K  F N+   +A  +AR
Sbjct  851   CWEREPASTEVISLAWAEVGEKRTLGDINFTLGKVMGALQGWSKVKFKNV--SRAIEKAR  908

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
              K +   V +N         R+    LNE+L +EE+LW Q+SR  W+++           
Sbjct  909   -KDLATLVSHNADYSEI---RRSSDVLNELLYREEMLWLQRSRISWLKE-----------  953

Query  1825  TLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTG  2004
                   +S   M KI               +++F D+F     +D S        K+   
Sbjct  954   -----VKSTHEMEKIE--------------TDYFKDMFTADPCIDQSRVSRLFQEKVSPE  994

Query  2005  QMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGR  2184
                 L ++ T  E+  A+F +    +PG DG  A F+Q  W+ +K  + + VK       
Sbjct  995   MNVDLCKDFTEQEIADALFQIGPIKAPGLDGFPARFFQRNWDAIKKDVVSAVKSFFETSI  1054

Query  2185  VPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNS  2364
             +P  + ++ I LIPK D P    DFRPI+L NV +KI+SK +VNR+RPI+  L+   Q++
Sbjct  1055  MPEGVNDTAIVLIPKVDQPMELKDFRPISLCNVIYKIVSKCLVNRLRPILDELVSQNQSA  1114

Query  2365  FLPGRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
             F+PGR   DN +L  E  H++ R K   K   A KLDL KAYD +DW FLE T+   GF 
Sbjct  1115  FVPGRMITDNALLAFECFHFIQRNKNANKAACAYKLDLSKAYDRVDWVFLEQTMCKLGFA  1174

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
                I  IM  +     S+ +NG  L  F P RGLRQGDPL+P+LF+   +  S  ++E+V
Sbjct  1175  PRWIKWIMTCLSSVRYSIKFNGTLLDTFAPSRGLRQGDPLSPFLFLFVADGFSRLMEERV  1234

Query  2722  RVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKS  2901
                +  P+ + RG  G+SHL F +D +LF +A  +Q R+I   L +++  +G  +N +K 
Sbjct  1235  AAGDITPVKICRGALGISHLLFVDDTLLFFKADCEQARLIKGVLNEYALGTGQLVNPNKC  1294

Query  2902  NIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANW  3081
             +I     +++E +  +KNL  I   +    YLG P    R++K  F  + + M +++  W
Sbjct  1295  SILFDDTSHAETQDAIKNLLQIVCHNFEDKYLGFPTPEGRLNKGKFQSLQEKMWKRIILW  1354

Query  3082  KGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLV  3261
               N LS  G+  +++  + ++PVY M +F+LP   C D++++ R+F WG     +K H  
Sbjct  1355  GENYLSSGGKEIMLKVVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWGADKGKRKTHWR  1414

Query  3262  GWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATP  3441
              W+ + K K  GGL  R    FN ALLA+ AW+L+   D L  +VM+ KY  N +   T 
Sbjct  1415  AWSCLTKPKHNGGLAFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKYYPNGSLVDTA  1474

Query  3442  MIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSE  3621
                NAS GWR+I  G ++++ G  WRIGNG S+  W D W    P               
Sbjct  1475  FGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWI---PRDHSCRPITTKRNCR  1531

Query  3622  AK-VSDFILPNRTWNVDKLSSL-LPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVR  3795
              K VSD +  + +W+V K+S + LP D  + ++       E+  D L W     G FSVR
Sbjct  1532  VKWVSDLLGQDGSWDVQKVSRVFLPIDADEILKIRTSVRLEE--DFLSWHPDRLGQFSVR  1589

Query  3796  SAFS-HIAGNDEDAMDTS----------WVWKMRVTERCrlflwllmrgrllTNMERWRK  3942
             SA+   I+ +  D   +S           +WK  V ++ ++F W      L     + ++
Sbjct  1590  SAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKVKVFCWRAANNCLANQENKKKR  1649

Query  3943  GMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCAS  4122
              +    +C  CG+  E ++H L  C  A   W       S   +        V  N    
Sbjct  1650  NLERSEICCICGNETEDVSHALSRCPHAVHLWEAMKAAGSLSLN--------VAGNATGG  1701

Query  4123  DW----INGCPWG--VTFIYTCWEIWKARNQ--------------RIFENTASAPMDIMR  4242
              W    I   P    +      W IW  RN+              R  E+  S+ ++I +
Sbjct  1702  SWFFDQIENTPAEERMMLCMMLWRIWFVRNELYHGKVPPPIAVSKRFLESYCSSLLEIKQ  1761

Query  4243  RANNLTLDTVEVF-----LNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAG  4407
               +   +    V      +  +  H+ ++    W+ P+ GW+K N DG++  N+     G
Sbjct  1762  HPHADVVRGKHVVQQPTRMRSEANHLRRVVPARWEKPQMGWMKLNVDGSYDSNSSKGGIG  1821

Query  4408  GLARDHKGEWLF---GFMTNIGVSNSFAAELWGLRE  4506
              + RD  G  +F   GF+     S+   +EL   +E
Sbjct  1822  VVLRDSVGTVIFSACGFLER--CSSPLESELLACKE  1855



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score =   507 bits (1306),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 353/1206 (29%), Positives = 570/1206 (47%), Gaps = 65/1206 (5%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+ S+ + +V       +   V     +  ++  Y  PN   + + W     +     
Sbjct  536   LFWKKSV-DISVYYEDKNLLDLAVQFGEYSSFLTCVYGNPNFCYRYQVWERLTRFGLSRK  594

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
               W M+GDFN+I +N+E+ G    + +  L F      CG+ ++ +SG  ++W  + G  
Sbjct  595   GNWCMIGDFNEILNNEEKLGGPRRSDNSFLPFSTMLKDCGMSELPSSGNGFTWGGRRGTH  654

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +Q  KLDR   N +  + FP A    LP+  SDH P+  L    +        FRF+  
Sbjct  655   WIQS-KLDRCFANKDWVSCFPAANQAFLPKRGSDHRPI--LVSLVSSQDLYRGSFRFDKR  711

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISE----VTNLSKKWNKETFGNIFGRKASLQARIK  1650
              L +   ++    VW  S +     +S+       +  KW KE   N   +  ++Q  ++
Sbjct  712   LLHKPGVKEAISMVWRQSAISAPAPVSQRIRDCRRVLSKWKKENEMNSKVKIIAIQNELE  771

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
              VQ S   + SR L+ L+ KLV    E  K+EE  W QKSR  W+ +GDRNT F+H S  
Sbjct  772   LVQSSSDPSASR-LRSLKNKLV----EANKEEESHWQQKSRDKWMLEGDRNTKFFHASVK  826

Query  1831  IRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQ  2007
               R+++ +  L+  NG  +    +  +  +++F +LF   + +D         P++    
Sbjct  827   NLRSKNGLDKLQDPNGIVHRSEASKGEVAASYFQNLFSTSSPVDIQAMLEGVTPRVTDVM  886

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
                L  +V+  EVK AVF +    +PG DG+   F+Q +W+ V   +T+ V      G  
Sbjct  887   NQSLLAKVSKEEVKNAVFSINPSKAPGADGMTGMFFQQYWDIVGHQVTSEVLAFFDSGIF  946

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
             P +   + + LIPKK +    SD RPI+L +V +K+++K+I++R++P++  ++ P Q++F
Sbjct  947   PKEWNFTQLCLIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIVSPNQSAF  1006

Query  2368  LPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             +P R  +DNI++  E +H +R  K   K  MA+K D+ KAYD ++W +LE+ ++  GF Q
Sbjct  1007  IPERLISDNILIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALMLGLGFHQ  1066

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
               + L+MF V   + ++L NG+      P RGLRQGDPL+P LF+L  E L+  + +   
Sbjct  1067  RWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHLLNKAES  1126

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
                   I  S  G  + HL FA+D +   +ASEDQG  +   L  +   +G  IN+ KS+
Sbjct  1127  EGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSS  1186

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             I         +K  +    GI      GTYLG+P            YI D MK +++ W 
Sbjct  1187  ITFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMSGWF  1246

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
                LS  G+  L++S   +MPV+ M  FKLP  TC ++      F W  +   KK+H + 
Sbjct  1247  ARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKKKMHWIS  1306

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  +C  K AGGLG +    FN ALL+K AW+++   D L+ +  + +Y  + +F +  +
Sbjct  1307  WEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFLSATL  1366

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPL--AFMDEVTIPDSQS  3618
                 S+ WRSI+ GR +++ G    IG+G S   WS  W  D  +    M  +       
Sbjct  1367  GYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNILF---DL  1423

Query  3619  EAKVSDFI-LPNRTWNVDKLS-SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSV  3792
             +  V D +    ++W++ KL     P D+   ++  P+   E   D L W  + +GA+SV
Sbjct  1424  DLMVKDLLDTTTQSWDLAKLQYHFYPRDVELILKIKPVMSSE---DYLIWEHTKSGAYSV  1480

Query  3793  RSAF------SHIAGNDEDAMDTS------WVWKMRVTERCrlflwllmrgrllTNMERW  3936
             +S +        I    E  M  S       +WK+    + R FLW ++ G +    +  
Sbjct  1481  KSGYWAAYQREKIDLLTEALMQPSVLPIKNQIWKISTATKIRNFLWKVVSGAIPVADKML  1540

Query  3937  RKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVS---------FQYSLVTPL  4089
              +GM  D+ C +CG   E++NHVL  C+ A+  W   + PV          FQ      L
Sbjct  1541  SRGMKVDSRCQSCGLEGESVNHVLFSCTVARQVWAMFNFPVPCNGFDSESVFQNIYYLLL  1600

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTA-SAPMDIMRRANNL---  4257
              S  KN+    +     PW        W++WK RN   FE  +  A   I +  +N    
Sbjct  1601  VS--KNSKYPVEVRTAFPW------VLWQLWKNRNLFSFEGRSFCASRTIAKIRDNASQW  1652

Query  4258  ----TLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDH  4425
                 +L   +  + +    +GK  W    PP  GW K N   ++ + T    A  + R+ 
Sbjct  1653  FHVQSLTAADAIIERSKADLGKKGWY---PPVQGWKKCNLGSSWDKETSTGGAAWVLRNK  1709

Query  4426  KGEWLF  4443
             KGE L 
Sbjct  1710  KGETLM  1715



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score =   506 bits (1302),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 334/1181 (28%), Positives = 559/1181 (47%), Gaps = 66/1181 (6%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             V+F Y  P    + R W+   +     + PW ++GDFN+     E +  +     +  +F
Sbjct  229   VTFVYGEPRVENRHRMWSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDF  288

Query  1219  VESFSACGLLDMGTSGVSYSW-FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
              +    C L D+G  GV +++  ++EG R V+ R LDR + + + ++++  A+ + L   
Sbjct  289   RDVLQDCELHDLGFKGVPHTYDNKREGWRNVKVR-LDRVVADDKWRDIYSTAQVVHLVSP  347

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-----SNSLLDVVGAI  1560
              SDH P+       +P +   +   +E  W    +   +    W        L D+  A+
Sbjct  348   CSDHCPILLNLVVKDPHQLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKAL  407

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
             ++V    + W++    N+ GR+  L+   K + E +  N  R    + R     +NE+L 
Sbjct  408   AKVMTALRSWSRAKVKNV-GRE--LEKARKKLAELIESNADR---TVIRNATDHMNELLY  461

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             +EE+LW Q+SR  W++D DRNT F+H   + R  +++I  L+  N   +S    +    +
Sbjct  462   REEMLWLQRSRVNWLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMAT  521

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
              +F D++     ++          K+      KL  + T  E+ +A+F +    SPGPDG
Sbjct  522   EYFQDVYTADPNLNPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDG  581

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A FYQ  W  +K+ I   V++  + G +P  + ++ I LIPKK+ P    DFRPI+L 
Sbjct  582   FPARFYQRNWGTIKADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLC  641

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGL  2454
             NV +K++SK +VNR+RPI+ +L+   Q++F+ GR   DN +L  E  H M+  KK     
Sbjct  642   NVVYKVVSKCLVNRLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAA  701

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
              A KLDL KAYD +DW FLE  +   GF +  ++ IM  V      + +NG  L  F P 
Sbjct  702   CAYKLDLSKAYDRVDWRFLEMAMNKLGFARRWVNWIMKCVTSVRYMVKFNGTLLQSFAPT  761

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RGLRQGDPL P+LF+   + LS  ++EKV   +  P  + R   G+SHL FA+D +LF +
Sbjct  762   RGLRQGDPLLPFLFLFVADGLSLLLKEKVAQNSLTPFKVCRAAPGISHLLFADDTLLFFK  821

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A + +  ++   L  ++  +G  IN +K +I     +   +   +  +  +        Y
Sbjct  822   AHQREAEVVKEVLSSYAMGTGQLINPAKCSILMGGASTPAVSEAISEILQVERDRFEDRY  881

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG P    R+ K  F  +   + +++  W  N LS  G+  L+++ + ++PVY M +FKL
Sbjct  882   LGFPTPEGRMHKGRFQSLQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKL  941

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P    +D+ ++ ++F W      +K H   W+ + K K  GGLG R    FN ALLA+ A
Sbjct  942   PESVIDDLTKLTKNFWWDSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQA  1001

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+L+T  D L  +V++ KY  + +   T   +N+S  WRSI  G  +++ G  WR+GNG 
Sbjct  1002  WRLITYPDSLCARVLKAKYFPHGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGN  1061

Query  3535  SLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILPNRTWNVDKLSSLLPHDIIDGI  3711
             S+  W D W    P           +    K VSD I  + +W+V K+     H++   +
Sbjct  1062  SIRIWRDSWL---PRDHSRRPITGKANCRLKWVSDLITEDGSWDVPKIHQYF-HNLDAEV  1117

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAG--NDEDA-------MDTSW--VWK  3858
                         D + W     G FSVRSA+   A   N E++       ++ +W  +WK
Sbjct  1118  ILNICISSRSEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWK  1177

Query  3859  MRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
              +V ++ ++F W +    L T + + ++ + +  +C  C   +E   H L  C  A   W
Sbjct  1178  CKVPQKVKIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLW  1237

Query  4039  RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGV------TFIYTCWEIWKARNQR  4200
                H   S            +K +     W+  C   +       F+ T W  W  RN+ 
Sbjct  1238  SCMHKSGSVSVD--------IKASVLGRFWLFDCLEKIPEYEQAMFLMTLWRNWYVRNEL  1289

Query  4201  IFENTASAPMDIMRRANNLTLDTV---------EVFLNKKCVHVGKMR-----------W  4320
             I   +A  P +  +R     +D +         ++   K  V    ++            
Sbjct  1290  IHGKSA-PPTETSQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQ  1348

Query  4321  VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
              CW+ P+ GW+K N DG+F  ++G    G + R+  G+ +F
Sbjct  1349  PCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIF  1389



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   502 bits (1292),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 359/1190 (30%), Positives = 557/1190 (47%), Gaps = 47/1190 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
             F  +    +F ++  +   I G V       R    Y  P    K R W        EF+
Sbjct  260   FTGKKEAIDFTLVSFSKNHICGDVVRRGERWRFVGVYGWPEESNKHRTWELIRHLCLEFD  319

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              P ++ GDFN+I    E+ G +         F E    CGL D+   G  Y+W R +   
Sbjct  320   GPLVLGGDFNEILSYDEKQGGADRERRAMRGFREVIDTCGLRDLRAVGQWYTWERGDSPE  379

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             T  R +LDR L +     LFPEA    L R  SDH  +    +A    +   R F+FE  
Sbjct  380   TRIRERLDRFLVSQTWLQLFPEAVVEHLVRYKSDHAAIVLKTQAPKMKQCHMRQFKFETK  439

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGA-ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
             WL  E         W  S+ D + + +  V      W+K   G++  +   ++ ++   Q
Sbjct  440   WLLEEGCEATVREAWDGSVGDPIQSRLGVVARGLVGWSKAGSGDLAKKIDRVEKQLHNAQ  499

Query  1660  -ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
              E +   T +    LE+    EL+ +  + E  W+ +SR   I+DGDRNT+++H     R
Sbjct  500   KEEISETTCKKCGELEK----ELDSLNAKLEAHWYMRSRVAEIKDGDRNTSYFHHKASQR  555

Query  1837  RNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDM--YCGPKLDTGQ  2007
             + R+RI+ +   +GEW  + + +   +  +F ++F   +   G+ +++  +    + T  
Sbjct  556   KKRNRIKGLFDEHGEWREEEEELERLVQKYFREIFTSSDPSTGAMDEVLQFVKKSVTTEF  615

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
                L +  +  E+ +A+  M    +PGPDG+ A FYQ FW  +   +  FV  +L     
Sbjct  616   NDILLKPYSKEEIHEALKQMHPCKAPGPDGLHAIFYQRFWHIIGDEVFHFVSNILHSYCC  675

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
             P  +  + I LIPK  +P   S+FRPI+L NV +KI SK +V R++  + +++   Q++F
Sbjct  676   PSSVNCTNIALIPKVKNPTLVSEFRPISLCNVLYKIASKALVLRLKQFLPDIVTENQSAF  735

Query  2368  LPGRSTADNIILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             +PGR   DN ++  EI H M+ +   +KGL+A+KLD+ KAYD ++W FL   L+  GF  
Sbjct  736   VPGRLITDNSLIALEIFHSMKKRNNSRKGLIAMKLDMSKAYDRVEWGFLRKLLLTMGFDG  795

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
               ++L+M  +   S S L NG       P RGLRQGDPL+P+LFIL  +  S  IQ+KV 
Sbjct  796   RWVNLVMSCISSVSYSFLINGRAGGSVTPSRGLRQGDPLSPFLFILVADAFSQMIQQKVL  855

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
              K       SR G  +SHL FA+D +LF  A+  +   I++ L K+   SG  IN  KS 
Sbjct  856   SKELHGAKASRSGPEISHLLFADDSLLFTRATRQECLKIVDILNKYEAASGQKINYEKSE  915

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             +  S   N   +  L  +  +   D    YLGIP L  R  K  F  +LD + +KL  WK
Sbjct  916   VSFSKGVNCVQRESLSGILQMRQVDRHQKYLGIPTLWGRSKKGMFRDLLDRVWKKLRGWK  975

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
               +LS AG+  L+++ + S+P Y M V+K P     +I      F WG     +K+H V 
Sbjct  976   EKLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQEIHSAMARFWWGGKGMERKMHWVS  1035

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  + K K  GG+G +    FN+ALL +  W+L+   + L  +V+  KY  + +     +
Sbjct  1036  WEKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYKNSLLSRVLSAKYYPDGDVLQARL  1095

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA  3624
               + S+ WRSI   +S+V+ G  WR+G G ++N WSD W GD+   F     I  +++E 
Sbjct  1096  GFSNSFSWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDERGRF-----ILSNRAEG  1150

Query  3625  --KVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVR  3795
                VSD I    + W  + +           I + P++   +  D L W  S  G +SV+
Sbjct  1151  LNTVSDLIDDTTKEWKFEAIEQHFGERDQQCILSIPLS-SRETEDVLTWAYSKDGLYSVK  1209

Query  3796  SAFSHIAGNDEDAMDTSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCA  3969
             +A+    G + +    +WV  W + V+ + R FLW      L T      + + E+  C 
Sbjct  1210  TAYMIGKGGNLEDFHKAWVVLWGLDVSPKVRHFLWRYCTSSLPTRATLMARHLLEEGGCP  1269

Query  3970  TCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTP----LKSWVKNNCCASDWIN-  4134
              C    ET  H +  C+  +  W             V      L+ W   N      +  
Sbjct  1270  WCPSELETSQHAIFSCARIRRLWVDHGCEAMVGDGRVEGGCEMLERW---NALDKKMVQK  1326

Query  4135  GCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIM-----RRANNLTLDTVEVFLNKKCV  4299
             GC       +  W IW  RN+ +FENT   P+ I+     R+ ++    T  ++    CV
Sbjct  1327  GC-------FLAWNIWAERNRFVFENTCQ-PLSIISQRVSRQVDDHNEYTTRIYGQPACV  1378

Query  4300  H-VGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
               V    W    PPE G IK NTD   + N G  S   +AR+  G+ LF 
Sbjct  1379  RPVSSSHWCA--PPE-GVIKLNTDAHIEGN-GWVSVATVARNTCGQVLFA  1424



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score =   496 bits (1278),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 329/1183 (28%), Positives = 556/1183 (47%), Gaps = 78/1183 (7%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
             VR +F Y  P R  K  FWN   +Y    + PW+  GDFN+   + E+ G + V  +R  
Sbjct  101   VRCTFVYGTPYRREKMDFWNWMTNYFGPTDIPWLCGGDFNEFVWDHEKSGGARVLYNRXG  160

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
                   +A  L+D+G  G  ++                   W +  + +       I+ +
Sbjct  161   YLNNFLNAANLMDLGFIGPKFT-------------------WRVLHETVIGSDXCPIVVQ  201

Query  1393  THSDHHPLK--FLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN----SLLDV-V  1551
             +       K  F  EA                W   ED RD+  + WS+      LD   
Sbjct  202   SQPSARKGKRIFRFEAF---------------WAKEEDCRDLVTKCWSSLGKGRWLDTWH  246

Query  1552  GAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNE  1731
               +S   +    W++  F    G +         + +    +    +QV+       +++
Sbjct  247   QKLSICKSHLITWSRNKFKK-RGLEIEELVHHLDLLQLHXEDNVEEIQVV----FNRIDQ  301

Query  1732  VLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRN-RSRIRMLKINGEWNSDFKTISD  1908
             + +QEEL W  + R  W++DGD NTAF+H++TL RR   S +R+  ++G+   D + +  
Sbjct  302   LREQEELYWLXRFRVNWLRDGDANTAFFHRTTLQRRRVNSIVRLKDVDGQXVDDGRRVFT  361

Query  1909  HISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMKKFGSP  2085
              + + F  L+      D   N + C   + +  M+  L + V+  E+K AV  M    +P
Sbjct  362   LVDDHFQSLYTSXGSRDWG-NILNCLEPMVSELMNADLIKPVSEEEIKAAVHQMGGLKAP  420

Query  2086  GPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRP  2265
             GPDG Q  FY +F + + + +   V   ++       I  +++ LIPK  +PE  S +RP
Sbjct  421   GPDGFQGIFYHSFXDIIVAEVNGLVMDFMQGVGNSRSINSTYLVLIPKVPTPELVSQYRP  480

Query  2266  ITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGK  2445
             I+L N SFKI+SKV+ NR++P++  LI P QN F+  R   +N+ L  E+ H+++L+K K
Sbjct  481   ISLCNFSFKILSKVLANRLQPLLPLLISPMQNXFIADRQIQENLGLAHELFHFLKLRKTK  540

Query  2446  KGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAP  2622
             +   M +KLD+ KAYD ++W+FLE+ L+  GF ++  +L+M  VR    ++L NG     
Sbjct  541   QKFEMCVKLDMQKAYDRVEWDFLEAVLLKLGFSRDWTNLVMNCVRTVKFAILLNGXPGKW  600

Query  2623  FQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLM  2802
             F P  G+RQGDPL+PYLF++  + LS  IQ  V       I ++  G  +SHLFF +D +
Sbjct  601   FSPSXGIRQGDPLSPYLFLMVSDVLSRMIQRGVDDXRLNGIHMNPRGPCISHLFFXDDTL  660

Query  2803  LFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDN  2982
             +  +A++  G  IM+ L ++   SG  +N  K +++   NT ++++  L +L G+    +
Sbjct  661   ICLQATQRNGENIMHILNQYCLASGQMMNXQKXSVYFGRNTPAQVRSQLGSLLGMPSVSD  720

Query  2983  LGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQ  3162
              G YLG+P +  R  + +  ++   +  K+  WK + LS AG+  L+++ + ++P Y M 
Sbjct  721   PGVYLGLPAIXGRSKRSSLAFVKXXVXGKIQGWKQSALSFAGKEVLLKAVVQAIPTYXMN  780

Query  3163  VFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALL  3342
             +FK P   C D+D +   FLWGD   ++ +H V W+ + + K  GGLG R   DFN+ALL
Sbjct  781   LFKFPVAVCKDLDSMSAGFLWGDCGGHRXIHWVNWDTLGRPKYEGGLGFRNFQDFNDALL  840

Query  3343  AKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRI  3522
              K  W L+ + + LW + ++ +Y  + +F    + + A W W S+  GR I++ GA W+I
Sbjct  841   VKQCWXLILNPNSLWAQTLKARYFXHSSFLDAKLGSRAXWAWASLPVGRDILKNGAHWQI  900

Query  3523  GNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RTWNVDKLSSLLPHDI  3699
              NG     W D W    PL      +        KVS  I P+ ++W+++ L   +    
Sbjct  901   LNGXDTRLWVDRWLPSXPLGHPIPSSPTSVTLNTKVSSLICPSTKSWDIEFLRPFISEVE  960

Query  3700  IDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDE----------DAMDTSW  3849
                I   P+  C +  D L W  S  G + VRS +  I  + E            + TS+
Sbjct  961   JKXIYDIPLGNCSR-RDRLIWTSSXXGNYXVRSGYHXIHSSXELTRAPASVVTSTLGTSF  1019

Query  3850  ---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECS  4020
                +W  +   + R FLW  +   L T    +++      +C  C   +E++  +L+ C 
Sbjct  1020  WKAIWHAKAPPKIRHFLWRAVSEALATVGGLFKRRSASSPMCPICKTQEESVLXLLLRCP  1079

Query  4021  FAKDCW-------RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEI  4179
             + +  W       RR    VS  +  ++ L +   N    S  ++         ++C  I
Sbjct  1080  WVEPIWXGGPLGXRRVGEGVSSXHHWLSVLINXTPNLQDRSRLLS------VIXFSCXYI  1133

Query  4180  WKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKF  4359
             WK R    F+ +A A   ++   +      +EV +         +    W PP   +IK 
Sbjct  1134  WKXRCNFXFKASALAXSQVLHSISFSLGSFLEVQVPLSRSRPSPILDPRWXPPSAPFIKV  1193

Query  4360  NTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAE  4488
             N D ++ +  G+A    + RDH G ++     +IG      AE
Sbjct  1194  NVDASWCQFDGMARLAAVLRDHNGLFVAAHKWSIGAPFVVFAE  1236



>emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
 emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
Length=1274

 Score =   495 bits (1275),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 347/1093 (32%), Positives = 545/1093 (50%), Gaps = 47/1093 (4%)
 Frame = +1

Query  1030  NVRVSFAYVRPNRMA-KERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSR  1206
             NV V      PN +  +  FW+   S  ++ ++ W++ GDFNDI DN E+ G        
Sbjct  41    NVEVEILEAAPNFIDNRSVFWDKISSLGAQRSSAWLLTGDFNDILDNSEKQGGPLRWEGF  100

Query  1207  CLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIIL  1386
              L F    S  GL D+  +G S SW        ++ R LDRAL N     LFP +K   L
Sbjct  101   FLAFRSFVSQNGLWDINHTGNSLSWRGTRYSHFIKSR-LDRALGNCSWSELFPMSKCEYL  159

Query  1387  PRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLD-VVGAIS  1563
                 SDH PL     A    R +   F        +E+ R +   VW  +  D V+  IS
Sbjct  160   RFEGSDHRPLVTYFGAPPLKRSKPFRFDRRLR--EKEEIRALVKEVWELARQDSVLYKIS  217

Query  1564  EVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQ--VLERKLVTELNEVL  1737
                    KW KE   N      S +A IK  Q+++    S  +    L   +  EL    
Sbjct  218   RCRQSIIKWTKEQNSN------SAKA-IKKAQQALESALSADIPDPSLIGSITQELEAAY  270

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHI  1914
             +QEEL W Q SR  W+  GDRN  ++H +T  RR  + + +++  +G+   + + I+  I
Sbjct  271   RQEELFWKQWSRVQWLNSGDRNKGYFHATTRTRRMLNNLSVIEDGSGQEFHEEEQIASTI  330

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPD  2094
             S++F ++F   N  D         P + +    +L +  ++ E+K+A+F +    +PGPD
Sbjct  331   SSYFQNIFTTSNNSDLQVVQEALSPIISSHCNEELIKISSLLEIKEALFSISADKAPGPD  390

Query  2095  GIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITL  2274
             G  A+F+  +W+ +++ ++  ++    D  + P++ E+ +TLIPK  +P   SD+RPI L
Sbjct  391   GFSASFFHAYWDIIEADVSRDIRSFFVDSCLSPRLNETHVTLIPKISAPRKVSDYRPIAL  450

Query  2275  LNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL  2454
              NV +KI++K++  R++P +  LI   Q++F+PGR+ ADN+++T EI+H++R+   KK  
Sbjct  451   CNVQYKIVAKILTRRLQPWLSELISLHQSAFVPGRAIADNVLITHEILHFLRVSGAKKYC  510

Query  2455  -MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQP  2631
              MAIK D+ KAYD I W FL+  L+  GF    I  +M  V   S S L NG       P
Sbjct  511   SMAIKTDMSKAYDRIKWNFLQEVLMRLGFHDKWIRWVMQCVCTVSYSFLINGSPQGSVVP  570

Query  2632  GRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFA  2811
              RGLRQGDPL+PYLFIL  E LS   ++         I ++RG   V+HL FA+D M F 
Sbjct  571   SRGLRQGDPLSPYLFILCTEVLSGLCRKAQEKGVMVGIRVARGSPQVNHLLFADDTMFFC  630

Query  2812  EASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGT  2991
             + +      + N LKK+   SG +IN++KS I  S  T  +IKR +K    I     +G 
Sbjct  631   KTNPTCCGALSNILKKYELASGQSINLAKSAITFSSKTPQDIKRRVKLSLRIDNEGGIGK  690

Query  2992  YLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFK  3171
             YLG+P    R  +  F  I+D ++++  +W    LS AG++ L+++ LSSMP Y M  FK
Sbjct  691   YLGLPEHFGRRKRDIFSSIVDRIRQRSHSWSIRFLSSAGKQILLKAVLSSMPSYAMMCFK  750

Query  3172  LPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKL  3351
             LPA  C  I  +   F W      +K+  V W+ +    + GGLG R+       + AKL
Sbjct  751   LPASLCKQIQSVLTRFWWDSKPDKRKMAWVSWDKLTLPINEGGLGFRE-------IEAKL  803

Query  3352  AWQLVTSHDKLWVKVMREKYVKNKNFF---ATPMIANASWGWRSIMRGRSIVELGAAWRI  3522
             +W+++     L  +V+  KY    +F    A+P    AS GWR I+ GR ++  G  W I
Sbjct  804   SWRILKEPHSLLSRVLLGKYCNTSSFMDCSASPSF--ASHGWRGILAGRDLLRKGLGWSI  861

Query  3523  GNGLSLNFWSDWWTGDKPLAFMDEVTIP-DSQSEAKVSDFILPN-RTWNVDKLSSLLPHD  3696
             G G S+N W++ W    P +    +  P ++  +  V D I  + ++WNV+ +   LP  
Sbjct  862   GQGDSINVWTEAWLS--PSSPQTPIGPPTETNKDLSVHDLICHDVKSWNVEAIRKHLPQ-  918

Query  3697  IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDA--MDTSW---VWKM  3861
               D IR   I     + DSL W    +G ++ ++ ++    N   A  +D +W   +WK+
Sbjct  919   YEDQIRKITINALP-LQDSLVWLPVKSGEYTTKTGYALAKLNSFPASQLDFNWQKNIWKI  977

Query  3862  RVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWR  4041
               + + + FLW  M+G L       R+ +  +  C  CG  + ++ H+++ C +AK  W 
Sbjct  978   HTSPKVKHFLWKAMKGALPVGEALSRRNIEAEVTCKRCGQTESSL-HLMLLCPYAKKVWE  1036

Query  4042  RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGV----TFIYTCWEIWKARNQRIFE  4209
                 PV F  S  T   S       A   +   P G+     + +  W +WKARN+ IF+
Sbjct  1037  LA--PVLFNPSEATH-SSVALLLVDAKRMVALPPTGLGSAPLYPWLLWHLWKARNRLIFD  1093

Query  4210  NTASAPMDIMRRA  4248
             N + +   ++ +A
Sbjct  1094  NHSCSEEGLVLKA  1106



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   496 bits (1277),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 368/1195 (31%), Positives = 566/1195 (47%), Gaps = 63/1195 (5%)
 Frame = +1

Query  946   FWRSSIFNFAVIRNTSQAIHGLVSGPHSNVR---VSFAYVRPNRMAKERFWNDCLSYSSE  1116
              W S+I + AV+  ++  I   V   H N     V F Y  P    K   W        +
Sbjct  33    LWWSNI-DVAVLSFSAHHIEAAVLDEHKNPSWHAVGF-YGWPETANKHLSWQ---LMRQQ  87

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
                P +  GDFN+I   +E+ G    +      F E+   C + D+G  G  ++W R   
Sbjct  88    CPLPLMFFGDFNEITSVEEKEGGVLRSERLMDAFREAIDDCAIKDLGFKGNKFTWQRGNS  147

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
               T+ R +LDR L +    +LFP  +  ILPR  SDH PL       +  RR N+ F+FE
Sbjct  148   PSTLIRERLDRMLADDAWCDLFPSWEVQILPRYRSDHAPLLLKTGLNDSYRRGNKLFKFE  207

Query  1477  gAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKG  1653
               WL++E+   +    WS S   D+   ++ V+    KW    FG++  RK     ++  
Sbjct  208   ALWLSKEECGKVVEEAWSGSRGADIAERLAGVSGDLTKWATHCFGDLKKRKKRALEKLNI  267

Query  1654  VQESVFYNTSRGLQVLER--KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
             +Q+      +   +VLE+     TEL+E+ + EE  W  ++R   I+DGD+NT ++H   
Sbjct  268   LQQR-----APDARVLEQCHAASTELDEICRLEESYWHARARANEIRDGDKNTKYFHHKA  322

Query  1828  LIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCG-----P  1989
               R+ R+ I+ +L  NG W      I++ +  +F DLF  +      PN+M        P
Sbjct  323   SQRKKRNAIKGLLDENGVWKKGKDEINEVVQRYFGDLFATEG-----PNEMEAALTGISP  377

Query  1990  KLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKV  2169
              +       L +     EV+ A+F M    +PG DG+ A F+Q FW  +   I TFV+  
Sbjct  378   CVSNEMNQALIKSPAGDEVRDALFAMHPNKAPGIDGLHALFFQKFWHILGPDIITFVQDW  437

Query  2170  LRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIG  2349
                      I  + I LIPK ++P++  DFRPI+L  V +KI+SK + NR++ I+ ++I 
Sbjct  438   WSGLVDLTVINRTCIVLIPKCENPQSMKDFRPISLCTVLYKILSKTLANRLKVILPSIIS  497

Query  2350  PFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLM-AIKLDLHKAYDSIDWEFLESTLV  2526
             P Q++F+P R   DN ++  EI H M+ K   + ++ A+KLD+ KAYD ++W FLE  + 
Sbjct  498   PNQSAFVPRRLITDNALVAFEIFHAMKRKDANRDVICALKLDMSKAYDRVEWCFLERVME  557

Query  2527  DFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWD  2706
               GF  + IS +M  +   S +   NG       P RGLRQGDP++PYLF+L  +  S  
Sbjct  558   KLGFCADWISRVMACISGVSFTFKVNGVVEGSLSPSRGLRQGDPISPYLFLLCADAFSTL  617

Query  2707  IQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNI  2886
             I +    K      + RG   VSHLFFA+D +LF +AS  +  ++ + + K+   SG  +
Sbjct  618   ITKATEEKKIHGARICRGAPMVSHLFFADDSILFTKASVQECSVVADIISKYERASGQKV  677

Query  2887  NVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKR  3066
             N+SK+ +  S N  S+ +  +  + G++  +    YLG+P +  R  K TF  I + + +
Sbjct  678   NLSKTEVVFSRNVESDRRDAIVRVLGVNEVERQEKYLGLPTVIGRSKKVTFACIKERIWK  737

Query  3067  KLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNK  3246
             KL  WK  +LS  G+  L++S   ++P Y M VF LP+G  ++I  +   F WG +   +
Sbjct  738   KLQGWKEKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDEIHAMLARFWWGSNGGER  797

Query  3247  KVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKN  3426
             K+H   W+ +C  K  GGLG R    FN ALLAK AW+L      L  +V++ +Y KN  
Sbjct  798   KMHWHSWDAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRDATLLSQVLQARYYKNVE  857

Query  3427  FFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIP  3606
             F       N S+ WRS+   +S++  G  W +G+G  +N W++ W   +       V  P
Sbjct  858   FLEARRGYNPSFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGEG---SHHVPTP  914

Query  3607  --DSQSEAKVSDFILPNRT-WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPT  3777
               DS  E +V D I  NR  WNV+ +  +   +    I   P++         +WP S  
Sbjct  915   RHDSNMELRVCDLIDVNRGGWNVEVVQQVFVEEEWRSILDIPLSRFWPEDHRYWWP-SRN  973

Query  3778  GAFSVRSAF-SHIAGNDE-------DAMDTSW--VWKMRVTERCrlflwllmrgrllTNM  3927
             G FSVRS +     G+D        +     W  VW++    +   F+W   +G L    
Sbjct  974   GVFSVRSCYWLGRLGHDRTWRLQHGEGETRLWKEVWRIGGPPKLGHFIWWACKGSLAVKE  1033

Query  3928  ERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKS---W  4098
                R+ + E T+CA CG   E+++H L ECSFAK  W  +        +  +       W
Sbjct  1034  SLARRHICESTVCAVCGASVESIHHALFECSFAKAIWEVSPFVALLNMAPTSSFAELFIW  1093

Query  4099  VKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEV  4278
             +++   + D    C          W  W  RN+ IFE  +     +   A+N      + 
Sbjct  1094  LRDKLSSDDLRTVCS-------LAWASWYCRNKFIFEQQSVEASVV---ASNFVKLVDDY  1143

Query  4279  FLNKKCVHVGKMRW----VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
              L  K V  G        V WQ P  G IK N D     N G    G + RD  G
Sbjct  1144  GLYAKKVLRGSTTMCTSEVSWQRPPAGLIKANFDAHVSPN-GEIGLGVVVRDSSG  1197



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score =   505 bits (1300),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 352/1206 (29%), Positives = 570/1206 (47%), Gaps = 65/1206 (5%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+ S+ + +V       +   V     +  ++  Y   N   + + W     +     
Sbjct  536   LFWKKSV-DISVYYEDKNLLDLAVQFGEYSFFLTCVYGNTNFCYRHQVWERLTRFGLSRK  594

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
               W M+GDFN+I +N+E+ G    + +  L F      CG+ ++ +SG  ++W  + G  
Sbjct  595   GNWCMIGDFNEILNNEEKLGGPRRSDNSFLPFSTMLKDCGMSELPSSGNGFTWGGRRGTH  654

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +Q  KLDR   N +  + FP A    LP+  SDH P+  L    +        FRF+  
Sbjct  655   WIQS-KLDRCFANKDWVSCFPAANQAFLPKRGSDHRPI--LVSLVSSQDLYRGSFRFDKR  711

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISE----VTNLSKKWNKETFGNIFGRKASLQARIK  1650
              L +   ++    VW  S +     +S+       +  KW KE   N   +  ++Q  ++
Sbjct  712   LLHKPGVKEAISMVWRQSAISAPAPVSQRIRDCRRVLSKWKKENEMNSKVKIIAIQNELE  771

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
              VQ S   + SR L+ L+ KLV    E  K+EE  W QKSR  W+ +GDRNT F+H S  
Sbjct  772   LVQSSSDPSASR-LRSLKNKLV----EANKEEESHWQQKSRDKWMLEGDRNTKFFHASVK  826

Query  1831  IRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQ  2007
               R+++ +  L+  NG  +    +  +  +++F +LF   + +D         P++    
Sbjct  827   NLRSKNGLDKLQDPNGIVHRSEASKGEVAASYFQNLFSTSSPVDIQAMLEGVTPRVTDVM  886

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
                L  +V+  EVK AVF +    +PG DG+   F+Q +W+ V   +T+ V      G  
Sbjct  887   NQSLLAKVSKEEVKNAVFSINPSKAPGADGMTGMFFQQYWDIVGHQVTSEVLAFFDSGIF  946

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
             P +   + + LIPKK +    SD RPI+L +V +K+++K+I++R++P++  ++ P Q++F
Sbjct  947   PKEWNFTQLCLIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIVSPNQSAF  1006

Query  2368  LPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             +P R  +DNI++  E +H +R  K   K  MA+K D+ KAYD ++W +LE+ ++  GF Q
Sbjct  1007  IPERLISDNILIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALMLGLGFHQ  1066

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
               + L+MF V   + ++L NG+      P RGLRQGDPL+P LF+L  E L+  + +   
Sbjct  1067  RWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHLLNKAES  1126

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
                   I  S  G  + HL FA+D +   +ASEDQG  +   L  +   +G  IN+ KS+
Sbjct  1127  EGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSS  1186

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             I         +K  +    GI      GTYLG+P            YI D MK +++ W 
Sbjct  1187  ITFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMSGWF  1246

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
                LS  G+  L++S   +MPV+ M  FKLP  TC ++      F W  +   KK+H + 
Sbjct  1247  ARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKKKMHWIS  1306

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  +C  K AGGLG +    FN ALL+K AW+++   D L+ +  + +Y  + +F +  +
Sbjct  1307  WEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFLSATL  1366

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPL--AFMDEVTIPDSQS  3618
                 S+ WRSI+ GR +++ G    IG+G S   WS  W  D  +    M  +       
Sbjct  1367  GYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNILF---DL  1423

Query  3619  EAKVSDFI-LPNRTWNVDKLS-SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSV  3792
             +  V D +    ++W++ KL     P D+   ++  P+   E   D L W  + +GA+SV
Sbjct  1424  DLMVKDLLDTTTQSWDLAKLQYHFYPRDVELILKIKPVMSSE---DYLIWEHTKSGAYSV  1480

Query  3793  RSAF------SHIAGNDEDAMDTS------WVWKMRVTERCrlflwllmrgrllTNMERW  3936
             +S +        I    E  M  S       +WK+    + R FLW ++ G +    +  
Sbjct  1481  KSGYWAAYQREKIDLLTEALMQPSVLPIKNQIWKISTATKIRNFLWKVVSGAIPVADKML  1540

Query  3937  RKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVS---------FQYSLVTPL  4089
              +GM  D+ C +CG   E++NHVL  C+ A+  W   + PV          FQ      L
Sbjct  1541  SRGMKVDSRCQSCGLEGESVNHVLFSCTVARQVWAMFNFPVPCNGFDSESVFQNIYYLLL  1600

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTA-SAPMDIMRRANNL---  4257
              S  KN+    +     PW V      W++WK RN   FE  +  A   + +  +N    
Sbjct  1601  VS--KNSKYPVEVRTAFPWVV------WQLWKNRNLFSFEGRSFCASRTVAKIRDNASQW  1652

Query  4258  ----TLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDH  4425
                 +L   +  + +    +GK  W    PP  GW K N   ++ + T    A  + R+ 
Sbjct  1653  FHAQSLTVADAIVERSKADLGKKGWY---PPVQGWKKCNLGSSWDKETSTGGAAWVLRNE  1709

Query  4426  KGEWLF  4443
             KGE L 
Sbjct  1710  KGETLM  1715



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   487 bits (1253),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 324/1050 (31%), Positives = 514/1050 (49%), Gaps = 106/1050 (10%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNV--RVSFAYVRPNRMAKERFWNDCLSYSSE  1116
              FW+S + N A+  +++  I   V G   ++  R++  Y  P        WN     +SE
Sbjct  41    LFWKSEL-NLAIRSSSTHHIDAEVGGIGDSLHWRLTGFYGYPATEDTHLSWNLLRDLASE  99

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
                PW+ MGDFN++    E+ G       + L F ++ S C L DMG  G +++WF    
Sbjct  100   SRLPWVCMGDFNELLYANEKEGGLIRPVRQMLAFRDAISDCHLDDMGFEGATFTWFSTRN  159

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
             G   +R  LDR L N E ++LFP+A    L    SDH P+         P R    FRFE
Sbjct  160   GGIKER--LDRVLANCEWRSLFPQATVHHLEPCSSDHLPILLEASPTMKPWRRRSFFRFE  217

Query  1477  gAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
               W   ED   I                     ++  WN    G +              
Sbjct  218   SMWTQHEDCESI---------------------IANAWNTSFTGTLM------------Y  244

Query  1657  QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
             Q S ++            L+++L+ +L +EE  W Q+S+  W+++GDRNT F+H+    R
Sbjct  245   QVSTYH-----------LLMSQLDSLLSREEAFWKQRSKVSWLKEGDRNTRFFHQRASNR  293

Query  1837  RNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH  2013
             + R+ ++ L+ N G W  D + +   + ++F  LF          +      ++     +
Sbjct  294   KQRNYVKGLRDNTGRWREDEQGLQYVVLDYFTHLFTSSASGSEGESIDAVESRVTPDMNN  353

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              L  +    E+ +AVF M    +PGPDG+   F+Q +W  V S +               
Sbjct  354   LLLTDYCDAEIHEAVFQMYPTKAPGPDGMPPIFFQKYWHIVGSDV---------------  398

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
                            P+  S  RPI+L NV FKI +KV+ NR++ I+  +I P Q++F+ 
Sbjct  399   -------------KHPKDMSQLRPISLCNVLFKIATKVLANRLKLILHKIISPSQSAFIS  445

Query  2374  GRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNL  2550
             GR  +DN IL  EI+HY+R ++  K   M +K+D+ KAYD I+W FLE+ +   GF +  
Sbjct  446   GRLISDNTILAAEIIHYLRRRRRGKKGFMVLKMDMSKAYDRIEWSFLEAIMRKLGFAEQW  505

Query  2551  ISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVK  2730
             I L++  +   S S + NG       P RGL QGDPL+PYLF+L  E L+  I +K R  
Sbjct  506   IQLMLTCISTVSYSFVINGTPHGFLHPSRGLHQGDPLSPYLFLLCAEGLTELIAQKEREG  565

Query  2731  NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
               K +++ RG   +SHLFFA+D +LFA A+      + +C++     SG  +N  KS + 
Sbjct  566   FLKGVSICRGAPAISHLFFADDSVLFARAN------MADCMRA----SGQQVNFQKSAVC  615

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGN  3090
              S N +   +  L    GI   D+   YLG+P++  +    +F ++ + + +KL  WKG 
Sbjct  616   FSKNVHRGDQLMLAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKERLWKKLQTWKGK  675

Query  3091  MLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWN  3270
             +LS AG+  L++    ++P+YTM  F LP   C D++++   F W  S +NKK+H + W+
Sbjct  676   LLSGAGKEILIKVVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWWNSSTENKKIHWMAWD  735

Query  3271  DICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIA  3450
              +C  K+ GGLG R    FN ALLAK  W+L+ + D L  KV++ KY   ++F  T +  
Sbjct  736   RLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLITKVLKAKYFPTRSFLETAVSL  795

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKV  3630
             +AS  W+S+   R+++  G+ W++G+G ++  W D W   +P +F      P+  +  KV
Sbjct  796   HASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWL-PQPNSFRIFFPKPEHSAITKV  854

Query  3631  SDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
             SD I  + R WNV  L ++   + +  IR+ P+++     D L W     G F+V+SA+ 
Sbjct  855   SDLIHGDSREWNVPLLQNVFFPEEVMLIRSIPLSL-RLTPDMLVWHYDKKGMFTVKSAY-  912

Query  3808  HIA-----------GNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
             H+A            ++ DA+  +W  +WK  V  R + F W ++ G L T     RK +
Sbjct  913   HVARSVHSSTGRASSSNSDAVARNWSLLWKAIVPARVKTFWWRVISGILPTKANLARKKV  972

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
             + D  C  C    E+  H+L +C FA   W
Sbjct  973   SLDEECMLCEGPVESSIHILCDCPFAICAW  1002



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score =   497 bits (1280),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 335/1117 (30%), Positives = 544/1117 (49%), Gaps = 64/1117 (6%)
 Frame = +1

Query  1210  LNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILP  1389
             L F ES  AC L+DMG  G  ++W  +  G      +LDR L + +  + F    AI L 
Sbjct  238   LEFKESIRACNLMDMGFKGHKFTWSNRRFGVNYIEERLDRVLCSKDWGSTFQNLPAISLA  297

Query  1390  RTHSDHHPLKF----LCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS----NSLLD  1545
                SDH P+ F     C+  +  +       +E  W + E   +I    W     NS   
Sbjct  298   NWVSDHCPIMFEVKVCCKKLHYKKNSFPRDYYEDMWSSYEACSNIVRSEWESFDGNSWES  357

Query  1546  VVGAISEVTNLS----KKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKL  1713
              V     V   S    K W+KE F     ++  L  R+K  ++        G ++  RKL
Sbjct  358   PVQKFQRVAKRSLAHLKIWSKEEFEGRKKKQNELIDRLKMTKQEPLQAID-GEEI--RKL  414

Query  1714  VTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSD  1890
               +++ +L  EE+ W Q+SR  W+++GD+NT F+H     RR +++I  ++ + G W  D
Sbjct  415   EDQISNMLVDEEVYWKQRSRADWLKEGDKNTKFFHSKASARRRKNKIWGVEDDQGNWVDD  474

Query  1891  FKTISDHISNFFIDLFGRKNIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFD  2064
              + I      FF  LF   N      ++   G  PK+       L    T  ++ +A+ +
Sbjct  475   PEGIEGEFCGFFQQLFTSSNPSQTQISEALKGLLPKVSQEMNTHLEEPFTPEDITRALSE  534

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             M    +PGPDG+ AAF+Q  W+ V   +T     +L +      +  +FI LIPK + P 
Sbjct  535   MCPTKAPGPDGLPAAFFQKHWQIVGEGLTKTCLHILNEQGTLDSLNHTFIALIPKVEKPR  594

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
                +FRPI+L NV ++I++K I NR++PI+ ++I P Q++F+P R   DN+I+  E +H 
Sbjct  595   KVMEFRPISLCNVVYRIVAKAIANRLKPILNHIISPNQSAFIPNRLITDNVIIGYECLHK  654

Query  2425  MRLKKGKK-GLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLW  2601
             +RL KG++ GL+A+KLD+ KAYD ++W FLE T+ + GF    ISLIM  +  +  S+L 
Sbjct  655   IRLSKGRRNGLVALKLDISKAYDRVEWNFLEQTMSNLGFSAKWISLIMSCITTTCFSVLI  714

Query  2602  NGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHL  2781
             NG  +   +P RGLRQG PL+PYLFIL  E  S  + +  R +  + +  ++  T ++HL
Sbjct  715   NGNPVGLIKPERGLRQGCPLSPYLFILCAEAFSNLLNQAEREQKIRGLKFAQDIT-ITHL  773

Query  2782  FFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLT  2961
              FA+D ++F++AS    + +      ++  SG   N  KS++F S   +SE    +K++ 
Sbjct  774   LFADDSLVFSKASVADCKYLKGIFDCYAKASGQIFNFEKSSMFFSGKASSEQISAIKSIF  833

Query  2962  GISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSS  3141
              + V      YLG+P +  R     F  +   +  K+++W   + S  G+  L+++   +
Sbjct  834   QLKVVPKYEKYLGLPPMLGRNKMSFFKEVKLKVTSKISSWHHKLFSAGGKEILIKAVAQA  893

Query  3142  MPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCL  3321
             +P Y M VFKLP G C DI +    F WG       +H   W+ + K+K  GGLG R   
Sbjct  894   VPAYAMSVFKLPKGLCEDIQKEIARFWWGTKKDKHGIHWARWDSMSKAKRRGGLGFRDLP  953

Query  3322  DFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVE  3501
              FN AL+AK  W+LV   + L  +VM+ +Y KN  F+   + +N S+ WRSI+ G  +++
Sbjct  954   SFNQALVAKQGWRLVRYPNSLMARVMKARYYKNSTFWNAKVGSNPSFIWRSILWGSQVIK  1013

Query  3502  LGAAWRIGNGLSLNFWSDWWTGDKPLAF--MDEVTIPDSQSEAKVSDFILPNRTWNVDKL  3675
              G  WRIG+G  +  + D W   +P  F  +   T+P    E  V+D I     W VD+L
Sbjct  1014  KGVRWRIGDGKKVLVYKDKWI-PRPATFQPISPKTLP---HETVVADLIDSENKWRVDRL  1069

Query  3676  SSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWV-  3852
                   + I+ I    +   ++  D + W     G +SV+S +  +A N     +     
Sbjct  1070  EQHFMKEDIEAILKILLPSGKE-EDEVLWHFDKKGEYSVKSGY-QLALNQNFPNEPESSN  1127

Query  3853  ---------WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
                      W + + E+ ++F+W  ++  L T    W++   ++ +C  C    ET++HV
Sbjct  1128  SSSRLWKIPWMLDLPEKVKIFMWRALKNILPTAENLWKRRSLQEPICQRCKLQVETVSHV  1187

Query  4006  LMECSFAKDCWRRTHHPVSFQ---------YSLVTPLKSWVKNNCCASDWINGCPWGVTF  4158
             L+EC  A+  W     P+  Q         +S +  +  W +++   ++ +         
Sbjct  1188  LIECKAARKIWDLA--PLIVQPSKDHNQDFFSAIQEM--WSRSSTAEAELM---------  1234

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWV---CW  4329
             I  CW IW ARN+ IFE   S    +  +A+++ L   +       VH  K R +    W
Sbjct  1235  IVYCWVIWSARNKFIFEGKKSDSRFLAAKADSV-LKAYQRVSKPGNVHGAKDRGIDQQKW  1293

Query  4330  QPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWL  4440
             +PP    +K N D A          G + RD +G+ L
Sbjct  1294  KPPSQNVLKLNVDAAVSTKDQKVGLGAIVRDAEGKIL  1330


 Score = 55.8 bits (133),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 65/161 (40%), Gaps = 2/161 (1%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNV-RVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              FW S + +  +   +S  I  +V      + R +  Y       K   W      +  +
Sbjct  32    LFWSSDV-DVTIKSFSSHHIDAIVQNQSGKIWRCTGIYGHAEASQKHHTWALLKMLAELY  90

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             +  W  +GDFN+I  + E+ G++  + +    F ES  AC L+DMG     Y+W  +   
Sbjct  91    SYNWCCLGDFNEILYSHEKLGANDHSSNMMSEFRESIRACNLMDMGYKEHKYTWSNRRYE  150

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKF  1422
                    LDR   + +  + F    A  L    SDH P+ F
Sbjct  151   DNFIEETLDRVFCSKDWSSTFQNLPATSLVNWVSDHCPIMF  191



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score =   506 bits (1302),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 334/1181 (28%), Positives = 559/1181 (47%), Gaps = 66/1181 (6%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             V+F Y  P    + R W+   +     + PW ++GDFN+     E +  +     +  +F
Sbjct  832   VTFVYGEPRVENRHRMWSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDF  891

Query  1219  VESFSACGLLDMGTSGVSYSW-FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
              +    C L D+G  GV +++  ++EG R V+ R LDR + + + ++++  A+ + L   
Sbjct  892   RDVLQDCELHDLGFKGVPHTYDNKREGWRNVKVR-LDRVVADDKWRDIYSTAQVVHLVSP  950

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-----SNSLLDVVGAI  1560
              SDH P+       +P +   +   +E  W    +   +    W        L D+  A+
Sbjct  951   CSDHCPILLNLVVKDPHQLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKAL  1010

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
             ++V    + W++    N+ GR+  L+   K + E +  N  R    + R     +NE+L 
Sbjct  1011  AKVMTALRSWSRAKVKNV-GRE--LEKARKKLAELIESNADR---TVIRNATDHMNELLY  1064

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             +EE+LW Q+SR  W++D DRNT F+H   + R  +++I  L+  N   +S    +    +
Sbjct  1065  REEMLWLQRSRVNWLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMAT  1124

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
              +F D++     ++          K+      KL  + T  E+ +A+F +    SPGPDG
Sbjct  1125  EYFQDVYTADPNLNPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDG  1184

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A FYQ  W  +K+ I   V++  + G +P  + ++ I LIPKK+ P    DFRPI+L 
Sbjct  1185  FPARFYQRNWGTIKADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLC  1244

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGL  2454
             NV +K++SK +VNR+RPI+ +L+   Q++F+ GR   DN +L  E  H M+  KK     
Sbjct  1245  NVVYKVVSKCLVNRLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAA  1304

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
              A KLDL KAYD +DW FLE  +   GF +  ++ IM  V      + +NG  L  F P 
Sbjct  1305  CAYKLDLSKAYDRVDWRFLEMAMNKLGFARRWVNWIMKCVTSVRYMVKFNGTLLQSFAPT  1364

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RGLRQGDPL P+LF+   + LS  ++EKV   +  P  + R   G+SHL FA+D +LF +
Sbjct  1365  RGLRQGDPLLPFLFLFVADGLSLLLKEKVAQNSLTPFKVCRAAPGISHLLFADDTLLFFK  1424

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A + +  ++   L  ++  +G  IN +K +I     +   +   +  +  +        Y
Sbjct  1425  AHQREAEVVKEVLSSYAMGTGQLINPAKCSILMGGASTPAVSEAISEILQVERDRFEDRY  1484

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG P    R+ K  F  +   + +++  W  N LS  G+  L+++ + ++PVY M +FKL
Sbjct  1485  LGFPTPEGRMHKGRFQSLQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKL  1544

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P    +D+ ++ ++F W      +K H   W+ + K K  GGLG R    FN ALLA+ A
Sbjct  1545  PESVIDDLTKLTKNFWWDSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQA  1604

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+L+T  D L  +V++ KY  + +   T   +N+S  WRSI  G  +++ G  WR+GNG 
Sbjct  1605  WRLITYPDSLCARVLKAKYFPHGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGN  1664

Query  3535  SLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILPNRTWNVDKLSSLLPHDIIDGI  3711
             S+  W D W    P           +    K VSD I  + +W+V K+     H++   +
Sbjct  1665  SIRIWRDSWL---PRDHSRRPITGKANCRLKWVSDLITEDGSWDVPKIHQYF-HNLDAEV  1720

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAG--NDEDA-------MDTSW--VWK  3858
                         D + W     G FSVRSA+   A   N E++       ++ +W  +WK
Sbjct  1721  ILNICISSRSEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWK  1780

Query  3859  MRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
              +V ++ ++F W +    L T + + ++ + +  +C  C   +E   H L  C  A   W
Sbjct  1781  CKVPQKVKIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLW  1840

Query  4039  RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGV------TFIYTCWEIWKARNQR  4200
                H   S            +K +     W+  C   +       F+ T W  W  RN+ 
Sbjct  1841  SCMHKSGSVSVD--------IKASVLGRFWLFDCLEKIPEYEQAMFLMTLWRNWYVRNEL  1892

Query  4201  IFENTASAPMDIMRRANNLTLDTV---------EVFLNKKCVHVGKMR-----------W  4320
             I   +A  P +  +R     +D +         ++   K  V    ++            
Sbjct  1893  IHGKSA-PPTETSQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQ  1951

Query  4321  VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
              CW+ P+ GW+K N DG+F  ++G    G + R+  G+ +F
Sbjct  1952  PCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIF  1992



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score =   500 bits (1287),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 330/1126 (29%), Positives = 552/1126 (49%), Gaps = 46/1126 (4%)
 Frame = +1

Query  949   WRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAP  1128
             W+  I +  V+  T   I   +S    +   +F Y  P+   +   WN+  +  +    P
Sbjct  39    WKKDI-DLTVLSTTDNFIETRISSKGKSFLTTFLYGEPDHTKRNAVWNELTTLHANLKEP  97

Query  1129  WIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTV  1308
             W + GDFN++ DN E+ G           F    S   L D+  SG  +SW  + G   V
Sbjct  98    WFLTGDFNELQDNSEKKGGPERAEGTFGAFRTFLSENDLFDLKHSGNPFSWRGKRGAHLV  157

Query  1309  QRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWL  1488
              R +LDRA+ N E   LFP  +   L    SDH P+  L       ++ +  FR++    
Sbjct  158   -RCRLDRAMSNPEWMELFPSCRCQYLKFEGSDHRPI--LSYLDTTRKKGHNLFRYDRRLK  214

Query  1489  TREDYRDIWGRVWSN-SLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQES  1665
              +++ +++   +W N + L V   +  V     KW K    N      +L+  +      
Sbjct  215   DQKEIKELVAEIWQNCTYLGVEARLVLVRRAICKWCKLFQENSKQTIENLRVELDDQMTK  274

Query  1666  VFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNR  1845
                +  R +Q + + ++   N     EE  W Q+SR +W+  GD N+ ++H  T  R+ R
Sbjct  275   DDPDEDR-IQDINKLILKAYNS----EEAYWKQRSRLLWLTLGDSNSGYFHAVTKTRKAR  329

Query  1846  SRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPN-DMYCGPKLDTGQMHKL  2019
             +R+ +++  +G    +   IS  + +++ +LF      + S        P +       L
Sbjct  330   NRLTVMENKDGIPVYEEDQISALVCSYYDNLFTANQRGEISSTISQALKPCVTQEWNELL  389

Query  2020  TREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKI  2199
             TR+ +  E+K+A+F +    +PGPDG  A+F+ + WE +   I T +++    G + P +
Sbjct  390   TRDPSPAEIKEALFAIHADKAPGPDGFSASFFHSNWETIGQSIITEIQEFFSTGVLSPTL  449

Query  2200  LESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGR  2379
               + + LIPK    +   ++RPI L NV +K+ISK++  R++PI+ ++I   Q++F+PGR
Sbjct  450   NVTHVRLIPKTLGAKRVDEYRPIALCNVYYKVISKLLSLRLKPILCSIISENQSAFIPGR  509

Query  2380  STADNIILTQEIVHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLIS  2556
             +  DN+++T E++ +++  + KK   MA+K+D+ KAYD ++WEF+   +   GF +  I+
Sbjct  510   AITDNVLITHEVLQFLKTSQAKKQCAMAVKMDMSKAYDRVEWEFIAQVMKRLGFHEKWIN  569

Query  2557  LIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNW  2736
              IM  +   S S L N       +P RG+RQGDP++PYLFIL  E LS   ++     + 
Sbjct  570   WIMQCITSVSYSYLINDSVYGLVKPHRGIRQGDPISPYLFILCGEVLSGLCRKAELEGSM  629

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
             + + ++RG   V+HL FA+D M+F  ++ +    ++  L+ +   SG  +N++KS I  S
Sbjct  630   RGVRVARGCPRVNHLLFADDTMIFCNSTSESCLALLRILRDYESVSGQKVNIAKSAINFS  689

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
               T  E+K+  K+L GI     +G YLG+P    R  K  F  I+D ++++ ANW    L
Sbjct  690   SKTPPEVKQAAKDLLGIQKEGGMGKYLGLPEHFGRKKKDLFTSIVDRIRQRAANWSTRFL  749

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S AG+ T++++ L+++P Y M  F LP   CN I      F W  S   K +  V W  +
Sbjct  750   SRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWWDKSPDKKNMCWVAWGKL  809

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANA  3456
              + K AGGLGLR    FN ALLAK+AW+++TS   L  +V+  KY   K+F      A  
Sbjct  810   TRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVLTGKYCHKKSFLDVQTPAVC  869

Query  3457  SWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTG-DKPLAFMDEVTIPDSQSEAKVS  3633
             S GWRSI+ GR +++      IGNG +   W D W     PL     V   ++  + +VS
Sbjct  870   SHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWISLQAPLKPYGPVQ--EAGLDLRVS  927

Query  3634  DFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF---  3804
             D +  +  WN DK+   LP D    I+    +  E   D   W    +G +S +S +   
Sbjct  928   DLLTDDLQWNKDKIDKFLP-DFTKQIQCLKPSK-EGAEDIYVWLPLESGVYSTKSGYNSK  985

Query  3805  ------SHI---AGNDEDAMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
                   +H+     N    ++  W   VW ++   + +LFLW +++G L    E  R+GM
Sbjct  986   TQLNAHTHLQQRTSNPPPNLEFDWLKDVWSIKTAPKLKLFLWSIIQGALPLGSELQRRGM  1045

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWV---KNNCCA  4119
                  C  C   +E+  H+  +C FAK+ WR      S   +     +S++   ++  C 
Sbjct  1046  INAAACPRC-KKEESATHIFFQCPFAKEVWRHIPLNSSVHLADAETFESYMGQFRSALCL  1104

Query  4120  SDWINGCPWGV---TFIYTCWEIWKARNQRIFENTASAPMDIMRRA  4248
                    P G+      + CW +W ARN+ IF++  + P++I  + 
Sbjct  1105  P------PTGIRSPVLPWICWSLWTARNKLIFDDKTAQPLEIATKG  1144



>ref|XP_010430691.1| PREDICTED: uncharacterized protein LOC104714925 [Camelina sativa]
Length=1239

 Score =   489 bits (1258),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 330/1086 (30%), Positives = 524/1086 (48%), Gaps = 49/1086 (5%)
 Frame = +1

Query  1087  WNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSG  1266
             W   L      ++PW  +GDFN++  N E+ G    +PS  L F      CG LD    G
Sbjct  3     WERLLRIGVSRSSPWFTVGDFNELTGNHEKRGGKLRHPSSFLAFNGMIQDCGFLDFPYLG  62

Query  1267  VSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpp  1446
                SW      + + R +LDRAL N +   LFP+     LP   SDH P+  +   G   
Sbjct  63    DCLSWRGWRDKKPI-RSRLDRALGNEDWHELFPDTVLEYLPMIASDHKPI--VVNIGAKR  119

Query  1447  rrenrpfrfegAWLTREDYRDIWGRVWSNSLLDV----VGAISEVTNLSKKWNKETFGNI  1614
              R  R F F+  W+ ++   +     W      +    +  I        +W K      
Sbjct  120   PRGKRRFTFDPRWIGKDGLMEAIEAGWVGGSPQISPNFMDKIVNCRRAISQWRKNQVP--  177

Query  1615  FGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELN----EVLKQEELLWFQKSRRMW  1782
             FGR       I+ ++  +  + ++        ++T+LN    E  K EE+ W+ KSR  W
Sbjct  178   FGRDT-----IEDLKSQL--SVAQADDATPLSVITDLNARLWEAYKDEEVYWYLKSRNKW  230

Query  1783  IQDGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMD  1959
             +Q GD+N+ ++H  T  RR R+RI  L    E W+++   I +   ++F DLF   +  +
Sbjct  231   MQMGDQNSRYFHALTKQRRARNRITCLFDKNEIWSTEDVDICNIAVSYFADLFTTLHPTN  290

Query  1960  GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVK  2139
                      P +      +LT  VT  EV+ A+F M    +PGPDG+ A FYQ  W+ VK
Sbjct  291   FDEVLGEVRPVITAEANAQLTAPVTELEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVK  350

Query  2140  SHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNR  2319
               + + V     +G     +  + I LIPK   P   ++ RPI+L NV +KIISK++  R
Sbjct  351   GDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQR  410

Query  2320  MRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSI  2496
             ++  + +LI   Q++F+PGR  +DNI++ QE+ H +R     KG  M IK D+ KAYD +
Sbjct  411   LKKFLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMTIKTDMSKAYDRV  470

Query  2497  DWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLF  2676
             +W F+E  L   GF +  I  IMF V      +L NG+      P RGLRQGDPL+PYLF
Sbjct  471   EWVFIEKLLYKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLF  530

Query  2677  ILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLK  2856
             IL  E L  +I++    K    I ++     ++HL FA+D + F + ++DQ  +I+  L+
Sbjct  531   ILCTEVLIANIRKAEVDKLITGIKVANQCPPITHLLFADDSLFFCKVAKDQCEVILKILR  590

Query  2857  KFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHT  3036
              +   SG  IN +KS++        + K  ++ + GI+    +G+YLG+P          
Sbjct  591   NYEAVSGQQINFAKSSVQFGHKVAEQTKMEIQGILGITTQGGMGSYLGLPESLGGSKTKV  650

Query  3037  FGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRD  3216
             F ++ + ++ +   W   +LS  G+  +V+S  +++P + M  F+LP    + +     +
Sbjct  651   FSFVRERLQGRTTGWSAKLLSKGGKEVMVKSIATAVPTFVMSCFRLPKTITSKLTSAVAN  710

Query  3217  FLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKV  3396
             F W    +   +H + W+ +C +K  GGLG R   DFN+ALLAK  W+L+   D L+ +V
Sbjct  711   FWWSSDGRTGGMHWLAWDKLCCTKQMGGLGFRNVDDFNSALLAKQLWRLIEFPDSLFARV  770

Query  3397  MREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKP  3576
              + +Y +N N        + S+GWRSI+   S+V+ G   R+G+G S++ W+D W     
Sbjct  771   FKGRYYRNSNPMEPIRSYSPSYGWRSIVSACSLVQKGLIIRVGSGESISIWTDPWI----  826

Query  3577  LAFMDEVTI---PDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQV  3744
             LA      I   P      K+S  I    R W +D LS       ++ I A P+  C + 
Sbjct  827   LAQFPRPAISKGPFKDPSLKISHLIDCRTRLWRMDVLSEHFDPVDVELIGALPLGSCPK-  885

Query  3745  SDSLYWPRSPTGAFSVRSAFSHIA-------------GNDEDAMDTSWVWKMRVTERCrl  3885
              D+L W  +  G ++V+S + H A             G +  ++  S VW +R   + + 
Sbjct  886   DDTLGWHFTKNGRYTVKSGY-HAARLTTQGPFKAPGVGPEITSLLAS-VWNVRCPPKIQH  943

Query  3886  flwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSF  4065
             F+W  + G +  +    R+G+  D  C+ CG  +ET+NHVL  C  A+  W  +  PV  
Sbjct  944   FMWQALSGCMPVSRNLRRRGIACDLGCSRCGAEEETVNHVLFLCPPARQVWALSQVPVG-  1002

Query  4066  QYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRR  4245
               S   P++S   N     D  +       F +  W +WKARN ++F+N    P + +R 
Sbjct  1003  --SNCFPVESVFANMDHFLDPKSPGSHVAAFPWILWFLWKARNAKVFDNITERPEETVRI  1060

Query  4246  ANNLTL  4263
             A    L
Sbjct  1061  AEGEAL  1066



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score =   491 bits (1264),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 344/1168 (29%), Positives = 545/1168 (47%), Gaps = 59/1168 (5%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +S  Y  P    + + W    S   +    W ++GDFNDI  N E+ G    +PS    F
Sbjct  100   ISCVYGLPVTHMRPKLWEHLNSIGLKRAEAWCLIGDFNDIRSNDEKLGGPRRSPSSFQCF  159

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
                   C + ++G++G S++W      + VQ  KLDR   N    ++FP A    L +  
Sbjct  160   EHMLLNCSMHELGSTGNSFTWGGNRNDQWVQC-KLDRCFGNPAWFSIFPNAHQWFLEKFG  218

Query  1399  SDHHPL--KFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVT  1572
             SDH P+  KF  +      +     R +      E     W    S        ++ E  
Sbjct  219   SDHRPVLVKFTNDNELFRGQFRYDKRLDDDPYCIEVIHRSWNSAMSQGTHSSFFSLIECR  278

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLER--KLVTELNEVLKQE  1746
                  W   +  N        Q+RIK +++ +    S  +    R   +  +L+     E
Sbjct  279   RAISVWKHSSDTNA-------QSRIKRLRKDLDAEKSIQIPCWPRIEYIKDQLSLAYGDE  331

Query  1747  ELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDH---IS  1917
             EL W QKSR+ W+  GD+NT F+H +    R ++ +  L    E + +F   SD     S
Sbjct  332   ELFWRQKSRQKWLAGGDKNTGFFHATVHSERLKNELSFLL--DENDQEFTRNSDKGKIAS  389

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
             +FF +LF    I+  + +      K+ +   H L +EVT  EV  AVF + K  +PGPDG
Sbjct  390   SFFENLFTSTYILTHNNHLEGLQAKVTSEMNHNLIQEVTELEVYNAVFSINKESAPGPDG  449

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A F+Q  W+ VK  I T +      G +P     + I LIPK  SP+  SD RPI+L 
Sbjct  450   FTALFFQQHWDLVKHQILTEIFGFFETGVLPQDWNHTHICLIPKITSPQRMSDLRPISLC  509

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGL  2454
             +V +KIISK++  R++  +  ++   Q++F+P R  +DNI++  E++H +R   +  K  
Sbjct  510   SVLYKIISKILTQRLKKHLPAIVSTTQSAFVPQRLISDNILVAHEMIHSLRTNDRISKEH  569

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
             MA K D+ KAYD ++W FLE+ +   GF    IS IM  V   S S+L NG+      P 
Sbjct  570   MAFKTDMSKAYDRVEWPFLETMMTALGFNNKWISWIMNCVTSVSYSVLINGQPYGHIIPT  629

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RG+RQGDPL+P LF+L  E L   + +  +      I        V+HL FA+D +L  +
Sbjct  630   RGIRQGDPLSPALFVLCTEALIHILNKAEQAGKITGIQFQDKKVSVNHLLFADDTLLMCK  689

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A++ +   +M CL ++   SG  IN++KS I    N + +IK  +K+ +GIS+    G Y
Sbjct  690   ATKQECEELMQCLSQYGQLSGQMINLNKSAITFGKNVDIQIKDWIKSRSGISLEGGTGKY  749

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG+P       +  FG+I + ++ +L  W    LS  G+  L++S   ++PVY M  FKL
Sbjct  750   LGLPECLSGSKRDLFGFIKEKLQSRLTGWYAKTLSQGGKEVLLKSIALALPVYVMSCFKL  809

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P   C  +  +  DF W    Q +K+H + W  +   KD GG G +    FN ALLAK A
Sbjct  810   PKNLCQKLTTVMMDFWWNSMQQKRKIHWLSWQRLTLPKDQGGFGFKDLQCFNQALLAKQA  869

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+++     L+ +V + +Y  N +F +    +  S+ WRSI+ GR ++  G    IGNG 
Sbjct  870   WRVLQEKGSLFSRVFQSRYFSNSDFLSATRGSRPSYAWRSILFGRELLMQGLRTVIGNGQ  929

Query  3535  SLNFWSDWWTGD----KPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLP-HD  3696
                 W+D W  D    +PL     + +     + KVS  I P +R WN++ L  L P  D
Sbjct  930   KTFVWTDKWLHDGSNRRPLNRRRFINV-----DLKVSQLIDPTSRNWNLNMLRDLFPWKD  984

Query  3697  IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGN------DEDAMDTSW---  3849
             +   ++  P+   E   DS  W  S  G +SV++ +  ++         E  +  S    
Sbjct  985   VEIILKQRPLFFKE---DSFCWLHSHNGLYSVKTGYEFLSKQVHHRLYQEAKVKPSVNSL  1041

Query  3850  ---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECS  4020
                +W +    + R+FLW  + G +        +G+  D  C  C   +ET+NH+L EC 
Sbjct  1042  FDKIWNLHTAPKIRIFLWKALHGAIPVEDRLRTRGIRSDDGCLMCDTENETINHILFECP  1101

Query  4021  FAKDCWRRTHHPVS---FQYSLVTPLKSWVKNNCCASDWINGCPWGVTFI--YTCWEIWK  4185
              A+  W  TH   +   F  S+ T +   +          N  P  + F+  +  W +WK
Sbjct  1102  LARQVWAITHLSSAGSEFSNSVYTNMSRLID-----LTQQNDLPHHLRFVSPWILWFLWK  1156

Query  4186  ARNQRIFENTASAPMDIMRRANNLTLD--TVEVFLNKKCVHVGKMRWVCWQPPETGWIKF  4359
              RN  +FE   S    ++ +A     +  + +  +     H+   +W    PP  G +K 
Sbjct  1157  NRNALLFEGKGSITTTLVDKAYEAYHEWFSAQTHMQNDEKHLKITKWC---PPLPGELKC  1213

Query  4360  NTDGAFKRNTGLASAGGLARDHKGEWLF  4443
             N   A+ +    + A  + RD +G+ L 
Sbjct  1214  NIGFAWSKQHHFSGASWVVRDSQGKVLL  1241



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score =   498 bits (1282),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 347/1214 (29%), Positives = 572/1214 (47%), Gaps = 100/1214 (8%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W+  + +  V+ +  + I   V        +S  Y  P R  + + W        E  
Sbjct  519   LMWKEEV-HIKVLHSDKRTIDVQVKWQDKEFFLSCIYGDPVRGERGKVWERLTRIGIERR  577

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW+M GDFN++ D  E+ G    + + C+ F +  SACGL ++   G  +SWF      
Sbjct  578   GPWMMTGDFNELVDPSEKKGGPVRSMATCVEFQQMLSACGLWEVRHKGYQFSWFGNRNEE  637

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              VQ R LDR + N E   LFPEA+A+ L +  SDH PL  +        R    F+++  
Sbjct  638   LVQCR-LDRTVANQEWMELFPEAQAVYLKKVSSDHSPL--ITTLMGEKWRRWVGFKYDQR  694

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK----WNKETFGNIFGRKASLQARI-  1647
             W+ RE + D     W +  +    ++ E     +K    W +    N   R   L +RI 
Sbjct  695   WVQREGFCDFMKETWESEKVKQSNSLVEKLTRCRKEISGWKRRNKPNSSLRIQELHSRID  754

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
             +  Q+S F           R+L +ELN+   QEE  W QKSR +W+ +GD+NT F+H +T
Sbjct  755   RATQQSPFSIEE------VRRLKSELNKEYVQEEKFWQQKSRFIWLNNGDKNTKFFHAAT  808

Query  1828  LIRRNRSRIRML--KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
               RR ++RI++L  K   EW ++ + +     ++F  L+  +++      +M  G    +
Sbjct  809   KNRRAQNRIQVLEDKDGIEWFAE-EDLGRVAESYFKMLYTSEDV-GYRLQEMEQGTNTVS  866

Query  2002  GQMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRD  2178
              +M++ L+ EV++ EVK+AVF++     PGPDG+   F+Q FWE V   IT  V+  +R 
Sbjct  867   TEMNEMLSAEVSLEEVKEAVFEINPNKCPGPDGLTGFFFQQFWERVGEDITEMVRSFMRT  926

Query  2179  GRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQ  2358
             GR+  +I  + I LIPKK       DFRPI+L NV +KI+SK++ +R++ I+ N+I   Q
Sbjct  927   GRLEEEINRTNICLIPKKMKASKLQDFRPISLCNVVYKIVSKLLASRLKRILPNIISETQ  986

Query  2359  NSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFG  2535
              +F+ GR  +DNI++  E++H +  + K  +  +AIK D+ KAYD ++W FL + +   G
Sbjct  987   AAFVKGRLISDNILIAHEMLHALSSRNKCAENFIAIKTDISKAYDRVEWSFLGNAMTYLG  1046

Query  2536  FPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQE  2715
             F  + I L+M  V+     +L NG      QP RGLRQGDPL+PYLF++  E L   + +
Sbjct  1047  FSGSWIRLVMECVKTVEYQVLINGVPYRDIQPTRGLRQGDPLSPYLFVICTEMLVRMLNK  1106

Query  2716  KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVS  2895
                      + ++ G   +SHL FA+D + +    E++   ++  ++++S  SG  +N  
Sbjct  1107  AEEEGKITGLKIASGAPSISHLLFADDSLFYCRKEEEEINQMVRIIEEYSLASGQRVNYQ  1166

Query  2896  KSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLA  3075
             KS+I+       E +  +K+  GIS     G YLG+P   K        Y+ + + +++ 
Sbjct  1167  KSSIYFGKLIPEETRGEIKHKLGISKEGGEGIYLGLPEAFKGSKVTILSYLKERLNQRVN  1226

Query  3076  NWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVH  3255
              W+   LS  G+  L+++ + ++P YTM  FKLP      + R        D A+++   
Sbjct  1227  GWQTMFLSQGGKEVLLKAVVMALPTYTMTCFKLPRNALASMGR-------ADQAKSR---  1276

Query  3256  LVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA  3435
                          GG+  R    FN+ALL K  W+++T  + L  +V + +Y +  +   
Sbjct  1277  -------------GGIEFRDIEAFNDALLGKQLWRIITQKESLVARVFKSRYFRKSDPLT  1323

Query  3436  TPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVT--IPD  3609
              P+    S+ WRS+   + ++  GA   +GNG  +N W   W   KP   +  V    P 
Sbjct  1324  APLGYRPSYAWRSLQAAQELLRQGARAVVGNGKEINIWQHQWLQSKPARGLSRVKQIPPG  1383

Query  3610  SQSEAK----VSDFILPN-RTWNVDKLSSLLPHD---IIDGIRATPIAVCEQVSDSLYWP  3765
              QS       V D + P+ R WN D LS    ++    I+ IR        Q  D   W 
Sbjct  1384  FQSSVAQLVTVKDLLGPDGREWNRDLLSLAFENEDKQCIEEIRPGGF----QTKDGYTWD  1439

Query  3766  RSPTGAFSVRSAF----------SHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrg  3909
              + +G +SV+S +                D+ ++D  +  +WK+    +   F+W  +  
Sbjct  1440  YTKSGLYSVKSGYWVVLKVIRQRGRAQVVDQPSLDALYQQIWKLEAPPKIHHFVWKCLSN  1499

Query  3910  rllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPL  4089
              L  N       ++++ LC  C +  ET+NH+  +C +A+  W  +  P           
Sbjct  1500  CLSVNGNLAYPHISKEALCIRCPNCTETVNHLFFQCPYARVVWAVSSVPAP-------QG  1552

Query  4090  KSWVKNNCCASDWI--------NGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI-MR  4242
               W  +     DW         +  P      +  W +WK+RN+  F        DI + 
Sbjct  1553  GEWSDSLYANMDWFLNYQKEQRSQTPQPTVSQWVLWRLWKSRNELCFNGK-----DIGVE  1607

Query  4243  RANNLTLDTVEVFLNKKCVHVGKMR--------WVCWQPPETGWIKFNTDGAFKRNTGLA  4398
             R   L  +  E +  ++  + G++R         V W+PP   W+K N DGA+ R    +
Sbjct  1608  RLIKLVEEDAEEWRGRE-ENTGRLRPNPSALSLEVRWRPPPLEWVKCNMDGAWPREGDRS  1666

Query  4399  SAGGLARDHKGEWL  4440
               G + RDH+G  L
Sbjct  1667  GVGWVLRDHQGSVL  1680



>ref|XP_010681283.1| PREDICTED: uncharacterized protein LOC104896266 [Beta vulgaris 
subsp. vulgaris]
Length=1144

 Score =   484 bits (1246),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 303/994 (30%), Positives = 488/994 (49%), Gaps = 74/994 (7%)
 Frame = +1

Query  943   FFWR---SSIFNFAVIRNTSQAIHGLVSGPHSNVR--VSFAYVRPNRMAKERFWNDCLSY  1107
              FW+    S FN +++   S+ +   +S  + N++  + F Y  P    K  FW + + +
Sbjct  70    LFWKDCLQSPFNLSMLIKGSRFMAVSISMLNENLQFAIIFVYAPPQNNHKSEFWEEIILF  129

Query  1108  SSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFR  1287
             ++  + P+I++GDFNDI   Q++ G +S   S   N     ++   +++   G  ++W +
Sbjct  130   ANSLSTPFIIIGDFNDIGCEQDKVGGASFVSSCVANMNHLLASLPYVELPFQGSRFTWRK  189

Query  1288  QEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpf  1467
             +  G      +LDR + + E  + FP+AK +        HHP                  
Sbjct  190   KRAGPNNILERLDRGVVSPEWLSWFPQAKLV--------HHPF-----------------  224

Query  1468  rfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARI  1647
                    T  D+  +   +  +S++             K        N+ GR AS+Q ++
Sbjct  225   -------TSSDHCHVTLDLSKSSVI-------------KAPPFRQLRNVDGRLASVQNQM  264

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
              G            L  L+ +L+ + + +L      W QKS+  ++  GD NT +YH   
Sbjct  265   LGSP------LCPSLASLQDRLLRKRDNLLSFSNEYWKQKSKTKYLHLGDANTNYYHTHA  318

Query  1828  LIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNI------MDGSPNDMYCGP  1989
              IRR+R++I+  K   +      T  + ISN   + F ++ +       +   +     P
Sbjct  319   TIRRSRNQIKSFKSALD---QIITTPNEISNVITNEFEQRFVSNPACSFNEEVDFQLLAP  375

Query  1990  KLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKV  2169
              +       L  EV+  E+K AVF++    SPGPDG    F+Q +W  V + +   V+  
Sbjct  376   IISATDNEMLVAEVSADEIKSAVFELAPDKSPGPDGYPPFFFQKYWTLVGNSVIRAVRAF  435

Query  2170  LRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIG  2349
                G +  +I  +F+ LIPK D+P + + FRPI+L +  +K++SK++ NR++ ++  +I 
Sbjct  436   FHSGHLLKEINHTFLALIPKVDNPSSTNHFRPISLCSTIYKVVSKILTNRLKSVLGKIIH  495

Query  2350  PFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
             P Q +F+P R   DNI++  E+ H    K G  G +AIKLD+ KAYD ++W F+  +L  
Sbjct  496   PLQGAFVPDRFIQDNILIAHEVFHSFHKKSGVDGWLAIKLDMEKAYDRLEWNFILVSLKK  555

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              GF    +  I   +   S S+L NG     F P RG+RQGDPL+PYLFIL  E L+  +
Sbjct  556   LGFCSRWVDWIRSCISTPSFSVLVNGIPGKRFTPSRGIRQGDPLSPYLFILYAELLARQL  615

Query  2710  QE-KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNI  2886
                 +       + + + G  +  L FA+D M+FA+ASE    +I   L  +   SG  +
Sbjct  616   SAANLHRDKLVGVPIGKSGIRIPFLTFADDTMIFAKASEASCVVIKQILDSYCSMSGQLV  675

Query  2887  NVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKR  3066
             N  KS   CSPN     K     L G++   NLG YLG PI+  RV+K TFG + + +  
Sbjct  676   NYHKSAFQCSPNVPISTKASFAGLLGMNEVSNLGEYLGCPIIDSRVTKETFGVVCNRVAS  735

Query  3067  KLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNK  3246
             +L  WK N LS AGR  LVQ+ L++   Y MQ F LP      +D+  R+F W     NK
Sbjct  736   QLPKWKANSLSQAGRTVLVQANLATKANYQMQSFFLPLPILTALDKSYRNFFWNKDPLNK  795

Query  3247  KVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKN  3426
               +L+GW+ IC  K  GGLG+RK    N AL  KL WQL+ S+  LWV+++++KYVK+ +
Sbjct  796   TANLIGWDRICLPKAFGGLGIRKAKVNNVALQIKLIWQLLKSNSSLWVRLVKKKYVKSHD  855

Query  3427  FFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIP  3606
                  + A ASW WR +M  R + + G  W+IGNG  ++FW D W    P++   ++  P
Sbjct  856   VLTHRVSAVASWQWRKLMSLRPLFKKGLRWQIGNGFDISFWDDNWVFQYPIS---QIVSP  912

Query  3607  DSQSEA-KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGA  3783
                +E+ +V D       W+   L  L+P  + D I A  +    Q  DSL W  +  G 
Sbjct  913   MPGTESLRVRDVFNEFGCWDRVFLDQLVPSHVGDQIVALYLPSSPQ-KDSLVWGLTADGQ  971

Query  3784  FSVRSAFSHIAG---NDEDAMDTSWVWKMRVTER  3876
             +SV+       G    + + ++ +W+WK++V  +
Sbjct  972   YSVKIGAMLAQGLFNPNFEKVEFNWLWKLKVPPK  1005



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score =   484 bits (1247),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 349/1153 (30%), Positives = 545/1153 (47%), Gaps = 64/1153 (6%)
 Frame = +1

Query  1087  WNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNP-SRCLNFVESFSACGLLDMGTS  1263
             WN           PWI+ GDFN++   Q +  SS + P ++  +F  + S C L D+G  
Sbjct  6     WNLLRQLRLHSTQPWIVAGDFNEVMI-QSEVDSSHLRPQAQMQSFRLTLSDCELHDLGYD  64

Query  1264  GVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnp  1443
             G  ++W          R +LDRA+       L+P+A    L    SDH P+  + +    
Sbjct  65    GFPFTWCNNRKAPDTVRARLDRAIATQPWSQLYPKAVVKHLSHGSSDHLPILIVLDPNTL  124

Query  1444  prrenrpfrfegA--WLTREDYRDIWGRVWS-NSLLDVVGAISEVTNLSK-KWNKETFGN  1611
             P       RF     W +     ++  + W      D +    + T +S  KW ++  G 
Sbjct  125   PSSRPLRKRFRFEAFWASIPGCEEVIKQTWPLPHTPDTLNRRIQNTRISLLKWYQDKVGP  184

Query  1612  IFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQD  1791
             I  R   L   +  + +    + +   Q  ER L  E   + KQEEL W Q+ +  W++ 
Sbjct  185   IKTRLRRLAQELDALSK---LSITDATQASERHLKDEQESLWKQEELYWKQRGKAHWLRC  241

Query  1792  GDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSP  1968
             GDRNTAF+H S   +R ++RI+ +K ++G W +    +     ++F  LF   ++ D   
Sbjct  242   GDRNTAFFHASATEKRTQNRIKGIKNLHGHWVTLVSDVRSTFLSYFQHLFA-SSLPDPIQ  300

Query  1969  ND--MYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVK  2139
              D  +   P+  T  M   L R  T  EV  A+ +MK   SPGPDG+   FYQ +W  V 
Sbjct  301   IDRTLAVIPRTVTDSMRSVLERPYTAAEVWPAIRNMKPLSSPGPDGLPPLFYQKYWSTVG  360

Query  2140  SHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNR  2319
                   V  +L  G +  ++  SFI LIPK   P+  + +RPI+L NV +KI SK++  R
Sbjct  361   PATVRAVLHLLNHGSMESRMNHSFIVLIPKVSDPQEPAHYRPISLSNVVYKIASKMVATR  420

Query  2320  MRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGLMAIKLDLHKAYDSI  2496
             ++PIM+ +I   Q +FL GRS  DNI++  E+ H ++  ++G+    A+KLD+ KA+D I
Sbjct  421   IKPIMEKIISKEQAAFLSGRSITDNILMAYELNHSIKTSRRGEPRYGALKLDVSKAFDRI  480

Query  2497  DWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLF  2676
             +W FLE  L   GFP + I  IM  V   + S++ NG       P RG+RQGDPL+PYLF
Sbjct  481   EWTFLEKVLRCHGFPSSTIRTIMLCVTTVTYSVMINGVPEGNIIPTRGIRQGDPLSPYLF  540

Query  2677  ILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLK  2856
             IL  + LS  +  +    +     LS     +SHL FA+D ++F+ A+    R I   L 
Sbjct  541   ILCSDTLSRLLHAECDRNSEIGFQLSPTTPKISHLLFADDTLIFSSATLAAMRGIDGVLS  600

Query  2857  KFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHT  3036
              ++  SG  IN+ KS +      +++    L    G+ +++ LG YLG+P +     K  
Sbjct  601   SYAAVSGQMINLEKSVLVIPSEPDAQYTHLLSEAVGVPLTETLGRYLGLPSMVGLSKKAA  660

Query  3037  FGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRD  3216
             F  + D +  ++ +W    LS AG+  L++S L ++P Y+MQ FKLPA    +++ +   
Sbjct  661   FRNLKDRIHSRILHWHTKFLSKAGKMVLIKSVLQAIPAYSMQCFKLPASLIAELNGLLSS  720

Query  3217  FLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKV  3396
             F W D  +  K+HL+ W+ +C++   GGLG R    FN ALLAK  W+++   D L  ++
Sbjct  721   FWWDDRGK-PKMHLLAWDKLCRATVHGGLGFRNLAIFNKALLAKQCWRILMKPDSLLAQL  779

Query  3397  MREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKP  3576
             ++ KY +N +F    +  + S+ WRS++  R ++  G  W  G+G  +N WS  W     
Sbjct  780   LKGKYYRNTSFLCASLGRSPSFTWRSLLTARELLVSGLRWCPGDGSQINIWSSPWLPR--  837

Query  3577  LAFMDEV-TIPDSQSEAKVSDFILP-NRTWNVDKLSSL-LPHDIIDGIRATPIAVCEQVS  3747
             + F   +   P+     +VSD I P  R WN   +  L LP D    I + P+       
Sbjct  838   MGFFKPIYKRPELPPTLRVSDLINPGTRDWNRSLIRHLFLPID-ASSILSIPLGTGRH-P  895

Query  3748  DSLYWPRSPTGAFSVRSAF------SHI----AGNDEDAMDTSW--VWKMRVTERCrlfl  3891
             D L W  S  GA+SV+S +       H+      +  D     W  +W++ +  +  LF 
Sbjct  896   DRLIWHFSKDGAYSVKSGYKRAWSTEHLRCPGPAHSSDTFSAFWKQLWRIALPPKILLFA  955

Query  3892  wllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHP-VSFQ  4068
             W L R  L T     R+ +  D+ C  C   +E  +H +    +AK  W   H P     
Sbjct  956   WRLCRNILPTKALLRRRNVCRDSQCEVCDQEEENWHHAIATYPWAKLVWSNIHLPWALLS  1015

Query  4069  YSLVTPLKSWVKNNCCASDWINGCPWGVT------FIYTCWEIWKARNQ-RIFENTASAP  4227
              SL  PL            W++ C   +T       +  CW IW  RN+ R+F   A +P
Sbjct  1016  ASLSDPLI-----------WVHHCFRALTASDFRKMLIGCWAIWSKRNEVRLF---ARSP  1061

Query  4228  MDIMRRAN--NLTLDTVEVFLNKKCVHVGKMRWVC--WQPPETGWIKFNTDGAFKRNTGL  4395
              D+M      N  L T     + +   +     V   W+ P  G  K N D     N  +
Sbjct  1062  -DVMSTVAFINTYLATSTTAFDPEPQPLPHSPTVTRRWEAPAHGTFKVNVDSGRAGNHTV  1120

Query  4396  ASAGGLARDHKGE  4434
              +  G+ RD +G+
Sbjct  1121  CA--GIIRDDRGK  1131



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   486 bits (1250),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 351/1157 (30%), Positives = 539/1157 (47%), Gaps = 53/1157 (5%)
 Frame = +1

Query  1048  AYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVES  1227
              Y  P    K   W+           P +  GDFN+I    E+ G    +      F E+
Sbjct  68    VYGWPETANKHLTWSLLRQVKQNNEMPLLFFGDFNEIVCLGEKEGGVPRSERLMDAFREA  127

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
                C + D+G  G  ++W R     T+ R +LDR L N E  NLFP  + + LPR  SDH
Sbjct  128   IDDCEMKDLGYKGCPFTWQRGNSPTTLIRERLDRMLANEEWCNLFPSWEMLHLPRYRSDH  187

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISE-VTNLSK  1584
              PL       +   R  + F+FE  WL++E+   I    W +   + +G+  E V+    
Sbjct  188   APLLLKTGVNDAFCRGQKLFKFEALWLSKEECGKIVEDAWGDGEGEDMGSRLEFVSRRLS  247

Query  1585  KWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLE--RKLVTELNEVLKQEELLW  1758
              W   TFGN+  RK      +  +Q+     T+     LE  R + T+L+E+ K EE  W
Sbjct  248   DWAVATFGNLKKRKKEALHLLNRLQQRAPDATT-----LEHCRVVSTDLDEIHKLEESYW  302

Query  1759  FQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDL  1935
               ++R   ++DGD+NT ++H     R++R+ I+ +L  NG W      I + +SN+F  L
Sbjct  303   HARARTNELRDGDKNTKYFHHKASQRKSRNTIKGLLDENGVWKKGKDEIGEIVSNYFQQL  362

Query  1936  FGRKNI--MDGSPNDMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQA  2106
             F   N   M+ +   M C     T  M+ +L    T  +++ A+F M    +PG DG  A
Sbjct  363   FSSGNPVDMETALEGMQC---CVTDSMNVELMAPPTGEDIRLALFSMHPNKAPGVDGFHA  419

Query  2107  AFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVS  2286
              F+Q FW  V   I +FV +          I  + + LIPK  +P +  DFRPI+L  V 
Sbjct  420   LFFQKFWHIVGRDIISFVLRWWNGDVDLSSINRTCVVLIPKCATPLSMKDFRPISLCTVL  479

Query  2287  FKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAI  2463
             +KI+SK + N+++  +  +I P Q++F+P R   DN ++  EI H M+ K G   G+ A+
Sbjct  480   YKILSKTLANKLKKFLPTIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDGTNSGVCAL  539

Query  2464  KLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGL  2643
             KLD+ KAYD ++W FLE  +   GF    I  +M  V   + +   NG       P RGL
Sbjct  540   KLDMSKAYDRVEWCFLEKVMEKMGFCAEWIVRVMACVSSVAFTFKINGVVQGSLVPSRGL  599

Query  2644  RQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASE  2823
             RQGDP++PYLF+L  +  S  I +    K      + RG   +SHLFFA+D +LF  AS 
Sbjct  600   RQGDPISPYLFLLCADAFSTLITKAANEKKIHGAQICRGAPRISHLFFADDSILFTNASV  659

Query  2824  DQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGI  3003
              +  ++ + + K+   SG  +N+SK+ +  S N    ++  + N+ G++  +    YLG+
Sbjct  660   HECSVVADIISKYERASGQQVNLSKTEVVFSRNVGRGVRNEIVNVLGVNEVEKQEKYLGL  719

Query  3004  PILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAG  3183
             P +  R  K TF  I + + +KL  WK  +LS  G+  L+++ + ++P Y M VF LP+G
Sbjct  720   PTIIGRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEVLIKAVVQAIPTYMMSVFCLPSG  779

Query  3184  TCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQL  3363
               ++I  +   F WG     +K+H   W  +C  K  GGLG R    FN ALLAK AW+L
Sbjct  780   LIDEIHSLIARFWWGSKEGERKMHWHKWEALCMPKSMGGLGFRDLHCFNQALLAKQAWRL  839

Query  3364  VTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLN  3543
               +   L   +++ +Y K   F       N S+ WRSI   +S++  G  W +G+G S+ 
Sbjct  840   CNNSYSLLSLLLKARYYKKVEFIDARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIR  899

Query  3544  FWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRAT  3720
              W D W   +  A +      DS  E +VS  +      WNV+ +      +  D I   
Sbjct  900   VWDDAWLMGEG-AHLTPTPRLDSDMELRVSALLDYEGGGWNVELVRQTFVEEEWDMILKI  958

Query  3721  PIAVCEQVSDSLYWPRSPTGAFSVRSAF-----SHIAG-----NDEDAMDTSWVWKMRVT  3870
             P++      D LYW  +  G FSV+S +      HI        + D      VW +   
Sbjct  959   PLSRFWP-DDHLYWWPTQNGYFSVKSCYWLARLGHIRAWQLYHGERDQEIWRRVWSIPGP  1017

Query  3871  ERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTH  4050
              +   F+W   +G L      + + ++E  +C+ CG+  ET+ H L +C  AK  W+ + 
Sbjct  1018  PKMVHFVWRACKGSLGVQERLFHRHISESPMCSICGEQQETICHALFDCPQAKAIWQVSA  1077

Query  4051  HPV--------SFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
             +          SF  S       W+   C   D    C          W  W  RN+ IF
Sbjct  1078  YATLIADVPRSSFDVSF-----EWLVIKCSKDDLSVVCT-------LMWAAWFCRNKFIF  1125

Query  4207  ENTASAPMDIMRRANNLTLDTVEVFLNKKCVHV--GKMRWVCWQPPETGWIKFNTDGAFK  4380
             E+ A   M++      + L+  E +  +   HV  G      W  P  GW+K N D    
Sbjct  1126  ESQALCGMEVASNFVKMVLEYGE-YAGRVFRHVAGGAPSPTNWSFPAEGWLKVNFDAHVN  1184

Query  4381  RNTGLASAGGLARDHKG  4431
              N G    G + RD  G
Sbjct  1185  GN-GEIGLGAVMRDSAG  1200



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   486 bits (1250),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 344/1196 (29%), Positives = 559/1196 (47%), Gaps = 50/1196 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              +W+  +  F+++  +   I G V   +   R    Y       K   W+       + +
Sbjct  70    LYWKEEVM-FSLVSFSQHHICGDVEDGNKKWRFVGVYGWAKEEEKHLTWSLLRHLCEDTS  128

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              P ++ GDFN+I    E+ G ++      +NF ++     L D+G  G  Y+W R     
Sbjct  129   LPILLGGDFNEILSAAEKEGGANRVRREMINFRDTLDTLALRDLGYVGTWYTWERGRSPS  188

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             T  R +LDR L +    +L+P++      R  SDH  +    +    PR + R   FE +
Sbjct  189   TCIRERLDRYLCSNSWLDLYPDSVPEHTIRYKSDHSAIVLRSQRAGRPRGKTRRLHFETS  248

Query  1483  WLTREDYRDIWGRVWSNSLLDVV-GAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
             WL  ++   +    W NS  +V+ G ++ +     +W+ + F N+  +  + +  +   Q
Sbjct  249   WLLDDECEAVVRESWENSEGEVMTGRVASMGQCLVRWSTKKFKNLSKQIETAEKALSVAQ  308

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
              +    ++    VL  K   +L+E+  + E  W+ +SR   ++DGD+NT ++H     R+
Sbjct  309   NNPISESACQECVLLEK---KLDELHAKHEAYWYLRSRVAEVKDGDKNTKYFHHKASQRK  365

Query  1840  NRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDM--YCGPKLDTGQM  2010
              R+ ++ +    G W  +   I +  +++F  +F   N  D S   +     P +     
Sbjct  366   KRNFVKGLFDGLGTWREEADHIENIFTSYFSSIFTSSNPSDLSLEAVMSVIEPVVTEEHN  425

Query  2011  HKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVP  2190
              KL    +  E+  A+  M    +PGPDG+   FYQ FW  V   +T+F+  +L     P
Sbjct  426   LKLLEPFSKDEILAALQQMHPCKAPGPDGMHVIFYQRFWHIVGDDVTSFISNILHGHSSP  485

Query  2191  PKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFL  2370
               +  + I LIPK  +P  A++FRPI L NV +K++SK IV R++  +  +I   Q++F+
Sbjct  486   SCVNNTNIALIPKVKNPTKAAEFRPIALCNVLYKLMSKAIVMRLKSFLPEIISENQSAFV  545

Query  2371  PGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQN  2547
             PGR   DN ++  E+ H M+ + + +KG +A+KLD+ KAYD ++W FL   L+  GF   
Sbjct  546   PGRLITDNALIAMEVFHSMKNRNRSRKGTIAMKLDMSKAYDRVEWGFLRKLLLTMGFDGR  605

Query  2548  LISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRV  2727
              ++LIM  V   + S + NG       P RGLRQGDPL+PYLFI+  +  S  IQ KV+ 
Sbjct  606   WVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGDPLSPYLFIMVADAFSKMIQRKVQD  665

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
             K       SR G  +SHLFFA+D +LF  A+  +  +I++ L ++   SG  IN  KS +
Sbjct  666   KQLHGAKASRSGPEISHLFFADDSLLFTRANRQECTIIVDILNQYELASGQKINYEKSEV  725

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
               S   +   K  L N+  +   D    YLGIP +  R  K  F  ++D + +KL  WK 
Sbjct  726   SYSRGVSVSQKDELTNILNMRQVDRHEKYLGIPSISGRSKKAIFDSLIDRIWKKLQGWKE  785

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
              +LS AG+  L++S + ++P Y M V+K P      I      F WG S   +K+H   W
Sbjct  786   KLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSSDTQRKIHWKNW  845

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
             + +C  K  GG+G +    FN+ALL + AW+L      L  +VM+ KY  N +F   P+ 
Sbjct  846   DSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKYFPNCDFLNAPLG  905

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              ++S+ W SI   +++++ G  WR+GNG  +N WSD W  D+   F+        +  ++
Sbjct  906   HSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLTSTPHASIRWVSE  965

Query  3628  VSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
             + DF      W    L S L    +  I A+P++    V D L W  +    +SV++A+ 
Sbjct  966   LIDF--DRMEWKTSLLESFLNERDLRCILASPLSATP-VPDELTWAFTKDATYSVKTAYM  1022

Query  3808  HIAGNDEDAMDTSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCA-TCG  3978
                G + D    +WV  W + V+ + R FLW L    L        + +T+D LC   CG
Sbjct  1023  IGKGGNLDNFHQAWVDIWSLDVSPKVRHFLWRLCTTSLPVRSLLKHRHLTDDDLCPWGCG  1082

Query  3979  DGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTF  4158
             +  ET  H + +C   +D W                L S  +N C     ++ C   V++
Sbjct  1083  E-IETQRHAIFDCPKMRDLW----------------LDSGCQNLCSRDASMSMCDLLVSW  1125

Query  4159  -----------IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD----TVEVFLNKK  4293
                         Y  W IW  RN +IF N  +    +M+R + L  +       ++    
Sbjct  1126  RSLDGKLRIKGAYLAWCIWGERNAKIFNNKTTPSSVLMQRVSRLVEENGSHARRIYQPLV  1185

Query  4294  CVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNI  4461
                 G  R   W  P    IK N D +   + G      +AR   G  LF  +  +
Sbjct  1186  PRRTGSPRQ--WIAPPADSIKLNVDASLAVD-GWVGLSVIARRSDGGVLFAAVRRV  1238



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   491 bits (1264),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 329/1185 (28%), Positives = 553/1185 (47%), Gaps = 59/1185 (5%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  P++  +   W            PW+  GDFN++ +  E+ GS     ++  +F  + 
Sbjct  501   YGHPDQTQRHHSWELLRRLGRVDLGPWLCCGDFNEVMECNEKSGSRLRRDAQMEDFKMAI  560

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
             + C L     +G  ++W  +         +LDR   NL     +    +  L    SDHH
Sbjct  561   TDCCLFQFEFTGYPFTWSNKRKDTAHVEARLDRGFGNLALLQHWGNFTSHHLVAFSSDHH  620

Query  1411  PLKFLCEAgnpprre----nrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNL  1578
             P+    +  +  +       R F+FE  W    D  ++    W N++  +    +  +NL
Sbjct  621   PILIASDGPHGDKARGPRGRRRFQFEEVWTKEVDCEEVVRHSWQNAVSPLSNIDNCASNL  680

Query  1579  SKKWNKETFGNIFGRKASLQARIKGVQE-----SVFYNTSRGLQVLERKLVTELNEVLKQ  1743
             S+ W+ E  G +  +   L+ R+  +Q        F+N S         + TEL+  L+Q
Sbjct  681   SR-WSAEKGGQVPKKVKELRLRLASLQSDEPSTQTFHNRS--------LIETELDTCLEQ  731

Query  1744  EELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNR-SRIRMLKINGEWNSDFKTISDHISN  1920
             EE+ W Q+SR  W+Q GDRNT+F+HK    RR + + + +L  N  W  ++  I      
Sbjct  732   EEIYWHQRSRVHWLQHGDRNTSFFHKQATSRRKKNALVGILDENDRWQREYDKIGGVFVE  791

Query  1921  FFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGI  2100
             FF +LF     +           ++ +   H L    +  E++ A+  +    +PGPDG+
Sbjct  792   FFTNLFTSDMGVADVEVFSAVQARVSSRSYHNLLLPYSRDEIEVALNSIGPTKAPGPDGM  851

Query  2101  QAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLN  2280
              A FYQ +W  V   ++    +VL           + + LIPK  SP   S++RPI+L N
Sbjct  852   PALFYQKYWSIVGPEVSDLCLRVLNGSDGVNDFNHTLVALIPKVHSPTRVSEYRPISLCN  911

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL-M  2457
             V +KIISK + NR++ ++  +I  FQ++F+P R   DN++   E VH ++ +       +
Sbjct  912   VLYKIISKTLANRLKKVLPEVISEFQSAFIPNRMILDNVLAAFETVHCLKRRGKTGKKKL  971

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
              +KLD+ KAYD ++W+FLE  L   GFP   I LIM  V   S SLL  G       P R
Sbjct  972   ILKLDMAKAYDRVEWQFLEQMLRTMGFPIRFIQLIMGCVTTVSYSLLIQGRPFGRIIPSR  1031

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             GLRQGDP++PYLF++  E  S  +Q+  R      ++++     ++HLFFA+D +LF  A
Sbjct  1032  GLRQGDPISPYLFLIVAEAFSALLQQAERDSRLHGVSIAPSAPSINHLFFADDSLLFCNA  1091

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
                +   +      +   SG  +N+ KS +  SP+T   ++  ++ L  +++      YL
Sbjct  1092  GTTEALELKRIFGVYELASGQKVNLGKSALCFSPSTPRVLQDDIRQLLNVTLVPCHERYL  1151

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+P +  +  K  F  + D +  K+  W+G +LS AG+  L++S   ++P Y+M VF+LP
Sbjct  1152  GLPTIVGKDKKKLFRTVKDRVWNKVNGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLP  1211

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
              G C +I+ I   F W  +   + +H   W+ +C+ K  GGLG R+   FN ALL K  W
Sbjct  1212  VGLCREIESIIAKFWWSKN-DGRGIHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGW  1270

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +L+     L  ++++ +Y  N +F A    +  S+ W+S++ GR ++ LG  WRIG+G  
Sbjct  1271  RLLEFPHSLIARMLKARYFPNSDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRL  1330

Query  3538  LNFWSDWWTG-DKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIR  3714
             +N + D W   D+   F    +IP   + ++V D    +  W+V K+ +       + I 
Sbjct  1331  VNIYGDPWVPYDR---FFTIQSIPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAIL  1387

Query  3715  ATPIAVCEQVSDSL---YWPRSPTGAFSVRSAF--------------SHIAGNDEDAMDT  3843
             + P+     + D+L    W  +  G +SV+S +                +AG    ++  
Sbjct  1388  SIPL-----MGDNLDRRIWNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSL-K  1441

Query  3844  SW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMEC  4017
             SW  +WK++V ++    LW + +  L +    +R+ +T+  +C  C    ET  H L+ C
Sbjct  1442  SWKHLWKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGC  1501

Query  4018  SFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVT-FIYTCWEIWKARN  4194
                   W     P  F    V  + +W+      + W    P   + F +T W +W  RN
Sbjct  1502  VVCLQVWEALDFPRDFLLPTVADVGTWMD-----AAWSIIPPDKQSLFAFTVWVLWNERN  1556

Query  4195  QRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGA  4374
               +F +  +    +++RA +   +               +R + W+PP     K N DGA
Sbjct  1557  GVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSLSSLVRDIKWRPPTGNCFKLNVDGA  1616

Query  4375  FKRNTGLASAGGLARDHKGEWLFGFMTNIGVS--NSFAAELWGLR  4503
                 TG   AG + RD  G  L G +     S  +  A EL+ L+
Sbjct  1617  TDMETGARGAGAIVRDSHGN-LVGALAMRAPSRISVLATELYALK  1660



>ref|XP_008340956.1| PREDICTED: uncharacterized protein LOC103403885 [Malus domestica]
Length=1256

 Score =   481 bits (1238),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 358/1237 (29%), Positives = 572/1237 (46%), Gaps = 105/1237 (8%)
 Frame = +1

Query  1024  HSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPS  1203
             HS+  +   Y   +   ++R WN+     S      +++GDFNDI D+ E  G +  + +
Sbjct  46    HSDWSLLAVYASTDAKRRKRQWNELGKRISGMTGKCVVIGDFNDIVDDVENDGGNYRSMA  105

Query  1204  RCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAII  1383
                +F E  +A  LLD+G  G  ++W  +     +Q+R LDR +       LFP AK + 
Sbjct  106   STRDFREFLAANELLDLGFEGYPFTWRNKRDEGLIQQR-LDRGVATAGWVTLFPHAKILH  164

Query  1384  LPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVG-AI  1560
             +    SDH  L    E           +     W    + R+I    W  S++  V   +
Sbjct  165   VELEGSDHSMLVLSSEGKFQRVPRRFMYDSR--WGKTPECREIIKDAWRVSVVGSVAFKV  222

Query  1561  SEVTNLSKK----WNKETFGNIFGRKASLQARIKG--VQESVFYNTSRGLQVLERKLVTE  1722
             SE    +++    W + T  N   R   L+  I+   + E+V ++  RG +         
Sbjct  223   SEKLKGTRRQLGEWKRVTKPNSQRRIVELREEIRKGLMDENVRHDYLRGKE-------KA  275

Query  1723  LNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKT  1899
             L   LK+EEL W  KSR  W+++GD+NT F+H  T+ RR  ++I  L+ I+G W+ D   
Sbjct  276   LAVALKEEELYWKVKSRNTWLREGDKNTKFFHAQTVQRRRNNQIVGLEDIHGVWHKDPTC  335

Query  1900  ISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFG  2079
             +   + ++F  LF                 K+D  Q  +L R  +  E++ A F +    
Sbjct  336   VQQIVLHYFNTLFHSGGSRLEGEVAGCVEIKVDGRQNAELIRLFSAEEIRDAAFQIPATK  395

Query  2080  SPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDF  2259
             SPGPDG  A F+Q  WE V   I   V+     GR+  K+  + I LIPK  +P+  ++ 
Sbjct  396   SPGPDGFTAGFFQDHWEVVGEDIIRMVQAFHHSGRLLKKVNHTHIVLIPKVKNPKRMTEL  455

Query  2260  RPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-  2436
             RPI L NV +KII+KV+  R+  +M  +I   Q++F+PGR   DNI++  EI+H ++   
Sbjct  456   RPIALCNVVYKIIAKVLSRRLTNVMDRIISGNQSAFVPGRQIHDNILIVHEILHSLKQGV  515

Query  2437  KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKL  2616
             +G+ G MA+KLD+ KAYD ++W FL   + +  F  +  + I   +   S S+L NG   
Sbjct  516   EGENGRMAVKLDMAKAYDRVEWHFLLDVMRNMXFHPSFCAWIRECISSVSYSVLINGVPS  575

Query  2617  APFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAED  2796
               F+P RGLRQGDPL+P+LF++  E LS  I+   R      + ++ G   +SHLFFA+D
Sbjct  576   GFFRPQRGLRQGDPLSPFLFLICAEALSAYIRANERAGLISGVRVAPGAHAISHLFFADD  635

Query  2797  LMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVS  2976
              ++F +A E++   ++  L+ +  +SG  IN++KS+IF       + K+ + +   I   
Sbjct  636   SVVFCKADENEVGTVIRILENYGRESGQIINLAKSSIFFGKWCYKKTKKRIVSRMNIQAR  695

Query  2977  DNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYT  3156
             D  G YLGI        K  F  +  GM+ ++  W    LS AG+  L++S   +M  + 
Sbjct  696   DGFGKYLGIQADFGHSKKAVFESVRRGMESRIDGWAEQFLSPAGKEVLIKSVXMAMXNHV  755

Query  3157  MQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNA  3336
             M  FKLP   C +++R+   F W +    +  + V W+ + +SK  GGLG R  + FN A
Sbjct  756   MACFKLPVTLCKEMERVIAXFFWRNQPNTRGCYWVAWDKLTESKKMGGLGFRDLVGFNLA  815

Query  3337  LLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAW  3516
             +LAK+ W+++   + +   V+R+KY  + +F       N+S GW+ I+ GR I+  G  W
Sbjct  816   MLAKIGWRVMDKPESMLSMVLRDKYFPHSSFXEARQQKNSSXGWKGILLGRQIMLRGLRW  875

Query  3517  RIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRT-WNVDKLS-SLLP  3690
             R+GNG ++     W    KP +F   +   D  +  +V + +  +R  WN++ L   + P
Sbjct  876   RVGNGETVRVADPWVP--KPHSFKPVLXSLDPNT--RVCELMTVDRQGWNLEALERGVAP  931

Query  3691  HDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIA---------GNDEDAMDT  3843
              D++  IRA P +     +D   W  + TG ++VRS + H+A         G     M +
Sbjct  932   EDMVL-IRAIPFSRY-GCADKRIWHYTKTGVYTVRSGY-HVAMDMMKNGEFGRKGRGMSS  988

Query  3844  SW---------VWKMRVTERCrlf--lwllmrgrllTNMERWRKGMTEDTLCATCGDGDE  3990
             S          +W + V  + + F          +  N+ER R  +     C  CG  DE
Sbjct  989   SMGSLGGLWKXIWLLXVPPKLQFFMWKAGRRALAVRHNLERRRIHIL--NRCELCGVNDE  1046

Query  3991  TMNHVLMECSFAKDCWRRTHHPVSFQYSLVTP-LKSW---VKN--NCCASDWINGCPWGV  4152
             T  H+   C F++  W  T   ++     V   L+ W   VK+  N   +D I       
Sbjct  1047  TEAHLFFNCEFSRSFWFGTSMQLNMAALDVQDFLEGWKLVVKHLENVEDADLILQ-----  1101

Query  4153  TFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFL------NKKCVHVGKM  4314
               ++  W IWK RN   F+   + P    R A  L    VE F        +    +G  
Sbjct  1102  QVVFGFWRIWKCRNDLFFKGVTTEP----RVAVELWHRHVEEFRTASDTSERGTGALGSD  1157

Query  4315  RW---------------------------------VCWQPPETGWIKFNTDGAFKRNTGL  4395
             RW                                 + WQ P  G +K N D A+K+ TG 
Sbjct  1158  RWDRVRGGRRVGSGEGGVRHGDGIVVGERREEVGLLXWQKPLFGTLKLNCDAAWKKATGE  1217

Query  4396  ASAGGLARDH-KGEWLFGFMTNIGVSNSFAAELWGLR  4503
                G + RD  +   L G M      ++  AE   +R
Sbjct  1218  GGVGVVLRDFGRSSLLAGGMGGERFRDAIMAEAEAIR  1254



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score =   468 bits (1205),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 281/737 (38%), Positives = 397/737 (54%), Gaps = 64/737 (9%)
 Frame = +1

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAY  2487
             +V R++ +M  LIGP Q+SF+PG  +ADNI++ QE VH MR KKG          LH A 
Sbjct  1     MVMRLKRVMPKLIGPTQSSFIPGWLSADNIVVVQEAVHSMRRKKGHT--------LHAA-  51

Query  2488  DSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAP  2667
                              P + I+ IM  V+E ++++LWNGEK   F P RGLRQGDPL+P
Sbjct  52    ---------------NLPSSWINWIMKCVKEPAMTVLWNGEKTESFIPSRGLRQGDPLSP  96

Query  2668  YLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMN  2847
             YLF+L +ERL   I   V  K WKPI++SRGG  +SH+ FA+DL+LFAEAS  Q R++  
Sbjct  97    YLFVLCLERLCHQIDLAVGTKEWKPISMSRGGPLLSHICFADDLILFAEASVAQIRVVRK  156

Query  2848  CLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVS  3027
              L+KF   SG  +++ KS IF S N + ++++ + + +GI  +  LG YLG+P+L KR++
Sbjct  157   VLEKFCIASGQKVSLEKSKIFFSQNVHRDLEKFISDESGIKSTKELGKYLGMPVLQKRIN  216

Query  3028  KHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRI  3207
             K TFG IL  +  +LA WKG MLSLAGR TL +S LSS+P++TM    LP  T +  DRI
Sbjct  217   KDTFGEILLRVSSRLAGWKGRMLSLAGRLTLTKSVLSSIPIHTMSTIALPKATLDGFDRI  276

Query  3208  CRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLW  3387
              + F+WG S + KK HL+ WN I  +K AGGLG+R     N ALLAK+ W+L+     LW
Sbjct  277   SKSFVWGSSTEKKKQHLLAWNKIYCTKQAGGLGIRSSRAMNTALLAKIGWRLLQDKSSLW  336

Query  3388  VKVMREKYVKNKNFFATPMIANASWGWRSIMRG-RSIVELGAAWRIGNGLSLNFWSDWWT  3564
              +V                          IM G R +V  G +W +G+G +  FW+D W 
Sbjct  337   ARV--------------------------IMLGMREVVIPGVSWVVGDGQTTRFWADKWL  370

Query  3565  GDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQV  3744
              + PL        P    EA+V D     R W ++ ++  +  DI   ++A  +     V
Sbjct  371   MNTPLREDIIGPAPVGLEEARVCDLWQHGRGWLLENIAPYVAPDIRLRLKAVVVDNITGV  430

Query  3745  SDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS----WVWKMRVTERCrlflwllmrgr  3912
              D L W  S  G F+V+SA+S +  ++    D S     VWK+   ER ++FLWL +   
Sbjct  431   RDRLSWGESLDGKFTVKSAYSSLMKDNTPRSDLSRMYDRVWKVIAPERVKIFLWLGVHQV  490

Query  3913  llTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLK  4092
             ++TNMER R+ +++  +C  C  GDET+ H+L +C      W R              L 
Sbjct  491   IMTNMERQRRHLSDTGICQVCKGGDETIIHILRDCPAMYGIWTRIIPRRKRGTFFTQTLL  550

Query  4093  SWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTV  4272
              WV +N   S  ++GCPW        W  WK R   +F        D+++   +   + +
Sbjct  551   EWVYDNLGDSGKVDGCPWSCVR----WG-WKWRCGNVFGVNGKC-RDMVKFVRDRASEVI  604

Query  4273  EVFL---NKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
             +  L   N   +     R V W  P  GW+K NTDGA K N GLA+AGG+ R   G W+ 
Sbjct  605   QAHLVEGNSGKIRGRIERMVSWVKPAEGWLKLNTDGASKGNPGLATAGGILRQQDGSWIG  664

Query  4444  GFMTNIGVSNSFAAELW  4494
             GF  NIG+ ++  AELW
Sbjct  665   GFAVNIGICSAPLAELW  681



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score =   493 bits (1270),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 368/1222 (30%), Positives = 572/1222 (47%), Gaps = 63/1222 (5%)
 Frame = +1

Query  946   FWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRV--SFAYVRPNRMAKERFWNDCLSYSSEF  1119
              + S  F   V+ +  Q +H  V+ P  ++ +  +F Y +  R  +   WN   + +++ 
Sbjct  915   LFHSVEFICEVLLDHPQCLHVRVTIPWLDLPIFTTFVYAKCTRSERTPLWNCLRNLAADM  974

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               PWI+ GDFN I   +E+   +  +     +F      CGLLD G  G  ++W      
Sbjct  975   EGPWIVGGDFNIILKREERLYGADPHEGSIEDFASVLLDCGLLDGGFEGNPFTW---TNN  1031

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             R  QR  LDR ++N +  N FP  +   L R  SDH PL   C   N   +    FRF  
Sbjct  1032  RMFQR--LDRMVYNQQWINKFPITRIQHLNRDGSDHCPLLLSC--SNSSEKAPSSFRFLH  1087

Query  1480  AWLTREDYRDIWGRVWS-----NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
             AW    ++       W+     + L+        +    K WNK  FG+IF      + R
Sbjct  1088  AWALHHNFNASVEGNWNLPINGSGLMAFWSKQKRLKQHLKWWNKTVFGDIFSNIKEAEKR  1147

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             ++  +       + G ++   K   +LN+ L  EE+ W QKS   W+ +G+RNT F+H  
Sbjct  1148  VEECEILHQQEQTIGSRIQLNKSYAQLNKQLSMEEIFWKQKSGVKWVVEGERNTKFFHMR  1207

Query  1825  TLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
                +R RS I ++ + +G W  D + +     +FF  L   ++  D       C   +  
Sbjct  1208  MQKKRIRSHIFKIQEQDGNWIEDPEQLQQSAIDFFSSLLKAESCDDTRFQSSLCPSIISD  1267

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                  L  E T+ EVK+AVF +    + GPDG  + FYQ  W+ +   +   VK+     
Sbjct  1268  TDNGFLCAEPTLQEVKEAVFGIDPESAAGPDGFSSHFYQQCWDIIAHDLFEAVKEFFHGA  1327

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P  +  + + LIPK  S    S+FRPI+L  V  KII+K++ NR+  I+ ++I   Q+
Sbjct  1328  DIPQGMTSTTLVLIPKTTSASKWSEFRPISLCTVMNKIITKILANRLAKILPSIITENQS  1387

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
              F+ GR  +DNI+L QE++  +  +K + G +A+KLD+ KAYD +DW FL   L   GF 
Sbjct  1388  GFVGGRLISDNILLAQELIGKLD-QKNRGGNVALKLDMMKAYDRLDWSFLFKVLQHLGFN  1446

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
                I +I   +     SLL NG  +  F+  RGLRQGD ++P LFILA E L+  +    
Sbjct  1447  AQWIGMIQKCISNCWFSLLLNGRTVGYFKSERGLRQGDSISPQLFILAAEYLARGL--NA  1504

Query  2722  RVKNWKPITLSRGGT-GVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
                 +  +  S G +  VSHL FA+D+++FA  S+   + IM  L+++   SG  IN  K
Sbjct  1505  LYDQYPSLHYSSGCSLSVSHLAFADDVIIFANGSKSALQKIMAFLQEYEKLSGQRINPQK  1564

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL--HKRVSKHTFGYILDGMKRKL  3072
             S +    N  S  ++ +   TG S      TYLG P+   HK+V    F  ++  ++ ++
Sbjct  1565  SCVVTHTNMASSRRQIILQATGFSHRPLPITYLGAPLYKGHKKVM--LFNDLVAKIEERI  1622

Query  3073  ANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKV  3252
               W+   LS  GR TL++S LSS+P+Y +QV K P      I+R+  +FLWG S  +K++
Sbjct  1623  TGWENKTLSPGGRITLLRSTLSSLPIYLLQVLKPPVIVLERINRLLNNFLWGGSTASKRI  1682

Query  3253  HLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFF  3432
             H   W  I      GGL +R   D   A   KL W+  T+ + LW + MR KY   +   
Sbjct  1683  HWASWGKIALPIAEGGLDIRNVEDVCEAFSMKLWWRFRTT-NSLWTQFMRAKYCGGQLPT  1741

Query  3433  ATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDS  3612
                   + S  W+ ++   SI E    WRIG+G  L FW D W G++PL   ++     +
Sbjct  1742  DVQPKLHDSQTWKRMVTISSITEQNIRWRIGHG-ELFFWHDCWMGEEPLVNRNQAF---A  1797

Query  3613  QSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSV  3792
              S A+VSDF L N +WNV+KL ++L  ++++ I   PI      +D  YW  +P G FS 
Sbjct  1798  SSMAQVSDFFL-NNSWNVEKLKTVLQQEVVEEIVKIPIDTSS--NDKAYWTTTPNGDFST  1854

Query  3793  RSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCAT  3972
             +SA+  I     +    +++W   V      FLW L+   +   ++   KG    + C  
Sbjct  1855  KSAWQLIRNRKVENPVFNFIWHKSVPLTTSFFLWRLLHDWIPVELKMKTKGFQLASRCRC  1914

Query  3973  CGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCA----SDWIN-G  4137
             C   +E++ HV+ +   A   W  ++    FQ  ++ P    +    CA     D+   G
Sbjct  1915  C-KSEESLMHVMWKNPVANQVW--SYFAKVFQIQIINPCT--INQIICAWFYSGDYSKPG  1969

Query  4138  CPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVE--------------  4275
                 +  ++T W +W  RN     N    P  ++ +   L     +              
Sbjct  1970  HIRTLVPLFTLWFLWVERNDAKHRNLGMYPNRVVWKILKLLHQLFQGKQLQKWQWQGDKQ  2029

Query  4276  ------VFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEW  4437
                   + L        K+  + W  P  G +K N DG+ K N   A+ GGL RDH G  
Sbjct  2030  IAQEWGIILKADAPSPPKL--LFWLKPSIGELKLNVDGSCKHNPQSAAGGGLLRDHTGSM  2087

Query  4438  LFGFMTNIGVSNSFAAELWGLR  4503
             +FGF  N G  +S  AEL  L 
Sbjct  2088  IFGFSENFGPQDSLQAELMALH  2109



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   482 bits (1241),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 345/1140 (30%), Positives = 542/1140 (48%), Gaps = 62/1140 (5%)
 Frame = +1

Query  1126  PWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRT  1305
             P +  GDFN+I    E+ G +         F E+   C L D+G SG +++W R    RT
Sbjct  94    PIVFFGDFNEILHASEKEGGAVRGERHIDEFRETVELCELGDLGYSGGAFTWQRGLEERT  153

Query  1306  VQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAW  1485
             + R +LDR L       LFP A     P   SDH P+    ++G   RR+ + F FE  W
Sbjct  154   IIRERLDRFLACDRWGTLFPHAWVKNFPIYKSDHAPILLSTDSGQQERRKGKRFHFEALW  213

Query  1486  LTREDYRDIWGRVWSNS---LLD--VVGAISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
             L+  D + +  + W+ S    +D  + G  SE+    ++W   TFG++  R    +  ++
Sbjct  214   LSNSDCQTVVKQAWATSGGSQIDERIAGCASEL----QRWAAVTFGDVKKRIKKKEEELQ  269

Query  1651  GVQESVFYNTSRGLQVLER--KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
                  V+ N +   ++L +  +LV EL+E+ +  E  W  ++R   ++DGD+NT+++H  
Sbjct  270   -----VWQNKAPDGRMLGKCKELVRELDELNRLHESYWHARARANEMKDGDKNTSYFHHK  324

Query  1825  TLIRRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
                R+ R+ I  L+ + G W +D K +S  IS++F ++F   +  +         PK+  
Sbjct  325   ASQRKKRNAIHKLRDSAGVWKTDEKDVSAIISDYFTNIFASSSPANFDDALAGLSPKVPH  384

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                  L  E T+ EV+ A+F M    +PG DG+ A FYQ FW  V   I  F++    +G
Sbjct  385   TANEVLMAEPTVDEVRDALFQMHPNKAPGVDGMHALFYQKFWHIVGDDIVLFIRDWW-NG  443

Query  2182  RVPPKIL-ESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQ  2358
             RV    L  + I LIPK  +P+   DFRPI+L  V +KI+SK++ NR++  + +LI   Q
Sbjct  444   RVQIGSLNRTCIVLIPKCSNPQQMGDFRPISLCTVLYKILSKMMANRLKVFLSDLISLHQ  503

Query  2359  NSFLPGRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFG  2535
             ++F+PGR   DN +   EI H M R   GKKG+MA KLD+ KAYD ++W FLE  +   G
Sbjct  504   SAFVPGRLITDNAMTAFEIFHSMKRGGDGKKGVMAFKLDMSKAYDRVEWSFLERVMGRLG  563

Query  2536  FPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQE  2715
             F +  +  IM  +   S S   NG       P RGLRQGDPL+PYLF+L  E  S  + +
Sbjct  564   FCEGWVRRIMECLSSVSYSFKLNGSVEGNIIPSRGLRQGDPLSPYLFLLCAEAFSALLSK  623

Query  2716  KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVS  2895
                        + R    +SHLFFA+D +LF  A+  +  ++ + L  +   SG  IN  
Sbjct  624   AAGDGLIHGARVCRSAPRISHLFFADDSILFTRAALQECSVVADILSTYERASGQKINFD  683

Query  2896  KSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLA  3075
             KS +  S N +   K  +++L G+   +    YLG+P +  R  K  F  + + + +KL 
Sbjct  684   KSEVSFSKNVDDSRKNDIRSLFGVREVERHEKYLGLPTVIGRSKKMVFTVLKERVWKKLQ  743

Query  3076  NWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVH  3255
              WK  +LS AG+  L+++ + S+P Y M +F +P    ++I+ +C  F WG     +++H
Sbjct  744   GWKEKLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSEINAMCARFWWGSRGTERRMH  803

Query  3256  LVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFA  3435
              + W  +C  K  GG+G R    FN ALLAK  W+L+  +  +   V   +Y    NF  
Sbjct  804   WLSWEKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHNGSMAHAVFNARYYPRSNFLN  863

Query  3436  TPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQ  3615
                  + S+ WRSI   +S++  G  WR+G+G S+  W + W   +  A    V  P+ +
Sbjct  864   ARRGFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGESAAV---VPTPNME  920

Query  3616  SEA--KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
             S A  +VSD +  +  W+   L +    + I  IR  P++   +  D  YW  S  G F+
Sbjct  921   SPADLRVSDLLDASGRWDELVLRNHFTEEDILLIREIPLS-SRKPPDLQYWWPSTDGFFT  979

Query  3790  VRSAF------------SHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMER  3933
              +SA+             H  G + +      +W +    + + FLW    G L T    
Sbjct  980   TKSAYWLGRLGHLRGWLGHFGGANGEVWKV--IWGLEGPPKLKHFLWRACMGALATRGRL  1037

Query  3934  WRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKS------  4095
               + + ED  C  C   DE++ H +  CS     W  +  P ++ Y    P  S      
Sbjct  1038  KERHIVEDGCCTHCNREDESIVHAIFRCSLVSPIWENS--PFTY-YVRDGPTSSFMDFFV  1094

Query  4096  WVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFE----NTASAPMDIMRRANNLTL  4263
             W+ +    +D +       +F+   W  W  RN   FE    N   + +  M+  ++   
Sbjct  1095  WLISRMERTDLL-------SFMAMAWAAWSYRNSVTFEEPWSNVTVSVVGFMKLVSDYKS  1147

Query  4264  DTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
                 VF     V  G      W  P+ G  + NTD A     GL   G + RD +G  L 
Sbjct  1148  YAALVF-RAGPVTTGFPSRSSWVAPDEGRFRLNTDAAMLAE-GLVGVGAVVRDSRGSVLL  1205



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   478 bits (1229),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 315/1048 (30%), Positives = 511/1048 (49%), Gaps = 37/1048 (4%)
 Frame = +1

Query  1354  NLFPEAKAIILPRTHSDHHPLKF-LCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS  1530
              LFP A    L +  SDH P+   L +         R FRFE AWL  E    +  + W 
Sbjct  8     TLFPTAVVTHLLKYKSDHCPIVVRLVQPRRQREGSRRTFRFETAWLLEEGCESVVKQAWD  67

Query  1531  NSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLER  1707
              S+   V+  I  V      W+ ++  N+  +  + +  +K  Q+      S    +   
Sbjct  68    GSVGAGVMERIGGVAGGLVSWSSKSLHNLGKQIKNTEKALKEAQQR---RISPANCLTCN  124

Query  1708  KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWN  1884
              L  +L+++  ++E  WF +SR   ++DGD+NT ++H     RR R+R++ +L   G W+
Sbjct  125   NLEAKLDDLNCKQEAYWFMRSRASEVRDGDKNTKYFHHKASHRRTRNRMKGLLDSEGVWH  184

Query  1885  SDFKTISDHISNFFIDLFGRKNIMDGSPNDMY------CGPKLDTGQMHKLTREVTMCEV  2046
              D   + + +  ++ DLF           ++         P+++      L+R  T  E+
Sbjct  185   EDEDKMQEIVEKYYHDLFTSTEPTTAQMQEVLKHMERVISPEIN----EVLSRPYTKAEI  240

Query  2047  KKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIP  2226
              +A+  M    +PGPDG+ A F+Q FW  V   +   V  +L  G +P     + I +IP
Sbjct  241   FEALQQMHPSKAPGPDGMHAIFFQKFWHIVGDDVAGLVINILHGGEMPEHFNRTNIVMIP  300

Query  2227  KKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILT  2406
             K   P   S +RPI+L NV +K++SK IV R++ I+ +L+   Q++F+PGR   DN+++ 
Sbjct  301   KIKDPTELSKYRPISLCNVIYKLVSKAIVIRLKTILPDLVTENQSAFVPGRQITDNVLIA  360

Query  2407  QEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRES  2583
              E+ H M+ + K ++G++A+KLD+ KAYD ++W FL+  L+  GF    ++LIM  V   
Sbjct  361   MELFHTMKQRNKCRRGIIAMKLDMSKAYDRVEWGFLKKLLLTMGFDGRWVNLIMNCVTTV  420

Query  2584  SISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGG  2763
               S + NG+      P RGLRQGDPL+PYLFIL  +  S  +   V+ K       SR G
Sbjct  421   QYSFVINGQVRGAVSPSRGLRQGDPLSPYLFILVADAFSKMLLNAVQEKRIHGAKASRSG  480

Query  2764  TGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKR  2943
               +SHL FA+D +LFA A+  +   +++   K+   SG  IN  KS +  S     E K 
Sbjct  481   PVISHLLFADDSLLFARATRQECLAVVDLFNKYEEASGQKINYEKSEVSFSKGVRFEQKE  540

Query  2944  GLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLV  3123
              L  L  +   D  G YLGI  +  +  K  F  ILD + +KL  WK  +LS AG+  L+
Sbjct  541   ELLGLLNMRQVDRHGKYLGITTVAGQSKKAIFTAILDRIWKKLRGWKEKLLSRAGKEVLL  600

Query  3124  QSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGL  3303
             +S + ++P Y M ++K P    + I      F WG S   +++H   W  +C+ K  GGL
Sbjct  601   KSVIQAIPTYLMGIYKFPVSVTSTISSAMAQFFWGQSGGGRRIHWKNWKAMCELKCLGGL  660

Query  3304  GLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMR  3483
             G +    FN+ALL + AW+++     L  KVM+ KY ++ +F   P+    S+ WR I  
Sbjct  661   GFKDLEIFNDALLGRQAWRIMNGEHTLLGKVMKAKYYRHCSFLDAPLGYAPSYSWRGIWS  720

Query  3484  GRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TW  3660
              +++V+ G  WR+GNG  +N W D W  D+   F+      +++  +KVS+ I  +   W
Sbjct  721   SKALVKEGMLWRVGNGQDINIWRDPWIADETGRFIQS---DEAEEVSKVSELIHSDTGEW  777

Query  3661  NVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMD  3840
             N++ L+ L      + I A P++   Q  D + W  + +G +SV++A+    G + D   
Sbjct  778   NLELLARLFTERDQECILAIPLSERSQ-RDIITWAFTKSGEYSVKTAYMVGKGFELDNFH  836

Query  3841  TSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLME  4014
              +WV  W +  + + R FLW L  G L T      + + E+  C  CG   ET  H + E
Sbjct  837   NAWVTIWNIEASPKVRFFLWRLCTGTLPTKALLHYRHLIEEEHCPWCG-AVETDRHAIFE  895

Query  4015  CSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARN  4194
             CS   + W  +      Q    T +  +V +                     W IW  RN
Sbjct  896   CSRVAELWEGSGSSHLIQSVGTTTMLDFVASRKSLEK-----KEQQKLAMLAWCIWSERN  950

Query  4195  QRIFENTASAPMDIMRRANNLTLD----TVEVFLNKKCVHVGKMRWVCWQPPETGWIKFN  4362
             +++F NT +    ++ R + LT +    +  ++ +++    G  +   WQ P  G +K N
Sbjct  951   EKVFNNTFTPNTVLLARLHRLTTEHDKYSQRIYGSRREGSRGSAK--IWQSPAVGHVKLN  1008

Query  4363  TDGAFKRNTGLASAGGLARDHKGEWLFG  4446
              D +   + G    G +ARD+ G  LF 
Sbjct  1009  CDASLAVD-GWRGLGVVARDNAGRVLFA  1035



>ref|XP_011085143.1| PREDICTED: uncharacterized protein LOC105167219 [Sesamum indicum]
Length=1203

 Score =   479 bits (1232),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 347/1166 (30%), Positives = 553/1166 (47%), Gaps = 72/1166 (6%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
             +  ++ Y +  R  +   W D L    +   PW++ GDFN +    E+ G ++       
Sbjct  66    ILCTWVYAKHTRAERRELW-DALRNIDDGEEPWLLGGDFNTVLYCSERKGGAAPKIRTME  124

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
             +F +    CGL D G  G  ++W R    R  QR  LDR L++      FP ++   L R
Sbjct  125   DFGDMMMDCGLQDAGFEGSKFTWSR---SRLWQR--LDRFLFSHTWTQAFPLSRIQHLTR  179

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN-----SLLDVVGA  1557
               SDH PL  L       +    PFRF+  W    D++      W +      +      
Sbjct  180   NVSDHCPL--LLSVKQEKKTGPTPFRFQNMWTKHHDFKHCVTTSWQHPIHGHGMFAFQQK  237

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             +  +    K WN E FGNIF      + R+K  +++   + S    +   K   EL   L
Sbjct  238   LHRIKAALKLWNTEVFGNIFQNITDAEQRVKIAEQAYDGDPSDENLIAMNKATAELTFAL  297

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHIS  1917
               EE  W QK+   W+++G++NT ++H  T  +R +SRI  ++ NG   +  + I   + 
Sbjct  298   SVEESYWKQKAACKWLEEGEKNTKYFHSLTKKKRKQSRIYKIQHNGATLTKAEDIKVSVV  357

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPK-LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPD  2094
             ++F   F R + +  S +D++  P  L     H+L    T+ +VK  +FDM    + GPD
Sbjct  358   DYFTQAFTRDDTV--SVDDLHWVPNILSEEDRHQLNATPTIEDVKTIIFDMCPHSTAGPD  415

Query  2095  GIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK-ILESFITLIPKKDSPETASDFRPIT  2271
             G  A F+Q  WE +   +   V   L  G  PPK    + I LIPK ++P T  DFRPI+
Sbjct  416   GFSAHFFQCCWEIIGQDLYGAVLDFL-SGSTPPKNFTTTTIVLIPKIEAPSTWKDFRPIS  474

Query  2272  LLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG  2451
             L NV+ KI+SKVI N+M  ++  +I P Q+SF+ GR  +DNI+L QE+ H +    GK G
Sbjct  475   LCNVTGKILSKVINNQMAKLLPKIISPSQSSFVQGRMISDNILLAQELSHCL----GKNG  530

Query  2452  LMA---IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAP  2622
              ++    K+D+ KAYD ++W FL   L+  GFP + I++I   +     S+L NGE +  
Sbjct  531   SLSNTIFKIDMEKAYDRVNWTFLYHMLMRVGFPTHWINMIKKLIENCWFSILINGEGVGF  590

Query  2623  FQPGRGLRQGDPLAPYLFILAMERLS----WDIQEKVRVKNWKPITLSRGGTGVSHLFFA  2790
             F+  RGLRQGDPL+P LF++A E LS    W  Q++ R+        +R    +SHL FA
Sbjct  591   FKSTRGLRQGDPLSPTLFVIAAECLSRGLDWLFQQQPRMN-----FFARSSKNISHLAFA  645

Query  2791  EDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGIS  2970
             +D+++F++ +    + +M  L+ +   SG  IN  KS+      T++   R ++ +TG  
Sbjct  646   DDIIIFSKGTRKDLKTLMEFLRHYELISGQRINKEKSSFTVDKKTSNMRIRCIQQVTGFR  705

Query  2971  VSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPV  3150
             +     TYLG P+         F  ++  ++ K+  W+  +LS  GR  L++S LS+MP 
Sbjct  706   LKYLPITYLGAPLFKGNKKGALFDELIQKIRNKITGWEKALLSHGGRLQLIKSVLSAMPT  765

Query  3151  YTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFN  3330
             Y +QV K P      I+R+   FLWG++ + +K++   W+DIC   + GG G+R+  D  
Sbjct  766   YLLQVLKPPKYVMERIERLFNKFLWGNTGEQRKLNWSSWDDICYPTEEGGFGVRRIQDVV  825

Query  3331  NALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGA  3510
             +A   KL W+   +   LW     EKY    +     +   AS  W+ + R R   +   
Sbjct  826   HAFQLKLRWRF-RNQSSLWALFFLEKYCTGSHPVPAKLSYIASPNWKRMCRHRKEADRQI  884

Query  3511  AWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLP  3690
              W +G G  ++FW D W G+KPL  +    +PD +      +    N +WNV KL  +L 
Sbjct  885   FWSLGKG-HISFWFDNWIGEKPLFEI----MPDFEWNTTPVNNYWENNSWNVAKLREVLT  939

Query  3691  HDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWVWKMRVT  3870
              D++  I   P  V    SD+  W  S  G FS+++ ++ +            +W   VT
Sbjct  940   ADMVHQICQIPFDV--DTSDTPLWKLSGDGIFSMKATWNSLRQTRATQQLVKEIWSPFVT  997

Query  3871  ERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTH  4050
                 +F+W L+  +L  + +  +KG+   + C+ C +  E++ HV +E +  +  W   H
Sbjct  998   PTMSVFMWRLINDKLPVDEKLQKKGIQLASKCSCC-NHVESLQHVFIEGNGIRCVWE--H  1054

Query  4051  HPVSFQYSL-----VTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENT  4215
                 F  +L     +  L ++ + +    + I      +  +   W  W  RN     N 
Sbjct  1055  FARKFNMNLPNTDNIVLLLNYWRISALGQNHIR----MIVPMLILWFGWLERNDVKHRNK  1110

Query  4216  ASAPMDIMRRANNLTLDTVEVFLNKKCVHVG------------------KMRWVCWQPPE  4341
                   I  + +   + T +    K+    G                  K++ V W  PE
Sbjct  1111  NFNSDRIKWKVHQHIVTTFKSKTTKRINWKGDRFVAKFMGLELGSQYKPKIKIVKWTKPE  1170

Query  4342  TGWIKFNTDGAFKRNTGLASAGGLAR  4419
              GWIK NTDGA K N G A AGG+AR
Sbjct  1171  LGWIKINTDGASKGNPGRAGAGGIAR  1196



>ref|XP_009147172.1| PREDICTED: uncharacterized protein LOC103870758 [Brassica rapa]
Length=1637

 Score =   487 bits (1254),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 341/1139 (30%), Positives = 543/1139 (48%), Gaps = 63/1139 (6%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+S I    +       I   V     +  +S  Y  P    KE  W           
Sbjct  327   LFWKSDI-KLDIKYADKNLIDMKVHYGEVSFFLSCIYGEPASEGKEIVWERISRIGVRRR  385

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
               W ++GDFN+I  N E+ G      S    F +  SACG+ ++ +SG+ ++W  Q   +
Sbjct  386   EKWCLIGDFNEILSNDEKIGGPQRPESSFKPFGDMLSACGMEELESSGIRFTWAGQRWQK  445

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +Q   LDRA  N      FP +    L +  SDH P+  L +      RE   FRF+  
Sbjct  446   WIQC-CLDRAFGNKAWLQAFPASNQKFLDKRGSDHRPV--LVKFQVSQAREAGLFRFDKK  502

Query  1483  WLTREDYRDIWGRVWSNSLL-----DVVGAISEVTNLSKKWNKETFGNIFGRKASLQARI  1647
             +L +   +      W  S +      VV  + +   +   W KE   N   R   L+ R+
Sbjct  503   FLFQPGVKQKIIEAWRISEVGSVNRSVVKRLRDCRGVLSTWKKERIFNAKDRIHILERRL  562

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
             +  Q S  Y     ++V+ +    EL    K+EEL W QKS   W++ GDRN+ F+H+S 
Sbjct  563   EWFQ-SRNYPCWHAIRVIRK----ELCRAYKEEELFWQQKSMEKWLKYGDRNSNFFHES-  616

Query  1828  LIRRNRSRIRMLKI---NG--EWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPK  1992
              ++ NR++I+++KI   NG   W+ + K  +    ++F +LF   N            P+
Sbjct  617   -VKANRAKIKLIKIKDVNGVERWSEEAK--AQVALDYFNELFKSSNPPSYQQVFQEMVPR  673

Query  1993  LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVL  2172
             +       L  EVT  E+K AVF +K   +PGPDG+   F+Q FWEEV + ++  VK   
Sbjct  674   VSDAMNQGLMAEVTEEEIKSAVFSIKASSAPGPDGMSGLFFQQFWEEVGTKVSLEVKNFF  733

Query  2173  RDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGP  2352
               GR+P     +++ L+PK   PET +D RPI+L +V +KIISKVIV R++P++  +I  
Sbjct  734   ERGRMPTDWNFTYLCLLPKVQDPETMADLRPISLCSVLYKIISKVIVRRLQPLLPEIISV  793

Query  2353  FQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
              Q++F+  R   DNI +  E VH +R+ +   K  M +K D+ KAYD ++W +L + +  
Sbjct  794   NQSAFVAERLITDNIGIAHEAVHALRVNQSIMKEYMVVKTDMSKAYDKVEWSYLRTLMEA  853

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              GF    I L+M  V   S ++L N +     +P RGLRQGDPL+P+LF++  E L+  +
Sbjct  854   LGFATVWIDLVMACVSSVSFAVLVNDKPFGMIRPQRGLRQGDPLSPFLFVICTEGLTHLL  913

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
                 R+     +  S  G  V HL FA+D +   +A++++ +++   L ++   +G  IN
Sbjct  914   NRAERMSLLNGLKFSEEGPSVHHLLFADDSLFMCKATQNEAQILHEVLLRYGKATGQTIN  973

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
             + KS I      + E K  ++ + GI        YLG+P            Y+   +  +
Sbjct  974   LQKSAISFGAQIDHECKVVIQEVLGIMNEGGSSKYLGLPECFSGSKIELLDYLRSRVNGR  1033

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
             L  W    LS  G+  L+++  S++PV+ M VFKLP     +I     +F WG  A  +K
Sbjct  1034  LNAWYLRKLSQGGKEILLKTTASALPVFPMSVFKLPKKVIANISGAMANFWWGSDAHLRK  1093

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNF  3429
             +H + W  +C SK++GG+G R    FN ALLAK AW+++++   L  ++++ +Y  N NF
Sbjct  1094  IHWIAWEKLCLSKESGGMGFRDLEAFNQALLAKQAWKVLSAPHCLLAQLLKSRYFPNSNF  1153

Query  3430  FATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAF------MD  3591
                 +    S+ WRS++ GR ++  G   R+G+G S+N W+D W  D+   +      + 
Sbjct  1154  LEAKIGDRPSYAWRSLLFGRELLIKGLQKRVGDGNSINVWTDRWMEDEADGYGLRAPWIK  1213

Query  3592  EVTIPDSQSEAKVSDFILPNRTWNVDKLSSL-LPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
               T   +     + DF   NR WNV  L  + +P DI   I+  P+   E   D   W  
Sbjct  1214  NCTFNVNLRARDLIDF--QNRRWNVQALEEVFVPSDIQILIKNQPVTSKE---DFWTWKF  1268

Query  3769  SPTGAFSVRSAFSHIAGNDEDAMDTSW-------------VWKMRVTERCrlflwllmrg  3909
             + +GA+SV+S +  +A  ++     SW             VWK++   + ++FLW  +  
Sbjct  1269  NKSGAYSVKSGY-WLASQEKSKDLRSWVEAFPSINTLKAQVWKVQSVPKIKIFLWKALSQ  1327

Query  3910  rllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ-------  4068
              L        +GM  D  C  CG   E++NHVL  C  A+ CW  ++ P   +       
Sbjct  1328  ALPVAELLSERGMKCDERCQLCGFEGESVNHVLFSCHLARQCWALSNIPSPRKGFNDQSI  1387

Query  4069  YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRR  4245
             Y  +  L    K      + +   PW        W +WK RN  IFE  +    +I R+
Sbjct  1388  YENLDYLLRLSKAVTTDGEAVRRWPW------MLWFLWKNRNTFIFEGKSFDAEEISRK  1440



>ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa]
Length=1257

 Score =   479 bits (1233),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 336/1122 (30%), Positives = 525/1122 (47%), Gaps = 87/1122 (8%)
 Frame = +1

Query  964   FNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMG  1143
              +  V   T   I  ++    +  + +F Y  P+   +   WN+  +       PW + G
Sbjct  23    IDLTVRTATPNYIDTIIQYKGTTFQATFVYGEPDHSKRLAVWNELTTLQPATGDPWFLTG  82

Query  1144  DFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKL  1323
             DFN++ DN E+ G +         F    S   L D+   G   SW  + G   VQ R L
Sbjct  83    DFNELVDNSEKKGGAERAEGTFCAFRTFLSENDLYDLKHYGNFLSWRGKRGSHVVQCR-L  141

Query  1324  DRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDY  1503
             DR L N    +LFP A+   L    SDH PL                       L+  D 
Sbjct  142   DRTLTNSGWSDLFPAARCQYLKFEGSDHRPL-----------------------LSFLDT  178

Query  1504  RDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASL-QARIKGV-QESVFYN  1677
                 GR        V     E+   SK++ + +  NI   +  L +A   G+ +E + Y 
Sbjct  179   SRSKGR-------KVFRCRREICKWSKQFQENSRANIEDLRLKLDEAMSSGLNKEDLIY-  230

Query  1678  TSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR  1857
                       +L  +L +  K EE  W Q+SR++W+  GD NTA++H  T  R+ ++R+ 
Sbjct  231   ----------QLNAQLLQSYKSEEAFWRQRSRQLWLILGDANTAYFHAVTKGRKAKNRLS  280

Query  1858  MLKING--EWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK-LTRE  2028
             +++ +    W  +   I+  +  ++  LF   +  DG            T Q+++ LT++
Sbjct  281   VMEDDSGVPWFEE-DQIASVVCKYYNSLFTSSH-HDGQSTVWEALQPCITQQINEELTKD  338

Query  2029  VTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILES  2208
              +  E+++A F +    +PGPDG   +F+Q  W  V   I   V+     G + P    +
Sbjct  339   PSPEEIREATFAIHPDKAPGPDGFSVSFFQANWCVVGPAIIKEVQLFFSTGTLRPSQNNT  398

Query  2209  FITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTA  2388
              + LIPKK   +  +D+RPI L NV FKIISK++  R++P++  +I    ++F+PGR+  
Sbjct  399   HVRLIPKKTGAKRVADYRPIALCNVFFKIISKILSLRLKPVLNIIISENHSAFIPGRAIT  458

Query  2389  DNIILTQEIVHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIM  2565
             DN+++T E++ +++  K +K   MA+K D+ KAYD I+W+F+E  L   GF     + I+
Sbjct  459   DNVLITHEVLQFLKHSKAEKNCTMAVKTDMSKAYDRIEWKFIEKVLQRLGFSDIWTNWIL  518

Query  2566  FSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPI  2745
               V   S S L N   L   +P RG+RQGDPL+PYLFIL  + LS    +  R    + I
Sbjct  519   QCVSTVSYSYLINETVLGSVKPHRGIRQGDPLSPYLFILCGQVLSGLCSKAERDGTLQGI  578

Query  2746  TLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNT  2925
              ++RG   V+HL FA+D M F  AS +    + + L  +   SG  IN  KS+I  S  T
Sbjct  579   RVARGSPRVNHLLFADDTMFFCNASPESCSKLKSILLDYEKASGQKINSEKSSITFSSKT  638

Query  2926  NSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLA  3105
               + K   K L GI      G YLG+P    R  +  F  ++D ++++ ++W    LS A
Sbjct  639   PEDKKSAAKTLLGIDKEGGTGKYLGLPEYFGRKKRDMFTSVVDRIRQRASSWATRRLSKA  698

Query  3106  GRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQN-KKVHLVGWNDICK  3282
             G+ T+++S L S+P Y M  F+LPA  C  I  +   F W D   N KK+  + W+ + K
Sbjct  699   GKLTMLKSVLLSIPTYPMSCFELPASLCKRIQSVLTRFWWDDPQSNSKKMCWIAWSKMTK  758

Query  3283  SKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASW  3462
              K  GGLGLR    FN ALLAK AW+++T+ D L  +V+  KY    +F      A  S 
Sbjct  759   PKAGGGLGLRDIQLFNQALLAKQAWRILTAPDCLLARVLLGKYCHKASFLQAETPAVCSH  818

Query  3463  GWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVT----IPDSQSEAKV  3630
             GWRSI+ GR +++      IGNG     W+D W     LA  + +     IP+S  + +V
Sbjct  819   GWRSILHGRDLLKGNVGKAIGNGEDTKVWNDSW-----LALQENIKIYGPIPESGIDLRV  873

Query  3631  SDFILPNRTWNVDKLSSLLP--HDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             SD +     WN  +L   +P   D +  IR +        SD+  W  S +G +S +S +
Sbjct  874   SDLLTSEMKWNESRLQEFIPLVADRVKCIRPSETG----ASDTFIWQASKSGKYSFKSGY  929

Query  3805  SHIAGND-----EDAMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDT  3960
               ++ ND      D     W   +W    + + ++FLW + +  L   +    +G+  + 
Sbjct  930   FTVSMNDATPEPSDHNGFDWIKDIWTGSFSPKMQMFLWSIAQNALPLGVNLQHRGINSEA  989

Query  3961  LCATCGDGDETMNHVLMECSFAKDCWR----RTHHPVSFQYSLVTPLKSWVKNNCCASDW  4128
             +C  C +  ET  H    C FA+  W     +    ++   S    +  + K  C     
Sbjct  990   VCMRCKEV-ETAMHTFFFCPFAQGVWDLIPLQREIVIATDRSFKDAITRFRKAVCLPPSG  1048

Query  4129  ING--CPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRA  4248
             I G   PW       CW +W ARN  IFE+  + P +   RA
Sbjct  1049  ITGNILPW------VCWTVWTARNTLIFEDQHNTPEETAARA  1084



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score =   468 bits (1203),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 264/823 (32%), Positives = 421/823 (51%), Gaps = 32/823 (4%)
 Frame = +1

Query  2041  EVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITL  2220
             EVK A  +M    +PGPDG Q  FY TFWE +   +   V+ ++     P  +  ++I L
Sbjct  18    EVKAAALNMGGLKAPGPDGFQGVFYHTFWENIVGDVNDLVRSIIMGQDNPINLNSTYIVL  77

Query  2221  IPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNII  2400
             IPK  +PE  S FRPI+L N S+KI+SKV+ NR++PI+  +I P QN+F+ GR   DNI 
Sbjct  78    IPKVQNPEMVSQFRPISLCNYSYKILSKVLANRLKPILTEIISPMQNAFVAGRQIQDNIR  137

Query  2401  LTQEIVHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVR  2577
             L  E+ H+++++K K+   + IKLD+ KAYD ++W+FL++ +   GF  +   LIM  V 
Sbjct  138   LAHEVFHFLKVRKAKRRFEVGIKLDMQKAYDRVEWDFLDAVMERMGFGISWRKLIMGCVS  197

Query  2578  ESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSR  2757
               + ++L NG+    F    GLRQGDPL+PYLF+L  + LS  IQE V  +  + + LS 
Sbjct  198   SVNFAVLLNGQPGEKFAHSHGLRQGDPLSPYLFLLVGKVLSRMIQEAVERRQLEGVKLSV  257

Query  2758  GGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEI  2937
              G  +SH+FF +D ++F +        +++ LK +   SG  IN+ KS++F   N  S +
Sbjct  258   AGPVISHIFFTDDTLIFLKEDRKNCNNLVDLLKDYCNASGQAINMQKSSVFFGNNVQSTL  317

Query  2938  KRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRT  3117
                L N+ G++V +N G+YLG+P +  R  K    Y+   +  KL  WK +MLS AG   
Sbjct  318   SEELGNILGMTVVENPGSYLGVPAIWGRSKKLGLAYVKGRILGKLQGWKQSMLSRAGNEV  377

Query  3118  LVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAG  3297
             L+++ + ++P Y M +FK PA  C ++D +   F W DS+  +K H V    +   K  G
Sbjct  378   LIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSSGRRKTHWVSMETLGLPKHLG  437

Query  3298  GLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSI  3477
             G+G R   DFN+ALLAK  W+L+   D LW +VM+ +Y  N +F         SW W S+
Sbjct  438   GMGFRNFQDFNDALLAKQCWRLIVEPDSLWAQVMKARYFSNCSFLDATKGDRTSWAWSSL  497

Query  3478  MRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NR  3654
             + GR +++ GA W+I  G  +  W D W     L               +VS  I P ++
Sbjct  498   LVGRDLIQKGAHWQIMGGEEVRLWVDRWXPALLLGHPSPSGDVAVTRNTRVSSIICPSSK  557

Query  3655  TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF----------  3804
             TW+ + L   L  +    IR TPI    +  D L W  +  G++SV+S +          
Sbjct  558   TWDFEFLLPFLSAEECAAIRDTPIGNPRR-KDRLVWASNRNGSYSVKSGYLWLQLQSLSL  616

Query  3805  -SHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATC  3975
               H +       +  W  +W+++V  + RLFLW  +   L+T    +++  +   +C  C
Sbjct  617   IDHRSPISRSVPELLWKGIWRVKVPAKVRLFLWSSLHNALVTVAVLFQRRSSPTPICPIC  676

Query  3976  GDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVK-------NNCCASDWIN  4134
                +E++ H+L+ C +    W       + Q  + +   +W+         +  + +W+ 
Sbjct  677   LCQEESVEHLLLSCPWVFSIWSGGALKYNIQVGIFSSWGAWLHAVFTSNLGSLASKEWVQ  736

Query  4135  GCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLT---LDTVEVFLNKKCVHV  4305
                      +TCW IWK+R   +F      P  ++          L+   V +N + V  
Sbjct  737   -----TYMAFTCWHIWKSRCDYVFNQVPIIPSKVIMGIGFSVAEFLNARSVPVNSQSVDR  791

Query  4306  GKMRWVC-WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
             G +R +C W PP + ++K N D ++ R      A  +ARD +G
Sbjct  792   GLVRQLCRWTPPVSPFVKLNVDASWSRVNNSGFAAVVARDARG  834



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score =   477 bits (1227),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 332/1127 (29%), Positives = 544/1127 (48%), Gaps = 56/1127 (5%)
 Frame = +1

Query  1237  CGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHP-  1413
             CG++++ +SG  ++W  + G   +Q R LDRA  N +  + FP +    L +  SDH P 
Sbjct  5     CGMIELPSSGNPFTWSGKRGNLWIQSR-LDRAFGNQKWFDQFPASNQAFLDKRGSDHRPV  63

Query  1414  -LKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKW  1590
              +K +    +         RF    L  E     W     NS +++   I        +W
Sbjct  64    LIKLISSQDSYRGSFKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRW  123

Query  1591  NKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKS  1770
              K+   N   R   +Q  ++  Q S+  +  R ++ L + LV    +  K+EE  W QK 
Sbjct  124   KKKNVSNSKLRITKIQVELEQEQSSMNPSFPR-MENLTKSLV----KAYKEEENFWKQKC  178

Query  1771  RRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRK  1947
             +  WI  GD NT  +H +  + R+++ I  L+  NG +     +      N+F DLF   
Sbjct  179   KDDWILHGDGNTKIFHAAVQVARSKNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKST  238

Query  1948  NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFW  2127
             N +D S        ++       LTR++T  EVK+AVF +K   +PG DG+   F+Q +W
Sbjct  239   NSVDYSDLLRDLPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298

Query  2128  EEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKV  2307
             E V   +T  V      G +P     + I LIPKK +    SD RPI+L  V +K ISK+
Sbjct  299   EIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTISKI  358

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKA  2484
             + +R++  +  ++ P Q++F+  R  +DNIIL  E VH +R  +   K  MA K D+ KA
Sbjct  359   LASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDMSKA  418

Query  2485  YDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLA  2664
             +D ++W +L++ L+  GF    +  IM  V   + S+L NG+      P RGLRQGDP++
Sbjct  419   FDRVEWHYLQALLLSLGFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPIS  478

Query  2665  PYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIM  2844
             P+LF+L  E L+  + +     + K I  +  G  V HLFFA+D +   +A   Q ++  
Sbjct  479   PFLFVLCTEGLTHMMNQASLRGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQ  538

Query  2845  NCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRV  3024
             +   K+   +G  IN+SKS++    NT   +K  +K+  GI      G+YLG+P      
Sbjct  539   DIFLKYGEATGQVINLSKSSLTFGKNTCPSLKAQIKSKLGIYSEGGAGSYLGLPECFSGS  598

Query  3025  SKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDR  3204
                   YI D MK +++ W    LS AG+  +++S   +MP+Y M  FKLP  TCN++  
Sbjct  599   KVEMLAYIQDKMKGRMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKS  658

Query  3205  ICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKL  3384
                 F W  S    K+H + W+ +C SK+ GG+G +    FN ALLAK AW+++T+ D L
Sbjct  659   AMAAFWWQASEDKSKIHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSL  718

Query  3385  WVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWT  3564
               + ++ +Y  N +F +  + +  S+ WRSI+ GR ++E G    +GNGLS++ WS  W 
Sbjct  719   LTRFLQSRYFSNGSFLSATLGSRPSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWL  778

Query  3565  GDKP---LAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLLPHDIIDGIRATPIAV  3732
              D     +  M  + +       KVSD ++PN   W+  KL +L     I+ I     AV
Sbjct  779   IDGERLRIPLMKNILV---DLNLKVSDLMIPNSDLWDHQKLENLFYDQDIEIILKIKPAV  835

Query  3733  CEQVSDSLYWPRSPTGAFSVRSAF----------SHIAGNDEDAMD--TSWVWKMRVTER  3876
                  D L W  + +G +SV+S +          ++++     +++   S +W +    +
Sbjct  836   SS--PDFLCWNHTRSGEYSVKSGYWFAEKEAKKEAYVSSQALPSLNGIKSHIWSLNTAPK  893

Query  3877  CrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHP  4056
              ++FLW ++ G +        +GM  D+ C  CG   E+MNHVL  C+ A+  W   H P
Sbjct  894   IKVFLWKVIGGAISVADHLIERGMKVDSRCQICGLEGESMNHVLFNCTIARQSWAICHFP  953

Query  4057  V-------SFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENT  4215
                     S  YS +  +     N           PW        W+IWK RN  +F+ +
Sbjct  954   APVNGFDPSSIYSNIFYVLKMGNNQNWPVHIRRSGPW------ILWQIWKNRNSFLFKGS  1007

Query  4216  ----ASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVC--WQPPETGWIKFNTDGAF  4377
                 +     +++ A++  L   E+   ++ + + K + +   W+PP + W K +    +
Sbjct  1008  LIVGSKFATSLLQEADHWFL-IKEMEKQEQAIDLEKKKRIIFGWKPPPSSWFKCDIGFDW  1066

Query  4378  KRNTGLASAGGLARDHKGEWLFG---FMTNI--GVSNSFAAELWGLR  4503
              +N   + A  + R+ +G+ L       +NI     +SF + LW L 
Sbjct  1067  DKNRKESGAAWILRNAEGKVLLHGRRSFSNIRSKSESSFQSWLWALE  1113



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score =   475 bits (1222),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 334/1187 (28%), Positives = 522/1187 (44%), Gaps = 84/1187 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+  +  F+++  +   I G V       R    Y  P    K R W+       +  
Sbjct  33    LFWKEEV-QFSLVSFSHHHICGDVEDGVKKWRFVGIYGWPKEEEKHRTWSLIRHLCEDTI  91

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              P +  GDFN+I    E+ G +        NF E+     L D+G  G  ++W R     
Sbjct  92    LPILFGGDFNEILCYAEKEGGADRIRREMSNFRETMDNLALRDLGYVGTWHTWERGTSPS  151

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             T  R +LDR + +     L+P        R  SDH  +    +  + P +  +   FE  
Sbjct  152   TCIRERLDRFISSDSWFTLYPHTSVEHTLRYKSDHSAIVIKPQKFSRPTKRKKRRYFETC  211

Query  1483  WLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
             WL  E+   +    W  S+   V G +  +      W+ E F  I               
Sbjct  212   WLLDENCEAVVRTAWDASIGTSVTGRVESMGQALLTWSAENFTKI---------------  256

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
                                             W+ +SR   ++DGDRNT ++H     RR
Sbjct  257   ------------------------------AYWYLRSRVAEVKDGDRNTKYFHHKATQRR  286

Query  1840  NRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDM--YCGPKLDTGQM  2010
              R+ ++ +    G W  D   I +  +++F  +F   N  D   +++  +  P +     
Sbjct  287   KRNYVKGLFDEQGTWWDDADNIENIFTSYFDSIFTSSNPSDSDFDEVLQFIDPVVSAACN  346

Query  2011  HKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVP  2190
              +L R  T  E+  A+  M    +PG DG+ A FYQ FW  +   +T FV  +L     P
Sbjct  347   QQLLRPFTKDEIYAAIQQMHPCKAPGHDGMHAIFYQRFWHIIGDDVTLFVSNILHGILSP  406

Query  2191  PKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFL  2370
               +  + I LIPK  +P  A+DFRPI L NV +K++SK +V RM+  +  +I   Q++F+
Sbjct  407   SCVNNTNIALIPKVKNPTKAADFRPIALCNVLYKLVSKSLVIRMKDFLPQMISEQQSAFV  466

Query  2371  PGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQN  2547
             PGR   DN ++  E+ H M+ + + ++G +A+KLD+ KAYD ++W FL   L+  GF   
Sbjct  467   PGRLITDNALIAMEVFHSMKNRSRSQRGTIAMKLDMSKAYDRVEWGFLRKLLLTMGFDGR  526

Query  2548  LISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRV  2727
              ++L M  V   + S + NG       P RGLRQGDPL+PYLFI+  +  S  IQ+KV+ 
Sbjct  527   WVNLSMNCVSSVTYSFIINGGVCGSVVPARGLRQGDPLSPYLFIMIADAFSKMIQKKVQD  586

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
             K       SR G  +SHLFFA+D +LF  A+  +  +I++ L  +   SG  IN  KS +
Sbjct  587   KQIHGAKASRSGPDISHLFFADDKLLFTRATRQECTVIVDILNLYELASGQKINYEKSEV  646

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
               S   +S  +  L ++  +   D    YLGIP +  R  K  F  + D + +KL  WK 
Sbjct  647   SFSKGVSSTQREELTSILNMRQVDKHEKYLGIPSISSRSKKAIFDSLTDRIWKKLQGWKE  706

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
              +LS AG+  L++S +  +P Y M V+K+P      I      F WG S   +KVH   W
Sbjct  707   KLLSRAGKEILLKSVIQVIPTYLMGVYKIPCMIIQKIQSAMARFWWGSSNSQRKVHWKSW  766

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
             + +C  K  GG+G +    FN+ALL + AW+L+   + L+ +VM+ KY  + +F   P+ 
Sbjct  767   DSLCSPKCLGGMGFKDLKVFNDALLGRQAWRLIREPNLLFGRVMKAKYFPHCDFLDAPLG  826

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              ++S+ WRSI   +++V+ G  WR+GNG  +  W D W  D+   F+     P+    + 
Sbjct  827   YSSSYSWRSIWSSKALVKEGVIWRVGNGTQIKLWDDPWVADENGRFLTSEKNPNF---SL  883

Query  3628  VSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             VSD I L N  W  +   S      I  I  TP++    V D L W  +    +SV++A+
Sbjct  884   VSDLIDLENMEWRTEIFDSSFNERDIRCILGTPLS-SAPVKDELTWAFTRDAHYSVKTAY  942

Query  3805  SHIAGNDEDAMDTSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCG  3978
                 G + D    SWV  W++ V+ + R FLW L    L        + +T D  C    
Sbjct  943   MIGKGGNLDNFHQSWVDIWRLEVSPKVRHFLWRLCTDSLPVRSLFKYRHLTNDDCCPWGC  1002

Query  3979  DGDETMNHVLMECSFAKDCWRRT-------HHPVSFQYSLVTPLKSWVKNNCCASDWING  4137
                ET NH +  C      W            P +F   ++   + + K           
Sbjct  1003  GLQETRNHAIFHCPILAALWSDIGCESLLDFDPEAFMCDILASWRGFDKKM---------  1053

Query  4138  CPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVE----VFLNKKCVHV  4305
                 +T  Y  W +W  RN  +F    S+   ++ R      +  +    ++ ++     
Sbjct  1054  ---QITGAYLAWVLWGERNNLVFNTKTSSHGILLARVYRYVEENEKYAGSIYTSRTASPC  1110

Query  4306  GKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
                R   W PP  G  K N D       G      +AR   G+ +F 
Sbjct  1111  SSPR--HWVPPPAGVTKINVDACLGVE-GWVGLSAIARKSNGDVVFA  1154



>ref|XP_009140393.1| PREDICTED: uncharacterized protein LOC103864388 [Brassica rapa]
Length=1377

 Score =   469 bits (1208),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 338/1191 (28%), Positives = 547/1191 (46%), Gaps = 62/1191 (5%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +SF Y  P R  +   WN+    +      W + GDFN++ +N E+ G      S   +F
Sbjct  101   MSFVYGDPVRQRRIAVWNELKVIALNRTGGWFLAGDFNELMNNSEKVGGPPRQESSFFDF  160

Query  1219  VESFSACGLLDMGTSGVSYSW--FRQEGGRTVQRR-----KLDRALWNLEAQNLFPEAKA  1377
                   C L ++ +SG   SW   R+     V+ +     +LDRA  N E   +FP++  
Sbjct  161   RAMARDCRLKEIPSSGNRLSWGGVREIMENGVKEKVWVQCRLDRAFGNAEWFRIFPQSHT  220

Query  1378  IILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGA  1557
             + L +T SDH P+       N  +R    F F+  W  + +  ++  R W ++ +   G+
Sbjct  221   VYLEKTGSDHRPI--FTSLANIGQRRTGRFMFDKRWCQKPEITEVIRRGWCSNFISGQGS  278

Query  1558  ISEVTNLSK----KWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTEL  1725
             +SE     +    KW +    N       L+  ++ V+ES  +     L +L   L  +L
Sbjct  279   VSERIKSCRQELCKWKRHANVNSSVTIRRLRRELE-VEESKRWPN---LLILP-SLRLDL  333

Query  1726  NEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKING---EWNSDFK  1896
              +   +EE  W QK +  W+Q GD+NT  +H     RR +++I  L  N    +++ D  
Sbjct  334   EKAYDEEEAFWKQKCKNSWLQVGDKNTKVFHGWVESRRMKNKIHSLIDNAGIEQFSED--  391

Query  1897  TISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKF  2076
              +      +F +LF      D S       P++       L + ++  E+++AV ++K  
Sbjct  392   EMGKVAVEYFQELFHSTGSADVSELLDGMAPRVTESMNIGLIKPISDAEIRRAVKEIKSD  451

Query  2077  GSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASD  2256
              +PG DG+   F+Q FW  V   +T  V++   DG +P     + + L+PK  +P    D
Sbjct  452   STPGVDGMTGQFFQKFWNIVGPQVTHEVRRFFDDGLLPVDWNYTELCLLPKVQNPNQMKD  511

Query  2257  FRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK  2436
              RPI+L +V +KI+SKV+ +R++ ++ +++ P Q +F+ GR  +DN+++  E+VH +R  
Sbjct  512   LRPISLCSVVYKIVSKVLCDRLKVVLPHIVSPAQGAFVAGRLISDNLLIAHEMVHGLRTN  571

Query  2437  KG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEK  2613
                K   +AIK D+ KAYD ++W+FLE+  +  GF Q  +S IM  VR  S S++ NG+ 
Sbjct  572   PACKSDFIAIKTDMSKAYDRVEWDFLEALFLKLGFHQRWVSWIMLCVRSVSYSVILNGQS  631

Query  2614  LAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAE  2793
                F P RG+RQGDPL+P+LFIL  E L   + +  +      + L+     V HL FA+
Sbjct  632   YGHFTPERGIRQGDPLSPFLFILCAEALVHTMSKAEQEGVLTGMKLAPSCPAVQHLLFAD  691

Query  2794  DLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISV  2973
             D      AS  +    +  LK +   SG  IN  KS I      +  ++R L  L  I  
Sbjct  692   DSFFLCRASLAECTEFLRRLKLYGDSSGQMINFQKSAITFGAGIDPIMRRVLAELLNIEK  751

Query  2974  SDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVY  3153
                 G YLG+P       +    +I + M ++L  W    LS  G+  L++S   ++PVY
Sbjct  752   EGGDGKYLGLPECFSGSKQQLLAFIGEKMSKRLKGWFAKKLSFGGKEVLLKSIAMALPVY  811

Query  3154  TMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNN  3333
              M  F+L    C  I      F W ++ + KK+H + W  +C SK+ GGLG R   DFN 
Sbjct  812   AMSCFRLTKHLCQKIMSAMASFWWDENDEKKKIHWISWKKLCISKENGGLGFRDIEDFNQ  871

Query  3334  ALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAA  3513
             ALLAK AW+L+     L  ++ + +Y  + +F  +      S+ WRSI+ GR ++  G  
Sbjct  872   ALLAKQAWRLLNDPTSLIARIYKGRYFASSDFMNSGKGYRPSYAWRSILFGRELLNKGLM  931

Query  3514  WRIGNGLSLNFWSDWWTGD----KPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSS  3681
               IGNG S   WS  W  D    +P+    E+ I       +VS  I  +  W+V+KL  
Sbjct  932   KSIGNGNSTFVWSHNWILDETPRRPINKQPEIDI-----NLRVSSLIGDDGQWDVNKLQC  986

Query  3682  LLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW----  3849
               P + +  IR  P+     V D   W  SP G+++V+S +       E A   +     
Sbjct  987   RFPQNEVTRIRQLPVG---DVPDRDIWAYSPNGSYTVKSGYKVATQAKETAEVQAMSLKP  1043

Query  3850  --------VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
                     +WK+    + R FLW    G L        +G+  D  C  C    E++ HV
Sbjct  1044  GVLELKGIIWKVATLPKIRNFLWRAASGALAVAERLNTRGLNLDLRCKICKAATESIEHV  1103

Query  4006  LMECSFAKDCWRRTHH---PVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWE  4176
             L +CS A + W        P     S++  L +++      +D +      +   +  W 
Sbjct  1104  LFKCSLAHEAWSSAGFQSLPHVGNLSVIDCLSAYLH---MMNDVLIPLEQRLAIPWILWT  1160

Query  4177  IWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVC-----WQPPE  4341
             IWK RN  ++  T  +    +++A        E  LNKK V +  +  +      W PP 
Sbjct  1161  IWKNRNMLLYAETQVSITIQIKQALEEACTWHE--LNKKAVSLENITGLNEETKRWDPPL  1218

Query  4342  TGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVS-NSFAAEL  4491
              G++K N    ++     +    + RD +G  L      I  S N   +EL
Sbjct  1219  AGYVKCNFHANWRNAALHSGVAFIVRDQRGNVLHHARDAITFSPNRITSEL  1269


 Score = 61.6 bits (148),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +3

Query  732  MIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLFNV  911
            M  L WNCRG+ + LTV   + + R++    +  LETK N+ D + K+   LGFD  + V
Sbjct  1    MTTLVWNCRGLRSNLTVRRLEEMCREHLPDFLFLLETK-NSSDHVIKLWSSLGFDHCYLV  59

Query  912  DPLGFAGGLTLFLEI*H  962
            DP+G +GGL LF +  H
Sbjct  60   DPVGLSGGLALFWKKKH  76



>gb|EEC84753.1| hypothetical protein OsI_31756 [Oryza sativa Indica Group]
Length=1350

 Score =   479 bits (1233),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 311/994 (31%), Positives = 485/994 (49%), Gaps = 79/994 (8%)
 Frame = +1

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             N PW++MGDFN++    E +     N S+   F ++  +C L D+G  G+ +++  +  G
Sbjct  370   NLPWLVMGDFNEVLWQYEHFSKRPRNESQMRAFRDALHSCELHDLGFRGLPHTYDNKREG  429

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
                 + +LDRA+ +   +++F  A+   L    SDH P+       +  +   +  ++E 
Sbjct  430   WNNVKVRLDRAVADGNWRDVFSNAQLSHLVSPCSDHCPIVLQLSGDSRTQGRKKCLQYEI  489

Query  1480  AWLTREDYRDIWGRVWSN-----SLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
              W       ++ G  WS       L ++  A+ +V      W++    N+       + R
Sbjct  490   FWEREAAISEVIGEAWSEYGTKEDLGEINKALGKVMIALHSWSRTKCKNVGRELERARKR  549

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +  + E+     + G  V  R++   +N++L +EE+LW Q+SR  W+++GDRNT F+H  
Sbjct  550   LSNLLEA----NADGATV--RQVTDNMNDLLYREEMLWLQRSRVSWLKEGDRNTKFFHSR  603

Query  1825  TLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTG  2004
                    S+I  L         F+T                              K+   
Sbjct  604   V------SKITRL---------FQT------------------------------KVSAK  618

Query  2005  QMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGR  2184
                KL  + T  EV  A+F +    +PGPDG  A FYQ  W  +KS I   VK+  R G 
Sbjct  619   MNDKLCEDFTEEEVAIAMFQIGPIKAPGPDGFPAHFYQRNWGGLKSDIVRAVKEFFRSGI  678

Query  2185  VPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNS  2364
             +P  + ++ I LIPK D P    D RPI L NV +K++SK +VNR++P++  LI   Q++
Sbjct  679   MPVGVNDTAIVLIPKIDQPTELKDLRPIGLCNVIYKVVSKCLVNRLKPLLDELISVNQSA  738

Query  2365  FLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
             F+PGR   DN +L  E  HY++  K   K   A KLDL KAYD +DW FLE  +   GF 
Sbjct  739   FVPGRMITDNALLAFEYFHYIQKNKNPNKAASAYKLDLSKAYDRVDWGFLEQAMYKLGFA  798

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
                +  IM  +     S+ +NG  L  F P RGL QGDPL+P+LF+   + LS  + EKV
Sbjct  799   HRWVRWIMECITTVRYSVKFNGTLLDSFAPSRGLCQGDPLSPFLFLFLADGLSLLLDEKV  858

Query  2722  RVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKS  2901
             +     PI +     G+SHL FA+D +LF +A  +Q  +I   L  ++  +G  IN SK 
Sbjct  859   QQGVLSPIHICHSAPGISHLLFADDTLLFLKAVPEQAEVIREVLNDYATATGQQINPSKC  918

Query  2902  NIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANW  3081
             +I    +++  ++  +++   I+ +     YLG P    R+ K  F  I + + ++L  W
Sbjct  919   SIMFGDSSSELVQEAIRDTLQIANNVFEDKYLGFPTPDGRLKKGKFQSIQERIWKRLIQW  978

Query  3082  KGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLV  3261
               N LS  G+  L+++ + ++PVY M +FKLP   C+++ RI R F WG     +K H  
Sbjct  979   GENYLSSGGKEILIKALIQAIPVYVMGIFKLPESVCDELTRITRGFWWGGEKGARKTHWK  1038

Query  3262  GWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATP  3441
              W+ + K K+ GGLG R    FN ALLA+ AW+L+ S D L   V++ KY  N N   T 
Sbjct  1039  AWDTLTKPKNCGGLGFRDFRLFNQALLARQAWRLIDSPDSLCAMVLKAKYFLNGNLTDTS  1098

Query  3442  MIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSE  3621
                NAS GWR+I  G  +++ G  WRIGNG S+  W D W    P           S  +
Sbjct  1099  FGGNASPGWRAIEFGLELLKKGIIWRIGNGRSVRIWRDPWI---PRDHSRRPITKKSNYK  1155

Query  3622  AK-VSDFILPNRTWNVDKLSSL---LPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
              K V+D +     W+V+++  +   +  ++I  IR       + VSD + W     G FS
Sbjct  1156  TKWVTDLLTDAGEWDVNRVRQIFWPIDAEVILKIRVP----SQDVSDFVAWHPDRLGRFS  1211

Query  3790  VRSAFS-HIAGNDEDAMDTS----------WVWKMRVTERCrlflwllmrgrllTNMERW  3936
             VRSA+S  ++   E+A   S           +WK  V ++ ++F W +    L T + + 
Sbjct  1212  VRSAYSLAVSLASENAFSASSAVDRSKAWNMLWKCNVPQKVKIFAWKVALDCLATMVNKK  1271

Query  3937  RKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
             R+ +    +CA CG  +E   H L  C  AK  W
Sbjct  1272  RRKLEATDVCAICGTEEEDSAHALCRCPHAKSLW  1305



>gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAV32224.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1936

 Score =   482 bits (1240),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 311/1041 (30%), Positives = 514/1041 (49%), Gaps = 34/1041 (3%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             ++F Y  P    + R W+   +       PW+++GDFN+     E +  +    ++  NF
Sbjct  738   ITFVYGEPRVENRHRMWSLLRTIRQSSALPWMVIGDFNETLWQFEHFSKNPRCETQMQNF  797

Query  1219  VESFSACGLLDMGTSGVSYSW-FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
              ++   C L D+G  GV +++  R++G R V+ R LDRA+ + + ++LFPEA+   L   
Sbjct  798   RDALYDCDLQDLGFKGVPHTYDNRRDGWRNVKVR-LDRAVADDKWRDLFPEAQVSHLVSP  856

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS-----LLDVVGAI  1560
              SDH P+       +  R   +   +E  W    +   +    W N+     L D+  A+
Sbjct  857   CSDHSPILLEFIVKDTTRPRQKCLHYEIVWEREPESVQVIEEAWINAGVKTDLGDINIAL  916

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
               V +  + W+K    N+ G++  L+   K +++ +  N +R      R+    +NE+L 
Sbjct  917   GRVMSALRSWSKTKVKNV-GKE--LEKARKKLEDLIASNAARSSI---RQATDHMNEMLY  970

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             +EE+LW Q+SR  W+++GDRNT F+H   + R  +++I  L+  NG  +S    +    +
Sbjct  971   REEMLWLQRSRVNWLKEGDRNTRFFHSRAVWRAKKNKISKLRDENGAIHSTTSVLETMAT  1030

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
              +F  ++     ++          K+      KL +E    E+ +A+F +    SP PDG
Sbjct  1031  EYFQGVYKADPSLNPESVTRLFQEKVTDAMNEKLCQEFKEEEIAQAIFQIGPLKSPRPDG  1090

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A FYQ  W  +KS I   V+   + G +P  + ++ I LIPKKD P    D+RPI+L 
Sbjct  1091  FPARFYQRNWGTLKSDIILAVRNFFQSGLMPKGVNDTAIVLIPKKDQPIDLKDYRPISLC  1150

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGL  2454
             NV +K++SK +VNR+RPI+ +L+   Q++F+ GR   DN +L  E  H ++  KK     
Sbjct  1151  NVVYKVVSKCLVNRLRPILDDLVSKEQSAFIQGRMITDNALLAFECFHSIQKNKKANSAA  1210

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
              A KLDL KAYD +DW FLE  L   GF    +S IM  V     S+ +NG  L  F P 
Sbjct  1211  CAYKLDLSKAYDRVDWRFLELALNKLGFAHRWVSWIMLCVTTVRYSVKFNGTLLRSFAPT  1270

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RGLRQG+PL+P+LF+   + LS  ++EKV   +  P+ + R   G+S+L FA+D +LF +
Sbjct  1271  RGLRQGEPLSPFLFLFVADGLSLLLKEKVAQNSLTPLKICRQAPGISYLLFADDTLLFFK  1330

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A + +  ++   L  ++  +G  IN +K +I     + S +   ++N   +   +    Y
Sbjct  1331  AEKKEAEVVKEVLTNYAQGTGQLINPAKCSILFGEASPSSVSEDIRNTLQVERDNFEDRY  1390

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG P    R+ K  F  +   + +++  W  N LS  G+  L+++ + ++PVY M +FK 
Sbjct  1391  LGFPTPEGRMHKGRFQSLQAKIAKRVIQWGENFLSSGGKEILIKAVIQAIPVYVMGLFKF  1450

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P    +++ ++ R+F WG     ++ H   W+ + K+K  GGLG R    FN ALL + A
Sbjct  1451  PDSVYDELTKMTRNFWWGADNGRRRTHWRAWDSLTKAKINGGLGFRDYKLFNQALLTRQA  1510

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+L+   + L  +V++ KY  + +   T   ANAS  W  I  G  +++ G  WRIGNG 
Sbjct  1511  WRLIEFPNSLCAQVLKAKYFPHGSLTDTTFSANASPTWHGIEYGLDLLKKGIIWRIGNGN  1570

Query  3535  SLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILPNRTWNVDKLSSLLPHDIIDGI  3711
             S+  W D W    P           +    K VSD I  + TW+  K++        D I
Sbjct  1571  SVRIWRDPWI---PRDLSRRPVSSKANCRLKWVSDLIAEDGTWDSAKINQYFLKIDADII  1627

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAF---------SHIAGNDEDAMDTSW--VWK  3858
             +   I+   +  D + W    TG FSVRSA+         ++ + +    ++ SW  +WK
Sbjct  1628  QKICISARLE-EDFIAWHPDKTGRFSVRSAYKLALQLADMNNCSSSSSSRLNKSWELIWK  1686

Query  3859  MRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
               V ++ R+F W +    L T   + ++ +    +C  C    E   H L  C  A   W
Sbjct  1687  CNVPQKVRIFAWRVASNSLATMENKKKRNLERFDVCGICDREKEDAGHALCRCVHANSLW  1746

Query  4039  ---RRTHHPVSFQYSLVTPLK  4092
                 +  + VS  +   T +K
Sbjct  1747  VNLEKGKYVVSVNFPKTTAIK  1767


 Score = 48.1 bits (113),  Expect(2) = 3e-140, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query  729  SMIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLFN  908
            +M  L+WNCRG+GN  TV   ++L++      +   ET+  +V+++ ++  KL F     
Sbjct  635  AMSCLAWNCRGLGNTATVQDLRALIQKAGSQLVFLCETR-QSVEKMSRLRRKLAFRGFVG  693

Query  909  VDPLGFAGGLTLF  947
            V   G +GGL L+
Sbjct  694  VSSEGKSGGLALY  706



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   477 bits (1228),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 340/1139 (30%), Positives = 532/1139 (47%), Gaps = 70/1139 (6%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  P    K   W          + P I  GDFN+I    E+ G +  +      F ES 
Sbjct  96    YGWPKATNKHLTWALMRELKDTISLPVIFFGDFNEILHASEKEGGAVRSERLIDAFRESV  155

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
               C + D+G  G +++W R     ++ R +LDR L +     LFP A+    P   SDH 
Sbjct  156   ELCKVHDLGYRGGTFTWRRGNDASSMIRERLDRFLASDGWDELFPHARVRNFPIYRSDHA  215

Query  1411  PLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKW  1590
             P+    E     RR  R F FE  WL+  D  ++ G V +++L              + W
Sbjct  216   PILLETEEEGQRRRNGRRFHFEALWLSNPDVSNV-GGVCADAL--------------RGW  260

Query  1591  NKETFGNIFGRKASLQARIKGVQES--VFYNTSRGLQVLER--KLVTELNEVLKQEELLW  1758
                 FG+I       + RIK  +E   V+++ +   ++LE+  ++V EL+E+ +  E  W
Sbjct  261   AAGAFGDI-------KKRIKSKEEELQVWHSQAPDGRMLEKCKEIVKELDELNRLHESYW  313

Query  1759  FQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISDHISNFFIDL  1935
               ++R   ++DGDRNTA +H     R+ R+ IR LK + GEW    + +S  I+++F ++
Sbjct  314   HARARANEMRDGDRNTAHFHHKASQRKKRNMIRKLKDDTGEWKEKEEDVSRIITDYFSNI  373

Query  1936  FGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFY  2115
             F      D          K+       L       EV+ A+F M    +PG DG+ A FY
Sbjct  374   FSSSLPRDFDAALAGLTAKVTDEANEALVASPNSEEVRGALFQMHPNKAPGVDGMHALFY  433

Query  2116  QTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKI  2295
             Q FW  V   I  FV++  R       + ++ I LIPK  +P    DFRPI+L  V +KI
Sbjct  434   QKFWHIVGDDIVKFVQEWWRGETQIETLNKTCIVLIPKCPAPCKMGDFRPISLCTVIYKI  493

Query  2296  ISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLD  2472
             ISK++ NR++  + +LI   Q++F+PGR   DN ++  EI H+M+ K  GK GLMA KLD
Sbjct  494   ISKMMANRLKIYLSDLISAHQSAFVPGRLITDNAMIAFEIFHHMKRKGDGKNGLMAFKLD  553

Query  2473  LHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQG  2652
             + KAYD ++W FLE  ++  GF  + +  +M  +   + +   NG       P RGLRQG
Sbjct  554   MSKAYDCVEWSFLERVMLKLGFCVDWVRRVMECLSSVTYAFKLNGRVEGHIIPSRGLRQG  613

Query  2653  DPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQG  2832
             DPL+PYLF+L  E  S  + +           + R G  +SHLFFA+D +LF+ A+  + 
Sbjct  614   DPLSPYLFLLCAEAFSALLSKAADDGRIHGARVCRSGPRISHLFFADDSILFSRATLQEC  673

Query  2833  RMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL  3012
              ++   L  +   SG  IN  KS +  S + ++  +  +++L G+   +    YLG+P +
Sbjct  674   SVVAEILSTYERASGQKINFDKSEVSFSKHVDTNRRVAIRSLFGVREVEKHEKYLGLPTV  733

Query  3013  HKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCN  3192
               R  K  F  + + + +KL  WK  +LS AG+  L+++ + S+P Y M +F +P    N
Sbjct  734   IGRSKKVIFSVLKERVWKKLQGWKEKLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILN  793

Query  3193  DIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTS  3372
             +I+ +C  F WG     +K+H V W  +C  K  GG+G R    FN ALLAK  W+L+  
Sbjct  794   EINAMCSRFWWGARGTERKMHWVSWEKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCD  853

Query  3373  HDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWS  3552
              + L   VM+ +Y     F +     + S+ WRSI   ++++  G  WR+G+G S+N W 
Sbjct  854   TNSLAHLVMKARYFPRTLFTSARRGFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWE  913

Query  3553  DWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAV  3732
             D W      + +    I +S ++ +VSD I    TWN   LS+    +    IR   I+ 
Sbjct  914   DSWLPGDSCSVVPTPNI-ESPADLQVSDLIDRGGTWNELALSTHFTSNDAALIRTIHISR  972

Query  3733  CEQVSDSLYWPRSPTGAFSVRSAF-----SHIA------GNDEDAMDTSW--VWKMRVTE  3873
                  D  YW  +  G +S +S +      H+       G D      +W  +W +    
Sbjct  973   -RMPEDIQYWWPASNGEYSTKSGYWLGRLGHLRRWVARFGGDH---GVAWKAIWNLDGPP  1028

Query  3874  RCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHH  4053
             + R F+W    G L T      + +  D  C  C    E++ H L  CS     WR +  
Sbjct  1029  KLRHFVWRACTGALATKGRLCDRHVINDEACTFCHGERESVLHALFHCSLVAPIWRNSPF  1088

Query  4054  PVSFQYSLVTPLKS------WVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFE--  4209
                  Y +  P+ S      W+++   +S+ +       +F+   W  W  RN  +FE  
Sbjct  1089  ---LNYVVDGPVSSFMESFIWIRSKLASSELL-------SFLALAWAAWTYRNSVVFEEP  1138

Query  4210  --NTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKM-RWVCWQPPETGWIKFNTDGAF  4377
               N     +  ++  N+         L  + V V        W PP  GW K N+D A 
Sbjct  1139  WKNIEVWAVGFLKLVNDYKSYAT---LVHRAVSVSPFPSRSAWIPPTVGWYKLNSDAAM  1194



>gb|ABA96650.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1100

 Score =   468 bits (1205),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 274/917 (30%), Positives = 458/917 (50%), Gaps = 18/917 (2%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNV--RVSFAYVRPNRMAKERFWNDCLSYSSE  1116
              FW  S F+  ++  T++ I  LV    S +  R +F Y  P    +   W         
Sbjct  181   LFWDES-FHLDLLSYTNRHIDVLVKEDRSAMQWRCTFVYGEPKAHERHNMWTLLRRIKPN  239

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
               APW +MGDFN+     E +        + L+F E  S C + D+G  G  +++  +  
Sbjct  240   STAPWCLMGDFNEAMWQFEHFSEHKRKEKQMLDFREILSHCDVFDLGFIGTPWTYDNKRK  299

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
             G    R +LDRA+ +     L+P+A+   L  + SDH P+   C       + +R  R+E
Sbjct  300   GGYNVRVRLDRAVASQSWSVLYPQAQVRHLVSSRSDHCPILVQCTPDEDKDKPSRCMRYE  359

Query  1477  gAWLTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQA  1641
               W   E   +     W     +  L  V   +  V    + W++E FG++     +L+ 
Sbjct  360   ILWEREESLSEEIRTAWEQHHAATDLGSVSSKLKLVMGALQHWSREKFGSVNKELGALRK  419

Query  1642  RIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHK  1821
             +++ +Q    +   +  Q   R++     E+L +EE++W Q+SR  W+++GDRNT+F+ K
Sbjct  420   KMEELQLGGRHTHDQEYQSCSRRM----EEILYREEMMWLQRSRVAWLREGDRNTSFHRK  475

Query  1822  STLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
             +    R     ++   +G W    K +    +NFF DL+ +  ++   P       K+  
Sbjct  476   AAWRHRKNKISKLFLPDGSWTDQRKEMETMATNFFKDLYTKDPLVTPQPLLDLIMLKVTE  535

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                  L +  +  E+  A+F +    +PGPDG  A F+Q  WE +K+ +   VK      
Sbjct  536   QMNEDLCKAFSDKEISDALFQIGPIKAPGPDGFPARFFQRNWEVLKNDVCKAVKLFFDQK  595

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P  +  + I LIPKK   +   DFRPI+L NV +K+++K +VN +RPI++++I   Q+
Sbjct  596   VMPEGVNTTAIVLIPKKKESKELKDFRPISLCNVIYKVVAKCLVNHLRPILESIISQEQS  655

Query  2362  SFLPGRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+PGR   DN ++  E  H + + K+  +   A KLDL KAYD +DW++LE  L   GF
Sbjct  656   AFIPGRMITDNALIAFECFHNIAQSKRESQEFCAYKLDLAKAYDRVDWQYLEGVLDRMGF  715

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
                 I  +M  V     ++ +NG  L  FQP RGLRQGDPL+PYLF+   + LS  +   
Sbjct  716   SNTWIQWMMACVTSVRYAVRFNGSMLKSFQPSRGLRQGDPLSPYLFLFVADGLSTILSSA  775

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
             VR  +  P+ + R   G+SHL FA+D +LF +A+ +Q  ++   L  +   +   ++ +K
Sbjct  776   VRTGDLVPLKVCRQAPGISHLLFADDSLLFFKANVEQATVVKEALNLYERCTSQLLSPAK  835

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
              ++    + + + + G+K+L  +  +     YLG+P    R+    F  I +   ++L +
Sbjct  836   CSMLFGKHCSDQTQPGIKSLLDVQQNSFEDKYLGLPTPEGRMKADRFQSIKERFFKRLID  895

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W    L + G+  L++S + ++P Y M VFKLP   C +  ++ R F WG+    +KVH 
Sbjct  896   WAEKHLPMGGKEVLIKSVIQALPTYMMSVFKLPPSFCEEYMQLVRKFWWGEDRSQRKVHW  955

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
               W  + K K  GG+G +    FN ALLA+ AW+LV   D L  +V++ KY  N +   T
Sbjct  956   ASWQQLIKPKSMGGMGFKDMKIFNQALLARQAWRLVQFPDSLCARVLKAKYYPNGDLLDT  1015

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQS  3618
                + +S  W+ I+ G  +++ G  WRIG G  ++ W D W    P     +V    + +
Sbjct  1016  AFSSVSSDSWKGIVHGLELLKKGVIWRIGTGRKVHIWRDDWL---PREHGLKVMGKKTGT  1072

Query  3619  EAK-VSDFILPN-RTWN  3663
               K VSD ++PN ++W+
Sbjct  1073  RLKWVSDLLVPNEQSWD  1089



>gb|ABO80459.1| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease 
H [Medicago truncatula]
Length=869

 Score =   461 bits (1187),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 285/804 (35%), Positives = 414/804 (51%), Gaps = 67/804 (8%)
 Frame = +1

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSP-  2241
             MK + SPGPDG Q  F++ +W  V+  I   V      G   P I E+ I LIPK D P 
Sbjct  1     MKPYKSPGPDGFQCIFFKQYWHIVREDIFQLVSTAFHTGFFDPTISETLIALIPKIDPPP  60

Query  2242  -ETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIV  2418
              +T  DFRPI+L N+++KII+KVIV+R+RPI+ ++IGP+Q+SFL GR T+DN I+ QEIV
Sbjct  61    PQTYKDFRPISLYNITYKIITKVIVHRLRPILNDIIGPYQSSFLQGRGTSDNSIVLQEIV  120

Query  2419  HYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLL  2598
             H+MR  K KKG +A KLDL KA+D+++WEFL S L DFGFP + I LIM  V  S+ S+L
Sbjct  121   HFMRRSKRKKGYVAFKLDLEKAFDNVNWEFLRSCLQDFGFPDDTIKLIMHCVTSSTFSVL  180

Query  2599  WNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSH  2778
             WNG K  P +P  GLRQGDPL+PYLFI+ ME+LS  I + V    W+PI +S     +SH
Sbjct  181   WNGNKWPPIKPTHGLRQGDPLSPYLFIICMEKLSLAINKAVHEGEWEPIRMSASSPPLSH  240

Query  2779  LFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNL  2958
             L FA+D++LF +A   Q R I +   +FS   GL IN+SKS  F S   + +I   L ++
Sbjct  241   LLFADDVLLFTKAKNSQLRFIKDLFDRFSKALGLKINLSKSRAFYSGVPHQKII-NLTSI  299

Query  2959  TGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALS  3138
             +GI  + +LG YLG PIL  R  +  F +I++ M+ +LA WK  +L+ AG          
Sbjct  300   SGIRSTTSLGKYLGFPILKGRPKRSDFLFIIEKMRNRLATWKNKLLNKAG----------  349

Query  3139  SMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKC  3318
                                                + VHLVGW  I   +  GGLG++  
Sbjct  350   --------------------------------TNRRGVHLVGWKKIAMPRHLGGLGIKSA  377

Query  3319  LDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIV  3498
              + N  LL KL W+L  +  KLWV ++  KY    N     + +++S  W SI+R ++++
Sbjct  378   REANTCLLGKLVWELFHNKHKLWVSLLAAKYTAGPNLLNASITSSSSPIWSSIIRAKNVL  437

Query  3499  ELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLS  3678
               G +WR G+G S +FW   W+   PL  +  + I        V D I  N+   +  L 
Sbjct  438   ISGYSWRPGSG-SSSFWFTHWSEFGPLCSLVPI-IDIHDLHLTVKDVISNNQRSLM--LY  493

Query  3679  SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS---HIAGNDEDAMDTSW  3849
             + LP  + D I        + + D   WP +  G +S +S +     ++GND +    SW
Sbjct  494   TPLPQAVTDCINTINFRFNDAIEDVFIWPHNKNGTYSAKSGYQWLLSLSGNDNNTHSWSW  553

Query  3850  VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAK  4029
             + K +++E+ +  +WL     L T      + +     CA CG  DE++ H + +C F+K
Sbjct  554   ILKKKISEKYKFLIWLACHDSLPTAALLHHRQIIASATCARCGVSDESVFHCIRDCPFSK  613

Query  4030  DCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFE  4209
               W        + ++ VT ++ W K+    S         + F    W IW++RN R   
Sbjct  614   IIWHHIGFSEPYFFA-VTDIEIWCKSGLIGSK-------AILFAAGLWWIWRSRNARCMS  665

Query  4210  NTASAPMDIMRRANNLTL---DTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFK  4380
               +   M + R A N+T    D    F     V V   R+V W          N DG+  
Sbjct  666   EES---MLLQRLAANITYFVDDINSCFFQPLPVMVSD-RYVKWNNSNFNCTILNVDGSCI  721

Query  4381  RNTGLASAGGLARDHKGEWLFGFM  4452
              +   A  GGL R+  G +L GF+
Sbjct  722   GSPIRAGFGGLIRNSVGFYLSGFL  745



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score =   484 bits (1245),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 373/1228 (30%), Positives = 566/1228 (46%), Gaps = 82/1228 (7%)
 Frame = +1

Query  952   RSSIFNFAVIRNTSQAIHGLVSGP--HSNVRVSFAYVRPNRMAKERFWNDCLS-YSSEFN  1122
             RS      VI +  Q +H  ++ P   +   V+  Y +  R  +   W DCL   + +  
Sbjct  952   RSPTAKNYVIFDHPQCLHVRLTSPWLETPFFVTIVYAKCTRSERTLLW-DCLRRLADDIE  1010

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW++ GDFN I   +E+   S+ +     +F  +   CGLLD G  G S++W      R
Sbjct  1011  VPWLVGGDFNVILKREERLYGSAPHEGAMEDFASTLLDCGLLDGGFEGNSFTW---TNNR  1067

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
               QR  LDR ++N    N FP  +   L R  SDH PL   C   N   +    FRF+ A
Sbjct  1068  MFQR--LDRIVYNHHWINKFPVTRIQHLNRDGSDHCPLLISC--FNSSEKAPSSFRFQHA  1123

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGA--------ISEVTNLSKKWNKETFGNIFGRKASLQ  1638
             W+   D++     V SN  L + G+           +    K WNK  FG+IF +    +
Sbjct  1124  WVLHHDFKT---SVESNWNLPINGSGLQAFWSKQHRLKQHLKWWNKAVFGDIFSKLKEAE  1180

Query  1639  ARIKGV-----QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRN  1803
              R++       QE  F +     ++   K   +LN+ L  EEL W QKS   W+ +G+RN
Sbjct  1181  KRVEECEILHQQEQTFES-----RIKLNKSYAQLNKQLNIEELFWKQKSGVKWVVEGERN  1235

Query  1804  TAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMY  1980
             T F+H     +R RS I ++    G W  D + +      +F  L   +   D       
Sbjct  1236  TKFFHMRMQKKRIRSHIFKVQDPEGRWIEDQEQLKHSAIEYFSSLLKVEPCYDSRFQSSL  1295

Query  1981  CGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFV  2160
                 +   +   L  E ++ EVK AVF +    + GPDG  + FYQ  W  +   +   V
Sbjct  1296  IPSIISNSENELLCAEPSLQEVKDAVFGINSESAAGPDGFSSYFYQQCWNIIAQDLLDAV  1355

Query  2161  KKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKN  2340
             +       +P  +  + + L+PKK S    SDFRPI+L  V  KII+K++ NR+  ++ +
Sbjct  1356  RDFFHGANIPRGVTSTTLILLPKKSSASKWSDFRPISLCTVMNKIITKLLSNRLAKVLPS  1415

Query  2341  LIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLEST  2520
             +I   Q+ F+ GR  +DNI+L QE++  +  K  + G +A+KLD+ KAYD +DW FL   
Sbjct  1416  IITENQSGFVGGRLISDNILLAQELIGKLNTK-SRGGNLALKLDMMKAYDKLDWSFLFKV  1474

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             L  FGF    I +I   +     SLL NG     F+  RGLRQGD ++P LFI+A E LS
Sbjct  1475  LQHFGFNGQWIKMIQKCISNCWFSLLLNGRTEGYFKSERGLRQGDSISPQLFIIAAEYLS  1534

Query  2701  WDIQEKVRVKNWKPITLSRG-GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSG  2877
               +        +  +  S G    VSHL FA+D+++F   S+   + I+  L+++   SG
Sbjct  1535  RGL--NALYDQYPSLHYSSGVSISVSHLAFADDVLIFTNGSKSALQRILAFLQEYQEISG  1592

Query  2878  LNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL--HKRVSKHTFGYIL  3051
               INV KS      N +S  ++ +   TG S    L TYLG P+   HK+V    F  ++
Sbjct  1593  QRINVQKSCFVTHTNVSSSRRQIIAQTTGFSHQLLLITYLGAPLYKGHKKVI--LFNDLV  1650

Query  3052  DGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGD  3231
               ++ ++  W+  +LS  GR TL++S L+S+P+Y +QV K P      ++RI   FLWG 
Sbjct  1651  AKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPICVLERVNRIFNSFLWGG  1710

Query  3232  SAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKY  3411
             SA +KK+H   W  I      GGL +R   +   A   KL W+  T  D LW + MR KY
Sbjct  1711  SAASKKIHWASWAKISLPIKEGGLDIRNLAEVFEAFSMKLWWRFRTI-DSLWTRFMRMKY  1769

Query  3412  VKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMD  3591
              + +    T    + S  W+ ++   +I E    WR+G G  L FW D W G+ PL   +
Sbjct  1770  CRGQLPMHTQPKLHDSQTWKRMVANSAITEQNMRWRVGQG-KLFFWHDCWMGETPLTSSN  1828

Query  3592  EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRS  3771
             +     S S  +V DF + N +W+++KL ++L  +++D I   PI    +  D  YW  +
Sbjct  1829  QEL---SLSMVQVCDFFM-NNSWDIEKLKTVLQQEVVDEIAKIPIDAMSK--DEAYWAPT  1882

Query  3772  PTGAFSVRSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMT  3951
             P G FS +SA+  I   +      +++W   V      FLW L+   +   ++   KG  
Sbjct  1883  PNGEFSTKSAWQLIRKREVVNPVFNFIWHKTVPLTISFFLWRLLHDWIPVELKMKSKGFQ  1942

Query  3952  EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTP------LKSW-VKNN  4110
               + C  C   +E++ HV+ +   A   W   +    FQ  ++ P      L +W    +
Sbjct  1943  LASRCRCC-KSEESIMHVMWDNPVATQVW--NYFSKFFQILVINPCTINQILGAWFYSGD  1999

Query  4111  CCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNK  4290
              C    I      +  I+T W +W  RN     N    P  I+ R   L           
Sbjct  2000  YCKPGHIR----TLVPIFTLWFLWVERNDAKHRNLGMYPNRIVWRILKLIQQLSLGQQLL  2055

Query  4291  K------------------CVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
             K                     +   +   W  P  G  K N DG+ K +   A+ GG+ 
Sbjct  2056  KWQWKGDKQIAQEWGITFQAESLPPPKVFPWHKPSIGEFKLNVDGSAKLSQN-AAGGGVL  2114

Query  4417  RDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             RDH G  +FGF  N+G+ NS  AEL  L
Sbjct  2115  RDHAGVMVFGFSENLGIQNSLQAELLAL  2142



>gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1715

 Score =   479 bits (1233),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 335/1215 (28%), Positives = 557/1215 (46%), Gaps = 63/1215 (5%)
 Frame = +1

Query  946   FWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNA  1125
             +W+  + +  VI +  + +   V   + N  +S  Y  P    +   W      S+  + 
Sbjct  433   YWKKHL-SIQVISHDVRLVDLYVEYKNFNFYLSCIYGHPIPSERHHLWEKLQRVSAHRSG  491

Query  1126  PWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRT  1305
             PW+M GDFN+I +  E+ G    +     NF    + C + D+ + G  YSW  +    T
Sbjct  492   PWMMCGDFNEILNLNEKKGGRRRSIGSLQNFTNMINCCNMKDLKSKGNPYSWVGKRQNET  551

Query  1306  VQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAW  1485
             ++   LDR   N + Q  FP  +   LP   SDH P+  + +       +   FR++   
Sbjct  552   IES-CLDRVFINSDWQASFPAFETEFLPIAGSDHAPV--IIDIAEEVCTKRGQFRYDRRH  608

Query  1486  LTREDYRDIWGRVWSNSLLDVVGAISEVTNLSK----KWNKETFGNIFGRKASLQARIKG  1653
                ED+ D   R W+    D  G   E  +  +    KW + T  N   +  +L+ R+  
Sbjct  609   FQFEDFVDSVQRGWNRGRSDSHGGYYEKLHCCRQELAKWKRRTKTNTAEKIETLKYRVDA  668

Query  1654  VQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLI  1833
              +     +T     +L  +L  +LN+  + EEL W  KSR  W+  GDRNT F++ ST +
Sbjct  669   AERD---HTLPHQTIL--RLRQDLNQAYRDEELYWHLKSRNRWMLLGDRNTMFFYASTKL  723

Query  1834  RRNRSRIRML-KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQM  2010
             R++R+RI+ +    G  N    TI     N+F DLF      D         PK+     
Sbjct  724   RKSRNRIKAITDAQGIENFRDDTIGKVAENYFADLFTTTQTSDWEEIISGIAPKVTEQMN  783

Query  2011  HKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVP  2190
             H+L + VT  EV+ AVF +    +PG DG  AAFY   W+ + + +   V+       + 
Sbjct  784   HELLQSVTDQEVRDAVFAIGADRAPGFDGFTAAFYHHLWDLIGNDVCLMVRHFFESDVMD  843

Query  2191  PKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFL  2370
              +I ++ I LIPK   P+  SD+RPI+L   S+KIISK+++ R++  + ++I   Q +F+
Sbjct  844   NQINQTQICLIPKIIDPKHMSDYRPISLCTASYKIISKILIKRLKQCLGDVISDSQAAFV  903

Query  2371  PGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQN  2547
             PG++ +DN+++  E++H ++ ++  + G +A+K D+ KAYD ++W FLE  ++  GF   
Sbjct  904   PGQNISDNVLVAHELLHSLKSRRECQSGYVAVKTDISKAYDRVEWNFLEKVMIQLGFAPR  963

Query  2548  LISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRV  2727
              +  IM  V   S  +L NG       P RG+RQGDPL+PYLF+   E LS  +++    
Sbjct  964   WVKWIMTCVTSVSYEVLINGSPYGKIFPSRGIRQGDPLSPYLFLFCAEVLSNMLRKAEVN  1023

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
             K    + +++    +SHL FA+D + F  AS      +    KK+   SG  IN +KS+I
Sbjct  1024  KQIHGMKITKDCLAISHLLFADDSLFFCRASNQNIEQLALIFKKYEEASGQKINYAKSSI  1083

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
                    +  ++ L  L GI      G YLG+P    R     F YI+  +K +   W  
Sbjct  1084  IFGQKIPTMRRQRLHRLLGIDNVRGGGKYLGLPEQLGRRKVELFEYIVTKVKERTEGWAY  1143

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
             N LS AG+  ++++   ++PVY+M  F LP   CN+I+ +   F WG             
Sbjct  1144  NYLSPAGKEIVIKAIAMALPVYSMNCFLLPTLICNEINSLITAFWWG-------------  1190

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
                   ++ G LG +    FN ALLAK AW+++T+   L  ++ +  Y  N  +      
Sbjct  1191  -----KENEGDLGFKDLHQFNRALLAKQAWRILTNPQSLLARLYKGLYYPNTTYLRANKG  1245

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
              +AS+GW SI  G+ +++ G   R+G+G +   W D W    P         P    + K
Sbjct  1246  GHASYGWNSIQEGKLLLQQGLRVRLGDGQTTKIWEDPWLPTLPPR---PARGPILDEDMK  1302

Query  3628  VSDFILPN-RTWNVDKLSSLL-PHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSA  3801
             V+D    N R W+      +L P D    +  +         DS  W  +    ++VRS 
Sbjct  1303  VADLWRENKREWDPVIFEGVLNPED--QQLAKSLYLSNYAARDSYKWAYTRNTQYTVRSG  1360

Query  3802  F---SHIAGNDEDAMD--------TSWVWKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
             +   +H+   +E+ ++           +W++++T + + F+W  + G L T  +   + +
Sbjct  1361  YWVATHVNLTEEEIINPLEGDVPLKQEIWRLKITPKIKHFIWRCLSGALSTTTQLRNRNI  1420

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDW  4128
               D  C  C + DET+NH++  CS+A+  WR  +   S +      L+  ++        
Sbjct  1421  PADPTCQRCCNADETINHIIFTCSYAQVVWRSANFSGSNRLCFTDNLEENIRLILQGKKN  1480

Query  4129  INGCPW--GVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVH  4302
              N  P   G+   +  W +WK+RN+ +F+     P  + ++A     + VE  +N   + 
Sbjct  1481  QN-LPILNGLMPFWIMWRLWKSRNEYLFQQLDRFPWKVAQKAEQEATEWVETMVNDTAIS  1539

Query  4303  VGKM--------RWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTN  4458
                         R   W  P  G++K N D  + +     S G + RD  G  L      
Sbjct  1540  HNTAQSNDRPLSRSKQWSSPPEGFLKCNFDSGYVQGRDYTSTGWILRDCNGRVLHSGCAK  1599

Query  4459  IGVSNS-FAAELWGL  4500
             +  S S   AE  G 
Sbjct  1600  LQQSYSALQAEALGF  1614



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score =   469 bits (1207),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 320/1054 (30%), Positives = 503/1054 (48%), Gaps = 45/1054 (4%)
 Frame = +1

Query  1165  NQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNL  1344
             N E+ G    + S  L+F      CG L+    G   SW R    +   R +LDRAL N 
Sbjct  109   NHEKRGGKLRHASSFLSFHGMIRDCGFLEFPYLGDWLSW-RGWWDKKPIRYRLDRALGNE  167

Query  1345  EAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRV  1524
             +  +LFP+     LPR  SDH PL  +   G    R  R F F+  W+ +    +   + 
Sbjct  168   DWHDLFPDTVTEYLPRIASDHAPL--IVNIGAKRSRGKRTFMFDRRWIGKAGLMESISQG  225

Query  1525  WSNSLLD----VVGAISEVTNLSKKWNKET--FGNIFGRKASLQARIKGVQESVFYNTSR  1686
             W+    +    VV  I         W KE   FG         Q  +    ++V    S 
Sbjct  226   WNGGHHEGPTSVVDKIVNCRRAISHWRKEQVPFGRDIIEDLKRQLAVAQADDAV----SS  281

Query  1687  GLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRML-  1863
             G+      L   L +    EE+ W+QKSR  W++ GD+NT ++   T  RR R+RI  L 
Sbjct  282   GVIT---DLTMRLRDAYNDEEIYWYQKSRNRWMRVGDKNTKYFQAQTKQRRARNRITGLY  338

Query  1864  KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCE  2043
               N  W++    I     ++F DLF   +  +           +      +LT      E
Sbjct  339   DRNNVWSTKDDDICTVAVSYFEDLFTSIHPSNFEAALSEVKRVITEDVNERLTAPAMEAE  398

Query  2044  VKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLI  2223
             V+KA+F M    +PGPDG+ A F+Q  W  VK  +   V +   +G     +  + I LI
Sbjct  399   VRKALFLMSPDKAPGPDGMTALFFQKAWRVVKEDLVAMVNRFFEEGVFDKSLNRTHICLI  458

Query  2224  PKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIIL  2403
             PK   P   ++ RPI+L NV +K+ISK +  R++ ++  LI   Q++F+PGR  +DNI++
Sbjct  459   PKVAKPTRMAEMRPISLCNVGYKLISKNLCQRLKGVLPELISETQSAFVPGRLISDNILI  518

Query  2404  TQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRE  2580
               E+ H +R     KG  MAIK D+ KAYD ++W F+E+ L   GF +  IS IMF V  
Sbjct  519   AHEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWGFIEALLRKMGFGEIWISRIMFCVTS  578

Query  2581  SSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRG  2760
                 +L NG+      P RGLRQGDPL+PYLFIL  E L  +I+   R K    I ++  
Sbjct  579   VEYKVLLNGQPNGRIVPERGLRQGDPLSPYLFILCTEVLVANIKRAEREKQITGIKVANK  638

Query  2761  GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIK  2940
                ++HL FA+D + F +A + Q  +I+  L ++   SG  IN +KS++      +  ++
Sbjct  639   CPPITHLLFADDSLFFCKAEKAQCEVILGILNQYEAVSGQQINFAKSSVQFGHKVDDTVR  698

Query  2941  RGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTL  3120
               ++ + GIS    +G+YLG+P          F ++ D ++ +   W   +LS  G+  +
Sbjct  699   SEMQGVLGISNLGGMGSYLGLPESLGGSKTKVFSFVRDRLQGRTTGWSAKLLSKGGKEVM  758

Query  3121  VQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGG  3300
             ++S  +++P + M  F++P    + +     +F W  S Q+  +H + W+ +C SK  GG
Sbjct  759   IKSVATAVPTFVMSCFRIPKIITSKLTSAVANFWWSTSGQSGGLHWLAWDKLCFSKQLGG  818

Query  3301  LGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIM  3480
             LG R    FN ALLAK  W+L+ + D L+ +V + +Y +N N        + S+GWRSI 
Sbjct  819   LGFRNVDAFNTALLAKQLWRLIEAPDTLFARVFKGRYYRNSNPMDPLRSYSPSYGWRSIT  878

Query  3481  RGRSIVELGAAWRIGNGLSLNFWSDWWT-GDKPLAFMDEVTIPDSQSEAKVSDFI-LPNR  3654
               RS+V  G   R+ +G S++ W+D W     P     +   P      K+S  I     
Sbjct  879   SARSLVNKGLIIRVSSGESISIWTDPWVPAQSPRPAFSKG--PHKDPSLKISHLIDCHTN  936

Query  3655  TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS---HIAGN-  3822
             TW +D+L      + +D I A P+    ++ DS+ W  + +G ++V+S +      A   
Sbjct  937   TWRMDRLKEFFAPEDVDLIGAIPLG-SRRLDDSMGWHYTKSGKYAVKSGYEVERRFAPQL  995

Query  3823  -------DEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGD  3981
                     E     + VW +    + + F+W ++ G +       R+G+  D+ C  CG 
Sbjct  996   TMVPRVGPEITPLLAAVWDVSCPPKIKHFMWQVLSGCISVLANLRRRGIPCDSACVRCGA  1055

Query  3982  GDETMNHVLMECSFAKDCWRRTHHPV---SFQY-SLVTPLKSWVKNNCCASDWINGCPWG  4149
              +ET+NH +  C  A+  W     PV   SF   S+   +  ++ ++  AS  +   PW 
Sbjct  1056  DEETINHAIFSCPPARQAWALAQVPVGPGSFPTESIYANVDHFLGSSNPASQ-VAAFPW-  1113

Query  4150  VTFIYTCWEIWKARNQRIFENTASAPMDIMRRAN  4251
                    W IWKARN R+FE+    PMD++R A 
Sbjct  1114  -----LMWYIWKARNARVFESVMENPMDVVRLAE  1142



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score =   479 bits (1232),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 347/1198 (29%), Positives = 554/1198 (46%), Gaps = 88/1198 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHG-LVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              +W+S++ +F+++  ++  I G +V       R    Y  P    K + W D L    ++
Sbjct  451   IYWKSAMLDFSLVSFSNNHICGDVVVANGVKWRFVGIYGWPEAGNKYKTW-DLLRSLGDY  509

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               P +  GDFN++    E  G    +     +F E      L D+G SG+ Y+W R +  
Sbjct  510   EGPVLFGGDFNEVLSMSEVEGGRVSDRRAMHDFREVVDELHLRDLGFSGLWYTWERGKNP  569

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLK---FLCEAgnpprrenrpfr  1470
              T  R +LDR L + +  + FP+     + R  SDH P+    F C+     R++ R   
Sbjct  570   TTQIRERLDRFLASPQWFDCFPQVHVEHMVRYKSDHTPIMVQLFGCKRRRKKRKKKRFRF  629

Query  1471  fegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASL-QAR  1644
                AWL  +    +    W +S  L     I  V      W+K+T  N  GR+  L +  
Sbjct  630   GT-AWLLEDSCESLVRTAWDHSSGLPFEARIGAVAQDLVVWSKDTL-NHLGREICLVEEE  687

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             IK +Q S        L     KL    + +L+++E  W+ +SR   I+DGD+NT ++H  
Sbjct  688   IKRLQHSSIAADQEHLMECHSKL----DGLLEKQEAYWYLRSRVAEIKDGDKNTKYFHHK  743

Query  1825  TLIRRNRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLD-  1998
                R+ R+ I  L   G+ W  D + I   +  ++ +LF         P+D      LD 
Sbjct  744   ASQRKRRNYINGLFDEGDVWRDDDEDIERVVEAYYKNLF-----TSSLPSDEALSAVLDA  798

Query  1999  -----TGQMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFV  2160
                  + +M+  L R V   EV +A+  M    +PGPDG+ A FYQ FW  V   +T+ V
Sbjct  799   VVPIISEEMNVVLCRRVVKEEVWEALRQMHPSKAPGPDGMHAVFYQRFWHIVGDDVTSVV  858

Query  2161  KKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKN  2340
               ++   R P  +  + I LIPK  SP   S+FRPI+L NV FK+++KV+ NR++ I+  
Sbjct  859   AGIIHGTRPPDALNNTNIALIPKVKSPTLVSEFRPISLCNVIFKLVTKVLANRLKTILPG  918

Query  2341  LIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLES  2517
             ++   Q++F+PGR   DN ++  E+ H M+ + KG +G +A+KLD+ KAYD ++W FL S
Sbjct  919   VVSENQSAFVPGRLITDNALIALELFHSMKYRCKGNRGFVAMKLDMSKAYDRVEWSFLRS  978

Query  2518  TLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERL  2697
              L   GF  + +  +M  V     S + NG+      P RGLRQGDP++PYLFIL  +  
Sbjct  979   LLDKMGFADSWVKCVMDCVSSVRYSFVVNGDVCGSVIPSRGLRQGDPISPYLFILVADAF  1038

Query  2698  SWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSG  2877
             S  +++ V  K+   I                           +  +I++ L K+   SG
Sbjct  1039  SALVRKAVADKSIHGI--------------------------QECSVIVDILNKYEAASG  1072

Query  2878  LNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDG  3057
               IN+ KS +  S   +S  K+ L     +   D    YLGIP L  R  +H F  I+D 
Sbjct  1073  QKINIEKSEVSFSKGVSSVQKKELVEFLAMRQVDRHSKYLGIPTLAGRSKQHLFSGIMDR  1132

Query  3058  MKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSA  3237
             + +KL  WK  +LS AG+  L+++ + ++P Y M V++ P      I      F WG   
Sbjct  1133  VWKKLQGWKEKLLSRAGKEVLLKTVIQAIPTYVMGVYRFPVAIVKSIHSAMAKFWWGSKG  1192

Query  3238  QNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVK  3417
               + ++   W  +C  K  GG+G R    FN ALL + AW+L+   D L  KV++ KY  
Sbjct  1193  DRRPMYWKSWESMCNPKCLGGMGFRDLSVFNEALLGRQAWRLIQCEDSLLSKVLKAKYYP  1252

Query  3418  NKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEV  3597
             + +F    +    S+ WRSI   +S+V+ G  WR+GNG ++N W D W  +    F+   
Sbjct  1253  SSSFLDASLGPVGSYSWRSIWGSKSLVKEGILWRVGNGATINIWDDPWVLNGESRFISSG  1312

Query  3598  TIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQV-SDSLYWPRSP  3774
              +   +    + DF   +  W+ + ++ L     I  I A P++  E++  D + W  + 
Sbjct  1313  RVERLKYVCDLIDF--GSMEWDANVVNELFNEQDIQAILAVPLS--ERLPHDRVAWAFTK  1368

Query  3775  TGAFSVRSAFSHIAGNDEDAMDTSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
              G +SV++A+      + D    +WV  W ++V+ + R FLW +    L        + +
Sbjct  1369  DGRYSVKTAYMVGKSRNLDLFHRAWVTIWGLQVSPKVRHFLWKICSNSLPVRAILKHRHI  1428

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDW  4128
             T D  C  C +G ET++H L+ CS  ++ W             +  L S + N   AS W
Sbjct  1429  TSDDTCPLCLEGPETISHALLHCSKVREVWE------------MAGLTSKLPNGDGAS-W  1475

Query  4129  INGCPWG----------VTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEV  4278
             ++   W           V   Y  + +W  RN+ +FE+       +   A     D  E 
Sbjct  1476  LDS--WDEWQEVEKDSLVALSYVAYYVWHRRNKVVFEDWCRPNEQVAALAMRAAADYNEY  1533

Query  4279  FLNKKCVHVGK--MRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
               +      G+       WQPP  G +K N D +   + G    G +AR+  GE LF 
Sbjct  1534  SQHIYGSVAGQNARSSKVWQPPPAGCVKLNADASIG-DDGWVGMGVVARNEVGEVLFA  1590



>gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana]
Length=1142

 Score =   467 bits (1202),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 282/868 (32%), Positives = 462/868 (53%), Gaps = 35/868 (4%)
 Frame = +1

Query  1708  KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWN  1884
             +L   L E  + EE  W+QKSR +W++ GD N+ F+H  T  RR R+RI  L   NG W+
Sbjct  104   ELTLRLKEAYRDEEQYWYQKSRSLWMKLGDNNSKFFHALTKQRRARNRITGLHDENGIWS  163

Query  1885  SDFKTISDHISNFFIDLFGRKN--IMDGSPNDMYCGPKLDTGQMHKL-TREVTMCEVKKA  2055
              +   I +   ++F +LF   N  + D +  ++     L T +++ L T + T CEV+ A
Sbjct  164   IEDDDIQNIAVSYFQNLFTTANPQVFDEALGEVQV---LITDRINDLLTADATECEVRAA  220

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
             +F +    +PGPDG+ A F+Q  W  +KS + + V   L++G    ++  + I LIPK +
Sbjct  221   LFMIHPEKAPGPDGMTALFFQKSWAIIKSDLLSLVNSFLQEGVFDKRLNTTNICLIPKTE  280

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
              P   ++ RPI+L NV +K+ISK++  R++ ++ NLI   Q++F+ GR  +DNI++ QE+
Sbjct  281   RPTRMTELRPISLCNVGYKVISKILCQRLKTVLPNLISETQSAFVDGRLISDNILIAQEM  340

Query  2416  VHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
              H +R     K   MAIK D+ KAYD ++W F+E+ L   GF +  IS IM+ +      
Sbjct  341   FHGLRTNSSCKDKFMAIKTDMSKAYDQVEWNFIEALLRKMGFCEKWISWIMWCITTVQYK  400

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGV  2772
             +L NG+      P RGLRQGDPL+PYLFIL  E L  +I++  R      I ++     V
Sbjct  401   VLINGQPKGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKAERQNLITGIKVATPSPAV  460

Query  2773  SHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLK  2952
             SHL FA+D + F +A+++Q  +I+  LK++   SG  IN SKS+I         IK  +K
Sbjct  461   SHLLFADDSLFFCKANKEQCGIILEILKQYESVSGQQINFSKSSIQFGHKVEDSIKADIK  520

Query  2953  NLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSA  3132
              + GI     +G+YLG+P          F ++ D ++ ++  W    LS  G+  +++S 
Sbjct  521   LILGIHNLGGMGSYLGLPESLGGSKTKVFSFVRDRLQSRINGWSAKFLSKGGKEVMIKSV  580

Query  3133  LSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLR  3312
              +++P Y M  F+LP    + +      F W  +  ++ +H + W+ +C SK  GGLG R
Sbjct  581   AATLPRYVMSCFRLPKAITSKLTSAVAKFWWSSNGDSRGMHWMAWDKLCSSKSDGGLGFR  640

Query  3313  KCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRS  3492
                DFN+ALLAK  W+L+T+ D L+ KV + +Y +  N   +    + S+GWRS++  RS
Sbjct  641   NVDDFNSALLAKQLWRLITAPDSLFAKVFKGRYFRKSNPLDSIKSYSPSYGWRSMISARS  700

Query  3493  IVELGAAWRIGNGLSLNFWSDWWTG---DKPLAFMDEVTIPDSQSEAKVSDFILPNRTWN  3663
             +V  G   R+G+G S++ W+D W      +P  +   +  P  + ++ +      +  WN
Sbjct  701   LVYKGLIKRVGSGASISVWNDPWIPAQFPRPAKYGGSIVDPSLKVKSLIDS---RSNFWN  757

Query  3664  VDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDT  3843
             +D L  L   + +  I A PI     + D+L W  +  G ++V+S + H A  D +   T
Sbjct  758   IDLLKELFDPEDVPLISALPIG-NPNMEDTLGWHFTKAGNYTVKSGY-HTARLDLNEGTT  815

Query  3844  ----------SWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDET  3993
                       +++WK++   + R FLW ++ G +  +    ++G+  D  C +CG  +E+
Sbjct  816   LIGPDLTTLKAYIWKVQCPPKLRHFLWQILSGCVPVSENLRKRGILCDKGCVSCGASEES  875

Query  3994  MNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGV---TFIY  4164
             +NH L +C  A+  W  +  P +     + P  S +  N     W    P GV    + +
Sbjct  876   INHTLFQCHPARQIWALSQIPTA---PGIFPSNS-IFTNLDHLFW--RIPSGVDSAPYPW  929

Query  4165  TCWEIWKARNQRIFENTASAPMDIMRRA  4248
               W IWKARN+++FEN    PM+I+  A
Sbjct  930   IIWYIWKARNEKVFENVDKDPMEILLLA  957



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score =   475 bits (1223),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 342/1234 (28%), Positives = 574/1234 (47%), Gaps = 82/1234 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W++++ + ++I    + I   V+  + +  +S  Y  P +  + + W      S   N
Sbjct  225   LMWKNNV-SLSLISQDERLIDSHVTFNNKSFYLSCVYGHPTQSERHQLWQTLEHISDNRN  283

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             A W+++GDFN+I  N E+ G          NF    S C + DM + G  +SW  +    
Sbjct  284   AEWLLVGDFNEILSNAEKIGGPMREEWTFRNFRNMVSHCDIEDMRSKGDRFSWVGERHTH  343

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPL------------KFLCEAgnpp  1446
             TV +  LDR   N      FP A+   L  T SDH P+            K         
Sbjct  344   TV-KCCLDRVFINSAWTATFPYAETEFLDFTGSDHKPVLVHFNESFPRRSKLFRFDNRLI  402

Query  1447  rrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRK  1626
                      + +W T  + R        +S    +  +   +NL+               
Sbjct  403   DIPTFKRIVQTSWRTNRNSRSTPITERISSCRQAMARLKHASNLNS--------------  448

Query  1627  ASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQ----EELLWFQKSRRMWIQDG  1794
                + RIK +Q S+        + ++R+L+ +L E L +    EE+ W QKSR  W+++G
Sbjct  449   ---EQRIKKLQSSL-NRAMESTRRVDRQLIPQLQESLAKAFSDEEIYWKQKSRNQWMKEG  504

Query  1795  DRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPN  1971
             D+NT ++H  T  R +++R+  ++   G   +  K I +H  +FF ++F   N +  SP 
Sbjct  505   DQNTGYFHACTKTRYSQNRVNTIMDDQGRMFTGDKEIGNHAQDFFTNIFS-TNGIKVSPI  563

Query  1972  DMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHI  2148
             D        T  ++  LT+E +  E+  A+  +    +PGPDG+ A FY+  W+ V   +
Sbjct  564   DFADFKSTVTNTVNLDLTKEFSDTEIYDAICQIGDDKAPGPDGLTARFYKNCWDIVGYDV  623

Query  2149  TTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRP  2328
                VKK      + P I  + I +IPK  +P T SD+RPI L NV +K+ISK +VNR++ 
Sbjct  624   ILEVKKFFETSFMKPSINHTNICMIPKITNPTTLSDYRPIALCNVLYKVISKCLVNRLKS  683

Query  2329  IMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWE  2505
              + +++   Q +F+PGR   DN+++  E++H ++++K   K  MA+K D+ KAYD ++W+
Sbjct  684   HLNSIVSDSQAAFIPGRIINDNVMIAHEVMHSLKVRKRVSKTYMAVKTDVSKAYDRVEWD  743

Query  2506  FLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILA  2685
             FLE+T+  FGF    I  IM +V+    S+L NG       P RG+RQGDPL+PYLFIL 
Sbjct  744   FLETTMRLFGFCNKWIGWIMAAVKSVHYSVLINGSPHGYITPTRGIRQGDPLSPYLFILC  803

Query  2686  MERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFS  2865
              + LS  I  +    + + + +  G   ++HL FA+D + F +A+    + + +    + 
Sbjct  804   GDILSHLINGRASSGDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYE  863

Query  2866  GKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGY  3045
               SG  INV KS I          +  LK +  I      G YLG+P    R  K  F Y
Sbjct  864   YYSGQKINVQKSMITFGSRVYGSTQSKLKQILEIPNQGGGGKYLGLPEQFGRKKKEMFEY  923

Query  3046  ILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLW  3225
             I+D +K++ + W    LS AG+  +++S   +MPVY M  FKLP G  ++I+ +  +F W
Sbjct  924   IIDRVKKRTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWW  983

Query  3226  GDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMRE  3405
               ++  + +  V W  +  SK  GGLG R    FN+ALLAK AW+L+   + L+ +VM+ 
Sbjct  984   EKASNQRGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKA  1043

Query  3406  KYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAF  3585
             +Y K+ +     +    S+GW S++ G ++++ G    IG+G ++    D      P   
Sbjct  1044  RYFKDVSILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDNIVDSHPPRP  1103

Query  3586  MD------EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVS  3747
             ++      E+TI ++  E K S +      W+  K+S  +       I    +A  ++  
Sbjct  1104  LNTEETYKEMTI-NNLFERKGSYYF-----WDDSKISQFVDQSDHGFIHRIYLAKSKK-P  1156

Query  3748  DSLYWPRSPTGAFSVRSAF---SHIAGNDEDAMD--------TSWVWKMRVTERCrlflw  3894
             D + W  + TG ++VRS +   +H    +  A++         + +W + +  + + FLW
Sbjct  1157  DKIIWNYNTTGEYTVRSGYWLLTHDPSTNIPAINPPHGSIDLKTRIWNLPIMPKLKHFLW  1216

Query  3895  llmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYS  4074
               +   L T      +GM  D +C  C   +E++NH L  C FA   W  +   +     
Sbjct  1217  RALSQALATTERLTTRGMRIDPICPRCHRENESINHALFTCPFATMAWWLSDSSLIRNQL  1276

Query  4075  LVTPLKSWVKN------NCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI  4236
             +    +  + N      +   SD+    P     ++  W IWKARN  +F     +P   
Sbjct  1277  MSNDFEENISNILNFVQDTTMSDFHKLLP-----VWLIWRIWKARNNVVFNKFRESPSKT  1331

Query  4237  MRRANNLTLDTVEVFLNKKCV-----HVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLAS  4401
             +  A   T D +    + K        + + + + W+ P   ++K N D  F      A+
Sbjct  1332  VLSAKAETHDWLNATQSHKKTPSPTRQIAENK-IEWRNPPATYVKCNFDAGFDVQKLEAT  1390

Query  4402  AGGLARDHKGEWL-FGFMTNIGVSNSFAAELWGL  4500
              G + R+H G  + +G M     SN   AE   L
Sbjct  1391  GGWIIRNHYGTPISWGSMKLAHTSNPLEAETKAL  1424



>ref|XP_010513742.1| PREDICTED: uncharacterized protein LOC104789794 [Camelina sativa]
Length=1787

 Score =   479 bits (1233),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 351/1232 (28%), Positives = 561/1232 (46%), Gaps = 79/1232 (6%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+ S +   VI    + I         +  VS  Y  P    ++  W+  +      +
Sbjct  487   LFWKPS-YEVEVISADHRIIDVKAKLGSLSFYVSCVYGDPVSSLRQGVWDSLVDIGVSRD  545

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             APW+++GD N++  N E+ G  +   S    F      C L ++ + G   SW  +    
Sbjct  546   APWLVIGDLNEMVSNTEKLGGPARAESSFFPFRNMILDCRLREVSSIGNRLSWAGKRNNM  605

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +Q   LDRAL N     LFP  +   + R  SDH  L  L    N     +  F F   
Sbjct  606   WIQC-CLDRALGNEAWFQLFPRVQGEYMERIGSDHRAL--LLRLANDNVSRSGRFIFNKR  662

Query  1483  WLTREDYRDI----WGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
             W+++ D+  +    W +  +     V+  I+E       W +        +  + + RI+
Sbjct  663   WISKPDFAAVVQSGWNKGVTTGQTSVMSRIAECRRTISGWKR-------SQNLNSKVRIQ  715

Query  1651  GVQESVFYNTSRGLQV-----LERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFY  1815
              V+E +    + G ++     L R L  EL E  + EEL W ++SR  W+Q GDRNT F+
Sbjct  716   QVREQL---DAEGTKIHPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFF  772

Query  1816  HKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKN---IMDGSPNDMYC  1983
             H S   RR +++I  +   NG       +  +    +F  +F   N   IM+     +  
Sbjct  773   HGSVQRRRIQNKILSLFDENGVEQFSEGSKGEVAVAYFRKMFTSSNPSAIMEALDGMV--  830

Query  1984  GPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVK  2163
              P++      +L R V+  E+K AVF +K   +PG DG+ + F++ +W+ V   +   V+
Sbjct  831   -PRVTDSMNAELIRPVSALEIKNAVFSIKGEKTPGADGMSSQFFKEYWDVVGPQVVQEVQ  889

Query  2164  KVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNL  2343
             +    G +P     + I LIPK  +P   ++ RPI+L +V +K +SKV+  R++  +  +
Sbjct  890   QFFASGHLPSDWNFTQICLIPKVQNPTRMTNLRPISLCSVLYKTVSKVLCQRLKRFLPKI  949

Query  2344  IGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLEST  2520
             +   Q +F+ GR   DNI+L  E+VH ++ K G  +  +AIK D+ KAYD ++W FLE  
Sbjct  950   VSDTQGAFVSGRLITDNILLAHELVHALQTKAGCNEEFLAIKTDMSKAYDRVEWNFLEEL  1009

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             L+  GF    ++ IM  VR  + S+L NG++    +P RG+RQGDPL+P+LFIL  E L 
Sbjct  1010  LIRLGFDIKWVNWIMSCVRSVTFSVLINGKEHGFIKPERGIRQGDPLSPFLFILCAEALV  1069

Query  2701  WDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGL  2880
               + +  +      + L+     + HL FA+D +    AS  +   ++ CL+ +   SG 
Sbjct  1070  HVMNKAEQEGRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQ  1129

Query  2881  NINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGM  3060
              IN+ KS+I      +  ++R +   TGI      G YLG+P       K    YI D +
Sbjct  1130  EINLQKSSITFGKKLDPYMRRVIGLFTGIEQEGGAGKYLGLPECFSGSKKDMLAYITDRL  1189

Query  3061  KRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQ  3240
               +L  W    LSL G+  L+++   ++PVY M  F+L    C  I  +  +F W    +
Sbjct  1190  TSRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSVMANFWWNAVEE  1249

Query  3241  NKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKN  3420
              +K+H V W  +CKSKD GGLG R    FN ALLAK AW+L+ +   L  +V + +Y  +
Sbjct  1250  KQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARYFPS  1309

Query  3421  KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGD----KPLAFM  3588
              +F    +    S+ WRSI+ GR ++E G    IG+GL  N W D W  D    +P    
Sbjct  1310  ISFMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFDELPRRPCNKE  1369

Query  3589  DEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
               + +       +VS+ I     WN+  L  L P   +  IR+ P     ++ D L W  
Sbjct  1370  QMINL-----NLRVSELITNQGDWNLQALQELFPPCDVIKIRSFPPDT--RLQDRLVWAY  1422

Query  3769  SPTGAFSVRSAF------SHIAGNDEDAMDT-----SWVWKMRVTERCrlflwllmrgrl  3915
             +  G +SV+S +        + G + +           VW +    + R+FLW ++ G +
Sbjct  1423  TNNGHYSVKSGYWLSSKAMEVPGGESEGSRVLNELKQKVWTVETAPKIRMFLWRVLSGAI  1482

Query  3916  lTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ-YSL-----  4077
                      G+  + +C  C   DET++H L  C  A   W  T  P+  Q +S      
Sbjct  1483  AVADCMRNHGLQVNPICQVCRSADETVSHALFLCPVASTVWSATALPLPVQGFSTSVSEN  1542

Query  4078  VTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN-  4254
             +      + N    S      PW        WEIWKARN  +F N       ++  A   
Sbjct  1543  IGHCLRLITNTDLPSSLRLAIPW------ILWEIWKARNGMVFNNKLQDHHVLIAGAVAD  1596

Query  4255  ----LTLDTVEVFLNKKCVHV--GKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
                 L L+ ++    +  V +  G M    W  P  G +K N + ++  +   A    + 
Sbjct  1597  AEEWLKLNELQKQEQRSVVGIMRGGMSQKRWTKPAFGILKCNINASWASSQHYAGGAWIL  1656

Query  4417  RDHKGEWLF----GFMTNIGVSNSFAAELWGL  4500
             R+H G+ LF     F+  +   N  AAEL  L
Sbjct  1657  RNHVGDVLFHSRHAFLPTV---NRIAAELQCL  1685



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score =   467 bits (1201),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 336/1156 (29%), Positives = 540/1156 (47%), Gaps = 131/1156 (11%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
              RV++ Y    R  KE FW    ++    N PW+  GDFN+I  + E+ G   +N +R  
Sbjct  154   TRVTWVYGTSYRAEKEAFWGWMHTWFKPSNIPWLCGGDFNEILWDYEKSGGXDLNYNRPW  213

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
                E  ++  L+DM   G  ++W     G+ V+ R LDR L N   Q  +P +  I  P 
Sbjct  214   FLEEFLNSSELMDMEFKGPPFTWRGMRNGQLVEER-LDRVLSNKLWQECWPNSLVIHEPV  272

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWS-NSLLDVVGA  1557
               SDH PL  + ++     +  + FRFE  W   E  ++I    W R +S + +      
Sbjct  273   IGSDHCPL--IIQSQPHGHKPKKVFRFEAFWAKEEKCKEIVESCWRRQYSGDGIARWQKK  330

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             + +  +    W++  F +       L  ++  +Q    YN ++  + ++ +L   +  + 
Sbjct  331   MHQCRSQLSCWSRNAFKSRGIELDCLLNQLGDLQ----YNWNQNFEQIQ-ELTVSIGRLW  385

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGE-WNSDFKTISDHI  1914
             + EE  W Q+SR  W+Q+GD NTAF+H+STL RR R+ +  L+   + W  +  +I    
Sbjct  386   EIEESYWLQRSRVKWLQEGDANTAFFHQSTLQRRRRNCVVKLQDGRQGWVENQDSIRHTF  445

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMKKFGSPGP  2091
              + +I+LF    + D     ++C   + + QM++ LTR V + E+K A F M    +PGP
Sbjct  446   EDHYINLFTSSGLRDWG-QSLHCIQHMVSDQMNEELTRPVGVEEIKLAAFQMGGLKAPGP  504

Query  2092  DGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPIT  2271
             +G Q  FYQTFW  +   +   V+  ++    P ++  ++I L+PK  +P +   FRPI+
Sbjct  505   NGFQGIFYQTFWNTLLDDVNCIVQDYMQGACSPKRLNSTYIVLVPKVKNPVSVGQFRPIS  564

Query  2272  LLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGK-K  2448
             L N S+KI+SKV+ NR++PI+ +LI P Q++F+ GR   DNI +  E+ H++  +K K K
Sbjct  565   LCNYSYKIVSKVLANRLKPILPDLISPMQSAFVSGRQIQDNIGIAHEMFHFLHXRKAKYK  624

Query  2449  GLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQ  2628
               M IKLD+HKAYD ++W+FLE+ +   GF     +L+M  V+    +++ NG+    F 
Sbjct  625   FEMGIKLDMHKAYDRVEWDFLEAVMERMGFCSLWRNLVMGCVKTVDFAVILNGQPGRKFT  684

Query  2629  PGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLF  2808
             P RG+RQGDPL+PYLFIL       ++Q+                   S +FF       
Sbjct  685   PSRGIRQGDPLSPYLFILV------NVQK-------------------SCMFF-------  712

Query  2809  AEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLG  2988
                                   G N+  S S   C+             + G+  ++N G
Sbjct  713   ----------------------GANVPNSLSAELCT-------------VMGMPSAENPG  737

Query  2989  TYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVF  3168
              YLG+P    R  K +  ++   +  K+  WK N LS AG+  ++++ L ++P Y M  F
Sbjct  738   LYLGLPSSWGRSKKQSLAFVKGRILEKIQXWKQNTLSQAGKEVMIKAVLQAIPAYPMNXF  797

Query  3169  KLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAK  3348
             K PA  C+++D +   F WG     K++H V  + +   K AGG+G R   +FN+ALLAK
Sbjct  798   KFPATLCSEMDSLIAAFWWGQKGGEKRIHWVSKDLLGLPKQAGGMGFRGFKEFNDALLAK  857

Query  3349  LAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGN  3528
               W L+   D LW K+++ +Y  N +F        ASWGW S++ GR ++  GA W+I N
Sbjct  858   QCWXLIQDPDSLWAKILKARYFPNGSFLDAIRGGXASWGWSSLLVGREVLLQGAHWQIMN  917

Query  3529  GLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLL-PHD--  3696
             G +   W D W    P      ++        +V   I  +  TW++D L   + P D  
Sbjct  918   GRTTRVWMDMWIPSIPEGHPLPISAVPVSRNLRVGTLISDSSGTWDLDFLQPFISPEDFS  977

Query  3697  -IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIA---------GNDEDAMDTS  3846
              I+D     P+     + D L WP +  G ++V+S +             G     +  S
Sbjct  978   AILDTCIGDPL-----LEDRLVWPGTRNGIYTVKSGYHWKKACSMPFTGRGTSSSYLIHS  1032

Query  3847  --W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLME  4014
               W  +WK+    + R F+W  +   L T    + +  +   LC  C   +E++ H+   
Sbjct  1033  KVWKAIWKLATPPKIRNFMWRALHRALATMDVLFIRRCSPSPLCPICHAQEESVEHLFFL  1092

Query  4015  CSFAKDCW-------RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCW  4173
             C + +  W       R      S   SL   L S+ +    + D I        F  TCW
Sbjct  1093  CPWVEPIWFGGSLSYRVNRESFS---SLXAWLASFFEAQLGSKDEIMRLLSYAAF--TCW  1147

Query  4174  EIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVC--------W  4329
              IWKAR   IF     +P  ++   +N    +V  FL   C  +G +R           W
Sbjct  1148  HIWKARCALIFNQKKPSPQQLILAISN----SVGSFLEASCAPMGLVRSSPPVSPSLDRW  1203

Query  4330  QPPETGWIKFNTDGAF  4377
              PP   + K N D ++
Sbjct  1204  SPPYAPFWKVNVDASW  1219


 Score = 53.9 bits (128),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  741  LSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLFNVDPL  920
            L+WNCRG+G+   V     L+R ++   I   ETK  +  R+  +  +LGF K F+V P+
Sbjct  57   LTWNCRGLGSDTVVRALYGLIRKHRPAMIFLSETKMKD-HRVDGVRRRLGFSKGFHVSPI  115

Query  921  GFAGGLTLFLE  953
            G AGGL+++ +
Sbjct  116  GRAGGLSMWWD  126



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   469 bits (1206),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 335/1162 (29%), Positives = 556/1162 (48%), Gaps = 59/1162 (5%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y  P+R  K + W       +    P IM GDFN+I    E+ G +         F  + 
Sbjct  69    YGWPDREHKYKTWEMMGRIKAMSREPCIMFGDFNEILRQAEKEGGAPRGEWEMDAFRRAV  128

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
               C L D+G  G  ++W R     T+ R +LDR L + +  ++FP+     + +  SDH 
Sbjct  129   DDCHLCDLGYKGCQFTWKRGNNPSTLVRERLDRFLADGQWCDMFPKVTVCHMAQYRSDHA  188

Query  1411  PLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKK  1587
             P+     + +   R  + FRFE  WL++ +  ++  + W+N    +VV  +        +
Sbjct  189   PILLSTWSPHDRGRNKKLFRFEALWLSKPECANVVEQAWTNCTGENVVERVGNCAERLSQ  248

Query  1588  WNKETFGNIFGRKASLQARIKGVQESVFYNTSR----GLQVLERKLVTELNEVLKQEELL  1755
             W   +FGNI       + +IK  +E +  N +R     +  L  +L  EL+E+ +QEE  
Sbjct  249   WAAVSFGNI-------KKKIKDTEEKLRLNQTRYPDAAMLQLCSELSKELDELHQQEESY  301

Query  1756  WFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFID  1932
             WF ++R   ++DGD+NT ++H+    RR+ + I  +   N  W    + + + +S++F +
Sbjct  302   WFARARANDLRDGDKNTTYFHRKASQRRHYNSIDGLFDENNRWRDKEEDLEELVSSYFDN  361

Query  1933  LFGRKNIMDGSPNDMYCGPKLDT---GQMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGI  2100
             LF      +G  N       L+T     M+K L  E T  E+K A+F M    +PGPDG+
Sbjct  362   LFS----TEGPTNIEQALEGLETRITEDMNKMLNTEPTDEEIKGALFQMHPNKAPGPDGM  417

Query  2101  QAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLN  2280
              A F+Q FW  V   I  FVK   R      ++ ++ + LIPK  +P+  ++FRPI+  N
Sbjct  418   HALFFQKFWHIVGKDIILFVKNWWRALVGLEEVNKTCVVLIPKCANPKRMTEFRPISCCN  477

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLM  2457
             V +KIISK + N+++P++ +LI   Q++F+P R   DN ++  EI H M+ K +G+ G  
Sbjct  478   VLYKIISKTMANKLKPLLGDLISENQSAFVPKRLITDNALIALEIFHAMKRKGEGRDGSF  537

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
             A+KLD+ KAYD ++W FLE  L   GF    ++ IM+ +   S +   N +      P R
Sbjct  538   ALKLDMKKAYDRVEWSFLEKVLYKLGFSGAWVTKIMYCLASVSFTFKINRKVSGSVIPSR  597

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             GLRQGDP++PYLF++  +  S  + +  + K      +  G   +SHLFFA+D +LFA+A
Sbjct  598   GLRQGDPISPYLFLIVADAFSALLTKAAQEKRIHGAKICNGAPRISHLFFADDSILFAKA  657

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             +  Q  +I   + ++   SG ++N+ K+++  S   ++  ++ +    G+        YL
Sbjct  658   TVRQCSVITEIISQYERASGQSVNLDKTDVVFSKCVDANRRQEIVATLGVKEVVQHAKYL  717

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+P +  R  K  F  + + + +K+  WK   LS  G+  L+++ + ++  Y M VFK+P
Sbjct  718   GLPTIIGRSKKVIFASLKERIWKKIQGWKEKSLSRPGKEVLLKAVVQAILTYMMSVFKIP  777

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
              G  N+I  +   F WG +   +K+H   W ++CK K  GG+G      FN ALLAK  W
Sbjct  778   EGLINEIHTLMARFWWGSTDTQRKMHWSSWAELCKPKAMGGMGFCNLHVFNQALLAKKIW  837

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +L T+   L  K+++ +Y K+          + S+ WRS+   +S++  G  WR+G+G++
Sbjct  838   RLHTNPTSLLHKLLKARYFKHDEVLNARRGFDPSYSWRSLWGAKSLLLEGLQWRVGDGVN  897

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAK----VSDFILPN-RTWNVDKLSSLLPHDII  3702
             ++ W + W      A      IP S    +    V+D I PN  TW    +S     +  
Sbjct  898   ISAWENAWVPGCRAA-----PIPRSMESKELIVNVADCIEPNGSTWKQHLVSQCFSDEDG  952

Query  3703  DGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSA--FSHIA-GNDEDAMDTSW--VWKMRV  3867
               I  TP+++    +D  YW  +  G ++V+S   F  +  G     ++  W  VWK+  
Sbjct  953   QRILKTPLSIFP-TNDIRYWGCTKDGVYTVKSGYWFGLLGEGVLPQTLNEVWKIVWKLGG  1011

Query  3868  TERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRT  4047
               +   F+W + +G +      +R+ + +D +C +CG   E++NHVL EC    D W   
Sbjct  1012  PPKLSHFVWQVCKGNMAVKEVLFRRHIAQDEICMSCGIEVESINHVLFECEAIGDVWANC  1071

Query  4048  HHP----VSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYT-CWEIWKARNQRIFEN  4212
              H      +   S  + L  WV                V  I T  W +W  RN+ I+ +
Sbjct  1072  KHGDIVRAAPSGSFASKLLWWVNEVSLEE---------VREITTIAWAVWFCRNKLIYAH  1122

Query  4213  TASAPM----DIMRRANNLTLDTVEVFLNKKCVHVGKMRWV-CWQPPETGWIKFNTDGAF  4377
                 P       +R  +     +  VF +   ++ G    V  W  P    IK N D   
Sbjct  1123  EVLHPQVMATKFLRMVDEYRSYSQHVF-SPTSINSGNGGLVSTWIRPSLDVIKINVDAHI  1181

Query  4378  KRNTGLASAGGLARDHKGEWLF  4443
                    S G + RD  G  L 
Sbjct  1182  LEGR-YVSLGVVIRDSSGAVLL  1202



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score =   476 bits (1226),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 343/1234 (28%), Positives = 574/1234 (47%), Gaps = 82/1234 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W++++ + ++I    + I   V+  + +  +S  Y  P +  + + W      S   N
Sbjct  451   LMWKNNV-SLSLISQDERLIDSHVTFNNKSFYLSCVYGHPTQSERHQLWQTLEHISDNRN  509

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             A W+++GDFN+I  N E+ G          NF    S C + DM + G  +SW  +    
Sbjct  510   AEWLLVGDFNEILSNAEKIGGPMREEWTFRNFRNMVSHCDIEDMRSKGDRFSWVGERHTH  569

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPL------------KFLCEAgnpp  1446
             TV +  LDR   N      FP A+   L  T SDH P+            K         
Sbjct  570   TV-KCCLDRVFINSAWTATFPYAEIEFLDFTGSDHKPVLVHFNESFPRRSKLFRFDNRLI  628

Query  1447  rrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRK  1626
                      + +W T  + R        +S    +  +   +NL+               
Sbjct  629   DIPTFKRIVQTSWRTNRNSRSTPITERISSCRQAMARLKHASNLNS--------------  674

Query  1627  ASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQ----EELLWFQKSRRMWIQDG  1794
                + RIK +Q S+        + ++R+L+ +L E L +    EE+ W QKSR  W+++G
Sbjct  675   ---EQRIKKLQSSL-NRAMESTRRVDRQLIPQLQESLAKAFSDEEIYWKQKSRNQWMKEG  730

Query  1795  DRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPN  1971
             D+NT ++H  T  R +++R+  ++   G   +  K I +H  +FF ++F   N +  SP 
Sbjct  731   DQNTGYFHACTKTRYSQNRVNTIMDDQGRMFTGDKEIGNHAQDFFTNIFS-TNGIKVSPI  789

Query  1972  DMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHI  2148
             D        T  ++  LT+E +  E+  A+  +    +PGPDG+ A FY+  W+ V   +
Sbjct  790   DFADFKSTVTNTVNLDLTKEFSDTEIYDAICQIGDDKAPGPDGLTARFYKNCWDIVGYDV  849

Query  2149  TTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRP  2328
                VKK      + P I  + I +IPK  +P T SD+RPI L NV +K+ISK +VNR++ 
Sbjct  850   ILEVKKFFETSFMKPSINHTNICMIPKITNPTTLSDYRPIALCNVLYKVISKCLVNRLKS  909

Query  2329  IMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWE  2505
              + +++   Q +F+PGR   DN+++  E++H ++++K   K  MA+K D+ KAYD ++W+
Sbjct  910   HLNSIVSDSQAAFIPGRIINDNVMIAHEVMHSLKVRKRVSKTYMAVKTDVSKAYDRVEWD  969

Query  2506  FLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILA  2685
             FLE+T+  FGF    I  IM +V+    S+L NG       P RG+RQGDPL+PYLFIL 
Sbjct  970   FLETTMRLFGFCNKWIGWIMAAVKSVHYSVLINGSPHGYITPTRGIRQGDPLSPYLFILC  1029

Query  2686  MERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFS  2865
              + LS  I  +    + + + +  G   ++HL FA+D + F +A+    + + +    + 
Sbjct  1030  GDILSHLINGRASSGDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYE  1089

Query  2866  GKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGY  3045
               SG  INV KS I          +  LK +  I      G YLG+P    R  K  F Y
Sbjct  1090  YYSGQKINVQKSMITFGSRVYGSTQSRLKQILEIPNQGGGGKYLGLPEQFGRKKKEMFEY  1149

Query  3046  ILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLW  3225
             I+D +K++ + W    LS AG+  +++S   +MPVY M  FKLP G  ++I+ +  +F W
Sbjct  1150  IIDRVKKRTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWW  1209

Query  3226  GDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMRE  3405
               ++  + +  V W  +  SK  GGLG R    FN+ALLAK AW+L+   + L+ +VM+ 
Sbjct  1210  EKASNQRGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKA  1269

Query  3406  KYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAF  3585
             +Y K+ +     +    S+GW S++ G ++++ G    IG+G ++    D      P   
Sbjct  1270  RYFKDVSILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDNIVDSHPPRP  1329

Query  3586  MD------EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVS  3747
             ++      E+TI ++  E K S +      W+  K+S  +       I    +A  ++  
Sbjct  1330  LNTEETYKEMTI-NNLFERKGSYYF-----WDDSKISQFVDQSDHGFIHRIYLAKSKK-P  1382

Query  3748  DSLYWPRSPTGAFSVRSAF---SHIAGNDEDAMD--------TSWVWKMRVTERCrlflw  3894
             D + W  + TG ++VRS +   +H    +  A++         + +W + +  + + FLW
Sbjct  1383  DKIIWNYNTTGEYTVRSGYWLLTHDPSTNIPAINPPHGSIDLKTRIWNLPIMPKLKHFLW  1442

Query  3895  llmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYS  4074
               +   L T      +GM  D  C  C   +E++NH L  C FA   WR +   +     
Sbjct  1443  RALSQALATTERLTTRGMRIDPSCPRCHRENESINHALFTCPFATMAWRLSDSSLIRNQL  1502

Query  4075  LVTPLKSWVKN------NCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI  4236
             +    +  + N      +   SD+    P     ++  W IWKARN  +F     +P   
Sbjct  1503  MSNDFEENISNILNFVQDTTMSDFHKLLP-----VWLIWRIWKARNNVVFNKFRESPSKT  1557

Query  4237  MRRANNLTLDTVEVFLNKKCV-----HVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLAS  4401
             +  A   T D +    + K        + + + + W+ P   ++K N D  F      A+
Sbjct  1558  VLSAKAETHDWLNATQSHKKTPSPTRQIAENK-IEWRNPPATYVKCNFDAGFDVQKLEAT  1616

Query  4402  AGGLARDHKGEWL-FGFMTNIGVSNSFAAELWGL  4500
              G + R+H G  + +G M     SN   AE   L
Sbjct  1617  GGWIIRNHYGTPISWGSMKLAHTSNPLEAETKAL  1650



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   466 bits (1200),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 335/1108 (30%), Positives = 520/1108 (47%), Gaps = 64/1108 (6%)
 Frame = +1

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F E  + C L D+G  G  ++W R     TV R +LDR L + +   LF  +     P  
Sbjct  10    FREVVAECDLRDLGFRGSPFTWQRGNDPATVIRERLDRFLASEDWCTLFSISSVCHFPIY  69

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-SNSLLDVVGAISEVT  1572
              SDH PL    +     R   + F FE  WL+R +  D+    W S++   +   ++   
Sbjct  70    KSDHAPLLLSADVRGRRRVHKKLFYFEALWLSRPECFDVVRSAWGSHAGEGIESRVAACA  129

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
                  W   TFG++  R    +A ++  Q  V       +    R LV EL+E+ + EE 
Sbjct  130   VQLGSWAAATFGDLKKRVKRKEAELEEWQSRV---PDAAMLSQCRVLVGELDELHRLEES  186

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHISNFFI  1929
              W  ++R   ++DGD+NT+++H     R+ R+ I  L+  +G    + + I D  S++F 
Sbjct  187   YWHARARVNELRDGDKNTSYFHHKASYRKRRNSILQLQDEHGVLKMEEEEIGDINSDYFT  246

Query  1930  DLFGRKNIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQ  2103
             ++F     +    ++   G   K+     H L    T  E+  A+  M    +PG DG+ 
Sbjct  247   NMFSSS--LPSGFDEALAGISSKVVDESNHALVAMPTREEIHSALLQMHPNKAPGVDGMH  304

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILES-FITLIPKKDSPETASDFRPITLLN  2280
             A FYQ FW  V   +  FV++   D RV  + L +  ITLIPK  +P    DFRPI+L N
Sbjct  305   ALFYQKFWSVVGDDVIDFVQQWW-DSRVDLQSLNATCITLIPKCQNPIQMGDFRPISLCN  363

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYM-RLKKGKKGLM  2457
             V +K+ISKV+ NR+  I+ +LI P+Q++F+PGR   DN ++  EI HYM R    K G M
Sbjct  364   VLYKVISKVMANRLEVILPDLISPYQSAFVPGRLITDNAMIAYEIFHYMKRSGDSKTGSM  423

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
             A KLD+ KAYD ++W FLE  +   GF  + +  IM  +   S +   NG+      P R
Sbjct  424   AFKLDMSKAYDRVEWSFLEQVMRKMGFCDSWVRRIMVCLSSVSYAFKLNGKVTGNIIPSR  483

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             GLRQGDPL+PYLF+L  E  S  + +           + R    +SHLFFA+D +LF  A
Sbjct  484   GLRQGDPLSPYLFLLCAEAFSTLLAKASDDGRIHGARVCRSAPRISHLFFADDSILFTRA  543

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             +  +  ++ + +  +   SG  IN +KS +  S N +   +  ++++ G+        YL
Sbjct  544   TLQECSVVADIISVYERASGQKINFNKSEVSFSKNVDDSRRVEIRSMLGVREVVKHDKYL  603

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+P L  R  K  F  + + + +KL  WK  +LS AG+  L+++ + ++P Y M +F +P
Sbjct  604   GLPTLIGRSKKAVFAVLKERVWKKLQGWKEKLLSKAGKEVLIKAVIQAIPTYMMSLFAIP  663

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
              G   DI+ +C  F W  +   +K+H + W   C  K  GG+G R    FN ALLAK  W
Sbjct  664   DGILEDINSMCARFWWRATGMARKMHWISWEKFCLPKSYGGMGFRDLKTFNQALLAKQGW  723

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +L+     L  ++MR +Y KN  F       + S+ WRSI   +S++  G  WR+GNG S
Sbjct  724   RLMCDDGSLAHQIMRARYFKNVPFLDARRGYDPSFVWRSIWGAKSLLMEGLKWRVGNGAS  783

Query  3538  LNFWS-DWWTGDKPLAFMDEVTIP--DSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDG  3708
             +  W   W  GD       +V  P  +S+ +  V+D +  N  W+V  L+  L  +  D 
Sbjct  784   IRVWDMAWLPGDSS----SKVPTPNVESREDLMVADLLSVNGGWDVAALAHHLTEE--DA  837

Query  3709  IRATPIAVCEQVS-DSLYWPRSPTGAFSVRSAF-----SHI-------AGNDEDAMDTSW  3849
             + A  I + E+   D LYW  +  G FS +SA+      H+        G   DA   S 
Sbjct  838   MLAREIPLSERYPIDVLYWWPAKDGIFSTKSAYWLGRLGHVRGWMNRFGGGHGDAW--SI  895

Query  3850  VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAK  4029
             +WK+    +   FLW    G L T      + +  D  C  C    +T+ H + +CS   
Sbjct  896   IWKLGGLPKLAHFLWRACVGALATRGRLRDRHIIADGQCIHCVGQTDTIVHAVCKCSLVA  955

Query  4030  DCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPW---------GVTFIYTCWEIW  4182
               W  +     FQ  L         ++C AS +++   W          ++F    W  W
Sbjct  956   SIWAAS----PFQQLL---------SDCNASSFVDLLLWLNSKLDRMDLLSFASLAWAAW  1002

Query  4183  KARNQ----RIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGW  4350
               RN       + N     +  +R  ++       V    + V +G      W PP  G 
Sbjct  1003  SFRNSVHHDEPWSNAQVGALGFLRLVHDYKSYGGAVLARPQGV-LGVFSRASWIPPGEGA  1061

Query  4351  IKFNTDGAFKRNTGLASAGGLARDHKGE  4434
             ++ NTD A   + G+   G + RD  G+
Sbjct  1062  VRINTDAAILGDDGVG-LGAVVRDSTGQ  1088



>ref|XP_008375089.1| PREDICTED: uncharacterized protein LOC103438319 [Malus domestica]
Length=1384

 Score =   470 bits (1209),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 339/1209 (28%), Positives = 545/1209 (45%), Gaps = 57/1209 (5%)
 Frame = +1

Query  976   VIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFND  1155
             VI  + Q +    +  H   +  F Y   + + +   W D +S   +   P + +GDFN 
Sbjct  82    VISISDQQVTVRCTFDHIPSQFXFVYASTSPIKRRDLWADFISLXPQTXVPXMAIGDFNA  141

Query  1156  IADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRAL  1335
             I    EQ G    +   C  F      C    + T G  ++       R    R L+R+L
Sbjct  142   ILGAHEQMGGGRPSQXSCAZFSNMSDTCNFTHLNTXGAXFTXSNGWRSRGRTERXLBRSL  201

Query  1336  WNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIW  1515
              +    + +P +  I LP+  SDH+PL F           +RPFRF+  W+    +R+  
Sbjct  202   CDXSWFDSWPHSNCIALPKVVSDHNPLIF--SGSRVLSXXHRPFRFQSMWVQHPSFRETV  259

Query  1516  GRVWSNS------LLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYN  1677
                W N+      +  ++  +  +    ++WN   FG++  R A+ +  +  +Q+ +   
Sbjct  260   THCWRNTVVYGCPMFIILQKLKALKTCLRQWNFSVFGDVHNRVANARXNLSMIQQRI---  316

Query  1678  TSRGLQ--VLERKLV--TELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNR  1845
             ++ G+   + E ++V  T + E L+ +E  W   +   W+  GD N++F+H    I+ + 
Sbjct  317   STEGINNDLFEEEIVAKTTVXESLQMQEAFWKDXAXVKWLTKGDXNSSFFHAYAXIKSSS  376

Query  1846  SRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYC---GPKLDTGQMHK  2016
             S I  +       +D   I +HI NF+  LFG      G   D  C    P +   +   
Sbjct  377   SHISCIXXGNNLLTDPLAIXNHIVNFYQTLFGSSFTXSGI--DXVCEVIQPMVXDSENDL  434

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             L+      E+K+AVF +    +PGPDG    FY   W+ V   +  FVK+  +   + P 
Sbjct  435   LSALPXBEEIKEAVFSLSAXSAPGPDGFPGFFYHHCWDIVSFDVIQFVKQFFQSNWLYPN  494

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
                +F+ LIPK +   + + FRPI L N  FKII K++  R+  +++ +I P Q +F+PG
Sbjct  495   ANSNFLVLIPKVEDXISMTHFRPIALANFLFKIIPKILAVRLSHVVQRIISPHQAAFIPG  554

Query  2377  RSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLIS  2556
             R   D I L  E  + +  KK + G M +K D+ KA+D++DW FL   L +FGF    I 
Sbjct  555   RRITDCIGLVSECFNVLD-KKTRGGNMGVKXDIAKAFDTLDWSFLLRVLTNFGFSTCFID  613

Query  2557  LIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNW  2736
              +   +R + +S+L NG     F   RG+RQGDPL+P LF LA E LS  +         
Sbjct  614   WVSTILRSAXLSILINGSPHGFFSCSRGVRQGDPLSPLLFCLAEEALSRGLSRLQLDGLT  673

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
             KP    RG    SH+ +A+DL +F  +     R +     ++S  SG  IN +KS  +  
Sbjct  674   KPTFAPRGCISPSHVLYADDLFIFCRSDGVTXRNLQGFFDRYSRASGQFINKAKSTFYLG  733

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
              +T+   K  +++  G         YLG+PI   +  +     + D  K KL  WKG +L
Sbjct  734   -STSRHRKXVVESYLGFKEGKXPFVYLGVPIFCGKPKRSYLQALADKAKAKLTGWKGKLL  792

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S+AGR  L QS   SM +++  V+K P+     + R  R+F+W     +KK   V W  I
Sbjct  793   SMAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIWSGDVTSKKSVTVSWRQI  852

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANA  3456
             C  K+ GGLGLR     N   L K  W ++T+ D  W   +RE++  +   ++     ++
Sbjct  853   CAPKNEGGLGLRDLGSLNTTXLLKJGWLIITT-DSPWSIYLRERFKLHGRLYSCSYKXSS  911

Query  3457  SW-GWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLA-FMDEVTIPDSQSEAKV  3630
              W G +SI+    I+     W IGNG + + W D W  DKP+   +    I  S S  KV
Sbjct  912   IWPGIKSILH---ILFQNCRWVIGNGSTTSLWVDKWL-DKPIVDVVGATEIAPSLSCTKV  967

Query  3631  SDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSH  3810
             S+ I   + W +  + S    D+   I   P+ + E   D L W  S +G FS    +  
Sbjct  968   SNIIRMGK-WVIPSIFSSTFPDLTKEILEMPLPIDED-KDVLIWEVSTSGVFSFSDGYEI  1025

Query  3811  IAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDE  3990
             +          S +W+  +  R  + +W ++  +L T     R+G+    +C  C    E
Sbjct  1026  VRHRFPVKSWASIIWRPFIPPRYSILVWKILFNKLPTXDXLQRRGIPLAPICQLCHKNSE  1085

Query  3991  TMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCP-----WGVT  4155
             +++H+   C FA+  WR     ++ Q+  + P    + +           P     W  +
Sbjct  1086  SIDHLFSSCEFAQCAWRW----LATQFGTIIPPTGSLSDLWLVFLSKRFSPHLXNVWIAS  1141

Query  4156  FIYTCWEIWKARNQRIFENTASAPMDI-------MRRANNLTLDTVEVFLNKKCV-HVGK  4311
               +    IWK RN+  FE    +   +       +R+        V   L+++ +  +G 
Sbjct  1142  GFFLLMAIWKMRNKVKFEGKPPSXSRLCRSTSAWIRQVGAJXPGHVRGILDRQLLXSLGI  1201

Query  4312  MRWVC---------WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIG  4464
                 C         W PP   W+K NTDG  K N G A+ GG+ RD  G +L GF  ++G
Sbjct  1202  SPNSCKAPSIVPXLWHPPPFSWVKVNTDGLAKGNXGPAACGGVFRDSAGYFLGGFSLSLG  1261

Query  4465  VSNSFAAEL  4491
                SF AEL
Sbjct  1262  HRTSFYAEL  1270



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score =   467 bits (1201),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 341/1184 (29%), Positives = 543/1184 (46%), Gaps = 96/1184 (8%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              +W+  + +F+++  +S  I G +       R    Y       K + W+         +
Sbjct  33    IYWKEEV-DFSLVSFSSHHICGDIRVEGQMWRFIGIYGWAKEEEKFKTWDLIRHLCENIS  91

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              P ++ GDF++I    E+ G    N      F +    C L ++G     Y+W R     
Sbjct  92    LPLLVGGDFSEILSYDEKDGGVDRNRREMGAFRDLLDDCALRNLGFDNPRYTWERGLSVT  151

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             T  R +LDR + NL    +FP      L R  SDH P+    +A    R + R FRFE  
Sbjct  152   TRIRERLDRFVSNLAWTQIFPNHGVENLLRYKSDHSPIVTRLKAAATERGKRRGFRFETC  211

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
             WL      +     W  S  D +                                     
Sbjct  212   WLLDAGCEEAVKEAWEASSGDKI-------------------------------------  234

Query  1663  SVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRN  1842
                   +R L +L+     ELNE   ++E  W+ +SR   ++DGD+NT ++H     R+ 
Sbjct  235   ------TRRLSLLD-----ELNE---KQEAYWYLRSRVAEVKDGDKNTQYFHHKASQRKK  280

Query  1843  RSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDM--YCGPKLDTGQMH  2013
             R+ ++ L+  +G W S+ + I    +N+F  +F   N  D +   +  Y  P +      
Sbjct  281   RNFVKGLQNDDGVWCSEIEEIEIFFANYFSTIFTSCNPSDVNLQHVLQYISPIVSDDCNC  340

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              L R  T  E+  A+  M    +PGPDG+ A FYQ FW  +   I+ FV  +L     P 
Sbjct  341   ALLRPYTKDEIYAALSQMHPCKAPGPDGMHAIFYQRFWHIIGDDISDFVCGILHGHHFPA  400

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
              +  + I LIPK   P+ A++FRPI L NV +K++SK IV R++  + +++  +Q++F+P
Sbjct  401   DLNCTNIALIPKVKDPKVAAEFRPIALCNVLYKLVSKAIVLRLKDFLPDIVTEYQSAFVP  460

Query  2374  GRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNL  2550
             GR   DN ++  E+ H M+ + + ++G +A+KLD+ KAYD ++W FL   L+  GF    
Sbjct  461   GRLITDNALIAMEVFHLMKHRSRSRRGTIAMKLDMSKAYDRVEWGFLRKMLLTMGFDGRW  520

Query  2551  ISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVK  2730
             ++LIM+ V   S S + NG       P RGLRQGDPL+PYLFIL  +  S  IQ+KV+ K
Sbjct  521   VNLIMWCVSSVSYSFIINGRVRGSVVPNRGLRQGDPLSPYLFILVADIFSKMIQKKVQEK  580

Query  2731  NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
                    SR    +SHL FA+D +LF  A+  +   I++ L ++    G  IN  KS + 
Sbjct  581   RLHGAKASRSEPEISHLLFADDSLLFTRATRQECFEIVDILNRYELAFGQKINYEKSEVS  640

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGN  3090
              S     E K  L  +  +   +    YLGIP +  R  K  F  +LD + +KL  WK  
Sbjct  641   FSKGVRVEQKEALMGILKMRQVEKHEKYLGIPFVAGRSKKLIFASLLDRIWKKLQGWKEK  700

Query  3091  MLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWN  3270
             +LS AG+  L+++ + ++P Y M  +KLP      I      F WG S   +K+H   W 
Sbjct  701   LLSRAGKEVLLKAVIQAIPTYLMGGYKLPTMIIQKIQAAMARFWWGSSDTKRKIHWKNWE  760

Query  3271  DICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIA  3450
              +C  K  GG+G +    FN+ALL + AW+L+ +   L  +V++ KY  +  F    +  
Sbjct  761   AMCTLKCLGGMGFKDLGVFNDALLGRQAWRLIHAPQSLLSRVLKAKYYPSCEFLDASLGY  820

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKV  3630
             + S+ WRSI   +++V+ G  WR+GNG S+N W   W  D+   +   +T P +     V
Sbjct  821   SCSYSWRSIWSAKALVKEGLVWRVGNGQSINIWEAPWVVDENGRY---ITSPRNNDITMV  877

Query  3631  SDFILPNRT-WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
                I PN   W +D + ++        I A P+       D L W  +  G +SV++A+ 
Sbjct  878   QHLIDPNNIEWRLDVIDAVFNERDKKCILAIPLC-SSSPHDMLSWALTKDGHYSVKTAYM  936

Query  3808  HIAGNDEDAMDTSWV--WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCA-TCG  3978
                G + +   ++WV  W M V+ + R FLW L    L T    + + + ++ +C   CG
Sbjct  937   LGKGCNLENFHSAWVDLWSMEVSPKVRHFLWKLCTHTLPTRGVLFHRHLIDEEVCPWGCG  996

Query  3979  DGDETMNHVLMECSFAKDCW-------RRTHHPVSFQYSLVTP---LKSWVKNNCCASDW  4128
             + + T  H +  C   ++ W        R +        LV     L S ++        
Sbjct  997   EHESTY-HAIFFCPRFEELWMDSGCARMRDNSDCDTMCDLVAKWKQLDSRIR--------  1047

Query  4129  INGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLN---KKCV  4299
             + G      F+  C  IW  RN ++F N  +    ++RR + L  +  +  +N   ++ V
Sbjct  1048  VKG-----PFLMLC--IWGERNNKVFNNKITPNSVLLRRVDRLVEEYGKYAVNIYRRQGV  1100

Query  4300  HVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
                 +R+  W PP  G  K N D +     G    G +ARDH G
Sbjct  1101  VTQSLRY--WNPPSPGCWKINVDASLA-TEGWVGLGIIARDHLG  1141



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   462 bits (1190),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 304/985 (31%), Positives = 470/985 (48%), Gaps = 49/985 (5%)
 Frame = +1

Query  1582  KKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWF  1761
             K W KET  N   +   L+A I+   +S  + +S  ++  E+    EL    K EEL W 
Sbjct  6     KNWYKETGXNSKKKVELLKAEIRVALQSKEF-SSGAVKQKEK----ELRVAHKDEELYWK  60

Query  1762  QKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLF  1938
              KSR  W+ +GD+NT F+H  TL RR+R++IR ++   G W  + K I+D    +F +LF
Sbjct  61    TKSRNQWLNEGDKNTKFFHAQTLKRRSRNQIRGIVDSQGVWQEEDKKIADTAVGYFSELF  120

Query  1939  GRKNIMDGSPNDMY--CGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAF  2112
               ++   G   D+      ++     + LT  VT  E+  AV  +    +PGPDG    F
Sbjct  121   --QSSRPGQIEDIVRNVDARISPEDNNALTGPVTTAEIVLAVSQIPPSRAPGPDGFSGCF  178

Query  2113  YQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFK  2292
             YQ  W  V   +   +K     G +  ++  + + LIPK   P+  + FRPI L NV +K
Sbjct  179   YQDHWNTVGEDVVKIIKAFWHSGTLLRQLNHTNLVLIPKVRCPKNMAQFRPIALCNVIYK  238

Query  2293  IISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVH-YMRLKKGKKGLMAIKL  2469
             I++KV+ NR++ +M  +IG  Q++F+ G+   DNI++  E++H  +  ++  +  MAIKL
Sbjct  239   ILAKVLTNRLKLVMPKVIGDNQSAFVAGKQIQDNILVVHEVLHSLLHQRREDQAGMAIKL  298

Query  2470  DLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQ  2649
             D+ KAYD ++W FL + +   GF       I   +   S S++ NG       P RGLRQ
Sbjct  299   DMAKAYDRVEWNFLIAIMSKLGFSPIFCKWIKACISTVSFSIVVNGTPTGFIVPQRGLRQ  358

Query  2650  GDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQ  2829
             GDPL+P+LF+L  E LS  +++ +          +  GT ++HLFFA+D ++F  A+ D+
Sbjct  359   GDPLSPFLFLLCTEGLSVLLRKGLEQDALHGFKFTDTGTPITHLFFADDSVVFGNATVDE  418

Query  2830  GRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPI  3009
              R +   LK ++  SG  +N++KS++F SP T +  KR ++   GI      G YLG+  
Sbjct  419   ARAVAEALKVYACGSGQEVNLTKSSVFFSPKTPNRTKRDIEGTLGIQCKQGFGKYLGLQA  478

Query  3010  LHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTC  3189
                   K  F  + D ++ +LA W    LS AG+  L++S   ++P Y M  FKLP G C
Sbjct  479   DFGHSKKAVFAEVRDKVEARLAGWTEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVC  538

Query  3190  NDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVT  3369
              DI++  R F W  + Q   +H V W+ I K K +GGLG +    FN ALLAK+ W+L  
Sbjct  539   RDIEKAIRKFWWKGNDQRHGIHWVSWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTC  598

Query  3370  SHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFW  3549
                 L   V+++KY     F         SWGW+ I   R ++  G  WR+GNG  +N  
Sbjct  599   YPTSLLATVLKDKYHPGCTFKEAGRGKLTSWGWKGIYEARKVLLQGIRWRVGNGQRINIR  658

Query  3550  SDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPI  3726
              D W   KP  F   V   ++     V + I P + +W  +++ +    +  + I + P+
Sbjct  659   DDPWF-PKPSTF--RVCPYENLDATMVCELIEPASNSWKDNRIFAGFHREDAETILSIPL  715

Query  3727  AV--CEQVSDSLYWPRSPTGAFSVRSAFSHI---------------AGNDEDAMDTSW--  3849
             +   CE   D L W  S  G +SV+S +                  A ++   +   W  
Sbjct  716   SHFGCE---DKLMWHYSVNGVYSVKSGYGIAREMMENGALGKKGLGAPSEPTQLKKVWSR  772

Query  3850  VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAK  4029
             +W+++V  + + F+W      L       ++ M  D +C  C   DET NH+   C F+ 
Sbjct  773   IWRLQVPNKIKFFIWRCCNNALAVRRNIQKRHMRVDNVCGVCNAVDETENHLFFRCRFSH  832

Query  4030  DCWRRTH-HPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
               W  +  H  S        L SW K         N       F +  W IWK RN  +F
Sbjct  833   IFWFSSPLHLNSHVLEGYDFLDSWGKFQAGMKGKENAEEICQEFAFGLWRIWKNRNDAVF  892

Query  4207  ENTASAPMDIM----------RRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIK  4356
             +     P ++M          R A+    DT    +        +   + WQ P  G IK
Sbjct  893   KGLYRQPNEVMDLWWKNIIEFREASTCLGDTARSTVVTPLSATARPS-LHWQRPRYGTIK  951

Query  4357  FNTDGAFKRNTGLASAGGLARDHKG  4431
              NTD A+ + T  A  G + RD  G
Sbjct  952   INTDAAWCKATLRAGVGWVGRDLAG  976



>ref|XP_010513204.1| PREDICTED: uncharacterized protein LOC104789164 [Camelina sativa]
Length=1030

 Score =   461 bits (1185),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 275/870 (32%), Positives = 442/870 (51%), Gaps = 31/870 (4%)
 Frame = +1

Query  1705  RKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEW  1881
             R +  +L E  + EEL W QKSR+ W++ GD+NT ++H ST  RR R++I  +   +  W
Sbjct  4     RDIERKLKEAYRDEELYWQQKSRKFWLRVGDKNTKYFHASTKQRRVRNKIVGLFGPDNVW  63

Query  1882  NSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVF  2061
             +     +    S +F DLF R ++   S       P +       LTRE+T  EV+KA+F
Sbjct  64    DESPLGMEPIASIYFEDLFKRSDVSGISDILQEISPIITDAMNRSLTREITEAEVRKALF  123

Query  2062  DMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSP  2241
              M    SP PDG+ A F+Q FW  +K  +   VK   R G   P++ E+ I LI K D P
Sbjct  124   AMHPEKSPCPDGMTALFFQRFWPSLKGDLVALVKNFFRTGGFDPRLNETNICLITKVDQP  183

Query  2242  ETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVH  2421
             +  ++FRPI+L NVS+KIISK +  R++  + +++   Q++F+ GR   DNI++ QE+ H
Sbjct  184   QRMTEFRPISLCNVSYKIISKALCFRLKRFLPSMVSETQSAFVSGRLITDNILVAQEMFH  243

Query  2422  YMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLL  2598
              +    + K   +A K D+ KAYD ++W+FLE+ ++  GF +  IS IM+ V   S  +L
Sbjct  244   GLNTNPRCKSEFLAFKTDMSKAYDRVEWDFLEAVMIKLGFDRRWISWIMWCVSSVSYQVL  303

Query  2599  WNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSH  2778
              NG+      P R LRQGDPL+PYLFIL  E L  +I++  R K    I+++R    +SH
Sbjct  304   LNGQPRGSILPKRDLRQGDPLSPYLFILCTEVLIANIKKAEREKRLTGISIARDYPSISH  363

Query  2779  LFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNL  2958
             L FA+D + F +A E + +++M+ +  +   SG  +N+ KS+I       S+++  +K +
Sbjct  364   LLFADDSLFFCKAEESECKVVMDIIGNYGKASGQEVNLEKSSIMFGKKVPSDVRSRIKTV  423

Query  2959  TGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALS  3138
              GIS    +G+YLGIP   +      F Y+ D +  ++  W   +LS  G+  +++S   
Sbjct  424   IGISREGGMGSYLGIPENLQGSKTEVFRYVNDRLDDRVNGWSAKILSKGGKEIMIKSVAL  483

Query  3139  SMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKC  3318
             ++P + M  +KL     + +      F W  + + + +H V W+ +CK K  GGL  R  
Sbjct  484   ALPTHVMSCYKLTQELTSSLTSAISKFWWKSNDKARGMHWVAWDKLCKDKCDGGLVFRAL  543

Query  3319  LDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIV  3498
              +FN+A+LAK  W+L+   + L  +VMR +Y + K+        + S+ WRSI   + +V
Sbjct  544   EEFNDAMLAKQYWRLIHYPNSLMARVMRGRYFRRKHPLLATKPYSPSFAWRSIFSTKGLV  603

Query  3499  ELGAAWRIGNGLSLNFWSDWWTGD---KPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVD  3669
             E GA W +G+G +++ W D W  D   +P      V  P+      ++   L    W++ 
Sbjct  604   ERGARWLVGSGRNISVWRDSWIPDHQTRPANSRGRVLHPNLMVNHLINPLTL---DWHLP  660

Query  3670  KLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF--------SHIAGND  3825
              L   L    I  +R+  ++    + D + W  + +  +SV+S +          + G  
Sbjct  661   ILEEFLDPADIQLVRSLTVSK-SLIPDRVIWHYTKSVKYSVKSGYRLARDLHKEVVYGPT  719

Query  3826  EDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
               A+     WK+ V  + + F W +  G L        +G+  D +C  CG   ET+NH 
Sbjct  720   CTALRAQ-AWKLDVPSKVQHFFWQVASGTLPVKERLAHRGVRCDDMCLRCGSEVETINHA  778

Query  4006  LMECSFAKDCWR-------RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIY  4164
             L EC  ++  W         T  P    YS +  L S   +N   S      PW      
Sbjct  779   LFECVRSRLIWELSPVQLSLTGFPFGSVYSNLDYLYSNTFSNSGGSGICYMLPW------  832

Query  4165  TCWEIWKARNQRIFENTASAPMDIMRRANN  4254
               W IWK RN ++F+   + PMDI+ +A N
Sbjct  833   ILWTIWKDRNNKVFQGIEAEPMDIINQALN  862



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score =   467 bits (1201),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 311/977 (32%), Positives = 482/977 (49%), Gaps = 46/977 (5%)
 Frame = +1

Query  1669  FYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRS  1848
             F+  +R   +    +V   N++L+ +E  W  K++   ++  D N+ +YH    IRRNR+
Sbjct  217   FFLRNRRATIFRPMVVDGRNKLLEFQETHWRIKAKATHLKFSDSNSKYYHACASIRRNRN  276

Query  1849  RIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKN--IMDGSPNDMYCGPKLDTGQMHKL  2019
              +  ++   G   S+ K +    ++ F   F      I D   +     P +   +  +L
Sbjct  277   FVSSIIDDRGISISNPKQVELCFTSAFASRFSSNPSCIFDEELDLHLLSPIISDEENARL  336

Query  2020  TREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKI  2199
               EV+  EV++AVF++    +PGPDG    F+Q +W  V + +   V+     G++  ++
Sbjct  337   CAEVSFEEVREAVFELGPDKAPGPDGYPPFFFQKYWSLVGNSVFKAVRAFFHLGKLLKEV  396

Query  2200  LESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGR  2379
               +F+TLIPK ++P + + FRPI+L +  +K+I+K++ +R++ ++  +I P Q +F+P R
Sbjct  397   NHTFVTLIPKVEAPSSPNHFRPISLCSTIYKVIAKIMASRLKMVLGKIIHPLQGAFVPER  456

Query  2380  STADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISL  2559
                DNI+L  E+ H  R K G  G +AIKLD+ KAYD ++W F+ +     GF    I  
Sbjct  457   LIQDNILLAHEVFHSFRKKSGSSGWLAIKLDMEKAYDRLEWNFIFAVFKKLGFCDRWIDW  516

Query  2560  IMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI----QEKVRV  2727
             +   +   S S+L NG     F P RG+RQGDPL+PY+FIL  E L+  +     E  R+
Sbjct  517   LKECISTVSFSVLVNGIPGDIFTPSRGIRQGDPLSPYIFILCAELLARQLFCASTEGSRL  576

Query  2728  KNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNI  2907
                  + L   G  +  L FA+D+M+FA+AS +  R I   L  +   SG  +N +KS  
Sbjct  577   VG---VKLGHSGVKIPFLTFADDIMIFAKASVESCREIRGILDTYCRMSGQLVNYNKSAY  633

Query  2908  FCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKG  3087
              CSPNT+  +      +  +  + +LG YLG PI+  +V+ +TFG I + ++ +L+ WK 
Sbjct  634   QCSPNTDPILASAFAQVLQMGEASSLGKYLGCPIIDSKVTNNTFGEIQEKVQAQLSKWKA  693

Query  3088  NMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGW  3267
             N LS AGR  L+QS L++   Y MQ F LP    + +D+  R+F W  S ++K  +L+GW
Sbjct  694   NSLSQAGRTILIQSNLATKANYQMQCFSLPTHILHSLDKSYRNFFWNKSPESKSPNLIGW  753

Query  3268  NDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMI  3447
               +CKSK  GGLGLRK    N AL  KL W+++ S   LWV ++ +KY+K+++ F   + 
Sbjct  754   EKVCKSKREGGLGLRKAKVMNMALQFKLLWKILVSQGNLWVDLVSKKYLKDESLFDHNVK  813

Query  3448  ANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK  3627
             A ASW WR +M+ R   + G  W +GNG  ++FW D W    PL+ +  V I  S+S   
Sbjct  814   ATASWQWRKLMQFRKTFKKGLRWVVGNGEKISFWFDNWAFQYPLSSICPV-IRGSESLV-  871

Query  3628  VSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
             V+ FI  +  W+  +L   +P ++   I+   I   +   D L W  SP G +SV+S   
Sbjct  872   VAHFIDQDSHWDYRRLLDFVPEEVGTSIKGIFIPR-QGPEDKLVWALSPDGCYSVKSGVE  930

Query  3808  HIAGNDED-----AMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCAT  3972
              I GN        A   SW+W + +  + + FLW +    L T        +     C  
Sbjct  931   LIQGNGAHLTRPIASPFSWIWNLLIPPKIKFFLWKICNDGLPTKKRLEISHVFSPLECIF  990

Query  3973  CGDGDETMNHVLMECSFAKDCWRR--THH------PVSFQYSLVTPLKSWVKNNCCASDW  4128
             C    E + H+ +EC F  D +     HH      P     S V  L +   N   + + 
Sbjct  991   CNHHSENLMHLFLECPFCIDVFDLLGLHHGWPSLPPKPSDLSFVEFLSN--MNKVVSLED  1048

Query  4129  INGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCV---  4299
             I           T W IW ARN   F     +P+             VE F   K     
Sbjct  1049  I------AKIAITWWFIWYARNGVSFRQEPCSPIGTSLMVWKFYSRIVENFEGVKLAISN  1102

Query  4300  --HVGKMRW-----VCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTN  4458
                  +MR      + W  P +G+ K N DG+ K N G AS G + RD  G       + 
Sbjct  1103  VRSPPRMRKIPRKNISWVAPPSGFCKLNFDGS-KLNDGSASLGFIIRDEFGIIKICGASP  1161

Query  4459  IGVSNS-FAAELWGLRE  4506
             I  S+S   AE W LRE
Sbjct  1162  ISPSHSILVAEAWALRE  1178



>gb|EPS72636.1| hypothetical protein M569_02121, partial [Genlisea aurea]
Length=1503

 Score =   471 bits (1212),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 330/1091 (30%), Positives = 533/1091 (49%), Gaps = 50/1091 (5%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R++  Y  P + ++   W+       +F+ PW+++GDFN++    E   S   + S    
Sbjct  427   RLTGFYGNPLQASRSDSWSLLTRLHHQFSLPWLVVGDFNEVLWQDEHLSSCLRSCSSMGL  486

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F  +   C L D+G  G  ++W       +  + +LDR + N    N+ P      L   
Sbjct  487   FRNALEECDLSDLGFQGYPFTWTNNRTHPSTVKARLDRFVANTSWINIVPHFSVSHLKFG  546

Query  1396  HSDHHPLKFLCE---AgnpprrenrpfrfegAWLTREDYRDIWGRVWS---NSLLDVVGA  1557
              SDH P+  + +     +   R  R F+FE  W   E  R I    W+   +S    +  
Sbjct  547   GSDHCPILLMFKDVVGCHTTLRRKRFFKFEKIWCENETCRVIIDGCWAVPRSSWCPQLSL  606

Query  1558  ISEVTNLSKK---WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELN  1728
             +  + N  +K   W++ + G++  R +S+Q R+  + E V  + S G Q+  R L  +L+
Sbjct  607   LRRLQNCRQKLQCWHRTSIGSLRHRISSIQDRLSTLMEGVISD-SVGDQI--RDLKAQLS  663

Query  1729  EVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTIS  1905
             ++LK +E+ W Q+S+  W+++GD+N  F+H     R+ R++I  LK  N  W  +   I 
Sbjct  664   QLLKLDEIWWKQRSKVHWLREGDKNNKFFHGVASSRQRRNKIERLKSRNNIWLENTSDIH  723

Query  1906  DHISNFFIDLFGRKNIMDGSPNDMY-CGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFG  2079
                 + + DLF      + + N++    P++ T +M+ KLT+  T  E+  AV  M    
Sbjct  724   HEFISVYEDLFKSTYPSEDAINNIVRTAPRMVTDEMNRKLTQAFTSEEILTAVMQMNADS  783

Query  2080  SPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDF  2259
             +PGPDG    FYQ FW  + S +   V   L + +   K   + I  IPK   P   + +
Sbjct  784   APGPDGFPPLFYQKFWPTIGSEVCNSVLDFLNNRKCFRKFNHTNIVFIPKVSDPVEVAHY  843

Query  2260  RPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMR-LK  2436
             RPI+L NV +K+ SK I NR++  +  +I P+Q++F+P R   DNI++  E+ H +R L+
Sbjct  844   RPISLCNVIYKMASKCITNRLKEFVSEIISPWQSAFVPDRLITDNILVAFEVNHSIRNLR  903

Query  2437  KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKL  2616
             +GKK  +++KLD++KAYD ++W FL++ L+  GF  + + LI+ +V   S SL+ NG+++
Sbjct  904   RGKKSFVSLKLDMNKAYDRVEWSFLKAMLIQLGFHISFVELILLAVSSVSYSLVINGDRV  963

Query  2617  APFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAED  2796
                 P RGLRQGDPL+PYLF+   E LS  ++   + ++     ++R G  +SHLFFA+D
Sbjct  964   GLINPQRGLRQGDPLSPYLFLFCAEGLSSALRAAEQSQSITGFRVTRRGPSISHLFFADD  1023

Query  2797  LMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVS  2976
              M+F EAS      + + L+ +   SG  +N  KS +  SPNT    K       G  V 
Sbjct  1024  AMIFCEASCAALSRVSDILQDYERASGQKVNTHKSAMVFSPNTPDSEKEIWSRGLGFLVK  1083

Query  2977  DNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYT  3156
              +   YLG+P L     K  F  +L+ + RK+  W    LS AG+  L+++ L ++P YT
Sbjct  1084  SHHDIYLGLPSLTGSSKKRLFSGLLERVNRKIEGWNSKFLSQAGKLVLIKAVLQAIPAYT  1143

Query  3157  MQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNA  3336
             M  F LP     D+      + W +    K +H   W+ I +S   GGLG R   DFN A
Sbjct  1144  MSCFALPKSFLGDLQSAISRYWWRNR-NGKGIHWKSWDFISRSFKEGGLGFRDLHDFNLA  1202

Query  3337  LLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAW  3516
             LL K  W++ ++   +  +V R KY  N + +     A  S+ W  IM+ R +V  G   
Sbjct  1203  LLGKQVWRIASAPHSILSRVFRAKYFPNGDIWTARPCARGSYVWNGIMKSRDLVSKGIRH  1262

Query  3517  RIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRT--WNVDKLSSLLP  3690
              IG+G S++ W D W   KP  F     +   +  A V+  I  +RT  W+V ++     
Sbjct  1263  LIGDGSSVDIWHDPWI-PKPPTF-KPTNLLGERRRASVATLI-DSRTKWWDVGRIREKF-  1318

Query  3691  HDIIDGIRATPIAVCEQVS-DSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDT--------  3843
              D +D      I + E  S D + W  S +G ++VRSA+  +     +   +        
Sbjct  1319  -DPVDANHIISIPLSESPSEDKILWHYSKSGTYTVRSAYHLVRSLRVEVSSSSSDSRVTP  1377

Query  3844  ---SWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLME  4014
                  +WK     +  LF+W L  G L TN   WR+ +  D  C+ C +  E+  H+L+E
Sbjct  1378  KVWDLIWKHACCPKIGLFMWRLAHGCLPTNETLWRRRIPIDKECSICLNRTESDRHILLE  1437

Query  4015  CSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGC-----PWGVTFIYT-CWE  4176
             C  A   W  +  P          + +W ++   A DWI+       P   + + T  W 
Sbjct  1438  CPPAIQVWALSDLPWG-------AINTW-RDGASAIDWISSVSATLKPAAFSRLMTIAWF  1489

Query  4177  IWKARNQRIFE  4209
             +W  RN RI E
Sbjct  1490  LWWKRNSRIHE  1500



>ref|XP_010495131.1| PREDICTED: uncharacterized protein LOC104772187 [Camelina sativa]
Length=1814

 Score =   475 bits (1223),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 349/1228 (28%), Positives = 560/1228 (46%), Gaps = 71/1228 (6%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FW+ S +   VI    + I         +  VS  Y  P    ++  W+  +      +
Sbjct  514   LFWKPS-YEVEVISADHRIIDVKAKLGSLSFYVSCVYGDPVSSLRQGVWDSLVDIGVSRD  572

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             APW+++GD N++  N E+ G  +   S    F      C L ++ + G   SW  +    
Sbjct  573   APWLVIGDLNEMVSNTEKLGGPARAESSFFPFRNMILDCRLREVSSIGNRLSWAGKRNNM  632

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              +Q   LDRAL N     LFP  +   + R  SDH  L  L    N     +  F F   
Sbjct  633   WIQC-CLDRALGNEAWFQLFPRVQGEYMERIGSDHRAL--LLRLANDNVSRSGRFIFNKR  689

Query  1483  WLTREDYRDI----WGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIK  1650
             W+++ D+  +    W +  +     V+  I+E       W +        +  + + RI+
Sbjct  690   WISKPDFAAVVQSGWNKGVTTGQTSVMSRIAECRRTISGWKR-------SQNLNSKVRIQ  742

Query  1651  GVQESVFYNTSRGLQV-----LERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFY  1815
              V+E +    + G ++     L R L  EL E  + EEL W ++SR  W+Q GDRNT F+
Sbjct  743   QVREQL---DAEGTKIHPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFF  799

Query  1816  HKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKN---IMDGSPNDMYC  1983
             H S   RR +++I  +   NG       +  +    +F  +F   N   IM+     +  
Sbjct  800   HGSVQRRRIQNKILSLFDENGVEQFSEGSKGEVAVAYFRKMFTSSNPSAIMEALDGMV--  857

Query  1984  GPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVK  2163
              P++      +L R V+  E+K AVF +K   +PG DG+ + F++ +W+ V   +   V+
Sbjct  858   -PRVTDSMNAELIRPVSALEIKNAVFSIKGEKTPGADGMSSQFFKEYWDVVGPQVVQEVQ  916

Query  2164  KVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNL  2343
             +    G +P     + I LIPK  +P   ++ RPI+L +V +K +SKV+  R++  +  +
Sbjct  917   QFFASGHLPSDWNFTQICLIPKVQNPTRMTNLRPISLCSVLYKTVSKVLCQRLKRFLPKI  976

Query  2344  IGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLEST  2520
             +   Q +F+ GR   DNI+L  E+VH ++ K G  +  +AIK D+ KAYD ++W FLE  
Sbjct  977   VSDTQGAFVSGRLITDNILLAHELVHALQTKAGCNEEFLAIKTDMSKAYDRVEWNFLEEL  1036

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             L+  GF    ++ IM  VR  + S+L NG++    +P RG+RQGDPL+P+LFIL  E L 
Sbjct  1037  LIRLGFDIKWVNWIMSCVRSVTFSVLINGKEHGFIKPERGIRQGDPLSPFLFILCAEALV  1096

Query  2701  WDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGL  2880
               + +  +      + L+     + HL FA+D +    AS  +   ++ CL+ +   SG 
Sbjct  1097  HVMNKAEQEGRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQ  1156

Query  2881  NINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGM  3060
              IN+ KS+I      +  ++R +   TGI      G YLG+P       K    YI D +
Sbjct  1157  EINLQKSSITFGKKLDPYMRRVIGLFTGIEQEGGAGKYLGLPECFSGSKKDMLAYITDRL  1216

Query  3061  KRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQ  3240
               +L  W    LSL G+  L+++   ++PVY M  F+L    C  I     +F W    +
Sbjct  1217  TSRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWWNAVEE  1276

Query  3241  NKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKN  3420
              +K+H V W  +CKSKD GGLG R    FN ALLAK AW L+     L  +V + +Y  +
Sbjct  1277  KQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWCLLDGPSSLLARVYKARYFPS  1336

Query  3421  KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGD----KPLAFM  3588
              +F    +    S+ WRSI+ GR ++E G    IG+GL  N W D W  D    +P    
Sbjct  1337  TSFMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFDELPRRPCNKE  1396

Query  3589  DEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPR  3768
               + +       +VS+ I     WN+  L  L P   +  IR+ P     ++ D L W  
Sbjct  1397  QMINL-----NLRVSELITNQGDWNLQALQELFPPCDVIKIRSFPPDT--RLQDRLVWAY  1449

Query  3769  SPTGAFSVRSAF------SHIAGNDEDAMDT-----SWVWKMRVTERCrlflwllmrgrl  3915
             +  G +SV+S +        + G + +           VW +    + R+FLW ++ G +
Sbjct  1450  TNNGHYSVKSGYWLSSKAMEVPGGESEGSRVLNELKQKVWTVETAPKIRMFLWRVLSGAI  1509

Query  3916  lTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ--YSLVTPL  4089
                      G+  + +C  C   DET++H L  C  A   W  T  P+  Q   + V+  
Sbjct  1510  AVADCMRNHGLQVNPICQVCRSADETVSHALFLCPVASKVWSATALPLPVQGFSTSVSEN  1569

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN-----  4254
               +       +D  +     + +I   WEIWKARN  +F N       ++  A       
Sbjct  1570  IGYCLRLITNTDLPSSLRLAILWIL--WEIWKARNGMVFNNKLQDHHVLIAGAVADAEEW  1627

Query  4255  LTLDTVEVFLNKKCVHV--GKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHK  4428
             L L+ ++    +  V +  G M    W  P  G +K N + ++  +   A    + R+H 
Sbjct  1628  LKLNELQKQEQRSVVGIMRGGMSQKRWTKPAFGILKCNINASWASSQHYAGGAWILRNHV  1687

Query  4429  GEWLF----GFMTNIGVSNSFAAELWGL  4500
             G+ LF     F+  +   N  AAEL  L
Sbjct  1688  GDVLFHSRHAFLPTV---NRIAAELQCL  1712



>ref|XP_009112590.1| PREDICTED: uncharacterized protein LOC103837948 [Brassica rapa]
Length=1415

 Score =   469 bits (1207),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 335/1114 (30%), Positives = 530/1114 (48%), Gaps = 65/1114 (6%)
 Frame = +1

Query  1021  PHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNP  1200
             P      SF +   ++  +   W+  ++ ++     W + GDFN++  ++E+ G      
Sbjct  165   PRKQFYSSFVHGSTDKNQRNHLWDVLVTKATIREDAWFITGDFNNLLCSEEKEGGQERPE  224

Query  1201  SRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAI  1380
                 +    FS   L D+  SG   SW  Q G   V R +LDRA  N      FP A+  
Sbjct  225   GSFTDMRTFFSEGDLFDLQHSGDPLSWRGQRGDHLV-RCRLDRAAANTLWAERFPTARCQ  283

Query  1381  ILPRT-HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS-LLDVVG  1554
              L     SDH PL  L       RR    FR++      E+ R +    W  +    V  
Sbjct  284   YLEADLTSDHKPL--LSFFDKGGRRRRGNFRYDRRLCKNEEARKMISNAWRGAGQASVRD  341

Query  1555  AISEVTNLSKKWNKETFGN----IFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTE  1722
              ++   +    WNK    N    I  +K +L A +     S   N    +QV+  KL   
Sbjct  342   KLASTRSAISAWNKTQHRNSQEVIQQQKTALNAAL-----SSPVNDIDLIQVIAAKL---  393

Query  1723  LNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI----NGEWNSD  1890
              N     EE  W Q+SR +W++ GDRNT ++H +T   +NR RI    +    +G+    
Sbjct  394   -NAAYSAEEEYWRQRSRALWLKLGDRNTGYFHATT---KNRKRINGFSVIEREDGQMVHK  449

Query  1891  FKTISDHISNFFIDLFG-----RKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKA  2055
              + I   I ++F  +F      R++I++ +   +  G + D+     L    T  E++ A
Sbjct  450   EEEIVQVIGDYFQKMFSSLPGEREDIVNRALQPLLTGEENDS-----LIAVPTSGEIRDA  504

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
              F +    +PGPDG  A F+ T WE+V   I   V+   R   +P  I E+ I LIPK  
Sbjct  505   AFSINAEKAPGPDGFSAGFFHTHWEDVGPDIVKEVQGFFRGEPLPELINETNIRLIPKIP  564

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
             +P+  SD+RPI L NV +KI SK++  R++P++  LI   Q++F+PGR+  DNI++T E+
Sbjct  565   NPQKVSDYRPIALCNVYYKIFSKLLTRRLQPLLSKLISVNQSAFVPGRAIGDNILITHEV  624

Query  2416  VHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
             +HY+   +  ++  MA+K D+ KAYD ++WEF+   +V  GF Q+ +  +M  +   + S
Sbjct  625   LHYLNTSQAEQRCAMAVKTDMSKAYDRLEWEFISLVMVRLGFHQDFVKCVMQCISSVTYS  684

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGV  2772
              L NG       P RG+RQGDPL+PY+FI+  E LS    +     + + I ++RG   +
Sbjct  685   FLINGLPRGKVVPSRGIRQGDPLSPYIFIMCSEVLSGLCNQAKEDGSLQGIRVARGCPRI  744

Query  2773  SHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLK  2952
             +HL FA+D M F E ++     + + L K+   SG  I+  KS I  S  T + IK  +K
Sbjct  745   NHLLFADDTMFFLETTQGNCSALTDILTKYESASGQTISKEKSAITFSRRTPAAIKEMVK  804

Query  2953  NLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSA  3132
                 I      G YLG+P    R     F  I+D +K+K   W    LS AG+  ++QS 
Sbjct  805   EELQIQKEGGTGKYLGLPEQFGRRKHDIFSSIVDRIKQKARGWSNKFLSSAGKMVMLQSV  864

Query  3133  LSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLR  3312
             LS+ P Y+M  F LP   C  I      F W ++   +K+  V W+ + K K  GGLG R
Sbjct  865   LSAAPSYSMSHFALPVSLCKRIQSTVTRFWWDNNEHTRKMAWVSWDSMAKPKALGGLGFR  924

Query  3313  KCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRS  3492
                 +N ALLAKL+W+LV + D L  +V+  KY    N       +N S GWRS++ GR 
Sbjct  925   DFQVYNVALLAKLSWRLVQNPDCLLGQVLLGKYCTESNVLTATGPSNMSHGWRSVLVGRD  984

Query  3493  IVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEV----TIPDSQSEAKVSDFILPNRT-  3657
             ++     W +GNG  +  W D W     L+F  +V       +S  E +VSD + P    
Sbjct  985   LLIKNLGWVVGNGQDIKVWDDPW-----LSFSKQVRPMGPPQESTVELRVSDLMCPGTCE  1039

Query  3658  WNVDKLSSLLP--HDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDED  3831
             W+  K+ S LP   + I  I+ +         D + W  + +G +SV+S + + A ++ D
Sbjct  1040  WDATKIHSWLPMYEETIRCIKPSQSGAL----DRIIWLGTKSGVYSVKSGY-YSAVDEGD  1094

Query  3832  -------AMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGD  3981
                        +W   VW++    + ++F W L++G L        + +  D  C  CG+
Sbjct  1095  FTPAGPAIASVNWKQSVWQLACAPKVKMFAWKLLKGALPVGERLVERHVPVDPACKRCGE  1154

Query  3982  GDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDW-INGCPWGVTF  4158
               E++NH+  +C+FA+  W       +  +S +  L     + C  +    +G   G   
Sbjct  1155  A-ESINHLFFQCAFARKVWLNAPFSTAPDFSGLLDLAGMWTDLCSITCLPPSGITAGSLA  1213

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLT  4260
              +  W IWK RN+ +FE T+++    + +A  L 
Sbjct  1214  PWILWSIWKERNKFVFEGTSASAESTLSKAIGLA  1247



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score =   457 bits (1175),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 279/855 (33%), Positives = 451/855 (53%), Gaps = 41/855 (5%)
 Frame = +1

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVP-P  2193
             L   +T  EVK A   +  + +PGPDG  +  Y+ +W+ + S+I +       +G     
Sbjct  5     LLVPITEEEVKAAAVQLGAWKAPGPDGFPSYLYKKYWK-IMSNIVSGTATDFHNGLCSLE  63

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
             +I ++FI LIPK  SP++   FRPI+L N S+KI++KVI NR++ I+  LI   QN+F+P
Sbjct  64    EINKTFIALIPKVQSPDSLGQFRPISLCNSSYKILAKVIANRLKKILPELISDSQNAFVP  123

Query  2374  GRSTADNIILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNL  2550
             GR   DN+IL  E  HY+++KK G+     IK+D++KAYD I+W+F+E+ +   GF    
Sbjct  124   GRQIQDNLILAHEAFHYLKMKKKGRCFETGIKVDMNKAYDRIEWDFMEALMRRMGFNSRW  183

Query  2551  ISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVK  2730
             I+L++  VR  S S++ NG+    F+P RGLRQGDPL+PYLF+L  E LS ++ + +R  
Sbjct  184   INLVLGCVRSVSFSIILNGKPGGFFRPSRGLRQGDPLSPYLFLLVSEALSLNLSKLIRDG  243

Query  2731  NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
             N + I L+R    +SHLFFA+D + F +A     +  M  L  +   SG  +N  KSN+ 
Sbjct  244   NIQGIKLARRSPTLSHLFFADDSLFFLKADVLNFQRFMQVLDMYCLASGQCVNFEKSNMV  303

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGN  3090
              SPNT S ++  L  + G +  DN GTYLG+P +  R  +    YI D ++RK+  WK +
Sbjct  304   FSPNTPSSLRVQLCEMFGFNGVDNAGTYLGLPTIWGRSKRAALDYIKDRVRRKIEGWKQS  363

Query  3091  MLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWN  3270
              LSLAG+  L+++  +++P Y M  FK PA  C+DI+     F W +  +  K+H   W 
Sbjct  364   SLSLAGKEILLKAVATAIPAYPMSCFKFPASVCSDINGEMTRFWWKNGEEGSKIHWKAWE  423

Query  3271  DICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIA  3450
              +CKSKD GGLG R    FN ALLAK +W+++ + +  WV++++ +Y  + +F      +
Sbjct  424   SLCKSKDEGGLGFRHFSSFNIALLAKQSWRILQNPNASWVRILKARYYPDCDFLKAKKGS  483

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKV  3630
              ASW W S++ GR  +   +  +I +G + N W D W        +    I    +  +V
Sbjct  484   RASWAWSSLLEGRDALIKDSRCQIFDGKNTNIWKDIWLPPPHDGIIKVREIVPPSAPQQV  543

Query  3631  SDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
              + +     +W ++ +   +    ++ IR   IA  E+  D + WP +  GA+SV+S + 
Sbjct  544   YEIMEKETHSWKLELIKPYVQPRTLEIIRCCTIANTER-QDKMVWPWTTNGAYSVKSRYR  602

Query  3808  ----------HIAGNDEDAMDTS-WV--WKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
                       H  G+   ++    WV  WK+    + ++FLW ++   + T    +R+ +
Sbjct  603   RIHSRCSYLIHATGSTSHSIPKEVWVCIWKIESLPKIKMFLWRVLSNAISTRWNLYRRKI  662

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL--VTPLKSWVKN----N  4110
              +  +C  CG  +ET+ H+L  C +    W     P++++  L   + +  W+K      
Sbjct  663   LDSPVCPICGMEEETIEHLLFLCPWTNVVW--FGAPLNYKVDLRGFSSVDRWLKGVINFQ  720

Query  4111  CCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNK  4290
               +   +      ++FI  CWEIWK R   IF++    P   + RA    +     FL+ 
Sbjct  721   GVSKREVQFLLTSISFI--CWEIWKTRCNFIFKSNHIDPRLTIDRA----MQNCREFLDA  774

Query  4291  KC---VHVGKMRWVC------WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
             K    V  G    V       W+PP + ++K N DGA+K+++ LA  G +ARD  G +  
Sbjct  775   KVKSHVPFGDASVVPNILAQGWRPPMSNYVKINFDGAWKKDSHLAGLGVVARDAIGSFCG  834

Query  4444  GFMTNIGVSNSFAAE  4488
             G  T    + +  AE
Sbjct  835   GLATPFHCNLALVAE  849



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   469 bits (1208),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 314/1079 (29%), Positives = 537/1079 (50%), Gaps = 53/1079 (5%)
 Frame = +1

Query  1357  LFP--EAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS  1530
             L+P  + + + LP   SDH PL  L      P +  + F +E  W   +  ++I    W+
Sbjct  338   LYPWEKVEVLALPALGSDHCPL--LLTTSTSPVKRKKTFTYEAFWNQDQQCKEIIQHSWN  395

Query  1531  NSLLD---VVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVL  1701
              S  D   +   +  V++   +W+K  F N   R A LQ +++ +    +Y +    + L
Sbjct  396   ISRADKTSLAAKLQTVSHELARWSKSKFSNGHLRIAHLQHQLQTLMNRKYYQSDD--KEL  453

Query  1702  ERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GE  1878
                +  E+ ++ +QEE  W  +SR  W++ GD+N+ F+H ST+ RR R+RI +LK     
Sbjct  454   AHSIRDEIQQIWQQEEQFWAMRSRINWLRWGDKNSKFFHASTVQRRQRNRICLLKDELQH  513

Query  1879  WNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH-KLTREVTMCEVKKA  2055
             W  + + + +    FF +L+   +  +  P  +   P++ T  ++  L R VT  EV +A
Sbjct  514   WIREPEQLKELTLGFFSNLYKSVSYCNFGPF-LNQFPEVVTKDINDHLLRTVTEDEVYQA  572

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
              F +    +PGPDG+   F+Q  WE +K+ +   V+     G +P  +    + L+PK  
Sbjct  573   TFQLGASKAPGPDGLNGLFFQQHWEIIKADVIKTVRDFFTSGIMPRSLNRMILVLVPKVH  632

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
              PE+   + PI+L N ++KIISKV+ NR++P + NLI     +F+  R   DNI++ QE+
Sbjct  633   HPESIDQYIPISLCNFAYKIISKVMANRLKPWLPNLISKEHAAFVKDRQIQDNIMVVQEV  692

Query  2416  VHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
             +H  +++K KK   + +K D+ KAYD ++W+FL++ ++  GF    + L+M  +  +S+S
Sbjct  693   LHQFKVRKSKKKFNLLLKTDMQKAYDRVEWDFLQAYMLQLGFNDRWVRLVMACITTTSLS  752

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGV  2772
             + +NGE+LA FQP RGLRQGDPL+PY+FIL    LS  I + V +   + I  +R    +
Sbjct  753   VRFNGEQLASFQPSRGLRQGDPLSPYIFILLANALSTLITQAVEMGQLQGIKFNRACPTL  812

Query  2773  SHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLK  2952
             SHLFFA+D + F +A+  + + + N L ++   +G  IN +KS ++ S N    +++ + 
Sbjct  813   SHLFFADDSVFFLKATISEAQNLANILNQYCLATGQIINRNKSGLYFSKNCPLSLQQNIA  872

Query  2953  NLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSA  3132
             +   + + +  G YLGIP    R  +  F +IL     KL  WK  +LS +G+  L++S 
Sbjct  873   SEFRMPMMNRYGKYLGIPSDWGRSKREMFSWILAKANAKLDGWKERLLSKSGKEILLKSV  932

Query  3133  LSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLR  3312
             + ++P Y M +FKLP   C  I++    F W ++     +H   W  +  SKD+GG+G R
Sbjct  933   VQALPQYAMSIFKLPLSLCRLIEKKISVFWWSNNNGKTGIHWQNWTSLKLSKDSGGMGFR  992

Query  3313  KCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRS  3492
               + FN A+L K AW L    + LW ++ +  Y +N +F          WGW+SI++GR 
Sbjct  993   DLVSFNKAMLGKQAWHLFQQPNALWSQLFKGLYFRNSSFQCAQAGNRTLWGWQSILKGRE  1052

Query  3493  IVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSE-AKVSDFI-LPNRTWNV  3666
              +     W +G+G  +    D W    P+  +       +Q E   V+D I   + TWN 
Sbjct  1053  AILPRLRWLVGDGSKIKIREDNWL---PMGTLGGTV---AQGEPVLVADLIDNSHHTWNS  1106

Query  3667  DKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMD--  3840
               +S+L    + + I   PI     ++D L W  + +G +SV+S++  ++ +    ++  
Sbjct  1107  TLISNLFDSQVSEEILKIPINPL-LLTDQLVWTATSSGVYSVKSSYHLLSSHLNTQLNVP  1165

Query  3841  -TSW---------VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDG-D  3987
              TS+         +W M+   + R+F+WL     L T    + + ++   +C+ C     
Sbjct  1166  STSYQNPIKLWRTIWHMKTAPKIRVFMWLACHNALATKANLFHRHISPSPVCSLCTQNMP  1225

Query  3988  ETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYT  4167
             ET+ H+   C++    W   H  V    + V    +WV      S   +        +  
Sbjct  1226  ETVEHLFFFCTWTSKIWAHPHIRVQILPTSVQRFDAWVAARATDSKAFHEFEVITNLL--  1283

Query  4168  CWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVC-------  4326
              W+IW+ RN  I+ N +  P+  +  A    L    ++   K V     R+         
Sbjct  1284  -WQIWRQRNNFIYRNQSPDPIQAVEDA----LAQSRIY---KVVDPTPHRFPISSLSPDQ  1335

Query  4327  -WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
              W+PP+ G +K N DGAF+      S   + R+HKG     F  +    ++F AEL+ L
Sbjct  1336  RWKPPDKGSLKCNIDGAFQSEGLQGSMACICRNHKGILTDVFTRSFSAQSAFQAELYAL  1394



>gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea]
Length=1469

 Score =   469 bits (1206),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 321/1014 (32%), Positives = 500/1014 (49%), Gaps = 41/1014 (4%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R +  Y  P    + R W+           PW++ GDFN++    E    +S   S+   
Sbjct  469   RFTGFYGNPAVQLRPRSWDLLRQIRHHSICPWLVAGDFNEVVMQNEVESLNSRPASQMRA  528

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F ++   C L D+G +G  ++W  +       R +LDRA+      NLFP A    LP  
Sbjct  529   FRDALLDCQLQDIGFTGFPFTWCNKRKAPDTVRARLDRAVATTTWNNLFPRAIVKHLPYG  588

Query  1396  HSDHHPLK-FLCEAgnpprrenrpfrfegA-WLTREDYRDIWGRVWS-NSLLDVVGAISE  1566
              SDH PL  FL  A     R N+      A W T     D+  + W+ NS         +
Sbjct  589   SSDHLPLLIFLDPAAPTSIRPNKRRFKFEAFWTTIPGCADVIHQSWAPNSQPTNFNYRIQ  648

Query  1567  VTNLSK-KWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQ  1743
              T +S  KW +   G I   K+ LQ     +      + +  ++  E  L  E   + KQ
Sbjct  649   KTRMSLLKWYQSKVGPI---KSRLQKIATELDLLARQSITDDIKHCESALKEEQASLWKQ  705

Query  1744  EELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISN  1920
             EE+ W Q+ +  W++ GDRNTAF+H S   +R ++RI  +K  +G W +    +   + +
Sbjct  706   EEMYWKQRGKIHWLRCGDRNTAFFHASASEKRTQNRIAGIKNAHGLWITRGPEVITTMLS  765

Query  1921  FFIDLFGRKNIMDGSPND-------MYCGPKLDTGQMHK-LTREVTMCEVKKAVFDMKKF  2076
             ++ DLF        SP D       +   P+  T  M   L R     EV  AV  MK  
Sbjct  766   YYQDLF------TSSPPDPIEMERALSIIPRTITDDMRAILERPYNAAEVWPAVRRMKPL  819

Query  2077  GSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASD  2256
              SPGPDG    FYQ +W  V       V K+L +G + P++  S I LIPKK +P+  + 
Sbjct  820   SSPGPDGFPPVFYQKYWPTVGQATVEAVLKLLNNGVMEPQLNHSHIVLIPKKSNPQEPAH  879

Query  2257  FRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-  2433
             +RPI+L NV++KI SK++ NR++PIM+ ++   Q +FL GRS  DNI+L  E+ H ++L 
Sbjct  880   YRPISLSNVAYKIASKMVANRLKPIMERIVSKEQAAFLSGRSITDNILLAYELNHSIKLA  939

Query  2434  KKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEK  2613
             ++  K   A+KLD+ KA+D ++W FLE  L   GFP +    IM  V  ++ S+L NG  
Sbjct  940   RRQSKRYGALKLDVSKAFDRLEWPFLEQVLRRHGFPASTTDTIMRLVSSATYSILINGSP  999

Query  2614  LAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAE  2793
                  P RG+RQGDP++PYLFIL  + LS  + E+        I LS     +SHL FA+
Sbjct  1000  EGHIVPTRGIRQGDPMSPYLFILCSDTLSRLLHEEGAHNPDLGIQLSPTVPKISHLLFAD  1059

Query  2794  DLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISV  2973
             D ++F+ A+      I + L +++  SG  IN+ KS +      +   ++ L    G+ +
Sbjct  1060  DTLIFSAATLTAMEGIRSVLTRYAAISGQLINLEKSALSVPSEADPHYRQLLSTAVGVPL  1119

Query  2974  SDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVY  3153
             +D+LG YLG+P +     K  F  + D ++ ++ +W    LS AG+  L++S L S+P Y
Sbjct  1120  TDSLGKYLGLPSMIGISKKAAFRSLKDRIQGRILHWHTKFLSKAGKMVLIKSVLQSIPSY  1179

Query  3154  TMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNN  3333
             TMQ FK+P     +++ +   F W D   + K+HL+ W+ +C++   GGLG R    FN 
Sbjct  1180  TMQCFKIPTTLIRELNSLFSQFWWSDRGHS-KMHLLAWDKLCEAPVQGGLGFRNLTTFNQ  1238

Query  3334  ALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAA  3513
             ALLAK  W++ T  D L  +V++ KY KN +F    +  N S+ WRS++  ++++  G  
Sbjct  1239  ALLAKQCWRIFTKDDLLLSRVLQGKYYKNTSFLEARLGRNPSFTWRSLLTAKNLLLSGLR  1298

Query  3514  WRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRT-WNVDKLSSL-L  3687
             WR G+G+ +N W+  W   +  +F      P      +VSD I P+   WN   +  + L
Sbjct  1299  WRPGDGVHINVWNSPWL-PRAGSFKPMFRNPALSPHLRVSDLISPDTCDWNRSYIQQVFL  1357

Query  3688  PHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI----------AGNDEDAM  3837
             P D    I + P+       D + W  S  G ++V+S + H             +    +
Sbjct  1358  PADAAT-ILSIPLGSSGH-HDRMIWHYSREGTYTVKSGYLHARSIESNRNPGPAHSNPEI  1415

Query  3838  DTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDET  3993
                W  +WK+ +  +  LF W L +G L T    + + +  D+LC  C   +ET
Sbjct  1416  SAFWKHLWKVALPPKIILFGWRLCKGILPTKDLLFHRKICPDSLCEICHQHEET  1469



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score =   469 bits (1208),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 337/1181 (29%), Positives = 542/1181 (46%), Gaps = 97/1181 (8%)
 Frame = +1

Query  979   IRNTSQAIHGLVSGPHSNVRVSFA--YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFN  1152
             + N S + + +V     N+   F   Y  P    K + W    +   ++  P +  GDFN
Sbjct  301   VTNNSGSDNDIVEAEQRNINWRFVGIYGWPEEENKHKTWLLIKTICDDYEGPIVFGGDFN  360

Query  1153  DIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRA  1332
             +I    E+ G  S      + F E   +C L D+   G  Y+W R     T  R +LDR 
Sbjct  361   EILSYDEKEGGVSRERRGMVGFREVMESCNLGDLWFVGQWYTWERGRSPETRIRERLDRF  420

Query  1333  LWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrf-egAWLTREDYRD  1509
             L +     LFPEA      R  SDH  +    +     +R  +     E +WL  +    
Sbjct  421   LVSHSWNELFPEAFIEHTVRYSSDHAAVILKSKVDVRDQRRQKRGFRFETSWLLDDSCES  480

Query  1510  IWGRVWSNSLLDVVGA-ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ-ESVFYNTS  1683
             +    W+ S+  V+   +  V    + W+K+  GN+  +   ++ R++  Q E+    + 
Sbjct  481   VVREAWNKSVGGVIEERLGVVARELQVWSKKGVGNLQKQIERVEKRLQEAQREATTTESC  540

Query  1684  RGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRML  1863
                  LE     EL+ +  + E  W+ +SR   ++DGDRNT+++H     R+ R+ I  +
Sbjct  541   MRCASLE----IELDSLHAKNEAYWYMRSRVTEVKDGDRNTSYFHHKASQRKKRNFIHGI  596

Query  1864  KI-NGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK--LTREVT  2034
             K   G W +D + + + +  +F ++F        S  ++    +    Q +   L +  +
Sbjct  597   KDREGVWQTDIEDVEEEVVRYFDNIFTSSVPSRDSLREVLQHVRFSVTQEYNDILLQPYS  656

Query  2035  MCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFI  2214
               E+  A+  M    +PGPDG+ A FYQ FW  +   +  +V  +L +   P +I  + I
Sbjct  657   KEEIHAALCQMHPCKAPGPDGMHAIFYQRFWHIIGDDVFEYVSNLLHNFYCPTEINCTNI  716

Query  2215  TLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADN  2394
              LIPK  SP   S+FRPI+L NV +KI  K IV R++  + +++   Q++F+PGR  +DN
Sbjct  717   ALIPKVKSPTDVSEFRPISLCNVLYKIAFKAIVLRLKQFLPDIVTENQSAFVPGRMISDN  776

Query  2395  IILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFS  2571
              ++  EI H M+ +   +KGL+A+KLD+ KAYD ++W FL   L+  GF    ++LIM  
Sbjct  777   SLIALEIFHSMKKRNNSRKGLIAMKLDMSKAYDQVEWGFLRKLLLTMGFDGRWVNLIMSC  836

Query  2572  VRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITL  2751
             V     S + N        P RGLRQGDPL+P+LFIL  +  S  IQ+K  V+       
Sbjct  837   VSSVQYSFIINRRVCGSVCPSRGLRQGDPLSPFLFILVFDAFSQMIQQKANVRELHGAKA  896

Query  2752  SRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNS  2931
             SR G  +SHL FA+D +LF  A   + R+                               
Sbjct  897   SRNGPEISHLLFADDNLLFTRAIRQECRV-------------------------------  925

Query  2932  EIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGR  3111
                            D    YLG+P +  R  K  F  +LD M +KL  WK  +LS AG+
Sbjct  926   ---------------DKHQKYLGVPTICGRSKKVVFRDLLDRMWKKLRGWKEKLLSRAGK  970

Query  3112  RTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDS-AQNKKVHLVGWNDICKSK  3288
               L+++ + ++P Y M V+K+PA    +I      F WG    + +K+H + W  +CK K
Sbjct  971   EVLIKAVIQALPTYLMGVYKIPATVIQEIHSAMARFWWGGGKGEERKMHWLSWEKLCKPK  1030

Query  3289  DAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGW  3468
               GGLG +    FN+ALL K  W L+   + L  +VM  KY  + + F   +  + S+ W
Sbjct  1031  CMGGLGFKDLRVFNDALLGKQVWCLLHYKNSLLSRVMSAKYYPHGDIFQAHLGHSNSYSW  1090

Query  3469  RSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP  3648
             RSI   +S+V+ G  WR+G+G  ++ WS+ W GD    F+    +   +    V D I  
Sbjct  1091  RSIWSAKSLVKEGMIWRVGDGKLIDLWSEPWVGDVDGRFIRSSRVAGLEV---VGDLIDD  1147

Query  3649  NR-TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGND  3825
             +   W  D + +         I A P++   ++SD L W  S  G +SV++A+    G +
Sbjct  1148  DSMEWRTDMIETHFDERDQRCILAIPLS-SRRISDKLTWAYSKDGLYSVKTAYMLGKGGN  1206

Query  3826  EDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMN  3999
              +     W  +W + V+ + R FLW +    L       R+ +T+D  C  C  G+E+  
Sbjct  1207  LEDFHRVWGLIWSLEVSPKVRHFLWRVCTNSLPVRAALKRRHLTDDDSCPRCACGEESAQ  1266

Query  4000  HVLMECSFAKDCW------RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFI  4161
             HV  +C+ A   W        T H V  +  +V  +  W  N+        G        
Sbjct  1267  HVFFDCTHASQLWDLVGCKEMTRHDVGEE--MVDLIIRW--NDLDKKLVQKGS-------  1315

Query  4162  YTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHV---GKMRWVC--  4326
             Y  W +W  +N+ +FEN +  P+ + +R        VE F N+    +   G+ R +   
Sbjct  1316  YLMWNLWTEKNKIVFENCSHPPVVVAQRVGR----QVEEF-NEHITRIYGGGQQRVMASS  1370

Query  4327  --WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
               W  P  G++K N+D +   + G    G +ARD +G+ LF
Sbjct  1371  SRWTTPPDGFVKLNSDASIG-DDGWIGLGVVARDSQGKILF  1410



>ref|XP_010693613.1| PREDICTED: uncharacterized protein LOC104906541 [Beta vulgaris 
subsp. vulgaris]
Length=1067

 Score =   459 bits (1182),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 292/951 (31%), Positives = 479/951 (50%), Gaps = 21/951 (2%)
 Frame = +1

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
             FS    +++   G  ++W ++  G      +LD+ + NL+  N+FP  K      T SDH
Sbjct  5     FSEVECIELPFLGSGFTWKKKRSGPDNILERLDKGVANLDFLNVFPNVKVQHHAFTTSDH  64

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS-----NSLLDVVGAISEVT  1572
               +    +      R++ PFRF+ AW TR+D+  I  + WS     + +  +      + 
Sbjct  65    CQVSV--KLDILQGRKSPPFRFDKAWTTRKDFEVIIKKAWSTRFHGSYMFRLTKKCKLLK  122

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRG-LQVLERKLVTELNEVLKQEE  1749
               +K W    FGN+  +   +++++K +Q+++  N S   L     K   +   +L+ +E
Sbjct  123   EKAKNWATTRFGNVIRQLKVVESKLKCIQDNLLANPSCPFLAAKLDKFHLKQVRLLELQE  182

Query  1750  LLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISDHISNFF  1926
             L W  K++   ++  D NT ++H    IRRNR+ I  ++ + G   +D K + +  +N F
Sbjct  183   LYWKTKAKSNHLKLSDSNTKYFHACASIRRNRNFISSIEDDTGVVLTDPKDVENCFTNSF  242

Query  1927  IDLF--GRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGI  2100
             +  F   ++   D   +       +       L  EV+  E+K AVF++    +PGPDG 
Sbjct  243   VQRFTANQECFFDEHCDFSLLESIISEEDNMLLCSEVSAEEIKNAVFELAPDKAPGPDGF  302

Query  2101  QAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLN  2280
                F+Q +W  V + +   V+     G +  ++  +FITLIPK +SP   + FRPI+L +
Sbjct  303   PPYFFQQYWSLVGNSVCHAVRAFFFSGTLLKEVNHTFITLIPKVESPSNPNQFRPISLCS  362

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMA  2460
               +K+I+K++ +R++ ++  +I P Q +F+P R   DN+++  E+ H  + K G +G +A
Sbjct  363   TIYKVIAKIMASRLKIVLGKIIHPLQGAFVPERLIQDNVLIAHEVFHSFKKKTGNQGWLA  422

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
             IKLD+ KAYD ++W F+ +     GF +  +  +   +   S S+L NG     F P RG
Sbjct  423   IKLDMEKAYDRLEWNFIFAVFKKLGFCERWVGWMKECISSVSFSVLVNGIPGDVFYPSRG  482

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRV-KNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             +RQGDPL+PY+FIL  E L+  +    R       + L      +  L FA+D M+FA+A
Sbjct  483   IRQGDPLSPYIFILCAEILARQLHAASREGPKLVGVALGHSRVKIPFLTFADDTMIFAKA  542

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             + D   +I   L  +   SG  +N +KS   CSPNT+  +     +   +  + +LG YL
Sbjct  543   TVDSCTVIREILDDYCRMSGQLVNYNKSAYQCSPNTDPILATSFTSFLRMGEACSLGKYL  602

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G PI+  +V+ +TFG I + ++ +L+ WK N LS AGR  L+QS L++   Y MQ F LP
Sbjct  603   GCPIIDSKVTNNTFGNIQEKVQGQLSKWKANSLSQAGRTVLIQSNLATKANYQMQCFLLP  662

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
                   +D+  R+F W  S+++K  +L+GW+ ICK K  GGLGLRK    N AL  KL W
Sbjct  663   PHIVESLDKSYRNFFWNKSSESKSPNLIGWDKICKPKQNGGLGLRKAKVMNMALQFKLLW  722

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +++   D LWV ++ +KY+K+   F   + AN SW WR +M  R   + G  W +G G  
Sbjct  723   KILFCPDNLWVNLVSKKYMKSDGLFDYRVKANVSWQWRKLMSLRDKFKHGLRWVVGRGDK  782

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRA  3717
             ++F  D W    PL  +  V +  S+S   V  FI     W+V +L   +  +I   I +
Sbjct  783   ISFCFDNWVFQYPLCSVCSV-LRGSESLV-VESFITQGNQWDVARLREFVKEEICLAICS  840

Query  3718  TPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDT------SWVWKMRVTERC  3879
               I     + D   W  SP G +SV+S    I G+  + + +       W+W ++V  + 
Sbjct  841   IFIPT-HPLEDKCVWALSPDGCYSVKSGVQLIQGSGPEMLGSLPRVPFFWIWSLQVPPKI  899

Query  3880  rlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
             R FLW +    L T        +     C  C    E + H+ +EC F  D
Sbjct  900   RFFLWKICNNGLPTKKRLEVSHVFLPLECVFCNHHSEHLLHLFVECPFCID  950



>ref|XP_008372905.1| PREDICTED: uncharacterized protein LOC103436258 [Malus domestica]
Length=1222

 Score =   462 bits (1190),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 283/934 (30%), Positives = 464/934 (50%), Gaps = 27/934 (3%)
 Frame = +1

Query  1759  FQKSRRMWIQDGDRNTAFY-HKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDL  1935
             F  S   W+   D N   + H+ +   R R++I  +K +  W      +   + + FI  
Sbjct  182   FSPSDIPWLCARDFNEFLWDHEKSGEWRRRNQIIKIKDDENWVEQPGRVRKLVEDHFIQT  241

Query  1936  FGRKNIMD-GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAF  2112
             F      + GS  D    P++       L + V+  E+K A+F M    + GPDG Q  F
Sbjct  242   FTSGEARNWGSLLDCI-SPRVSEEMNQALLKPVSEDEIKTAIFKMGGLKAQGPDGFQGIF  300

Query  2113  YQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFK  2292
             YQ++WE V + +   V+++++    P  +  ++I LIPK   PET S FRPI+L N S+K
Sbjct  301   YQSYWEHVYADVCALVRELMQGSSSPTSLNATYIVLIPKVPHPETVSQFRPISLCNYSYK  360

Query  2293  IISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL-MAIKL  2469
             ++SKV+ NR++ I+  LI P QN+F+ GR   DNI +  E+ H+++ +  K+   M +KL
Sbjct  361   VLSKVLANRLKVILPMLISPSQNAFVAGRQIQDNIGIAHEMFHFLKGRTAKRKFEMGVKL  420

Query  2470  DLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQ  2649
             D+ KAYD ++W+FL++ +   GF      L+M  V   + ++L NG+    F P RGLRQ
Sbjct  421   DMQKAYDRVEWDFLDAVMERMGFCCLWRRLVMGCVSSVNFAVLLNGQPGNKFAPSRGLRQ  480

Query  2650  GDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQ  2829
             GDPL+PYLFI+  E LS  IQ  +  K  + + +   G  +SHLFFA+D +LF  A ++ 
Sbjct  481   GDPLSPYLFIILGEVLSCMIQAAIDDKQLERVRIGVSGPIISHLFFADDTLLFLRAGDNY  540

Query  2830  GRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPI  3009
              R +++ + ++   SG  +N+ KS+I+   N    +   L  + G+SV DN GTYLG+P 
Sbjct  541   CRNLLSIIDRYCXASGXKVNLQKSSIYFGANVPKGVAANLGGILGVSVVDNPGTYLGVPX  600

Query  3010  LHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTC  3189
             +  R  K    Y+   +  KL  WK + LS AGR  L+++ + ++P Y M +FK P   C
Sbjct  601   IWGRSKKRGLAYVKGRILGKLQGWKQSALSRAGREVLIKAVVQAIPAYPMCIFKFPXVVC  660

Query  3190  NDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVT  3369
              ++D +   F WG   +++K+H V    +   KD GGLG R   +FN ALLAK  W+L+T
Sbjct  661   XELDALVARFWWGSHGZBRKIHWVSKZVLGLPKDMGGLGFRNFXEFNXALLAKQCWRLLT  720

Query  3370  SHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFW  3549
               + LW +V++ +Y  + +F+     A ASW W S++ GR ++  G+ W+I  G  +  W
Sbjct  721   EPNSLWARVIKARYFXHCSFWEAKKGAXASWAWSSLLSGRELLASGSHWQIMGGEXVRVW  780

Query  3550  SDWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPI  3726
              D W    P      +      S  +VS  I   +R W+ D L   L       I+ T I
Sbjct  781   VDRWLPSLPSGHPMPLXXVSXXSNLRVSSLIDSSSRQWDFDFLRXFLSLADQRAIQETII  840

Query  3727  AVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMD-----------TSW--VWKMRV  3867
                 +  D L W  +  G +SV+S +  +     D  D           T W  +W++ V
Sbjct  841   GD-SRWKDRLIWAVNRNGKYSVKSGYRWLQVRYIDVRDHRMPVVRSISKTLWKCIWQLAV  899

Query  3868  TERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRT  4047
              ++ R FLW+ +   L T      + ++    C  C   DET+ HV + CS+    W   
Sbjct  900   PQKIRHFLWVSLHLGLPTGKALCTRRLSPFPSCPLCQSADETVEHVFLRCSWVAAVWFGG  959

Query  4048  HHPVSFQYSLVTPLKSWVKNNCCASDWINGC--PWGVTFI-YTCWEIWKARNQRIFENTA  4218
                     + +     W++    +S+W +     W   ++ ++CW IWKAR   +F    
Sbjct  960   ALNYKVDAAGIDSWARWLQ-TVFSSNWGSSTNRQWFQAYVSFSCWFIWKARCDFVFNQVP  1018

Query  4219  SAPMDIMRRAN----NLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRN  4386
               P  ++   +    N  L    + + +      +   V W PP + ++K N D ++ ++
Sbjct  1019  INPSKVIFSLSTAFGNFLLAVSSLGIARPVSVSQEEVVVRWCPPASPFVKINVDASWSKS  1078

Query  4387  TGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAE  4488
             + +  AG +AR   G +     +++   +S  AE
Sbjct  1079  SWMGFAGVVARQDGGRFRAAVRSSVLAPSSLVAE  1112



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   459 bits (1180),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 302/1020 (30%), Positives = 494/1020 (48%), Gaps = 66/1020 (6%)
 Frame = +1

Query  1540  LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVT  1719
             + V   I  +  +  +WNKE   N        +  ++  Q S    T+  ++++ R +  
Sbjct  15    MQVSERIKLIRGIISRWNKEHQANSRVLIDQKRHELEEAQSS----TTNDIELIHR-VTE  69

Query  1720  ELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI--NGEWNSDF  1893
             +L +  + EE  W Q+SR +W++ GDRN+ F+H +T   +NR R   L +  +G  N  F
Sbjct  70    DLKKAYRAEEAYWRQRSRLLWLRLGDRNSGFFHAAT---KNRKRANALTVIEDGSGNPVF  126

Query  1894  K------TISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKA  2055
             +       I  +    F  L G ++ ++    D    P + + +  KL R  T  E+K A
Sbjct  127   QEGEIAQVIVKYFETLFTTLSGERSAIEDVV-DKALKPMVSSSENEKLIRIPTPEEIKTA  185

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
             VF +    +PGPDG  A F+   WE + + I   V+      ++PP I E+FI LIPK  
Sbjct  186   VFSIHADKAPGPDGFSAGFFHAHWEVIGADIVREVQGFFETSKLPPSINETFIRLIPKIQ  245

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
             SP+  +D+RPI L NV +KIISK++  R++P++  LI   Q++F+PGR+ +DN+++T E+
Sbjct  246   SPKVVADYRPIALCNVYYKIISKILTKRLQPLLPTLISENQSAFVPGRAISDNVLITHEV  305

Query  2416  VHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
             +++++  K +K   MA+K D+ KAYD ++WEF+   L   GF    I+ I+  V   + +
Sbjct  306   LYFLQNSKAEKRCSMAVKADMSKAYDRLEWEFIRLVLEKLGFHSRWIAWILECVSSVTYA  365

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGV  2772
              L NG       P RG+RQGDPL+PY+FIL  E LS              I ++RG   V
Sbjct  366   FLINGSPRGKVSPSRGIRQGDPLSPYIFILCSEVLSGLCNRAQETGQLTGIRVARGCPQV  425

Query  2773  SHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLK  2952
             +HL FA+D M F +A+++    +   L+++   SG  IN +KS+I  S      +K  +K
Sbjct  426   NHLLFADDTMFFVKANKENASALKAILQQYESASGQAINTNKSSITFSRKAPLSLKTMIK  485

Query  2953  NLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSA  3132
             +   I     +G YLG+P    R  +  F  I+D +K K + W    LS AG+  +++S 
Sbjct  486   DCLHIPKEGGVGKYLGLPEHFGRKKRDLFTSIVDRIKVKSSGWSNKFLSTAGKMVMLKSV  545

Query  3133  LSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLR  3312
             L+ +P Y+M  FKLP   C  I      F W   + N+K+  V W+ + KSK  GGLG R
Sbjct  546   LTPVPSYSMTCFKLPRSLCKRIQSAVTRFWWDGRSGNRKMAWVSWDKMTKSKQDGGLGFR  605

Query  3313  KCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRS  3492
                 FN+A LAKL W++  +   L  +V+  KY  +  F      +  S GWR ++ GR 
Sbjct  606   DFESFNDAYLAKLGWRIHNNPSGLLSRVLTGKYCTDTPFLQVAHRSAESHGWRGVLIGRD  665

Query  3493  IVELGAAWRIGNGLSLNFWSDWWTGD----KPLAFMDEVTIPDSQSEAKVSDFILPNRT-  3657
             ++   A W +GNG S+N WSD W       +P+        P+      V   +LPN T 
Sbjct  666   LMMSNAGWALGNGESINIWSDPWLSHSEQARPMG-----PAPEQFIHWTVKKLMLPNGTD  720

Query  3658  WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF-SHIAGNDED-  3831
             WN + +  + PH+    +   P      V+D L W  + +G ++ +S +   +  ND + 
Sbjct  721   WNREIIQQVFPHEEARILSLKPSKT--DVADKLIWLGTTSGEYTTKSGYLKALELNDTNP  778

Query  3832  ----AMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDE  3990
                  ++  W   +W ++   + +LFLW + +G L        + +     CA C D +E
Sbjct  779   IPPTTVEVDWKKGIWNLQTAPKIKLFLWKIFKGALPVGEALAVRNIGSAQTCALC-DSNE  837

Query  3991  TMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWIN--GCPWGVTFIY  4164
             ++NH+ + C FA + WR            +  L         ++ W+   G   G    +
Sbjct  838   SINHLFLHCDFAYNVWRLAPFSTCIDARGLLDL---------STAWLGLLGISLGPLAPW  888

Query  4165  TCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPE-  4341
               W +W ARN RIF N  + P +++ +A     + +    N+  +           PP+ 
Sbjct  889   ILWALWLARNDRIFNNKGTTPEEVITKATAAAQEWLREQGNEPIIRNNP-------PPQR  941

Query  4342  ----TGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTN-IGVSNSFAAELWGLRE  4506
                   +    +D A++ +  LA  G +  +  G      M++   VS+   AE   LRE
Sbjct  942   PLDTAHYACLQSDAAWRSDLHLAGLGWMVTE--GHQASSLMSHCFYVSSPLIAEGLALRE  999



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score =   476 bits (1224),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 357/1192 (30%), Positives = 560/1192 (47%), Gaps = 80/1192 (7%)
 Frame = +1

Query  976   VIRNTSQAIHGLVSGP--HSNVRVSFAYVRPNRMAKERFWNDCLS-YSSEFNAPWIMMGD  1146
             VI +  Q +H  ++ P     + V+F Y +  R  +   W DCL   +++   PW++ GD
Sbjct  1132  VIFDHPQCLHVRLTSPWLEFPIFVTFVYAKCTRSERTLLW-DCLRRLAADIEVPWLVGGD  1190

Query  1147  FNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLD  1326
             FN I   +E+   S+ +     +F  +   CGLLD G  G  ++W      R  QR  LD
Sbjct  1191  FNIILKREERLYGSAPHEGAMEDFASTLLDCGLLDGGFEGNPFTW---TNNRMFQR--LD  1245

Query  1327  RALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYR  1506
             R ++N    N FP  +   L R  SDH PL   C   N   +    FRF+ AW+   D++
Sbjct  1246  RIVYNHHWINKFPITRIQHLNRDGSDHCPLLISC--FNSSEKAPSSFRFQHAWVLHHDFK  1303

Query  1507  DIWGRVWSNSLLDVVGA--------ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
                  V SN  L + G+           +    K WNK  FG+IF +    + R++  + 
Sbjct  1304  T---SVESNWNLPINGSGLQAFWSKQHRLKQHLKWWNKVMFGDIFSKLKEAEKRVEECE-  1359

Query  1663  SVFYNTSRGLQVLER--KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
              + +   + ++ + +  K   +LN+ L  EE+ W QKS   W+ +G+RNT F+H     +
Sbjct  1360  -ILHQNEQTVESIIKLNKSYAQLNKQLNIEEIFWKQKSGVKWVVEGERNTKFFHTRMQKK  1418

Query  1837  RNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH  2013
             R RS I ++ + +G W  D + +      +F  L   +   D           +   +  
Sbjct  1419  RIRSHIFKVQEPDGRWIEDQEQLKQSAIKYFSSLLKFEPCDDSRFQRSLIPSIISNSENE  1478

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              L  E  + EVK AVF +    + GPDG  + FYQ  W  +   +   V+       +P 
Sbjct  1479  LLCAEPNLQEVKDAVFGIDPESAAGPDGFSSYFYQQCWNIIAHDLLDAVRDFFHGANIPR  1538

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
              +  + + L+PKK S    SDFRPI+L  V  KII+K++ NR+  I+ ++I   Q+ F+ 
Sbjct  1539  GVTSTTLILLPKKPSASKWSDFRPISLCTVMNKIITKLLSNRLAKILPSIITENQSGFVG  1598

Query  2374  GRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             GR  +DNI+L QE++  +   K + G +A+KLD+ KAYD +DW FL   L  FGF    I
Sbjct  1599  GRLISDNILLAQELIGKLNT-KSRGGNLALKLDMMKAYDRLDWSFLIKVLQHFGFNDQWI  1657

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
              +I   +     SLL NG     F+  RGLRQGDP++P LF++A E LS  +      + 
Sbjct  1658  GMIQKCISNCWFSLLLNGRTEGYFKFERGLRQGDPISPQLFLIAAEYLSRGL--NALYEQ  1715

Query  2734  WKPITLSRG-GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
             +  +  S G    VSHL FA+D+++F   S+   + I+  L+++   S   IN  KS   
Sbjct  1716  YPSLHYSTGVSIPVSHLAFADDVLIFTNGSKSALQRILAFLQEYEEISRQRINAQKSCFV  1775

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL--HKRVSKHTFGYILDGMKRKLANWK  3084
                N +S  ++ +   TG +      TYLG P+   HK+V    F  ++  ++ ++  W+
Sbjct  1776  THTNVSSSRRQIIAQTTGFNHQLLPITYLGAPLYKGHKKVI--LFNDLVAKIEERITGWE  1833

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
               +LS  GR TL++S L+S+P+Y  QV K P      I+RI   FLWG SA +KK+H   
Sbjct  1834  NKILSPGGRITLLKSVLTSLPIYLFQVLKPPVCVLERINRIFNSFLWGGSAASKKIHWTS  1893

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  I      GGL +R   +   A   KL W+  T+ D LW + MR KY + +    T  
Sbjct  1894  WAKISLPVKEGGLDIRSLAEVFEAFSMKLWWRFRTT-DSLWTRFMRMKYCRGQLPMHTQP  1952

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA  3624
               + S  W+ ++   +I E    WR+G G +L FW D W G+ PL   +      S S  
Sbjct  1953  KLHDSQTWKRMVASSAITEQNMRWRVGQG-NLFFWHDCWMGETPLISSNHEF---SLSMV  2008

Query  3625  KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             +V DF + N +W+++KL ++L  +++D I   PI    +  D  YW  +P G FS +SA+
Sbjct  2009  QVCDFFM-NNSWDIEKLKTVLQQEVVDEIAKIPIDAMSK--DEAYWAPTPNGEFSTKSAW  2065

Query  3805  SHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDG  3984
               I   +      +++W   +      FLW L+   +   +    KG    + C  C   
Sbjct  2066  QLIRKREVVNPVFNFIWHKAIPLTTSFFLWRLLHDWIPVELRMKSKGFQLASRCRCC-RS  2124

Query  3985  DETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIY  4164
             +E++ HV+ +            +PV+ Q   +  L                       I+
Sbjct  2125  EESIIHVMWD------------NPVAVQPGHIRTL---------------------IPIF  2151

Query  4165  TCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPET  4344
             T W +W  RN     N     ++   + +        +    K +   K+   CW  P  
Sbjct  2152  TLWFLWVERNDAKHRNLGQQLLEWQWKGDKQIAQEWGITFQAKSLPPPKV--FCWHKPSN  2209

Query  4345  GWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             G  K N DG+ K +   A+ GG+ RDH G  +FGF  N+G+ NS  AEL  L
Sbjct  2210  GEFKLNVDGSAKLSQN-AAGGGVLRDHAGVMIFGFSENLGIQNSLKAELLAL  2260



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score =   474 bits (1221),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 357/1228 (29%), Positives = 566/1228 (46%), Gaps = 98/1228 (8%)
 Frame = +1

Query  976   VIRNTSQAIHGLVSGP--HSNVRVSFAYVRPNRMAKERFWNDCLS-YSSEFNAPWIMMGD  1146
             +I +  Q +H  ++ P        +F Y +  R  +   W DCL   +++   PW++ GD
Sbjct  962   IILDHPQCLHVRLTSPWLEKPFFATFVYAKCTRSERTLLW-DCLRRLAADNEEPWLVGGD  1020

Query  1147  FNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLD  1326
             FN I   +E+   S+ +     +F      CGLLD G  G  ++W      R  QR  LD
Sbjct  1021  FNIILKREERLYGSAPHEGSMEDFASVLLDCGLLDGGFEGNPFTW---TNNRMFQR--LD  1075

Query  1327  RALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYR  1506
             R ++N +  N+FP  +   L R  SDH PL   C       +    FRF+ AW+   D++
Sbjct  1076  RVVYNHQWINMFPITRIQHLNRDGSDHCPLLISC--FISSEKSPSSFRFQHAWVLHHDFK  1133

Query  1507  DIWGRVWSNSLLDVVGA--------ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQE  1662
                   W+   L + G+           +    K WNK  FG+IF +    + R++  + 
Sbjct  1134  TSVEGNWN---LPINGSGLQAFWIKQHRLKQHLKWWNKAVFGDIFSKLKEAEKRVEECEI  1190

Query  1663  SVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRN  1842
                   + G ++   K   +LN+ L  EE+ W QKS   W+ +G+RNT F+H     +R 
Sbjct  1191  LHQQEQTVGSRINLNKSYAQLNKQLNVEEIFWKQKSGVKWVVEGERNTKFFHMRMQKKRI  1250

Query  1843  RSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRK-------------NIMDGSPNDMY  1980
             RS I ++ + +G W  D + +      +F  L   +             +I+  S N++ 
Sbjct  1251  RSHIFKVQEPDGRWIEDQEQLKQSAIEYFSSLLKAEPCDISRFQNSLIPSIISNSENELL  1310

Query  1981  CGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFV  2160
             C              E  + EVK AVFD+    + GPDG  + FYQ  W  +   +   V
Sbjct  1311  CA-------------EPNLQEVKDAVFDIDPESAAGPDGFSSYFYQQCWNTIAHDLLDAV  1357

Query  2161  KKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKN  2340
             +       +P  +  + + L+PKK S    S+FRPI+L  V  KII+K++ NR+  I+ +
Sbjct  1358  RDFFHGANIPRGVTSTTLVLLPKKSSASKWSEFRPISLCTVMNKIITKLLSNRLAKILPS  1417

Query  2341  LIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLEST  2520
             +I   Q+ F+ GR  +DNI+L QE++  +   K + G +A+KLD+ KAYD +DW FL   
Sbjct  1418  IITENQSGFVGGRLISDNILLAQELIRKLD-TKSRGGNLALKLDMMKAYDRLDWSFLIKV  1476

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             L  FGF +  I +I   +     SLL NG     F+  RGLRQGD ++P LFILA E LS
Sbjct  1477  LQHFGFNEQWIGMIQKCISNCWFSLLLNGRIEGYFKSERGLRQGDSISPQLFILAAEYLS  1536

Query  2701  WDIQEKVRVKNWKPITLSRG-GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSG  2877
               +        +  +  S G    VSHL FA+D+++F   S+   + I+  L+++   SG
Sbjct  1537  RGL--NALYDQYPSLHYSSGVPLSVSHLAFADDVLIFTNGSKSALQRILVFLQEYEEISG  1594

Query  2878  LNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL--HKRVSKHTFGYIL  3051
               IN  KS      N  +  ++ +   TG +      TYLG P+   HK+V    F  ++
Sbjct  1595  QRINAQKSCFVTHTNIPNSRRQIIAQATGFNHQLLPITYLGAPLYKGHKKVI--LFNDLV  1652

Query  3052  DGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGD  3231
               ++ ++  W+  +LS  GR TL++S L+S+P+Y +QV K P      ++R+   FLWG 
Sbjct  1653  AKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPVCVLERVNRLFNSFLWGG  1712

Query  3232  SAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKY  3411
             SA +K++H   W  I      GGL +R   +   A   KL W+  T+ D LW + MR KY
Sbjct  1713  SAASKRIHWASWAKIALPVTEGGLDIRSLAEVFEAFSMKLWWRFRTT-DSLWTRFMRMKY  1771

Query  3412  VKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMD  3591
              + +    T    + S  W+ ++   +I E    WR+G G ++ FW D W G+ PL   +
Sbjct  1772  CRGQLPMQTQPKLHDSQTWKRMLTSSTITEQHMRWRVGQG-NVFFWHDCWMGEAPLISSN  1830

Query  3592  EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRS  3771
             +     + S  +V DF   N +WN++KL ++L  +++D I   PI    +  D  YW  +
Sbjct  1831  QEF---TSSMVQVCDF-FTNNSWNIEKLKTVLQQEVVDEIAKIPIDTMNK--DEAYWTPT  1884

Query  3772  PTGAFSVRSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMT  3951
             P G FS +SA+  I          +++W   V      FLW L+   +   ++   KG+ 
Sbjct  1885  PNGDFSTKSAWQLIRKRKVVNPVFNFIWHKTVPLTTSFFLWRLLHDWIPVELKMKSKGLQ  1944

Query  3952  EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTP------LKSW-VKNN  4110
               + C  C   +E++ HV+ +   A   W   +    FQ  ++ P      + +W    +
Sbjct  1945  LASRCRCC-KSEESIMHVMWDNPVAMQVW--NYFAKLFQILIINPCTINQIIGAWFYSGD  2001

Query  4111  CCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNK  4290
              C    I      +  ++  W +W  RN     N    P  ++ R   L           
Sbjct  2002  YCKPGHIR----TLVPLFILWFLWVERNDAKHRNLGMYPNRVVWRVLKLIQQLSLGQQLL  2057

Query  4291  K------------------CVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
             K                     +   +   W  P  G  K N DG+ K++   A+ GG+ 
Sbjct  2058  KWQWKGDKQIAQEWGIIFQAESLAPPKVFSWHKPSLGEFKLNVDGSAKQSHN-AAGGGIL  2116

Query  4417  RDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             RDH GE +FGF  N+G  NS  AEL  L
Sbjct  2117  RDHAGEMVFGFSENLGTQNSLQAELLAL  2144



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score =   458 bits (1178),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 323/1101 (29%), Positives = 507/1101 (46%), Gaps = 92/1101 (8%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
             V ++F Y  P    +E  W      S   N  W+M+GDFNDI  N E+ G      S  +
Sbjct  13    VFITFVYGDPVVECRENVWERLTRMSLTRNGAWLMLGDFNDITGNHEKKGGRRRPDSSFM  72

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
              F    + CG++D  + G  +SW        VQ  KLDRA+ N +  +++       L  
Sbjct  73    PFKTMLANCGMIDFPSKGNPFSWVGNRSSGKVQC-KLDRAVGNEDWHHIYSHTNVEYLRL  131

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS----LLDVVGAI  1560
               SDH P+  L    +   +  R F+F+  W+ R+ +R+   + WS+       D+   I
Sbjct  132   WGSDHRPI--LTRFLSKRGKGRRGFKFDKRWIDRDGFRETILKGWSDPGNLHPPDLHERI  189

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
             +       +W +    N   R   L+ +++  Q     +T    ++L+ K   +L    +
Sbjct  190   AMCRKAIAQWKRANPLNFVARIEELKEKLEKAQ---LDDTISNDEILQLKW--DLCSAFR  244

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
              EEL W QKSR  W+++GDRNT F+H +T  RR R+R+  LK   G W    + I     
Sbjct  245   DEELYWKQKSRANWLKEGDRNTKFFHATTKQRRARNRLTKLKNPRGGWAEKEEDIEKVAE  304

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFD--MKKFGSPGP  2091
              +F  LF   N     P +                            FD  ++ FG    
Sbjct  305   EYFQVLFTTSN-----PGN----------------------------FDEALRNFG----  327

Query  2092  DGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPIT  2271
              GI A             I   V++      + P++ ++ I LIPK + P   ++FRPI+
Sbjct  328   -GITAG-----------EIFRMVREFFMSETLDPRLNQTNICLIPKTERPCEMTEFRPIS  375

Query  2272  LLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KK  2448
             L NVS+K++SK++ NR++  +  LI   Q++F+  R   DNI++ QE+ H +R     K 
Sbjct  376   LCNVSYKVVSKILSNRLKRHLPGLISETQSAFVAKRLITDNILVAQEVFHALRTNPSCKS  435

Query  2449  GLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQ  2628
               +AIK D+ KAYD ++W FLE+ +   GF    I+ I   +   S ++L NGE      
Sbjct  436   KFVAIKTDMSKAYDRVEWSFLEALMRKMGFTDRWIAWIHLCISSVSYNVLINGEPKGNIT  495

Query  2629  PGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLF  2808
             P RG+RQGDPL+P+LFI+  E L   IQ   R      + ++R    +SHL FA+D + F
Sbjct  496   PSRGIRQGDPLSPFLFIILTEALISQIQGAEREGRITGLKIARDSPPISHLLFADDSLFF  555

Query  2809  AEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLG  2988
              +A   Q R +M  ++++   SG  +NV+KS+IF       E+K  LK   GI+    +G
Sbjct  556   CKADTQQCRELMKIIEEYGRASGQQLNVAKSSIFFGSKVPPELKTELKEALGITREGGMG  615

Query  2989  TYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVF  3168
              YLG+P       +  F +I + +  +L +W   +LS  G+  L++S   +MP Y M  F
Sbjct  616   VYLGLPEKICGSKRQAFAFIQERLMSRLNSWSAKLLSKGGKEVLIKSVAQAMPSYVMSCF  675

Query  3169  KLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAK  3348
              LP      +      F W     N+ +H V WN IC   + GGLG R   +FN ALLAK
Sbjct  676   LLPQDIIKKLTSAIARFWWSTKQNNRGLHWVAWNKICLPTEKGGLGFRDLKNFNLALLAK  735

Query  3349  LAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGN  3528
               W+LV     L  KV++E+Y +N N       +  S+ WRSIM  + +++ G    IG+
Sbjct  736   QLWRLVQYPTSLLAKVLKERYFRNSNPIDVEKASQPSYVWRSIMAAKPLLKSGLRKSIGS  795

Query  3529  GLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIID  3705
             G +   W + W    P      V  P  +    V + I    ++WNV+ L +++  + I 
Sbjct  796   GYNTRVWDEPWIPSTPPRPPTGVA-PIQKPNLLVYELIDRETKSWNVEALKAVIAPEDIP  854

Query  3706  GIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIA-----GNDEDAMDTS------WV  3852
              I +  I+   +V DS  W  + +GA+SV++ +  I       N E  ++ S       V
Sbjct  855   LISSLRISRSFKV-DSFCWIHTKSGAYSVKTGYDEICRSENEQNTELCIEPSVTSLINQV  913

Query  3853  WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
             W      + + F+W  +   +        +    D  C  CG  DET+NH+L EC  A  
Sbjct  914   WATNTARKIKHFMWQALSNCVPVCSRLTDRHCHSDRSCQRCGHVDETVNHMLFECPPATQ  973

Query  4033  CWRRTHH-------PVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKAR  4191
              W    H       P    YS    L + +K      D +   PW +      W +WK+R
Sbjct  974   TWALALHLSLQGEFPSPSIYSNFDYLLNRIKKQDMPDDVLARIPWII------WFMWKSR  1027

Query  4192  NQRIFENTASAPMDIMRRANN  4254
             N ++FE     P++I++ A +
Sbjct  1028  NGKVFEGKDLTPLEILQSATS  1048



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score =   470 bits (1209),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 330/1104 (30%), Positives = 527/1104 (48%), Gaps = 57/1104 (5%)
 Frame = +1

Query  1033  VRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL  1212
             +RV+  Y  P+   +   W+     +     PWI+ GDFN++    ++ G      ++  
Sbjct  100   IRVTGFYGNPDSQLRHFSWDLLRRIAKSVRGPWIVFGDFNELLCIGDKRGGGERPEAQIR  159

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
              F E+   CGL ++  SG +++W R   G  ++R  LDR   N EA  LFP      +  
Sbjct  160   RFREAVDECGLQEVEFSGPTFTWKR---GTLLER--LDRCFINEEAGVLFPRFHEAHVDV  214

Query  1393  THSDHHPLKFLCEAgnpprre----nrpfrfegAWLTREDYRDIWGRVWS---NSLLDVV  1551
               SDH  L    E  N  R+      R F+FE  W   ++ + +    W    N L +V 
Sbjct  215   GASDHLSLVLFSEGLNCGRKGGWKGLRRFQFEPFWAKEQESKQVVADAWQSDGNQLNNVR  274

Query  1552  GAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNE  1731
               ++ V+   ++WN+  FG I  +   L    K +++  F ++   +Q     +V ELN+
Sbjct  275   AKLAGVSKELQRWNENKFGLIPKKIRQLN---KELEQCPFDSSDEVVQNRRNAIVAELNK  331

Query  1732  VLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISD  1908
              L+ EE +W Q+SR  W+Q+GDRNT F+H     R  ++R+  ++   GEW      I  
Sbjct  332   SLEIEESIWRQRSRINWLQEGDRNTKFFHGFAKGRGRKNRVLGIMSSTGEWIEQETEIQQ  391

Query  1909  HISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPG  2088
               +  F  LF  +              K+      KL +  T  ++ +A+  M    SPG
Sbjct  392   AFNTHFSQLFTSEGCDHMELVLDTVQRKVTDDMNAKLNKPFTKLDIDEALKQMGPDKSPG  451

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
              DG  A FYQ +WE V   ++    +VL +G     +  + + LIPK ++P+  +DFRPI
Sbjct  452   EDGFSARFYQAYWEIVGDEVSNRCLQVLNEGASVKDLNHTLLALIPKIENPQGVADFRPI  511

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-GK  2445
             +L NV +K+ISK +VNRM+ ++  +I  +Q++F+PGR   DN++   E++H +R K+ G 
Sbjct  512   SLCNVLYKLISKAMVNRMKVLLPEVISCYQSAFVPGRCIHDNVVTAFEVIHSIRNKQTGT  571

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
                  +KLD+ KAYD ++W FL + ++  GF +  + L+M  V   S S+LWNG+ +   
Sbjct  572   HPYCVLKLDISKAYDRVEWIFLRNIMLKLGFSERWVELVMKCVESVSFSILWNGKAMGMI  631

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
                RGLRQGDPL+PYLF+L  E L+   Q   R        +S G   +SH+ FA+D ML
Sbjct  632   NLSRGLRQGDPLSPYLFLLCSEGLTSLFQNVEREGLVHGAKVSEGSPPISHILFADDSML  691

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
             F  A   +  ++  CL  +   +G  +N  KS +   P    E K  +    G+ V    
Sbjct  692   FGRAEMQELTLLKQCLLLYERAAGQKVNFQKSAVAFGPGLLEEQKSLIATFLGVLVVPFH  751

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
               YLG+P +  R  K  F  I + + + L  W+  +LS AG+  L+++   ++P YTM V
Sbjct  752   EKYLGLPTVAGRNKKEMFKRIHERLDQHLQGWQSRLLSKAGKTILIKAVAQAIPSYTMSV  811

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             FKL  G C        ++ WG   +   +H   W+ +C++K  GGLG R    FN ALLA
Sbjct  812   FKLSKGVCRIYQSKVANYWWGSGGKKNGIHWCKWDLLCRNKMDGGLGFRDIECFNQALLA  871

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             K  W++V     L  +V++ KYV   ++ A P+    S+ WRS++ G+ ++  G  WR+G
Sbjct  872   KTVWRIVMQPTSLANRVLQAKYVHGGDWAAAPIGPKPSFIWRSLVWGKKLLCAGIRWRVG  931

Query  3526  NGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSS-LLPHDII  3702
             NG ++  W D W    P +F   VT     S  +VS  +     W+V  + +  LP   +
Sbjct  932   NGTAIRIWEDKWL-PSPWSFR-VVTPRFMDSNTRVSTLMTSPSMWDVIFIQTHFLP---V  986

Query  3703  DGIRATPIAVCEQV-SDSLYWPRSPTGAFSVRSAF-------------SHIAGNDEDAMD  3840
             D  +   I VCE+  SD   W  +  G ++V+S +             S      E   +
Sbjct  987   DADKILSIPVCERSGSDVAIWHYTNDGYYTVKSGYWLAMELKQVGKSTSSSGEKGETNSN  1046

Query  3841  TSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLME  4014
             + W  +W + V  + +LFLW      L      +++ +    +C+ CG   E++ H L  
Sbjct  1047  SVWSIIWGLSVPNKVKLFLWRACHAFLPCVERLFKRKVCSSDICSRCGGASESVLHSLWA  1106

Query  4015  CSFAKDCWRRTHHPVSFQYS-LVTPLKSWVKNNCCASDWINGCPWGVT------FIYTCW  4173
             C  A+  W+         YS L   +K W   +   SD ++      T      F   CW
Sbjct  1107  CRIAQKVWK---------YSWLAGVVKLWKFQS--FSDLLHRVAMEGTNKELDLFGLVCW  1155

Query  4174  EIWKARNQRIFENTASAPMDIMRR  4245
              IWK RN  I       P  +++R
Sbjct  1156  WIWKCRNDTIHGKEGLKPDILVQR  1179



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score =   469 bits (1207),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 342/1189 (29%), Positives = 543/1189 (46%), Gaps = 56/1189 (5%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R +  Y  P    +   W+   S     + PW+  GDFN+I D  E+ G+   +  +   
Sbjct  384   RFTGFYGHPETSQRHLSWDLLRSLRRVCSEPWLCCGDFNEILDFNEKTGAVQRSQRQIDG  443

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F  +   CGL +   +G  Y+W  +  G    + +LDR   NL     +       L   
Sbjct  444   FRHAVEDCGLYEFAFTGFQYTWDNRRKGDANVKERLDRGFGNLALIQQWGGISCHHLVSM  503

Query  1396  HSDHHPLKFLCEAgnppr---renrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISE  1566
              SDH PL F  +         R  R F FE  WLT E  R +  R W   +  VVG + +
Sbjct  504   SSDHCPLLFENDPPMSRGGNWRRKRRFLFEDMWLTHEGCRGVVERQWLFGVNSVVGKLEQ  563

Query  1567  VTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQE  1746
             V    K+WN+ETFG++  + ASL+  +  +Q       +  +     ++   L+ VL++E
Sbjct  564   VAGGLKRWNQETFGSVKKKVASLREELDVLQRQ---PPTSNIICKRNEVECLLDGVLERE  620

Query  1747  ELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNF  1923
             ELLW Q++R  W + GDRNT F+H++   R   +RI  +L  +  W SD   I     ++
Sbjct  621   ELLWKQRARVSWFKCGDRNTQFFHQTAKQRGRSNRICGILGEDNRWRSDVTDIGCVFVSY  680

Query  1924  FIDLF-GRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGI  2100
             F +LF      MD +  +     ++D      L +     E++ A+ DM    SPG DG+
Sbjct  681   FRNLFTAGGGSMDETIFEAVTS-RVDATSKKSLDQVYRREEIELALKDMNPSKSPGSDGM  739

Query  2101  QAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLN  2280
              A F+Q FW  + + +     + L           S I LIPK  +P+  +++RPI+L N
Sbjct  740   PARFFQKFWNIIGNDVVDVCLRFLNGDGSIADFNHSLIALIPKVQNPKKVTEYRPISLCN  799

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLM  2457
             V +K++SKV+ NR++ ++  +I   Q++F+  R   DNII   EI+H ++ + K  +  +
Sbjct  800   VVYKLVSKVLANRLKSVLPEVIAENQSAFMSQRIIHDNIIAAFEIIHCLKRRGKDSRQKI  859

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
             A+KLD+ KAYD ++W FL+  +   GFP   + LIM  V+  + S+L  G      +P R
Sbjct  860   ALKLDMTKAYDRVEWGFLQRMMEVMGFPDRFVFLIMDCVKSVTYSVLLQGAPFGKIKPSR  919

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             GLRQGDP++PYLF++  E LS  I++  R +    + ++RG   VSHLF+A+D +LF +A
Sbjct  920   GLRQGDPISPYLFLIVAEGLSALIRKAEREQQIHGVAIARGAPSVSHLFYADDSLLFCDA  979

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             +      + N    +   SG  IN  KS I  SP + + IK     +  + V      YL
Sbjct  980   TVTDCMALKNIFSTYEAASGQKINKDKSAICFSPKSPAAIKEACSAILDMPVVPCHERYL  1039

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+P +  +  K  F  + D +  ++  W+G +LS AG+  L+++   ++P YTM VF+LP
Sbjct  1040  GLPTVSGKDKKKLFQSLPDRVWNRVHGWEGKLLSKAGKEVLIKTVAQAIPNYTMSVFQLP  1099

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
             AGT + I++    F WG     K +H   W+D+C SK  GGLG R    FN ALL K  W
Sbjct  1100  AGTSDAINKCVARFWWGKEG-GKGIHWRRWSDLCFSKKDGGLGFRDLSLFNQALLGKQGW  1158

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +L+   D L  ++++ KY    +F    + ++ S+ WRS + GR ++  G  WRIG+G  
Sbjct  1159  RLMMYPDSLVARMLKAKYFPWDDFMEAELGSSPSYLWRSFLWGRELLRKGVRWRIGDGKE  1218

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRA  3717
             +  + D W    P      +    +    +VSD +  N  WN++ L+     D  + I +
Sbjct  1219  VRVFIDPWVPGLPS--FRPILRQGAPLFLRVSDLLHNNGGWNMEALNYWFTDDECEAISS  1276

Query  3718  TPIAVCEQVSDSLYWPRSPTGAFSVRSAF-SHIAGNDEDAMDT--------SWVWKMRVT  3870
               +    +  D   W     G ++V+S +      N E+A++           +WK+++ 
Sbjct  1277  ITVGATRR-PDVYMWNYCKNGRYTVKSGYWLACEENREEAINIVLAPRNFWKHLWKLKLP  1335

Query  3871  ERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRR--  4044
              +   FLW    G +        K +     C  C  G E+  H    CS     + R  
Sbjct  1336  PKINHFLWRCSMGFIPCMEVLLWKHIAHSASCFRCQQGRESPVHATWGCSCCVAVFERAG  1395

Query  4045  ------THHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
                   +    SF + L     +  K                 F    W  W  RN   +
Sbjct  1396  FYSKLSSGQFPSFIHLLHHAFSTLDKEEL------------QLFAVLLWLNWHERNN-CY  1442

Query  4207  ENTASAPMDIMRRANNLTLDTVEVFLNKKC---------VHVGKMRWVCWQPPETGWIKF  4359
                A  P DI+       L   +  L  +          V  G +R   WQ P +G +K 
Sbjct  1443  HKGAVVPSDIIYENGVKFLKCFKEALGCRAGVEVKAVEEVVPGSLRR--WQAPSSGQLKV  1500

Query  4360  NTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVS-NSFAAELWGLR  4503
             N DGA          G + RD  G  +     N     +S  AEL  ++
Sbjct  1501  NCDGAANFKDRCFGGGTIIRDEFGSLIVAGGKNFQHPVSSLVAELLAIK  1549



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score =   468 bits (1205),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 331/1135 (29%), Positives = 532/1135 (47%), Gaps = 81/1135 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
             FF      N     N    I  ++ G    V ++F Y  P    +++ W     +S+  N
Sbjct  49    FFMDEYRVNVLFSNNRMIDIEAVIDG--IKVYMTFVYGDPVLERRDQVWERLTRFSTTRN  106

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW M+GDFN+I  + E+ G      S  L F +  + CG+L+   +G   SW  +  G 
Sbjct  107   GPWFMIGDFNEITCHNEKEGGRQRPDSSFLPFKQMLNDCGMLEFLFTGDMLSWVGKRAGG  166

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             +  R +LDRA+ N +    FP +    +    SDH P+  L +    P R +R F+F+  
Sbjct  167   STVRCRLDRAVGNSDWHEKFPHSTVKYMRLWGSDHRPI--LADILIKPTRRSRKFKFDKR  224

Query  1483  WLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK----WNKETFGNIFGRKASLQARIK  1650
             WL  E+ R I    W +  L     I E  +  +K    W ++   N       L+ +++
Sbjct  225   WLDNEELRQIILEGWKSPDLPPHATIMEHISSCRKALSDWRRQHNVNSAKLVEELKEKVE  284

Query  1651  GVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTL  1830
             G+       T +    L+     EL++ LK EEL W QKSR  W+++GD+NT F+H  T 
Sbjct  285   GLYADDNATTEQIAAALK-----ELSDALKAEELFWKQKSRVFWLREGDKNTKFFHALTK  339

Query  1831  IRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQ  2007
              RR R++I ++L  NG    D + +    +++F  +F   N  D           +    
Sbjct  340   QRRARNKITQLLDENGNAVEDEEGLVAIATSYFRQIFESSNPEDIEDALSQVSTSITGAM  399

Query  2008  MHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRV  2187
                LT  V+  E+K A+F M    +PGPDG+ A FYQ FW+ VK  +T  V + L +G V
Sbjct  400   NDNLTAPVSEWEIKLALFAMHPEKAPGPDGMTALFYQKFWDIVKEDLTRMVNQFLFEGTV  459

Query  2188  PPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSF  2367
                + ++ I LIPK   P   + FRPI+L NVS+KIISK                     
Sbjct  460   TSGLNDTNICLIPKTTRPNEMAQFRPISLCNVSYKIISK---------------------  498

Query  2368  LPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
               GR     I   QE+ H +R K  G+   MAIK D+ KAYD ++W F+E+ L   GF +
Sbjct  499   --GR----KIRQPQELFHALRTKPSGRNNRMAIKTDMSKAYDRMEWSFIEAVLRKMGFSE  552

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERL-----SWDI  2709
               I  +M  +      +L NGE      PGRGLRQGDP +P++FIL  E L       +I
Sbjct  553   TWIGWVMRCITSVKYKVLMNGEPRGNIIPGRGLRQGDPXSPFIFILCTEALVSLLNHAEI  612

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
             Q K+       + ++R    VSHL FA+D + F +A   +   +M  ++K+   SG  IN
Sbjct  613   QGKI-----TGMRVTRACPSVSHLLFADDSLFFCKAEPRECEEVMKVVRKYGKASGQCIN  667

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
               KS++      N  +++ LK++ GI     +GTYLGIP          F ++ + +  +
Sbjct  668   FDKSSLLFGKRINVAMRQELKDVLGIQNEGGMGTYLGIPEDISGSKCKLFAFLKEKLMHR  727

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
             +  W G  LS  G+  L++S L ++P Y M  F LP   C ++      F W  +   + 
Sbjct  728   VNGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIAQFWWSSNPPKRG  787

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNF  3429
             +H   W  +C  ++ GG+G R   +FN ALLAK  W+LV   D L  +V+R +Y +  + 
Sbjct  788   IHWAKWEKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFPDSLVARVLRGRYYRLSSP  847

Query  3430  FATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPD  3609
                  + + S+ W SI   R ++ LG   +I +G  +  W D W    P      +  P 
Sbjct  848   LRVNTVTSPSYVWTSISAARKLLLLGIRQKIHSGHEVKVWEDPWVPTTPARPAIPIA-PV  906

Query  3610  SQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAF  3786
                  +VSD I   ++ W++  L + +  + I  IR+  I+   +  D+  W  +  G +
Sbjct  907   MHPNMRVSDLIDQASKEWDIGLLENYVSPEDIPLIRSLAISSTHR-RDTFCWNYTKNGQY  965

Query  3787  SVRSAFSHIAGN------DEDAMDTS------WVWKMRVTERCrlflwllmrgrllTNME  3930
             +V+S +  +A N      +++ ++ S      + W+++  ++    +W L+ G +     
Sbjct  966   TVKSGY-WLAQNVLKPSAEKEVLEPSITKLQAFAWQIKAPKKICHLIWQLLTGHVAVTRN  1024

Query  3931  RWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKS-----  4095
               R+ M  D  C  CG+ +ET+ H + EC  A   W  +  P S     V+ + +     
Sbjct  1025  LTRRNMRCDNYCPRCGELEETVTHAIFECPPALQVWSLSSTPTSPDIFPVSSVYTNMDFL  1084

Query  4096  -WVKNNCCASDW-INGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN  4254
              W KN+    +   +  PW +      W IWKARN+++F      P++++R A +
Sbjct  1085  FWRKNSIIEPELDRDPYPWII------WYIWKARNEKLFRGIDRDPLELVRHAES  1133


 Score =   152 bits (383),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 127/507 (25%), Positives = 212/507 (42%), Gaps = 65/507 (13%)
 Frame = +1

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             LS  G+  L++S   ++P++ M  FKLP   C  +     DF W      KK+  V W  
Sbjct  1280  LSQVGKEILLKSVGLALPIFAMSCFKLPKDVCAKLTSAMIDFWWSSGNNRKKISWVAWQK  1339

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIAN  3453
             +CK K+AGGLG ++   FN +LLAK AW++    + L  +++R +Y +N  F  + + + 
Sbjct  1340  LCKDKEAGGLGFKELEKFNQSLLAKQAWRIWDKPESLVARILRHRYFRNSGFLDSGVGSR  1399

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVS  3633
              S+ WRSI+ GR +++ G    +G+G     W+D W        +  +       +  V 
Sbjct  1400  PSYAWRSILHGRDLLKRGLVRVVGDGNDTKVWTDNW-------LIAPLPRSPRYRQGAVV  1452

Query  3634  DFIL--------PNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
             D  L         +  W++ KL  ++  + I  I    I      +D L W  S  G + 
Sbjct  1453  DLTLRVGDLLSDDSNVWDISKLREVIDDEDIPLI--LQIKTQRGKNDMLRWGFSRNGVYD  1510

Query  3790  VRSAFSHIAGNDE----------DAMDTSW--VWKMRVTERCrlflwllmrgrllTNMER  3933
              +S +  +    E                W  +WK + + + R FLW +M G L    + 
Sbjct  1511  SKSGYKLLESITELESAQPRPLPPLEKQLWRDLWKSKTSPKLRHFLWRVMSGALAVKQQL  1570

Query  3934  WRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHP------------VSFQYSL  4077
               +G+  D  C  C  G E++ H+L  C  AK+ W R+  P            ++  Y L
Sbjct  1571  SARGIPVDPCCPLCRQGPESICHMLFHCPSAKEVWERSSIPLPPAGFSPTSVFLNLHYLL  1630

Query  4078  VTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNL  4257
                 KS V                + F +  W IWK RN   FE  +++   I+ RA   
Sbjct  1631  ACSKKSSVDPKL-----------RLAFPWILWHIWKNRNLFCFEQRSNSAEIILSRA---  1676

Query  4258  TLDTVEVFL--------NKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGL  4413
              L+   V+L        +   + +       W+ P +  +K N   A+  +   + A  +
Sbjct  1677  -LEEASVWLQLNAYVPADPPAMELEVEDSYAWKKPPSTAVKCNVGSAWSASNSTSGAAWI  1735

Query  4414  ARDHKGEW-LFGFMTNIGVSNSFAAEL  4491
              RD  GE  L    + +GV +   A++
Sbjct  1736  LRDSGGEAVLHSRRSFVGVRSQLEADM  1762



>ref|XP_008228034.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=751

 Score =   445 bits (1145),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 243/618 (39%), Positives = 361/618 (58%), Gaps = 50/618 (8%)
 Frame = +1

Query  2170  LRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIG  2349
             L    +P ++  + ITL+PK  SP++   FRPI+L +  +K+ISK++V R+RPI+ +LI 
Sbjct  56    LEKCSIPDRLNYTLITLVPKVQSPQSMVQFRPISLCSTLYKVISKILVARLRPILPDLIS  115

Query  2350  PFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
             P Q SF+PGR   DNI++ QE++H  +L KGKKG +A K+DL KAYD + W F+E  L++
Sbjct  116   PNQVSFIPGRHITDNILIAQELMHKFKLSKGKKGFVAWKIDLSKAYDRLSWHFVEYVLLE  175

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
                P   + LIM  V+     +  NGE  APF P  G+RQGDPL+PYLF+L +E+LS  I
Sbjct  176   LRLPAPFVKLIMNCVQSVRYQINVNGELTAPFSPMNGIRQGDPLSPYLFVLCIEKLSHII  235

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
              + V  K W+P+  S+ G  +SHLFFA+DL+LFAEAS  Q +++ +CL  F   SG  +N
Sbjct  236   CDAVSKKKWRPVKSSQSGPAISHLFFADDLVLFAEASASQAKIMKSCLDLFCSASGQVVN  295

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
               KS +FCSPNT  E+ + +  + G  ++++LG YLG+P+LH R+ K T+  ++D + ++
Sbjct  296   FEKSAVFCSPNTCKEVAKEISLICGSPLTNDLGKYLGMPLLHSRIGKRTYSSLVDKVHKR  355

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
             LA WK  +LSLAGR TL+Q+  +S+PVY MQ  KLP   CND+DR+ R+F WG S +  K
Sbjct  356   LAAWKSKLLSLAGRATLIQAVTTSIPVYAMQTTKLPVSVCNDLDRLNRNFFWGSSEKKYK  415

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNF  3429
             +HL  W+  C+ K  GGLG +K    N ALLAK+ W+L +    LW K+   KY+K  + 
Sbjct  416   IHLCQWDLACRPKGKGGLGFKKTASMNQALLAKIGWRLHSKDSGLWAKIYEAKYLKGASI  475

Query  3430  FATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPD  3609
             F                     + LGA+W +G                       +TIPD
Sbjct  476   FD--------------------ISLGASW-LG-----------------------LTIPD  491

Query  3610  SQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
             S     VS F + N  W++DKL  +L  D++  + + P+     + D+  W  S  G FS
Sbjct  492   SN--CPVSSFSM-NGWWDIDKLRGVLCEDLVQQVISVPVGFLGSLPDTQIWKGSTNGDFS  548

Query  3790  VRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTL  3963
             V+SA+S   G      D+ W  +W + V  + + F+WL  +G++L+N +R R+ +  D  
Sbjct  549   VKSAYSLFFGGCSTP-DSCWKSLWSLNVPPKLQYFMWLASQGKILSNDQRVRRQLASDPS  607

Query  3964  CATCGDGDETMNHVLMEC  4017
             C  C    ET+ H+L +C
Sbjct  608   CGFCSWPTETVLHILRDC  625



>ref|XP_009150035.1| PREDICTED: uncharacterized protein LOC103873375 [Brassica rapa]
Length=1285

 Score =   460 bits (1183),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 324/1173 (28%), Positives = 540/1173 (46%), Gaps = 82/1173 (7%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             +S  Y  P    +   W       +    PW ++GDFN+I +N+E+ G    + +  L F
Sbjct  26    LSCIYGDPIIEGRNEVWERLNRIGTNRKEPWCLIGDFNEILNNEEKSGGPRRSEASFLPF  85

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
              +    CG+ ++ + G   +W  +   + +Q   LDR+  N E   +FP +  I L +  
Sbjct  86    ADMLKNCGMEELSSRGDKLTWGGKRWNKWIQC-ALDRSFGNEEWFKIFPGSNQIFLEKRG  144

Query  1399  SDHHP--LKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVT  1572
             SDH P  L F         +     +F      ++     W R  +     V   I    
Sbjct  145   SDHRPVWLNFYANHEAFKGQFRFDKKFLIQHDVKKQISIAWARNCNGRHQSVSQRIRNCR  204

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
             N   +W +++  N   +   LQ R++ +Q S  Y     + ++++ L+    +  K+EEL
Sbjct  205   NALSRWKRQSVYNSQDKIRLLQERLEWMQ-SRDYPCFFMINIIKKDLI----KAYKEEEL  259

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-ING--EWNSDFKTISDHISNF  1923
              W QKSR  W+  GDR + F+H S    R+R+ I  LK  NG  +W+   K  ++   ++
Sbjct  260   FWKQKSRDKWMIHGDRCSKFFHSSVKTSRSRNLIDKLKDKNGKDQWSEGAK--AEVAIDY  317

Query  1924  FIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQ  2103
             F  LF   N    +P      PK+       L+R+++  EV++A+F +    +PGPDG+ 
Sbjct  318   FSTLFRSSNPRSYTPVLESMVPKVSDSMNDVLSRDISKEEVREAIFSIDPDSAPGPDGMT  377

Query  2104  AAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNV  2283
               F+Q  W+ V   IT+ +++V +   +P     ++I L+PK + PE   D RPI+L +V
Sbjct  378   GLFFQRHWDLVGEQITSEIQEVFQTVSLPRDWNFTYICLLPKINDPEFMKDLRPISLCSV  437

Query  2284  SFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYM-RLKKGKKGLMA  2460
              +K +SK++V R++P ++++I   Q++F+  R  +DNI++  E VH + R     + +MA
Sbjct  438   LYKSVSKILVRRLQPFLQDIISSNQSAFVRDRLISDNIVIAHEAVHALKRHHPISQEMMA  497

Query  2461  IKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRG  2640
             +K D+ KAYD ++W +L S ++  GF    +  +M  V   S ++L N +      P RG
Sbjct  498   VKTDMSKAYDRVEWSYLRSLMLALGFSLKWVDWVMMCVTSVSFAVLINDQPFGLINPQRG  557

Query  2641  LRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEAS  2820
             LRQGDPL+P+LF+L  E L+  +    R      +  S  G  +SHL FA+D +   +AS
Sbjct  558   LRQGDPLSPFLFVLCTEGLTHLLNVAERNGLISGMKFSEEGPTISHLLFADDSLFLCKAS  617

Query  2821  EDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLG  3000
               +  ++   L  +   +G  IN  KS+I        E +  +++  GIS       YLG
Sbjct  618   VSEASVLQRILTFYGEATGQTINREKSSISFGDKVGEESRAAIQHTLGISNQGGASKYLG  677

Query  3001  IPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPA  3180
             +P          F Y+ D    KL  W    LS AG+  L++S+ SS+  + M  F+LP 
Sbjct  678   LPECFSGSKVDLFSYLKDKTHGKLDVWYYKHLSQAGKEVLIKSSGSSLSTFAMSCFRLPK  737

Query  3181  GTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQ  3360
                + +  +   F WG     +K+H V W  +C  KD GGLG R    FN A+LAK AW+
Sbjct  738   SIIDKLTSMLAAFWWGAEPHQRKIHWVAWERLCLPKDQGGLGFRDLEAFNQAMLAKQAWK  797

Query  3361  LVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSL  3540
             +++  D +  + ++ +Y  +  F + P+    S+ WRS++ GR ++  G   R+GNG   
Sbjct  798   VLSQPDSMLARFLKSRYFPDGEFLSAPLGLRPSYAWRSLLHGRELLTKGIIRRVGNGQKT  857

Query  3541  NFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFIL---PNRTWNVDKLSSL-LPHDIIDG  3708
               W D W  D P+  M    I +   +  +    L     R WN   L  + +P D+   
Sbjct  858   RVWIDKWI-DDPVEGMRAPWIKNYFFDVNLIASSLIDSSTRLWNPTALCEIFVPGDVQML  916

Query  3709  IRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF----------SHIAGNDEDAMD--TSWV  3852
             ++  P  + E   D   W  + +G FSV++A+          S     ++ +++     V
Sbjct  917   LKNQPAVLKE---DFYSWKLTRSGQFSVKTAYNLAFEEKTRLSQPEAFNQPSINPLKEKV  973

Query  3853  WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
             WK+    + ++FL              W+       L   CG   E++NH+L EC  A+ 
Sbjct  974   WKVLTVPKIKVFL--------------WKP--LNGGLSVVCGGSTESINHILFECPLARL  1017

Query  4033  CW--------------RRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTC  4170
              W               +T   V+F Y L    K  V  N          PW        
Sbjct  1018  VWAISGYVIPNPENGFHQTSIFVNFSYLLSLEKKRKVVPNS-----FRVWPW------IL  1066

Query  4171  WEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEV------FLNKKCVHVGKMRWVCWQ  4332
             W +WK+RN+ +F      P ++M RAN    +  E        L++  V++ K R   W+
Sbjct  1067  WSLWKSRNELLFRGFTPIPSNVMLRANQDADEWFEAQVVEEKILSETQVNIQK-RKEKWK  1125

Query  4333  PPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
             PP   W   N    + ++  LA  G + R+ +G
Sbjct  1126  PPPKDWSMCNVGFDWNKSKNLAGGGWVIRNERG  1158



>ref|XP_009123326.1| PREDICTED: uncharacterized protein LOC103848097 [Brassica rapa]
Length=1740

 Score =   467 bits (1201),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 347/1208 (29%), Positives = 565/1208 (47%), Gaps = 88/1208 (7%)
 Frame = +1

Query  943   FFWRSSIF-NFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
               W+SS++ +F  +       H  V   + +  VS  Y  P R  +   W          
Sbjct  453   LMWKSSVYIDFKFVDKHLLDFH--VQFGNLSFFVSCVYGEPVRGDRPHLWERLSRIGVFR  510

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               PW M+GDFN+I  N E+ G    +    L F E      ++++ +SG S++W    G 
Sbjct  511   KDPWCMLGDFNEIRSNDEKIGGPRRSDISFLPFNEMLEIGEMVELQSSGDSFTWGGNRGT  570

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
              ++Q  KLDR   N     LFP +  + L +  SDH P+  L +  +        FRF+G
Sbjct  571   LSIQS-KLDRCFGNKMWHRLFPVSNQVFLDKRGSDHRPV--LVKLSSVSVARRGQFRFDG  627

Query  1480  AWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK----WNKETFGNIFGRKASLQARI  1647
              +L ++   ++  + W  +       + E     +K    W K+   N   +   +Q  +
Sbjct  628   RFLHKKGVSEVLKKAWLTNHPYFEATVLERLKCCRKALSTWKKKECLNSRDKINQIQFAL  687

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
             +  Q S+  +T+  +  L+++LV    +  K+EE  W Q+ +  W   GD NT +YH S 
Sbjct  688   EREQSSLSASTTT-INFLKKELV----KAYKEEEEYWQQRCKEQWATKGDLNTKYYHAS-  741

Query  1828  LIRRNRSRIRMLKINGEWNSDF---KTISDHISNFFIDLFGRKNIMDGSPNDMYCG--PK  1992
              ++ NR+R R++K+  +   D    +   D  S +F +LF   N  +G  ++++ G   K
Sbjct  742   -VKHNRARKRIVKLKDDLGQDHFSEEAKGDVASAYFTNLFKSAN--NGEFSELFEGFSAK  798

Query  1993  LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVL  2172
             +       L++ V+  EVK+AVF +K   +PGPDG+   F+Q +W  V   +T  VK   
Sbjct  799   VTPAMNDSLSKVVSNAEVKEAVFSIKPGSAPGPDGMTGLFFQKYWGIVGDQVTKEVKDFF  858

Query  2173  RDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGP  2352
               G  P +   + + L+PK D P   SD RPI+L ++ +KIISK++V+R++P+M N++ P
Sbjct  859   SYGLFPAEWNFTHLCLLPKIDDPIFMSDLRPISLCSILYKIISKILVSRLKPLMPNIVSP  918

Query  2353  FQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
              Q++F+  R   DNI++  EI+H +R   K  K  MAIK D+ KA+D ++W +L + L  
Sbjct  919   TQSAFVEERLITDNILIAHEIIHALRTNVKFSKEFMAIKSDMSKAFDRVEWGYLRALLSA  978

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAM-ERLSWD  2706
              GF Q+ I  IMF V   S + L N                    P+ FIL   E L   
Sbjct  979   LGFNQDWIEKIMFCVSTVSYATLIND------------------VPHGFILPKREGLIHL  1020

Query  2707  IQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNI  2886
             I + V   + + I     G  + HL FA+D +L ++AS DQ R +M  LK +   +G  +
Sbjct  1021  IHKAVENGSLQGIQFCEEGPMIHHLLFADDCLLISKASPDQARKLMEILKIYERATGQLV  1080

Query  2887  NVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKR  3066
             NVSKS I         +K  +K +TGI      G+YLG+P            YI D +K 
Sbjct  1081  NVSKSAITFGAKLKENLKVAIKEITGIEKEGGSGSYLGLPECFSGSKTKILAYIYDRLKG  1140

Query  3067  KLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNK  3246
             +L+ W   +LSL G+  L+++   +M VY M  FKL    C ++ +   DF W      +
Sbjct  1141  RLSGWFLKLLSLGGKEILIKAVAMAMLVYAMSCFKLTKIFCENLTKAMADFWWNSLEHKR  1200

Query  3247  KVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKN  3426
             K+H + W+ +C +KD GGLG +    FN ALLAK AW+++   D L+ KV + +Y +N +
Sbjct  1201  KLHWLSWSKLCLAKDQGGLGFKDIQSFNQALLAKQAWRILAFPDSLFAKVFKSRYFENSD  1260

Query  3427  FFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTI  3603
               +  + +  S+ WRSI  G+ ++  G   ++GNG ++  W D W  GD   A + +   
Sbjct  1261  VVSAKIGSRPSYAWRSIQFGKELLVQGLRKQVGNGETIFVWVDRWIEGDVRRAPLMKNIF  1320

Query  3604  PDSQSEAKVSDFI-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTG  3780
              D     KVSD I   N  WN++KL  L   + I+ I A   A  E+  D   W  +  G
Sbjct  1321  VDLL--LKVSDLIDHQNNCWNLEKLRELFYEEDIERILAMKTAFREE--DYWVWLHNRHG  1376

Query  3781  AFSVRSAFSHI------------AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTN  3924
             ++SV+S +  I              +    +  S +WK+    + ++F W  M   +   
Sbjct  1377  SYSVKSGYWFINNLRRREEIREAEAHPSINVLKSDIWKVHTAPKIKMFFWRAMSNAIPVG  1436

Query  3925  MERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVS-------FQYSLVT  4083
                 ++G+  D    +CG   E++NH++ +CS A+  W   + P           +S   
Sbjct  1437  ELLVKRGIKMDPCRQSCGFQGESINHIIFQCSIARQVWALANVPYPENGFDKVSHFSNFH  1496

Query  4084  PLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRA-----  4248
              L   + +     +  N  PW V      W +WK RN  IF +     +D++++      
Sbjct  1497  SLILMMNDAIIPEEVRNAIPWIV------WYLWKYRNGIIFGDRQMTTLDLVKKIFEEAD  1550

Query  4249  ----NNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLA  4416
                   L     E   ++  + V K     W  P  GW+K N    + R+     A  + 
Sbjct  1551  FWLLAQLNEKNREQEEHEAGLDVSK----SWSVPPKGWLKGNIGVHWNRSQARCGAAWVV  1606

Query  4417  RDHKGEWL  4440
             R+ KG+ L
Sbjct  1607  RNDKGKVL  1614



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score =   464 bits (1193),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 333/1150 (29%), Positives = 550/1150 (48%), Gaps = 70/1150 (6%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
              +F +   + + +  FWN  +S  +  +APW + GDFNDI  N E+ G          + 
Sbjct  325   AAFVHGDTDFIKRRLFWNQMVSLMNGRDAPWFITGDFNDILSNDEKDGGPVRVEGSFSDL  384

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
                +S   L D+  SG   SW  Q G   V R +LDRA        LFP A++  L    
Sbjct  385   RSFYSEGDLYDLPHSGDLLSWRGQRGNHLV-RCRLDRAAATSSWAELFPSARSQYLAFEA  443

Query  1399  SDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS-LLDVVGAISEVTN  1575
             SDH PL  + E G   RR    +          + +++   VW+N+    +   IS   +
Sbjct  444   SDHRPLVTVLETGIKKRRGMFRYDRRLK--DNIEVKELVQTVWTNAGECSIREKISLTRS  501

Query  1576  LSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELL  1755
                +W+K+       R + L   +K  +     ++      L  ++ ++LN+    EE  
Sbjct  502   AIVEWSKQQ-----NRNSRLTIELKKQELEEALSSPVNDLTLIHQINSDLNDAYHAEEEH  556

Query  1756  WFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDL  1935
             W Q+SR +W++ GDRNT F+H    + RNR R     +  + N +     D I+   +  
Sbjct  557   WRQRSRLLWLRLGDRNTGFFHA---VSRNRKRANAFSVIEDVNGNVVYKEDDIARAIVQY  613

Query  1936  F-GRKNIMDGSPNDMYCGP--KLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSP-GPDGI  2100
             +      ++G+  +       +L + + + +L R  +  E++ AVF +    +P GPD I
Sbjct  614   YEALFTSVEGNKTETVNAALRRLVSDEDNIELIRRPSGQEIRNAVFSIHADKAPVGPDMI  673

Query  2101  QAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLN  2280
             +                  V+K    G  PP+  E+ + LIPK  +P+  +D+RPI L N
Sbjct  674   KE-----------------VQKFFDSGVFPPRTNETNVRLIPKILNPQVVADYRPIALCN  716

Query  2281  VSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL-M  2457
             V +K +SK++  RM+P++ N+I   Q++F+PGR+ +DN+++T E++H+++  + +K   M
Sbjct  717   VFYKTVSKLLSRRMQPLLANIISETQSAFVPGRAISDNVLITHEVLHFLKTSRAEKRCSM  776

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
             A+K D+ KAYD ++WEF+E  L   GF +  I +IM  V   + S L NG      QP R
Sbjct  777   AVKTDMSKAYDRLEWEFIELVLQRLGFHETWIKMIMQCVSTVTYSFLINGSPRGRVQPSR  836

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             G+RQGDPL+PY+FIL  E LS          + K I ++R    V+HL FA+D M F  A
Sbjct  837   GIRQGDPLSPYIFILCSEVLSGLCNRASEEGSLKGIRVARACPRVNHLLFADDTMFFIRA  896

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             +++  + +   LK++   SG +IN +KS+I  S     E++  +K    I     +G YL
Sbjct  897   NKESTQCLSKILKQYEEASGQSINTNKSSISFSRKAPLELRAKIKEELNIQREGGVGKYL  956

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+P    R  K  F  I+D + +K  +W    LS AG+ T+++S LS +P + M  FKLP
Sbjct  957   GLPEHFGRRKKDLFTSIVDRIIQKGRSWSNRFLSKAGKLTMIKSVLSPIPSHAMTCFKLP  1016

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
                C  I      F W D    KK+  V W+ + +SK+ GGLG+R    FN+A L KL+W
Sbjct  1017  LSLCKRIQAAVTRFWWDDKEGTKKMAWVSWDKMTQSKEVGGLGVRDFQAFNDAFLGKLSW  1076

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             +++ + + L  +V+  KY   ++F      +  S GWR ++ GR +++    W +GNG+S
Sbjct  1077  RILNNPEILLSRVLLGKYSSTESFLEVTEKSAISHGWRGVLIGRDLLKDNMGWSVGNGIS  1136

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN------RTWNVDKLSSLLPHDI  3699
             ++ W++ W     L+   +++ P   +  + S+F + +      RTWNV  +  +LP   
Sbjct  1137  ISIWNEPW-----LSLSQQLS-PTGPATEETSNFTVSDLFNEHERTWNVTTIKRVLPQWE  1190

Query  3700  IDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMD-----------TS  3846
              + I   P        D   W  +  G ++ +S + HIA      +D           + 
Sbjct  1191  QNIINIKP--SLSGAPDKRIWLGTNNGIYTTKSGY-HIALKRRRELDGIQTRNALFQWSK  1247

Query  3847  WVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFA  4026
              VW +++  + + FLW   +  L        + +  D +C  CG   E++NH+ + C+FA
Sbjct  1248  GVWNLQIAPKVKFFLWKTFQQALPVGEVLRHRHILTDNICKRCGT-PESINHLFLHCNFA  1306

Query  4027  KDCWRRTHHPVSFQYSLVTPLKS-WVKNNCCASDWI--NGCPWGVTFIYTCWEIWKARNQ  4197
             +D WR      +   S +  LK  W+  N C    +   G   G    +  W+IW ARNQ
Sbjct  1307  RDVWRAAPFAGAVDVSRLIDLKDVWL--NLCEKTCLPPTGLAEGSLAPWILWQIWSARNQ  1364

Query  4198  RIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAF  4377
              +F        D + +A     +  +  +  K     K   V   PP    I  +TD A+
Sbjct  1365  LVFNGKNWTAEDSLTKAIAQAREWNQSQV--KPPSTAKKAQVA-PPPPPDCITVHTDAAW  1421

Query  4378  KRNTGLASAG  4407
             K ++  A  G
Sbjct  1422  KASSQTAGLG  1431



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   461 bits (1187),  Expect(2) = 9e-134, Method: Compositional matrix adjust.
 Identities = 340/1174 (29%), Positives = 535/1174 (46%), Gaps = 57/1174 (5%)
 Frame = +1

Query  1030  NVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRC  1209
             N R+   Y   +   +   W +      +     +++GDFND   N E  G +   P+  
Sbjct  100   NWRLFGVYASTDEKKRREQWQELSKRIGQERDRCLLIGDFNDXLCNXEXEGGN-YRPAVS  158

Query  1210  LNFVESFSACG-LLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIIL  1386
             L    +F A   L+D+G  G  ++W        +Q+R LDR +  +    ++P  K   +
Sbjct  159   LRDFRNFXAREELMDLGYEGYPFTWRNNRESMPIQQR-LDRGMATMGWYEMYPNTKIKHV  217

Query  1387  PRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-----LDVV  1551
                 SDH  L  L        R+ R F F+G W   E+ R + G  W + +         
Sbjct  218   LLEGSDHXLL--LLSTEKELNRKGRQFSFDGRWSKSEECRTLVGEEWRDKIKGSHAFRFC  275

Query  1552  GAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNE  1731
               +  +    K W K    N       L+  I+     V Y ++       ++   E   
Sbjct  276   DKLKHLRRRLKVWYKGRGXNSAKMILQLKEEIR-----VAYISNEFASKEVKQKEKEXIA  330

Query  1732  VLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISD  1908
                Q E  W  KSR  W+++GD+NT F+H  TL RR  + IR ++   G W    K I D
Sbjct  331   AHXQXETYWKVKSRNQWLREGDKNTKFFHAQTLKRRRFNTIRGIEDGRGIWQZSLKGIGD  390

Query  1909  HISNFFIDLFG--RKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGS  2082
                 +F DLF   + N+++   + +    +L       LT  VT CE+ +A + +    +
Sbjct  391   TAIEYFSDLFQSCKPNLVEEIQSCIE--SRLSIEDNXGLTAMVTXCEIMEAAYQIPXXRA  448

Query  2083  PGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFR  2262
             PGPDG    FYQ  W+ V   +   VK     G +  K+  + + LI K   P+  S + 
Sbjct  449   PGPDGFSGCFYQDHWDTVGPDVIKIVKAFWHSGTLLRKLNHTNLVLIXKMKCPKNMSQYX  508

Query  2263  PITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVH-YMRLKK  2439
             PI L NV +KII+KV+ NR++ +M  +IG  Q++F+  +   DNI++  E +H  +  K 
Sbjct  509   PIALCNVIYKIIAKVLXNRLKRVMPKVIGENQSAFVAXKQIQDNILVVHEALHSLIHQKS  568

Query  2440  GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLA  2619
             G    MAIKLD+ KAYD I+W FL   +   GF       I   +   S S+L NG    
Sbjct  569   GDHPGMAIKLDMAKAYDRIEWXFLLGMMCSLGFAPLFXKWIKECISSVSFSVLINGSPTG  628

Query  2620  PFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDL  2799
              F+P RGLRQGD L+P+LF+L  E L   I+  +         +S  G  ++HLFFA+D 
Sbjct  629   XFRPNRGLRQGDXLSPFLFLLCTEGLXMLIRRGLERGVLHGFKISXAGAPLTHLFFADDS  688

Query  2800  MLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSD  2979
             ++F  AS ++   I+  LK ++  SG  IN++K ++F   NT+ +++  + +   I    
Sbjct  689   VVFGNASVEEAESIVEVLKTYARGSGQEINLTKXSVFFGANTSKKMRANIVDSLMIQSKX  748

Query  2980  NLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTM  3159
               G YLG+        K  F  I D ++  ++ W    LS AG+  LV++   ++P Y M
Sbjct  749   GFGKYLGLQADFGHSKKAVFXEIRDKIEAXMSGWAEQFLSQAGKEILVKTVAMALPNYAM  808

Query  3160  QVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNAL  3339
               FKLP G C D++R  R++ W  + Q K +H +  + + K K AGGLG +     N A 
Sbjct  809   SCFKLPIGVCRDVERAIRNYWWRGNEQRKGIHWISXDRLMKQKKAGGLGFKDIQCVNLAF  868

Query  3340  LAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWR  3519
             LAK+ W++  +   L   V+R+KY   K+F   P   N S GW+ +   R ++ LG  WR
Sbjct  869   LAKIGWRITLNPMSLLASVLRDKYFPGKSFGEXPKGKNTSXGWKGLFEARKVLNLGLRWR  928

Query  3520  IGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RTWNVDKLSSLLPHD  3696
             +GNG S+N   D W   KP  F  +V   ++  E  VSD I  + + W  D +++    D
Sbjct  929   VGNGKSINIREDPWF-PKPATF--KVRPRNNLVETMVSDLIDSDTKIWRTDLIANGFHRD  985

Query  3697  IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS-------------HIAGN--DED  3831
              +  I   P++     +D L W  +  G +SV+S +S                GN  + +
Sbjct  986   DVSTILIIPLSHAGS-NDRLVWHYATNGIYSVKSGYSMALKLMDDXALGRKXXGNPSESN  1044

Query  3832  AMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHV  4005
              +   W  +W+++V  + R+F+W      L       R+ M  D +C  C   +ET NH+
Sbjct  1045  KLKMVWNNIWRLQVPHKIRIFIWRCCNNALAVRRNLKRRHMRVDNVCGVCXAVNETENHL  1104

Query  4006  LMECSFAKDCWRRTHHPVSFQYSLVTP---LKSWVKNNCCASDWINGCPWGVTFIYTCWE  4176
                C  +   W  +  P+     ++     L+SW        D I+       F +  W 
Sbjct  1105  FFRCEISHVFWFCS--PLHLNSHVLEGRDFLESWCNFCDQVKDRIDADDIXHDFAFGLWR  1162

Query  4177  IWKARNQRIFENTASAPMDIMRR--------ANNLTLDTVEVFLN-KKCVHVGKMRWVCW  4329
             +WK RN  +F+     P+DI+            +L  D  +  L   K + V       W
Sbjct  1163  LWKNRNDVVFKGIYRQPLDILEAWKKSTGEYKASLAPDXEDHSLRMPKXIXVSDRICTKW  1222

Query  4330  QPPETGWIKFNTDGAFKRNTGLASAGGLARDHKG  4431
             + P  G IK NTD A+ ++T     G L RD  G
Sbjct  1223  KRPRFGTIKINTDAAWCKDTLRMGVGWLGRDFAG  1256


 Score = 47.0 bits (110),  Expect(2) = 9e-134, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 1/72 (1%)
 Frame = +3

Query  732  MIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLFNV  911
            M  ++WNC+G+G  LTV +     R +    +  LETK  + + I  +   LG D  F V
Sbjct  1    MKIITWNCQGIGGDLTVDNLLEQNRLHTPDMVILLETKNKSXNFI-HLKRSLGMDHWFIV  59

Query  912  DPLGFAGGLTLF  947
            +P G  GG+ +F
Sbjct  60   EPRGIXGGICVF  71



>ref|XP_010671205.1| PREDICTED: uncharacterized protein LOC104888072 [Beta vulgaris 
subsp. vulgaris]
Length=1592

 Score =   464 bits (1194),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 363/1240 (29%), Positives = 576/1240 (46%), Gaps = 97/1240 (8%)
 Frame = +1

Query  979   IRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDI  1158
             I N    I G+++  +    +   Y   +   +   W++ L +  E   P ++ GDFN++
Sbjct  297   IPNHCTPIKGILTLINFECTLINVYNPCDIAERAEVWSELLEFQKENALPCLISGDFNEV  356

Query  1159  ADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALW  1338
                 E+ GS  ++     NF        LL++ +S   ++WFR        R  LDR   
Sbjct  357   LKANER-GSQLLSQMGRSNFNNFVQDSHLLEISSSSGGFTWFRGNS-----RSILDRLFV  410

Query  1339  NLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWG  1518
             + E  +  P  K  +L R  SDH PL              +PFRF+  WLT  D   I  
Sbjct  411   HPEWLSKLPTIKVDLLQRGLSDHCPLLV---HTKDQNWGPKPFRFQNCWLTDPDCLKIVK  467

Query  1519  RVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQ  1695
              VW  S  L     + EV     +WN+  FGNI  +   L+  I+ + E    N  R L+
Sbjct  468   NVWQESAALQTREKLKEVKKRLNEWNQNEFGNIDTKIKKLENEIQRLDE---INNFRDLE  524

Query  1696  VLE----RKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRML  1863
               E    +K  +EL   +K++EL W Q SR  W+++GDRNT F+H     +R ++ I  +
Sbjct  525   AQEVDNRKKAQSELWVWMKRKELYWAQNSRISWLKEGDRNTKFFHDIASNKRRKNSINSI  584

Query  1864  KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPN-DMYCGPKLDTGQMHKLTREVTMC  2040
              I+G+   D   I +    FF  +F  +   D  P+ D     ++   Q  +LT   +  
Sbjct  585   IIDGQPVDDPSCIKNEARAFFKGIFREE--YDIRPHFDNLNFKQVTEEQGSQLTLPFSRE  642

Query  2041  EVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITL  2220
             E+  AV       +PGPDG    F ++ W+ VK  I   V K     ++P     ++I L
Sbjct  643   EIDNAVASCDSDKAPGPDGFNFKFIKSAWDIVKHDIYEMVHKFWASSQLPQGCNVAYIAL  702

Query  2221  IPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNII  2400
             IPK D+P +  DFRPI+++   +KII+K++ +R++ IM +LIG  Q+S++ GR   D  +
Sbjct  703   IPKIDNPSSFKDFRPISMVGCLYKIIAKLMASRLQKIMSSLIGTLQSSYIEGRQILDGAL  762

Query  2401  LTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRE  2580
             +  EI+   + K GK+ ++  KLD HKAYDS+ W FL+  L    FP      IM  V  
Sbjct  763   VAGEIIDSYK-KNGKEAIL-FKLDFHKAYDSVSWGFLKWVLEQMNFPSKWREWIMSCVSS  820

Query  2581  SSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRG  2760
             +  S+L NG   APF+  RGLRQGDPL+P+LF+L  E L+  I +   +  W  + + + 
Sbjct  821   AYASILVNGSPSAPFKLQRGLRQGDPLSPFLFLLIGEVLNQVILKASNMGLWSGLEIRKD  880

Query  2761  GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIK  2940
             G  ++HL +A+D+++F+EA  +  + I   L  F   SGL +N  KS+I         ++
Sbjct  881   GLNITHLQYADDILIFSEAKMESLKNIKKALILFHLASGLQVNFHKSSIIGLNTPKIWLQ  940

Query  2941  RGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTL  3120
             +   +L      D   TYLG+PI       H +  I++ + +KLA WKG MLS+ GR TL
Sbjct  941   QAAADLQ-CKTGDIPFTYLGLPIGGDLSRIHAWDPIINKVSKKLATWKGRMLSIGGRLTL  999

Query  3121  VQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGG  3300
             ++S+LS++P+Y M +F +P G    I++I R FLW  + + + + LV W  +   K  GG
Sbjct  1000  IKSSLSNLPIYYMSIFPIPTGVIKKINKITRQFLWSGNMEKRSLSLVSWEIVQLPKTMGG  1059

Query  3301  LGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWG-WRSI  3477
             LG+   L  N A+L+K  W+L+     LW +V+ +KY  +     + ++   S G WR I
Sbjct  1060  LGIGSILHKNIAMLSKWFWRLLQDPTPLWSQVICDKYRYSSAPSISDIVIPKSGGPWRKI  1119

Query  3478  MRG-------RSIVELGAAWRIGNGLSLNFWSDWWTGDKPL----AFMDEVTIPDSQSEA  3624
                       + I+  G    IGNG    FW + W    PL      +  ++I  + + A
Sbjct  1120  CAAILHQADVKEIISKGIRKNIGNGSQTRFWHEPWLASSPLKREFPRLFSISIDPNVTVA  1179

Query  3625  KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATP--IAVC--EQVSDSLYWPRSPTGAFSV  3792
                 +   N  W      +L P D ++  R     + VC  ++  DS+ W  + +G FS 
Sbjct  1180  AQGFWEGMNWVWTFSWKRALRPQDCVEKKRLDEMLLQVCPSQKAHDSIIWVYNKSGIFST  1239

Query  3793  RSAFSHI----AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGM--TE  3954
             +S    +      + +DA+    +W+  V  R  +F+WL + G+L T  +    G+   E
Sbjct  1240  KSVTMELDKIRPPSHQDAVRG--IWRGLVPHRIEVFVWLALLGKLNTRCKLASLGIISVE  1297

Query  3955  DTLCATCGDGDETMNHVLMECSFAKDCWR--RTHHPVS--FQYSLVTPLKSWVKNNCCAS  4122
             ++LC  C    ET +H+L+ CSFA   W        VS  F  +L      W        
Sbjct  1298  NSLCPLCSQESETSDHLLLHCSFASQLWSWWLNMWQVSWCFPRTLREAFTQW--------  1349

Query  4123  DWINGCP-----WGVTFIYTCWEIWKARNQRIFENTASAPMD------------IMRRAN  4251
              W    P     W   F    W +WK RNQRIF ++ S+  D            I     
Sbjct  1350  QWPKKAPFFKKVWVTVFFIITWTLWKERNQRIFSDSNSSMKDLKDLVLLRLGWWISSWKE  1409

Query  4252  NLTLDTVEVFLNKKCVHVGKMRWVC----------------WQPPETGWIKFNTDGAFKR  4383
                   +++  N  C     ++W C                W PP +   K+N D +   
Sbjct  1410  EFPYSPMDITRNPAC-----LQWNCKTNLSWSDSTLKRVATWSPPPSHTFKWNVDASMHP  1464

Query  4384  NTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLR  4503
                 ++ GG+ R+H G ++  F + I      +AE+  + 
Sbjct  1465  IESRSAIGGVLRNHLGNFISLFSSPIPFMEINSAEILAIH  1504



>gb|AAF97969.1|AC000103_19 F21J9.30 [Arabidopsis thaliana]
Length=1270

 Score =   458 bits (1178),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 328/1116 (29%), Positives = 523/1116 (47%), Gaps = 82/1116 (7%)
 Frame = +1

Query  1030  NVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRC  1209
             N  VS  Y  P+R  + + W             W M GDFNDI  N E+ G    +   C
Sbjct  61    NFCVSCVYGDPDRSKRSQAWERISRIGVGRRDKWCMFGDFNDILHNGEKNGGPRRSDLDC  120

Query  1210  LNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILP  1389
               F E    C L++M   G  ++W  + G   +Q R LDRA  N E    FP +    L 
Sbjct  121   KAFNEMIKGCDLVEMPAHGNGFTWAGRRGDHWIQCR-LDRAFGNKEWFCFFPVSNQTFLD  179

Query  1390  RTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEV  1569
                SDH P+  L +  +        FRF+  +L +ED ++   R WS        ++++ 
Sbjct  180   FRGSDHRPV--LIKLMSSQDSYRGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVADR  237

Query  1570  TNLSKK----WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
                 +K    W K+   N   +   L+A ++  ++S+ +   + + VL++    +L +  
Sbjct  238   LRACRKSLSSWKKQNNLNSLDKINQLEAALEK-EQSLVWPIFQRVSVLKK----DLAKAY  292

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHI  1914
             ++EE  W QKSR+ W++ G+RN+ ++H +    R R RI  LK +NG   +      +  
Sbjct  293   REEEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKGEVA  352

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPG  2088
             + +F +LF   N       D + G  P++       L  EV+  E+K+AVF +K   +PG
Sbjct  353   AAYFGNLFKSSN--PSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAPG  410

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
             PDG+ A F+Q +W  V + +T+ VKK   DG +P +   + + LIPK   P    D RPI
Sbjct  411   PDGMSALFFQHYWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPI  470

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGK  2445
             +L +V +KIISK++  R++P +  ++   Q++F+  R   DNI++  E+VH +++  +  
Sbjct  471   SLCSVLYKIISKIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRIS  530

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
                MA+K D+ KAYD ++W +L S L+  GF    ++ IM  V   + S+L N       
Sbjct  531   SEFMAVKSDMSKAYDRVEWSYLRSLLLSLGFHLKWVNWIMVCVSSVTYSVLINDCPFGLI  590

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
                RGLRQGDPL+P+LF+L  E L+  + +       + I  S  G  V HL FA+D + 
Sbjct  591   ILQRGLRQGDPLSPFLFVLCTEGLTHLLNKAQWEGALEGIQFSENGPMVHHLLFADDSLF  650

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
               +AS +Q  ++   LK +   +G  IN++KS+I      + ++K  ++   GI      
Sbjct  651   LCKASREQSLVLQKILKVYGNATGQTINLNKSSITFGEKVDEQLKGTIRTCLGIFTEGGA  710

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
             GTYLG+P            Y+ D +K KL  W    LS  G+  L++S   +MPV+ M  
Sbjct  711   GTYLGLPECFSGSKVDMLHYLKDRLKEKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSC  770

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             FKLP  TC +++     F W     ++K+H   W  +C  KD+GGLG R    FN ALLA
Sbjct  771   FKLPITTCENLESAMASFWWDSCDHSRKIHWQSWERLCLPKDSGGLGFRDIQSFNQALLA  830

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             K AW+L+   D L  ++++ +Y    +F    +    S+GWRSI+ GR ++  G   R+G
Sbjct  831   KQAWRLLHFPDCLLSRLLKSRYFDATDFLDAALSQRPSFGWRSILFGRELLSKGLQKRVG  890

Query  3526  NGLSLNFWSDWWTGDKPL-AFMDEVTIPDSQSEAKVSDFILPNRT--WNVDKLSSL-LPH  3693
             +G SL  W D W  D    A   +  I D   + K    +L  RT  W+ + L  L LP 
Sbjct  891   DGASLFVWIDPWIDDNGFRAPWRKNLIYDVTLKVKA---LLNPRTGFWDEEVLHDLFLPE  947

Query  3694  DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF------------SHIAGNDEDAM  3837
             DI   +R   I      +D   W  + +G FSV+SA+            S ++       
Sbjct  948   DI---LRIKAIKPVISQADFFVWKLNKSGDFSVKSAYWLAYQTKSQNLRSEVSMQPSTLG  1004

Query  3838  DTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMEC  4017
               + VW ++   + ++F                        L   CG+  E+ NH L  C
Sbjct  1005  LKTQVWNLQTDPKIKIF------------------------LWKVCGELGESTNHTLFLC  1040

Query  4018  SFAKDCWRRTHHPVS----FQYSLVTPLKSWVKNNCCASDWINGCPWGVT----FIYTCW  4173
               ++  W  + +P         S+ + +   ++N        +   W +     F +  W
Sbjct  1041  PLSRQIWALSDYPFPPDGFSNGSIYSNINHLLENK-------DNKEWPINLRKIFPWILW  1093

Query  4174  EIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVF  4281
              IWK RN  IFE  +    D + +  +   D VE F
Sbjct  1094  RIWKNRNSFIFEGISYPATDTVIKIRD---DVVEWF  1126



>ref|XP_009124968.1| PREDICTED: uncharacterized protein LOC103850017 [Brassica rapa]
Length=1053

 Score =   452 bits (1164),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 281/891 (32%), Positives = 450/891 (51%), Gaps = 70/891 (8%)
 Frame = +1

Query  1696  VLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKING  1875
              L R++ T LNE  + EE  W Q+SR +W+Q GDRN+ F+H +T   +NR R     +  
Sbjct  22    TLIREINTALNEAYRAEEAFWKQRSRLLWLQLGDRNSGFFHAAT---KNRKRANAFTVLE  78

Query  1876  EWNSDF--------KTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREV  2031
             + + +         KT+ ++    F  + G     D +    Y    L T + +++   +
Sbjct  79    DTDGNMVYKEEDIAKTVVEYYKMMFTSVKG-----DCADTVRYALQPLITQEDNEVLIAI  133

Query  2032  -TMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILES  2208
              T  E+K+A+F +    +PGPDG  A+FYQ  W EV   +   +++  R G +P  I  +
Sbjct  134   PTAAEIKEALFAVNAEKAPGPDGFSASFYQAHWAEVGPDLVVEIQEAFRTGTIPKGINGT  193

Query  2209  FITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTA  2388
              + LIPK  +P+  SD+RPI L NV +KI SK++  R++P+++ +I   Q++F+PGR+  
Sbjct  194   HVCLIPKIKTPQRVSDYRPIALCNVYYKIYSKILQRRLQPLLEKIISENQSAFVPGRAIG  253

Query  2389  DNIILTQEIVHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIM  2565
             DNI++T E++H ++  K  K + +A+K D+ KAYD ++W+F+ + L   GF    I LIM
Sbjct  254   DNILITHEVLHTLKTSKAAKRVSLAVKTDMSKAYDRLEWDFISTVLERLGFHHLWIGLIM  313

Query  2566  FSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSW---DIQEKVRVKNW  2736
               +   + S L NG       P RG+RQGDPL+PY+FIL  E LS      Q + R++ +
Sbjct  314   QCISTVTYSFLINGSPRGKVTPSRGIRQGDPLSPYIFILCSEVLSGLCSKAQVEGRMRGF  373

Query  2737  KPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCS  2916
             K   ++RG   ++HL FA+D M F  A +     +   L ++   SG +IN  KS+I  S
Sbjct  374   K---VARGSPRINHLLFADDTMFFLNADKGSTEELKAILSRYEKASGQSINKEKSSITFS  430

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
                  E+K+ + +   I     +G YLG+P    R  +  F  I++ +K+K   W    L
Sbjct  431   RKAPRELKQRVHSELQIQNEGGVGKYLGLPEHFGRRKRDLFTSIIERIKQKAEGWSTRFL  490

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S AG+  ++QS L+ +P + M  FKLP   C  I+   + F W D    +K+  + W  +
Sbjct  491   SPAGKLVMLQSVLTPIPSHAMSCFKLPVSLCQRIETALKRFWWDDRTGKRKMAWISWPKL  550

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANA  3456
                K  GGLG+R    FN A LAK++W+L+     L  + +  KY  + NF A    ++A
Sbjct  551   TLPKSNGGLGVRDIQAFNEAYLAKISWRLLEKPHGLLGRTLLSKYCPDGNFLACSSPSSA  610

Query  3457  SWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTG-DKPLAFMDEVTIPDSQSEAKVS  3633
             S GW SI+ GR ++     W IG+G S+N W D W   D P+  M   T  ++ +   V 
Sbjct  611   SHGWHSILAGRDLLNKNLGWVIGDGNSINIWEDQWLSLDSPIRPMGPAT--ETSANLLVK  668

Query  3634  DFILPNR-TWNVDKLSSLLPHDIIDGIRATPIAVCEQVS-----DSLYWPRSPTGAFSVR  3795
             D ILP    W+  ++  +LP +           +C Q S     D L W  +  G +SV+
Sbjct  669   DLILPGSGEWDRARIQQILPFE-------EERILCLQTSKNGAPDVLRWLGTSLGQYSVK  721

Query  3796  SAF-------SHIAGNDEDAMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKG  3945
             S +       +      E  M+  W   VW +++  + ++F W  ++G +   +    + 
Sbjct  722   SGYLVAMAEMTEEILEGEAIMNFDWKKTVWNLKLAPKVKMFTWKSLKGIIPVGVRLQERH  781

Query  3946  MTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASD  4125
             +  D  C  CG   E++NH+L  C FA+D W  +     F  S +T L+          D
Sbjct  782   LNVDPKCKRCGI-SESVNHLLFHCQFARDVWNLSPLEGGFDISGLTDLR---------ED  831

Query  4126  WI------NGCPWGVTFI----YTCWEIWKARNQRIFENTASAPMDIMRRA  4248
             W          P G+TF     +  W +WK+RN+ +FEN A  P D + +A
Sbjct  832   WTTLQAQKTLPPTGITFTPLVPWIMWSLWKSRNKFVFENFAGNPADTLSQA  882



>gb|ABA98898.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1188

 Score =   456 bits (1172),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 316/1175 (27%), Positives = 545/1175 (46%), Gaps = 145/1175 (12%)
 Frame = +1

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             N PW+++GDFN+     E +     N ++  +F +    C L  +G SGV Y++  +  G
Sbjct  13    NLPWLVLGDFNEALWQFEHFSVRQRNETQMQSFRDVLQTCDLHALGFSGVPYTYDNRREG  72

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             R   R +LDRAL + + + +F  A+   L  T SDH P+       +      +   +E 
Sbjct  73    RNNIRVRLDRALADNDWREMFGNARVSHLTSTRSDHCPISVCFSPEDCRPFHTKCLHYEI  132

Query  1480  AWLTREDYRDIWGRVWS-----NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
              W      +++    WS     + L ++  A+  V      W+K    N+       + R
Sbjct  133   CWEREPSLQEVITDAWSEGVSKSDLGEISTALHRVMTRLHSWSKVKVKNVGKELEKARKR  192

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +  +        S     L R+ +  LNE+L +EE+LW Q+SR  W+++GDRNT F+H  
Sbjct  193   LTSLL------VSDAESSLVRQALDHLNELLYREEMLWLQRSRINWLKEGDRNTRFFHSK  246

Query  1825  TLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
              + R  +++I  L+  +G  +     +    +++F  LF                P LD 
Sbjct  247   GVWRAKKNKISALRDASGTVHHLTNVMEQMATDYFKTLFS-------------ADPNLDH  293

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
              ++  L +E            +    +PGPDG  A F+Q  W  +K  +   VK+    G
Sbjct  294   SRVTTLIQE-----------KIGPLKAPGPDGFPARFFQRNWGLLKEEVVKAVKEFFNTG  342

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P  + E+ I LIPK D P    D+RPI+L NV +K++SK +VNR+RPI+  LI P Q+
Sbjct  343   VMPAGVNETAIVLIPKVDQPIELRDYRPISLCNVLYKVVSKCLVNRLRPILDELISPNQS  402

Query  2362  SFLPGRSTADNIILTQEIVHYMRL-KKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+PGR   DN ++  E  H ++  KK      A KLDL KAYD +DW+FLE ++   GF
Sbjct  403   AFVPGRMITDNALIAFECFHSIQKNKKLSSATCAYKLDLSKAYDRVDWKFLEQSMYKLGF  462

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
                 ++ IM  +     S+ +NG  L+ F P RGLRQGDPL+P+LF+  ++ LS  ++E+
Sbjct  463   AHCWVNWIMSCITSVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFVVDGLSLLLEER  522

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
             V      P+ + R   G+S+L F +D +LF +A+ +Q  ++MN L  ++  +G  IN  K
Sbjct  523   VAQGALSPVHICRRAPGISNLLFTDDTLLFFKATSEQANVVMNVLADYAWCTGQLINQEK  582

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
              +I     +  +++  ++++  +  +     YLG P    R++K  F  + + + +++  
Sbjct  583   CSIMFGEASPPDVQESVRSVLQVGSTSFDDKYLGFPTPEGRMNKGKFQSLQEKLCKRIMQ  642

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W  N LS  G+  L+++ L ++ VY M +FKLP   C+++ ++ R+F WG     +K H 
Sbjct  643   WGENFLSSGGKEILIKAVLQAITVYVMGIFKLPDSICDELTKLTRNFWWGSEKGKRKAHW  702

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
               W+ I K K  GGLG R    FN ALLA+ AW+L+ +   L +K+ R+ ++  ++F   
Sbjct  703   KSWDCITKPKHCGGLGFRDFRLFNQALLARQAWRLIENPHSLSIKIWRDPWLP-RDFSRR  761

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQS  3618
             P+    +   +                             W  D     +D+        
Sbjct  762   PITPKGNCRLK-----------------------------WVAD----LLDQ--------  780

Query  3619  EAKVSDFILPNRTWNVDKLSSL---LPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFS  3789
                       N +W+ D +S L   L  +II  IR +      Q  D + W     G FS
Sbjct  781   ----------NGSWDRDVISQLFWPLDGEIIKSIRLSS----RQDEDFIAWYPDKMGQFS  826

Query  3790  VRSAF------------SHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMER  3933
             +RSA+            S  +GND   +  + VWK  + ++ ++F W  +   L T + +
Sbjct  827   IRSAYMLAVQLANAGESSSSSGNDTKKV-WNHVWKCNIPQKVKVFSWRAISNCLPTMVNK  885

Query  3934  WRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNC  4113
              ++      +C+ CG   E + H L  C  A+  W      +  Q  L    +       
Sbjct  886   KKRNPELSDVCSFCGLEPEDVAHALWRCPHARRYWDLMSSEMQVQRILYGSGE-------  938

Query  4114  CASDWINGCPWGVT------FIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVE  4275
               SDWI      ++      F+ + W IW  RN+ I  + A+ P+++ +R     +++++
Sbjct  939   -GSDWILDFLESISEDDRPVFLMSLWRIWYTRNE-ITHDKAAPPVEVSKRFVRSYVNSLK  996

Query  4276  VFLNKKCVHVGKMRWVC---------------WQPPETGWIKFNTDGAFKRNTGLASAGG  4410
                 +   ++G  + V                W+ P +GW+K N DG+++ +  +     
Sbjct  997   EIKARPNANLGSGKHVIGEDRPKCKKQSVLAKWEKPPSGWMKLNVDGSYQEDN-IGEISA  1055

Query  4411  LARDHKGEWLF---GFMTNIGVSNSFAAELWGLRE  4506
             + R+  G+ +F   GF+      ++  AE+   +E
Sbjct  1056  ILRNSTGDVIFAACGFVEQ--CQSALEAEILACKE  1088



>ref|XP_009121338.1| PREDICTED: uncharacterized protein LOC103846184 [Brassica rapa]
Length=1285

 Score =   457 bits (1177),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 326/1115 (29%), Positives = 528/1115 (47%), Gaps = 81/1115 (7%)
 Frame = +1

Query  1000  IHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQW  1179
             I  +++      +++F Y  P+   +   WN+  +       PW + GDFN+I +N E+ 
Sbjct  55    IDTIITQKGVTFQITFVYGEPDHTKRLEVWNEISTLKPASGQPWFLTGDFNEITENSEKK  114

Query  1180  GSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNL  1359
             G           F    S   L D+   G   SW  +     VQ R LDRA+ N     +
Sbjct  115   GGPERAEGTFCAFRSFLSENDLFDIKHYGNYLSWRGKRNTHMVQCR-LDRAISNSNWMEV  173

Query  1360  FPEAKAIILPRTHSDHHPL-KFLCEAgnpprrenrpfrfegAWL-TREDYRDIWGRVWSN  1533
             FP  ++  L    SDH PL  FL        +  R  R     +  ++  R++W    S 
Sbjct  174   FPSCRSQYLKYEASDHRPLLTFLDTGRKKGLKIFRFDRRLKDHIEVKQIIREVWE---ST  230

Query  1534  SLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKL  1713
             + LDV G ++       +W+KE   N   RK     RI+        + +    V +  L
Sbjct  231   THLDVGGRLACCRRAICEWSKEFQAN--SRKMIETLRIQ-------LDDAMSNHVPDDDL  281

Query  1714  VTELNEVL----KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKING--  1875
             + ++N  L    KQEE  W Q+SR++W+  GD NT+++H +T  R++++R+ +++ +   
Sbjct  282   IHQINMQLLTAYKQEEEYWKQRSRQLWLALGDSNTSYFHATTKARKSKNRMTVIENDAGV  341

Query  1876  EWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKA  2055
              W  + + I++ I  ++ +LF      D    +    P + +     L ++ +  E+++A
Sbjct  342   PWFEE-EQIANVICKYYANLFKANQTTDLHIVEEALRPCVSSQINEALIQDPSAAEIREA  400

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
              F +    +PGPDG  A+F+Q  WE V   +   V+     G + P    + + LIPK  
Sbjct  401   TFAIHPDKAPGPDGFSASFFQANWEVVGPAVIKEVQLFFTTGVLRPAQNVTHVRLIPKTV  460

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
               +  +D+RPI L NV FKIISK++  R++ ++  +I   Q++F+PGR+ ADNI++T E+
Sbjct  461   GAKKVADYRPIALCNVFFKIISKLLALRLKTVLHLIISENQSAFIPGRAIADNILITHEV  520

Query  2416  VHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
             + ++++ +  K+  MA+K D+ K YD I+W F+E  L   GF      LIM  V   S S
Sbjct  521   LQFLKISQAQKRCTMAVKTDMSKTYDRIEWGFIEKVLQRLGFHSKWSQLIMQCVSTVSYS  580

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGV  2772
              L N        P RG+RQGDPL+PYLFIL  + LS   Q+  +    + I ++RG   V
Sbjct  581   YLINDSVHGSVTPQRGIRQGDPLSPYLFILCGQVLSGLCQKAEKEGTLQGIRVARGSPRV  640

Query  2773  SHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLK  2952
             +HL FA+D +                      +S   IN  KS+I  S  T  + KR +K
Sbjct  641   NHLLFADDTI----------------------RSTEKINSEKSSITFSSRTPEDTKRSVK  678

Query  2953  NLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSA  3132
                GI      G YLG+P    R  K  F  ++D ++++ +++    LS AG+ T++++ 
Sbjct  679   EALGIVKEGGQGKYLGLPEHFGRRKKDLFTTLVDRIRQRASSYSTRHLSKAGKLTMLKAV  738

Query  3133  LSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLR  3312
             L+++P +TM  F+LP   C  I  +   F W  S   KK+  V W+ +   K  GGLGLR
Sbjct  739   LTAIPTFTMSCFELPVSLCKRIQSVLTRFWWDSSDGVKKMCWVAWDRLTMPKAGGGLGLR  798

Query  3313  KCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRS  3492
                 FN ALLAK AW+++T+ + L  +V+  KY  NK+F    + A  S GWRSI+ GR 
Sbjct  799   DIQLFNQALLAKQAWRILTNPNCLLARVLLGKYCHNKSFMEVSVPAVCSHGWRSILHGRE  858

Query  3493  IVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIP-----DSQSEAKVSDFILPNRT  3657
             ++       +GNGLS   W D W        +D+ T P     +S  +  VSD +  +  
Sbjct  859   LLRDNVGKALGNGLSTKVWKDSWIS------LDKNTKPYGPIQESALDLTVSDLLTSDMK  912

Query  3658  WNVDKLSSLLPHDIIDGIRATPIAVCE----QVSDSLYWPRSPTGAFSVRSAFSHIAGND  3825
             WN  K+ +LLP      + A  I +         D   W    +G ++ +S +   A   
Sbjct  913   WNKSKVEALLP------LMAKEIQLLNPGHPTTEDIHVWQPLHSGKYTTKSGYYTAAMRT  966

Query  3826  EDAMDTS-----W---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGD  3981
             +   + S     W   +W  + + + +LF+W +++  +       R+G+  + LC  C  
Sbjct  967   QRIQEHSAYAFDWIKDIWNAKCSPKVQLFMWSIIQEAIPLGENLRRRGIQSEALCIRC-K  1025

Query  3982  GDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVT--  4155
             G E+  H+   C FA+  W+    P+     L T    + K        I   P GV+  
Sbjct  1026  GTESAMHIFFNCPFAQKVWKLI--PLRQVVHLATE-TDFKKAVIACRRLICLPPTGVSTT  1082

Query  4156  -FIYTCWEIWKARNQRIFENTASAPMDIMRRANNL  4257
                + CW +W ARN  +FE     P +I  +A  L
Sbjct  1083  ILPWMCWVLWTARNTLLFEKRTLTPEEIATKAVRL  1117



>ref|XP_009126341.1| PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]
Length=1160

 Score =   454 bits (1169),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 299/969 (31%), Positives = 483/969 (50%), Gaps = 33/969 (3%)
 Frame = +1

Query  1237  CGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHP-  1413
             CG++++ +SG  ++W  + G   +Q R LDRA  N +  + FP +    L +  SDH P 
Sbjct  5     CGMIELPSSGNPFTWSGKRGNLWIQSR-LDRAFGNQKWFDQFPASNQAFLDKRGSDHRPV  63

Query  1414  -LKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKW  1590
              +K +    +         RF    L  E     W     NS +++   I        +W
Sbjct  64    LIKLISSQDSYRGSFKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRW  123

Query  1591  NKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKS  1770
              K+   N   R   +Q  ++  Q S+  +  R ++ L + LV    +  K+EE  W QK 
Sbjct  124   KKKNVSNSKLRITKIQVELEQEQSSMNPSFPR-MENLTKSLV----KAYKEEENFWKQKC  178

Query  1771  RRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRK  1947
             +  WI  G  NT  +H +  + R+R+ I  L+  NG +     +      N+F DLF   
Sbjct  179   KDDWILYGGGNTKNFHAAVQVARSRNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKST  238

Query  1948  NIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFW  2127
             N +D S        ++       LTR++T  EVK+AVF +K   +PG DG+   F+Q +W
Sbjct  239   NSVDYSDLLRDLPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298

Query  2128  EEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKV  2307
             E V   +T  V      G +P     + I LIPKK +    SD RPI+L  V +K ISK+
Sbjct  299   EIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTISKI  358

Query  2308  IVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKA  2484
             + +R++  +  ++ P Q++F+  R  +DNIIL  E VH +R  +   K  MA K D+ KA
Sbjct  359   LASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDMSKA  418

Query  2485  YDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLA  2664
             +D ++W ++++ L+  GF    +  IM  V   + S+L NG+      P RGLRQGDP++
Sbjct  419   FDRVEWHYIQALLLSLGFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPIS  478

Query  2665  PYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIM  2844
             P+LF+L  E L+  + +     + K I  +  G  V HLFFA+D +   +A   Q ++  
Sbjct  479   PFLFVLCTEGLTHMMNQASLRGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQ  538

Query  2845  NCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRV  3024
             + L K+   +G  IN+SKS++    NT   +K  +K+  GI      G+YLG+P      
Sbjct  539   DILLKYGEATGQVINLSKSSLTFGKNTCPSLKAQIKSKLGICSEGGAGSYLGLPECFSGS  598

Query  3025  SKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDR  3204
                   YI D MK +++ W    LS AG+  +++S   +MP+Y M  FKLP  TCN++  
Sbjct  599   KVEMLAYIQDKMKGRMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKS  658

Query  3205  ICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKL  3384
                 F W  S    K+H + W+ +C SK+ GG+G +    FN ALLAK AW+++T+ D L
Sbjct  659   AMAAFWWQASEDKSKIHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSL  718

Query  3385  WVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWT  3564
               + ++ +Y  N +F +  + +  S+ WRSI+ GR ++E G    +GNGLS++ WS  W 
Sbjct  719   LTRFLQSRYFSNGSFLSATLGSRPSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWL  778

Query  3565  GDKP---LAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLLPHDIIDGIRATPIAV  3732
              D     +  M  + +       KVSD ++PN   W+  KL +L     I+ I     AV
Sbjct  779   IDGERLRIPLMKNILV---DLNLKVSDLMIPNSDLWDHQKLENLFYDQDIEIILKIKPAV  835

Query  3733  CEQVSDSLYWPRSPTGAFSVRSAF----------SHIAGNDEDAMD--TSWVWKMRVTER  3876
                  D L W  + +G +SV+S +          ++++     +++   S +W +    +
Sbjct  836   SS--PDFLCWNHTRSGEYSVKSGYWFAEKEAKKEAYVSSQALPSLNGIKSHIWSLNTAPK  893

Query  3877  CrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHP  4056
              ++FLW ++ G +        +GM  D+ C  CG   E+MNHVL  C+ A+   R+  + 
Sbjct  894   IKVFLWKVIGGAISVADHLIERGMKVDSRCQICGLEGESMNHVLFNCTIARH--RKNRNS  951

Query  4057  VSFQYSLVT  4083
               F+ SL+ 
Sbjct  952   FLFKGSLIV  960



>ref|XP_010513001.1| PREDICTED: uncharacterized protein LOC104788939 [Camelina sativa]
Length=1583

 Score =   463 bits (1191),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 300/968 (31%), Positives = 478/968 (49%), Gaps = 30/968 (3%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              F+    F  +V+  +++ I          + ++F Y  P    ++  W   L  S+  +
Sbjct  360   LFYNQDDFQVSVLFESNRLIDIEAVFKGRIIHLTFVYGDPVPNKRDLVWERILRISANRS  419

Query  1123  APWIMMGDFNDIADNQEQWGSSSV-NPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
              PW ++GDFN++  N E+ G   + +PS  L F      CG LD    G   SW      
Sbjct  420   TPWFLVGDFNELTGNHEKRGGGKLRHPSSFLAFNGMIRDCGFLDFPFIGDCLSWRGWRDK  479

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             + + R +LDRAL N +  +LFP+     LP   SDH PL  + + G    R NR F F+ 
Sbjct  480   KPI-RCRLDRALGNEDWHDLFPDTVTEYLPMIASDHKPL--VVKIGAKRPRGNRSFMFDR  536

Query  1480  AWLTREDYRDIWGRVWSNSLLDVVGAIS-EVTNLSK---KWNKETFGNIFGRKA----SL  1635
              W+ +    D     W   L  V    + ++ N  K   +W K      +GR+       
Sbjct  537   RWIGKTGLMDAIASGWDGGLDQVSDTFTYKIVNCRKTISQWRKSQVP--YGRETIDDLKR  594

Query  1636  QARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFY  1815
             Q  +    +S+   T   LQ       + L +    EE+ W+QKSR  W++ GD+N+ ++
Sbjct  595   QLEVALADDSIPPATISDLQ-------SRLRQAYGDEEIYWYQKSRSKWMRLGDKNSKYF  647

Query  1816  HKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPK  1992
             H  T  RR R+RI  +   +  W+++   I +   ++F DLF   N  +           
Sbjct  648   HALTKQRRARNRINGLFNKDDIWSTEDVGICNTAVSYFEDLFTSTNPTNFEEVLREVQTV  707

Query  1993  LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVL  2172
             +      +LTR  T  EVK A+F M    +PG DG+ A F+Q  W  VK+ +   V + L
Sbjct  708   ITAEDNERLTRPATEAEVKSALFMMHPDKAPGSDGMTALFFQKAWGIVKTDLVDLVNRFL  767

Query  2173  RDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGP  2352
              +G     +  + I LIPK   P   ++ RPI+L NV +KIISKV+  R++ ++  LI  
Sbjct  768   VEGVFDKGLNRTHICLIPKVAKPTRMAELRPISLCNVGYKIISKVLCQRLKGVLPGLISE  827

Query  2353  FQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVD  2529
              Q++F+PGR  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++W+F+ + L  
Sbjct  828   TQSAFVPGRLISDNILIAQEMFHDLRTNPSCKGKFMAIKTDMSKAYDRVEWDFVAALLQK  887

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              GF ++ +S IM  +      +L NG+      P RGLRQGDPL+PYLFIL  E L  +I
Sbjct  888   MGFAESWVSWIMVCITSVEYRVLINGQPNGLIVPERGLRQGDPLSPYLFILCTEVLIANI  947

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
             ++  R K    I ++     ++HL FA+D + F +A   Q ++I++ LKK+   SG  IN
Sbjct  948   RKAERDKLITGIKVANKCPPITHLLFADDSLFFCKADRGQCQVILDILKKYESVSGQQIN  1007

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
              SKS++      + + K  L+ + GI     +G+YLG+P          F +  + ++ +
Sbjct  1008  FSKSSVQFGHKIDDQTKTELQGVLGIMTLGGMGSYLGLPESLGGAKTKVFSFARERIQSR  1067

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
                W  N+LS  GR  +++S  +++P + M  F+LP    + +     +F W  + Q+  
Sbjct  1068  TNGWTANLLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTNGQSGG  1127

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNF  3429
             +H + W  +C SK  GGLG R   DFN+ALLAK  W+L+ + + L+ +V + +Y +N N 
Sbjct  1128  MHWLAWEKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPESLFARVFKSRYYRNTNP  1187

Query  3430  FATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPD  3609
                    + S+GWRSI   RS+V  G   R+G+G +++ WSD W    P  F        
Sbjct  1188  LDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWV---PAQFPRPAVSKG  1244

Query  3610  SQSEAKVSDFILPNR---TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTG  3780
                +  +    L +R   TW +D L+       +  IRA P+    Q  D   W  + TG
Sbjct  1245  PLKDHYLQMNHLIDRQTNTWRMDMLNEHFDPLDVALIRAIPLG-GNQKDDPFGWHFTKTG  1303

Query  3781  AFSVRSAF  3804
              ++V+S +
Sbjct  1304  KYTVKSGY  1311


 Score =   110 bits (276),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 100/346 (29%), Positives = 152/346 (44%), Gaps = 32/346 (9%)
 Frame = +1

Query  1237  CGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPL  1416
             CG LD    G   SW      + + R +LDRAL N +  +LFP+     LP   SDH PL
Sbjct  5     CGFLDFPFIGDCLSWRGWRDKKPI-RCRLDRALGNEDWHDLFPDTVTEYLPMIASDHKPL  63

Query  1417  KFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAIS-EVTNLSK---  1584
               + + G    R NR F F+  W+ +    D     W   L  V    + ++ N  K   
Sbjct  64    --VVKIGAKRPRGNRSFMFDRRWIGKTGLMDAIASGWDGGLDQVSDTFTYKIVNCRKTIS  121

Query  1585  KWNKETFGNIFGRKA----SLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
             +W K      +GR+       Q  +    +S+   T   LQ       + L +    EE+
Sbjct  122   QWRKSQVP--YGRETIDDLKRQLEVALADDSIPPATISDLQ-------SRLRQAYGDEEI  172

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFI  1929
              W+QKSR  W++ GD+N+ ++H  T  RR R+RI  +   +  W+++   I +   ++F 
Sbjct  173   YWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRINGLFNKDDIWSTEDVGICNTAVSYFE  232

Query  1930  DLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAA  2109
             DLF   N  +           +      +LTR  T  EVK A+F M    +PG DG+ A 
Sbjct  233   DLFTSTNPTNFEEVLREVQTVITAEDNERLTRPATEVEVKSALFMMHPDKAPGSDGMTAL  292

Query  2110  FYQTFWEEVKSHITTFVKKVLRDG-----------RVPPKILESFI  2214
             F+Q  W  VK+ +   V + L +G           + P  ILE F+
Sbjct  293   FFQKAWGIVKTDLVDLVNRFLVEGVFDKGXFLMETKQPSPILEKFV  338



>gb|AAD29058.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1229

 Score =   456 bits (1172),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 309/1016 (30%), Positives = 491/1016 (48%), Gaps = 35/1016 (3%)
 Frame = +1

Query  1150  NDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRT--VQRRKL  1323
             N+I DN E+ G    +    ++F    S  GL D+  SG  +SW    G R     R++L
Sbjct  36    NEILDNSEKRGGPPRDQGSFIDFRSFISKNGLWDLKYSGNPFSW---RGMRYDWFVRQRL  92

Query  1324  DRALWNLEAQNLFPEAKAIILPRTHSDHHPLK-FLCEAgnpprrenrpfrfegAW-LTRE  1497
             DRA+ N      FP  ++  L    SDH PL  F+ EA    R + R         +   
Sbjct  93    DRAMSNNSWLESFPSGRSEYLRFEGSDHRPLVVFVDEARVKRRGQFRFDNRLRDNDVVNA  152

Query  1498  DYRDIWGRVWSNSLLDVVGAIS-EVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFY  1674
               ++ W      S+L  +     E+ N ++  N             ++   K ++E++  
Sbjct  153   LIQETWTNAGDASVLTKMNQCRREIINWTRLQN-------LNSAELIEKTQKALEEALTA  205

Query  1675  NTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI  1854
             +      +    L   L    K EE  W Q+SR +W+  GDRNT ++H  T  RR ++R+
Sbjct  206   DPPNPTTI--GALTATLEHAYKLEEQFWKQRSRVLWLHSGDRNTGYFHAVTRNRRTQNRL  263

Query  1855  RMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREV  2031
              +++ ING    +   IS  IS +F  +F  ++  D S  D    P +  G    LTR  
Sbjct  264   TVMEDINGVAQHEEHQISQIISGYFQQIFTSESDGDFSVVDEAIEPMVSQGDNDFLTRIP  323

Query  2032  TMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESF  2211
                EVK AVF +    +PGPDG  A FY ++W  + + +   ++        P ++ E+ 
Sbjct  324   NDEEVKDAVFSINASKAPGPDGFTAGFYHSYWHIISTDVGREIRLFFTSKNFPRRMNETH  383

Query  2212  ITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTAD  2391
             I LIPK   P   +D+RPI L N+ +KI++K++  RM+ I+  LI   Q++F+PGR  +D
Sbjct  384   IRLIPKDLGPRKVADYRPIALCNIFYKIVAKIMTKRMQLILPKLISENQSAFVPGRVISD  443

Query  2392  NIILTQEIVHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMF  2568
             N+++T E++H++R    KK   MA+K D+ KAYD ++W+FL+  L  FGF    I  ++ 
Sbjct  444   NVLITHEVLHFLRTSSAKKHCSMAVKTDMSKAYDRVEWDFLKKVLQRFGFHSIWIDWVLE  503

Query  2569  SVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPIT  2748
              V   S S L NG       P RGLRQGDPL+P LFIL  E LS       R++    + 
Sbjct  504   CVTSVSYSFLINGTPQGKVVPTRGLRQGDPLSPCLFILCTEVLSGLCTRAQRLRQLPGVR  563

Query  2749  LSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTN  2928
             +S  G  V+HL FA+D M F+++  +    +   L ++   SG +IN  KS++  S  T 
Sbjct  564   VSINGPRVNHLLFADDTMFFSKSDPESCNKLSEILSRYGKASGQSINFHKSSVTFSSKTP  623

Query  2929  SEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAG  3108
               +K  +K +  I      G YLG+P    R  +  FG I+D +++K  +W    LS AG
Sbjct  624   RSVKGQVKRILKIRKEGGTGKYLGLPEHFGRRKRDIFGAIIDKIRQKSHSWASRFLSQAG  683

Query  3109  RRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSK  3288
             ++ ++++ L+SMP+Y+M  FKLP+  C  I  +   F W      +K   V W+ +   K
Sbjct  684   KQVMLKAVLASMPLYSMSCFKLPSALCRKIQSLLTRFWWDTKPDVRKTSWVAWSKLTNPK  743

Query  3289  DAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGW  3468
             +AGGLG R     N++LLAKL W+L+ S + L  +++  KY  + +F    + +  S GW
Sbjct  744   NAGGLGFRDIERCNDSLLAKLGWRLLNSPESLLSRILLGKYCHSSSFMECKLPSQPSHGW  803

Query  3469  RSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQSEAKVSDFIL  3645
             RSI+ GR I++ G  W I NG  ++ W+D W +  KPL  +          + +VS  I 
Sbjct  804   RSIIAGREILKEGLGWLITNGEKVSIWNDPWLSISKPLVPIGPAL--REHQDLRVSALIN  861

Query  3646  PNR-TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF--SHIA  3816
              N   W+ +K++ +LP +  + I+  P      V D L W    +G ++ RS +  + +A
Sbjct  862   QNTLQWDWNKIAVILP-NYENLIKQLPAPSSRGV-DKLAWLPVKSGQYTSRSGYGIASVA  919

Query  3817  GNDEDAMDTSW---VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGD  3987
                      +W   +WK++   + +  +W      L   ++  R+ ++    C  CG   
Sbjct  920   SIPIPQTQFNWQSNLWKLQTLPKIKHLMWKAAMEALPVGIQLVRRHISPSAACHRCG-AP  978

Query  3988  ETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVT  4155
             E+  H+   C FA   W         Q + V P  S +         I   P GVT
Sbjct  979   ESTTHLFFHCEFAAQVWEL----APLQETTVPPGSSMLDALSLLKKAIILPPTGVT  1030



>ref|XP_009102778.1| PREDICTED: uncharacterized protein LOC103828890 [Brassica rapa]
Length=1302

 Score =   457 bits (1176),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 318/1086 (29%), Positives = 514/1086 (47%), Gaps = 92/1086 (8%)
 Frame = +1

Query  1075  KERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDM  1254
             ++  W     +S+  N PW M+GDFN+I  + E+ G      S  L F +    CG+L+ 
Sbjct  122   RDEVWERLTRFSTTRNGPWFMIGDFNEIICHNEKEGGRRRPDSSFLPFKQMLHDCGMLEF  181

Query  1255  GTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEA  1434
               +G   SW  +  G +  R +LDRA+ N +    FP +    +    SDH P+  L + 
Sbjct  182   PFTGDMLSWVGKRAGGSTVRCRLDRAVGNADWHEKFPHSAVKYMRLWGSDHRPI--LADI  239

Query  1435  gnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK----WNKET  1602
                P R ++ F+F+  WL  E+ R +    W +  L     I E  +  +K    W K+ 
Sbjct  240   LIKPMRRSKKFKFDKRWLDNEELRQVILEGWKSPDLPPNATIMEHISSCRKALSEWRKQH  299

Query  1603  FGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMW  1782
               N       L+ +++G+       T      L+     EL++ LK EE+ W QKSR  W
Sbjct  300   NVNSAKLVEELKEKVEGLYADDNATTEEIAAALK-----ELSDALKAEEMFWKQKSRVFW  354

Query  1783  IQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMD  1959
             +++GDRNT F+H  T  RR R++I ++L  NG    D + +    +++F  +F   N  D
Sbjct  355   LREGDRNTKFFHALTKQRRARNKITQLLDENGNIVEDEEGLVAIATSYFRQIFESSNPED  414

Query  1960  GSPNDMYCGPKLDTGQMH-KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEV  2136
                  +   P   TG M+  L   VT  EVK A+F M    +PGPDG+ A FYQ FW+ V
Sbjct  415   IE-EALAQVPSTITGAMNDNLIAPVTEWEVKLALFAMHPEKAPGPDGMTALFYQKFWDIV  473

Query  2137  KSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVN  2316
             K  +T  V + L +G +   + ++ I LIPK   P   + FRPI+L NVS+KIISKV+  
Sbjct  474   KEDLTLMVNQFLFEGTMASGLNDTNICLIPKITKPNAMAQFRPISLCNVSYKIISKVLCQ  533

Query  2317  RMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDS  2493
             R++ ++  LI   Q++F+ GR  +DNI++ QE+ H +R K  G+   MAIK D+ KAYD 
Sbjct  534   RLKKVLPGLISETQSAFVAGRQISDNIMIAQEMFHALRTKPSGRNKRMAIKTDMRKAYDR  593

Query  2494  IDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYL  2673
             ++W F+E+ +   GF +  I+ IM  +      +L NGE      PGRGLRQGDPL+P++
Sbjct  594   MEWSFIEAVMRKMGFSEIWIAWIMRCISSVKYKVLMNGEPRGNIVPGRGLRQGDPLSPFI  653

Query  2674  FILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCL  2853
             FIL  E L+                     + ++H             +E QG++     
Sbjct  654   FILCTEALA---------------------SLLNH-------------AESQGKI-----  674

Query  2854  KKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKH  3033
                   +G+ +  +     C     +  ++ +K++ GI     +GTYLGIP         
Sbjct  675   ------TGMRVTRA-----CPSRITATSRQEIKDVLGIQNEGGMGTYLGIPEDISGSKCK  723

Query  3034  TFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICR  3213
              F ++ D +  ++  W G  LS  G+  L++S L ++P Y M  F LP   C ++     
Sbjct  724   LFAFLKDKLMHRVNGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIA  783

Query  3214  DFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVK  3393
              F W  +   + +H   W  +C  ++ GG+G R   +FN ALLAK  W+LV   D L  +
Sbjct  784   KFWWSSNPPKRGIHSAKWEKVCLPREEGGMGFRMIHEFNLALLAKQLWRLVQFPDSLVAR  843

Query  3394  VMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDK  3573
             V+R +Y K  +       +N S+ W SI   R ++  G   +I +G  +  W D W    
Sbjct  844   VLRGRYYKMSSPLRVISASNPSYVWSSISAARKLLLTGIRQKIHSGYEVKVWEDPWIPTI  903

Query  3574  PLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSD  3750
             P      +  P      +VSDFI P  + W+V  L S +  + I  IR+   +   +  D
Sbjct  904   PARPALPIA-PVMHPNMRVSDFIDPETKEWDVGLLESYVNPEDIPLIRSLATSSAHR-RD  961

Query  3751  SLYWPRSPTGAFSVRSAF-----SHIAGNDEDAMDTS------WVWKMRVTERCrlflwl  3897
             +  W  +  G ++V+S +       +   +++ ++ S      + WK++   +    +W 
Sbjct  962   TFCWNYTRNGQYTVKSGYWVAQNVLMTEGEKEVLEPSITKLQAFAWKIKAPSKICHLIWQ  1021

Query  3898  lmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSL  4077
             L+ G +       R+ M  D  C   G+ +E++ H + EC  A   W  +  P S     
Sbjct  1022  LLTGYVAVTRNLARRNMRCDNYCPRYGELEESVTHAIFECPPALQVWSLSSTPSSPGLFP  1081

Query  4078  VTPLKS------WVKNNCCASDW-INGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDI  4236
             V  + +      W KN+    +   +  PW +      W IWKARN+++F      P+++
Sbjct  1082  VPSIYANMDYLFWRKNSIIEPEQDRDPYPWII------WYIWKARNEKLFRGIDRDPLEL  1135

Query  4237  MRRANN  4254
             +R A +
Sbjct  1136  VRHAES  1141



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score =   449 bits (1156),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 286/893 (32%), Positives = 458/893 (51%), Gaps = 51/893 (6%)
 Frame = +1

Query  1870  NGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMY--CGPKLDTGQMHKLTREVTMCE  2043
              G W  D + +   + ++F  LF       GS  ++      ++     + L  +    E
Sbjct  20    TGRWREDEQGLQSVVLDYFTHLFTSS--ASGSEGEIIDAVESRVTPDMNNLLLTDYCDAE  77

Query  2044  VKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLI  2223
             + +AVF M    +PGPDG+   F+Q +W  V S +T  +K  L  GR+  KI  + + LI
Sbjct  78    IHEAVFQMYPTKAPGPDGMPPIFFQKYWHIVGSDVTRAIKDFLTSGRLLQKINFTHVVLI  137

Query  2224  PKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIIL  2403
             PK   P+  S  RPI+L NV FKI +KV+ NR++ I+  +I P Q++ + GR  +DN IL
Sbjct  138   PKVKHPKDMSQLRPISLCNVLFKIATKVLANRLKLILDKIISPSQSALISGRLISDNTIL  197

Query  2404  TQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRE  2580
               EI+HY+R ++  K   MA+K+D+ KAYD I+W FLE+ +   GF +  I L++  +  
Sbjct  198   AAEIIHYLRRRRRGKKGFMALKMDMSKAYDRIEWSFLEAIMRKLGFAEQWIQLMLTCIST  257

Query  2581  SSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRG  2760
              S S + NG       P RGLRQGDPL+PYLF+L  E L+  I +K R    K +++ RG
Sbjct  258   VSYSFVINGTPHGFLHPSRGLRQGDPLSPYLFLLCAEGLTALIAQKEREGFLKGVSICRG  317

Query  2761  GTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIK  2940
                +SHLFFA+D  LFA A+      + + L  +    G  +N  KS +  S N +   +
Sbjct  318   APAISHLFFADDSFLFAWANMADCMALKDILDTYERALGQQVNFQKSAVCFSKNVHRGDQ  377

Query  2941  RGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTL  3120
               L    GI   D+   YLG+P++  +    +F ++ + + +KL  WKG +LS AG+  L
Sbjct  378   LMLAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKERLWKKLQTWKGKLLSGAGKEIL  437

Query  3121  VQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGG  3300
             ++    ++P+YTM  F LP   C D++++   F W  S +NKK+H + W+ +C  K+ GG
Sbjct  438   IKVVAQAIPIYTMSCFLLPKYVCEDLNKLVAQFWWNSSTENKKIHWMAWDRLCAPKEEGG  497

Query  3301  LGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIM  3480
             LG R    FN ALLAK  W+L+ + D L  KV++ KY   ++F  T +   AS  W+S+ 
Sbjct  498   LGFRNLHAFNLALLAKQGWRLLQNPDSLVTKVLKAKYFPTRSFLETTVSPYASVVWKSLC  557

Query  3481  RGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPN-RT  3657
               R+++  G+ W++G+G ++  W D W   +P +F      P+  +  KVSD I  + R 
Sbjct  558   DARTVIIQGSRWQVGSGDTIGIWEDRWL-PQPNSFQIFSPRPEHSAITKVSDLIHGDSRE  616

Query  3658  WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIA-------  3816
             WN   L ++   + +  IR+ P+++     D L W     G F+V+SA+ H+A       
Sbjct  617   WNAPLLQNVFFPEEVMLIRSIPLSL-RLTPDMLVWHYDKKGMFTVKSAY-HVARSLHSST  674

Query  3817  ----GNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCG  3978
                  ++ DA+  +W  +WK  V  R + F W ++ G L T     RK ++ D  C  C 
Sbjct  675   GRASSSNSDAVARNWSLLWKAIVPARVKTFWWRVISGILPTKANLARKKVSLDEECMLCE  734

Query  3979  DGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTF  4158
                +++ H+L +C +        H P           K WV   C  ++ ++   +  TF
Sbjct  735   GPVKSLIHILRDCPWNNG----AHSP-----------KDWV---CRCAEQLSSQDFA-TF  775

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCV----HVGKMRWVC  4326
             +   W IW+ARN  ++ N  S    +   A+    D + V     C+      G+++ + 
Sbjct  776   LMVGWAIWEARNGLLWNNKKSRHEQVSLHASLRLHDFLRV---SNCLGSQSRQGQIKQM-  831

Query  4327  WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAA  4485
             WQPP    +K N DGA+K  T     G + RD  G+++ G  T +  +N F+A
Sbjct  832   WQPPHENSLKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKL--TNVFSA  882



>ref|XP_010666352.1| PREDICTED: uncharacterized protein LOC104883509 [Beta vulgaris 
subsp. vulgaris]
Length=1234

 Score =   455 bits (1171),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 339/1191 (28%), Positives = 529/1191 (44%), Gaps = 118/1191 (10%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHG-LVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              FW+    +F+++  +   I G +VS      R    Y  P    K++ W    +   E+
Sbjct  60    IFWKDETISFSLVSFSHNHICGDVVSRGDKTWRFVGIYGWPEEENKQKTWTLIKNLCEEY  119

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               P +  GDFN+I    E+ G S+ N      F +  + CGL ++   G  Y+W R    
Sbjct  120   QGPIVFGGDFNEILSYDEKEGGSNRNRRAMEGFRDVMANCGLGELRYVGQWYTWERGRSP  179

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrf-e  1476
              T  R +LDR + +    +LFPEA      R  SDH  +     AG   R         E
Sbjct  180   ETRIRERLDRFIISRGWLDLFPEAFIEHSVRYSSDHAAVVLKESAGGGERVRGSRGFRFE  239

Query  1477  gAWLTREDYRDI----WGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
               WL  E   ++    WG      + + +GA++      + W+K++FGN+  +   ++ +
Sbjct  240   TGWLLDESCEEVVKNAWGAAAGEHITERLGAVARDL---QGWSKKSFGNLKKQIVRVEKK  296

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +   Q     +TSR    L   L +EL+EV                 +DGDRNTA++H  
Sbjct  297   LHEAQRG---STSRENCDLCVALESELDEV-----------------KDGDRNTAYFHHK  336

Query  1825  TLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
                R+ R+ I  LK  +G W ++ + I   +  +F  +F        +  ++    +   
Sbjct  337   ASQRKKRNYIHGLKDRDGVWQTEEENIEREVVRYFDTIFTSSEPSRDNLQEVLKHVRSSV  396

Query  2002  GQMHK--LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLR  2175
              Q +   L R  T  E+  A+ DM    +PGPDG+ A FYQ FW  +   + T++  +L 
Sbjct  397   TQEYNDILLRPYTKEEIYAALSDMHPCKAPGPDGMHAIFYQRFWHIIGDEVFTYISNILH  456

Query  2176  DGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPF  2355
             +   P  +  + + LIPK +SP   S+FRPI+L NV +KI SK +V R++  +  ++   
Sbjct  457   NFSCPGDVNCTNVALIPKVNSPTVVSEFRPISLCNVLYKIASKALVLRLKQFLPTIVSEN  516

Query  2356  QNSFLPGRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDF  2532
             Q++F+PGR  +DN ++  EI H M R    +KGL+A+KLD+ KAYD ++W FL   L+  
Sbjct  517   QSAFVPGRMISDNSLIALEIFHTMKRRNNSRKGLIAMKLDMSKAYDRVEWGFLRKLLLTM  576

Query  2533  GFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQ  2712
             GF    ++L+M  V   S S + NG       P RGLRQGDPL+P+LFIL  +  S  IQ
Sbjct  577   GFDGRWVNLVMSCVSTVSYSFVINGRVCGSVTPSRGLRQGDPLSPFLFILVADAFSQMIQ  636

Query  2713  EKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINV  2892
             +K        ++ S+G                           ++C K            
Sbjct  637   QKKINYEKSEVSFSKG---------------------------VSCGK------------  657

Query  2893  SKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKL  3072
                            K  L NL  +   D    YLGIP L  R  K  F  +LD M +KL
Sbjct  658   ---------------KEELINLLHMRHVDRHQKYLGIPSLGGRSKKVFFRELLDRMWKKL  702

Query  3073  ANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKV  3252
               WK  +LS AG+  L+++ + ++P Y M V+KLP    ++I      F WG     +K+
Sbjct  703   RGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPGAVIHEIHSAMARFWWGGRGDERKM  762

Query  3253  HLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFF  3432
             H + W  +CK K  GGLG +    FN+ALL K  W+L+   + L  +VM  KY  + +  
Sbjct  763   HWLSWEKMCKPKCMGGLGFKDLTVFNDALLGKQVWRLLHHKESLLSRVMSAKYYPHGDVC  822

Query  3433  ATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDS  3612
                +  ++S+ WRSI   +S+V  G  WR+G+G  ++ WS  W GD+   F+    +   
Sbjct  823   QARLGYSSSYSWRSIWGAKSLVMEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARVEGL  882

Query  3613  QSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAV-CEQVSDSLYWPRSPTGAFS  3789
             +    + D  +  + WNV+ + S         I A P++  C Q  D L W  S  G +S
Sbjct  883   EVVGDLMD--VERKEWNVELIESHFNERDQQCILAIPLSTRCLQ--DDLTWAYSKDGIYS  938

Query  3790  VRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTL  3963
             V++A+    G + D     W  +W + V+ + R FLW      L       R+ + ++  
Sbjct  939   VKTAYMLGKGGNLDDFHRVWNILWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDEAG  998

Query  3964  CATCGDGDETMNHVLMECSFAKDCWRRTHH----PVSFQYSLVTPLKSWVKNNCCASDWI  4131
             C  C   DET  H+   C  +   W         P     ++   L  W + +       
Sbjct  999   CPCCDREDETQLHLFYRCPMSLKLWEELGCHILLPGVEDEAMCDTLVRWSEMDATVVQ--  1056

Query  4132  NGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGK  4311
              GC       Y  W +W  RN+++FE T+     + +R     +D    F N      G 
Sbjct  1057  KGC-------YLLWNVWVERNRKVFEYTSHPATIVGQRIMRQVVD----FNNYAVRIYGG  1105

Query  4312  MRWVC------WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG  4446
             +R         W  P  G IK NTD +     G    G +ARD +G+  F 
Sbjct  1106  VRSPAATSSSRWSAPPVGAIKLNTDASLAEE-GWVGLGVIARDSEGKVCFA  1155



>ref|XP_009102231.1| PREDICTED: uncharacterized protein LOC103828378 [Brassica rapa]
Length=1036

 Score =   450 bits (1157),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 278/852 (33%), Positives = 448/852 (53%), Gaps = 31/852 (4%)
 Frame = +1

Query  1708  KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWN  1884
             +L   LNE   +EE  W Q+SR  W+Q GDRNT F+H  T  R   +++ +++   GE  
Sbjct  15    RLSATLNEAYAEEESFWRQRSRIQWLQHGDRNTGFFHAVTRGRNAMNKMSVIENEAGEAV  74

Query  1885  SDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFD  2064
                  IS   + F+  +F      D S       P +       L    T  E+K AVF 
Sbjct  75    YGDDKISQAFAEFYRKVFTSSPRSDLSFISEVITPVISEEMNSSLIARPTDDEIKTAVFS  134

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             + K  +PGPDG  A+FY +FW+ + + + + ++       + P+  E+ + LI K    +
Sbjct  135   IHKDKAPGPDGFSASFYHSFWDIIGNDVCSDIRSFFDASCLNPRFNETHVRLIAKSKGAK  194

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
               +D+RPI L +  +KII+K++  R++P++  LI P Q++F+ GR+ +DN+++T E++HY
Sbjct  195   KVADYRPIALCSTHYKIIAKLLTKRLKPMLPALISPQQSAFVAGRAISDNVLITHEMLHY  254

Query  2425  MRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLW  2601
             +R  K KK   MAIK D+ KAYD I+W+FL+  L  FGF Q   + IM  V+  S S L 
Sbjct  255   LRTSKAKKSCSMAIKTDMSKAYDRIEWDFLDHVLHCFGFHQVWRTWIMQCVQSVSYSFLI  314

Query  2602  NGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKP-ITLSRGGTGVSH  2778
             NGE      P RGLRQGDPL+PYLFIL  E LS  +  K +     P + ++R    ++H
Sbjct  315   NGEPREKVLPERGLRQGDPLSPYLFILCSEVLS-GLCRKAQDSGLLPGLKVARNSPAINH  373

Query  2779  LFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNL  2958
             L FA+D M F+++       +++ L+K+   SG  IN+ KS I  S  T + I+  +K  
Sbjct  374   LLFADDTMFFSKSDPLSCSSLLDILRKYEIASGQCINLLKSAIMFSSKTPAAIRSRVKQD  433

Query  2959  TGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALS  3138
              GI+    +G YLG+P    R  +  F  I+D ++++  +W    L+ AG++ L+++ L 
Sbjct  434   LGIAAEGGIGKYLGLPEHFSRRKRDIFAGIIDRIRQRSHSWSTKFLNGAGKQVLLKAVLM  493

Query  3139  SMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKC  3318
             +MP Y M  FKLP   C  I  I   F W    + +K+  V W  + ++K  GGLG R  
Sbjct  494   AMPAYAMSCFKLPLSLCKQILSILTRFWWDMKPEIRKMCWVSWQTLTRAKADGGLGFRDI  553

Query  3319  LDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIV  3498
               FN+ALL KLAW+++T+ + L  +++  KY  + +F    + ++ S GWR IM GR +V
Sbjct  554   ALFNDALLGKLAWRIMTNPESLLGRILLGKYCHSASFLDVTIPSSPSHGWRGIMAGREVV  613

Query  3499  ELGAAWRIGNGLSLNFW-SDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDK  3672
             + G  W IG+G S+  W + W +  +P+A +     P       V+D I+P  R WN+  
Sbjct  614   KKGFGWLIGSGSSIPVWAAPWLSLKEPMAPIGPR--PYQSENLMVADLIIPETRDWNLPL  671

Query  3673  LSSLLPH--DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS  3846
             + + LP   D+I  +    ++    + D   W  + TG +S RS +  +  ND   +D  
Sbjct  672   IRTTLPQYEDLIRELIPGDLS----LQDERVWLYTNTGEYSTRSGYK-LLTNDVQPLDQQ  726

Query  3847  W-----VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLM  4011
             +     +WK+  + + + FLW L    L +      +G+   T C  CG+  ET  H+ +
Sbjct  727   FNWITNIWKLDTSPKVKTFLWKLKNRALASGFNLATRGILAPTECMRCGE-QETDLHIFL  785

Query  4012  ECSFAKDCWRRTHHPVSFQYSLVTP--LKSWVKNNCCASDWINGCPWGVT---FIYTCWE  4176
              C FA+  W     P  F+  L++   + S + +       +N  P G++   + +  W 
Sbjct  786   HCPFAQRTWELV--PAMFKLPLISAPDISSLLAS---GKRLVNLPPSGLSCPLYPWILWF  840

Query  4177  IWKARNQRIFEN  4212
             +WKARN+ +FE+
Sbjct  841   LWKARNRFLFED  852



>ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   440 bits (1131),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 258/775 (33%), Positives = 386/775 (50%), Gaps = 94/775 (12%)
 Frame = +1

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
             +FF   F   + +D     ++  P+++   +   +  ++M EVK A+F +    +PG DG
Sbjct  7     DFFSKFFSENDYVDSRVVSLWTFPRIEQHNLFACSVPISMLEVKNALFGIGGLKAPGVDG  66

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A FYQ  W++  S I   V        VPP + ++ I+LIPK + P+   +FRPI+L 
Sbjct  67    FPAIFYQHHWKDYASKIFNVVNTAFSSCSVPPDLNQTIISLIPKFEGPQHMVNFRPISLC  126

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLM  2457
             N  +K+ISK+IV R+RP M+ LI P Q S++PGR  +DNI++ QE++   +   G  G  
Sbjct  127   NTIYKVISKIIVARIRPFMQQLIIPNQVSYVPGRHISDNIMIAQELLFKFKKSCGSLGFF  186

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
             A K+DL KAYD + W F+E  L +  FP  L+ LIM  +  +S  + +NGE  + F+  R
Sbjct  187   AWKVDLSKAYDRLRWSFIEQILFEAKFPSTLVKLIMSCITTTSFQICFNGELTSSFKAQR  246

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             G+RQGDPL+PY+F+L ME+LS  I   V +  WKP+  S+ G  VSHLFFA+DLMLFAEA
Sbjct  247   GIRQGDPLSPYIFVLCMEKLSHLINSVVDMGYWKPVRASQSGPKVSHLFFADDLMLFAEA  306

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
                                             SP   S IK  L +   +S         
Sbjct  307   --------------------------------SPQQASIIKDCLDSFCDLS---------  325

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
                                     L+ W    LS+AGR TLVQS  +S+P+Y MQ  KLP
Sbjct  326   -----------------------GLSGWSSKTLSMAGRLTLVQSVTASIPIYAMQTAKLP  362

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
                C  ID+   +FLWGDS + KK+HLV W  +CK K  GGLGL+K  D N A+LAK +W
Sbjct  363   LSLCESIDKANINFLWGDSNEKKKIHLVNWESVCKPKHRGGLGLKKTADMNQAMLAKASW  422

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANA--SWGWRSIMRGRSIVELGAAWRIGNG  3531
             ++  +   LW  + R+KY+++    ++  IA A  S  WR I+ G  ++     WRIG+G
Sbjct  423   RIFQNDHGLWADIYRKKYLQDCCIESSNSIAPADCSNTWRGIVHGVELMRRNLKWRIGDG  482

Query  3532  LSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGI  3711
               + FW+                       A + +F   + +WN+  L S+LP  ++  I
Sbjct  483   AKIKFWN-----------------------ATIKEFWC-DTSWNISLLKSVLPDHVVMQI  518

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrl  3885
              + P        D L W  +  G FSV+S ++    +     +  W  +WK+    + + 
Sbjct  519   ISVPSGFGVSGHDKLIWNATANGKFSVKSTYNSFF-DSAGVSNPLWTHLWKLNCPPKLKT  577

Query  3886  flwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSF  4065
             F+W ++  ++LTN++R R+G +    C  C + DET+ H+L +C  ++  W     P S 
Sbjct  578   FMWSVLHQKILTNVQRVRRGFSTIASCPICKNADETLLHLLRDCPRSQAIWNSILRPGSI  637

Query  4066  QYSLVTPLKSWVKNNC-CASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAP  4227
               S       W+     C     N   W   F++ CW IWK RN+ IF+     P
Sbjct  638   TNSFSLDWNGWISAQFHCHVVIKNNIQWCNLFVFVCWFIWKWRNKVIFDPAFILP  692



>ref|XP_009102116.1| PREDICTED: uncharacterized protein LOC103828254 [Brassica rapa]
Length=1131

 Score =   452 bits (1162),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 324/1100 (29%), Positives = 521/1100 (47%), Gaps = 70/1100 (6%)
 Frame = +1

Query  1291  EGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfr  1470
             +G  TV R +LDRAL N E   LFP +    L    SDH P+    +   P R+  +   
Sbjct  11    KGAFTV-RCRLDRALANEEWHTLFPYSYTEYLRMVGSDHRPVVAFLDDKVPGRKRGQFRF  69

Query  1471  fegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSK------KWNKETFGN--IFGRK  1626
              +  W+ +E   +     W+ +   + G  +   N  +      + N + +G   IF   
Sbjct  70    DKR-WIGQEGLMESIVSGWTENQEGISGDFTTKINNCRHEISTWRKNNQPYGKDKIF---  125

Query  1627  ASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNT  1806
              +LQ  ++ VQ     N     +++E  +  +L E  + EE  W QKSR MW   GD NT
Sbjct  126   -NLQNALEEVQTD---NNRSQEEIIE--ISRKLQEAYRDEEEYWHQKSRNMWYSSGDLNT  179

Query  1807  AFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYC  1983
              FYH  T  RR R++I  L    G W S+   +     ++F  LF   N  +        
Sbjct  180   KFYHALTKQRRIRNKIVGLHDEEGNWISEENGVEKVAVDYFTGLFSSSNPREFDSFLEEI  239

Query  1984  GPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVK  2163
             GP +       L R  T  EV++A+F M    +PGPDG+ A F+Q  W  VK  +   V 
Sbjct  240   GPSISPQMNQLLLRRATEEEVRQALFMMHPEKAPGPDGMTALFFQHSWSVVKKDVVDLVN  299

Query  2164  KVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNL  2343
               L  G +  ++  + I +IPK + P   ++ RPI+L NV +KIISKV+  R++  + +L
Sbjct  300   NFLVSGDMDSRLNITNICMIPKVERPTRMAELRPISLCNVGYKIISKVLCQRLKICLPHL  359

Query  2344  IGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-KKGLMAIKLDLHKAYDSIDWEFLEST  2520
             I   Q++F+ GR  +DNI++ QE+ H +R  K  +   MAIK D+ KAYD I+W F+E+ 
Sbjct  360   ISETQSAFVAGRLISDNILIAQEMFHGLRTNKSCQNKFMAIKTDMSKAYDRIEWSFIEAL  419

Query  2521  LVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLS  2700
             L   GF  + + L+   +      +L NG+      P RGLRQGDPL+PYLFI+  E L 
Sbjct  420   LTKMGFDPHWVKLMQECISSVQYRVLLNGQPRGLIIPKRGLRQGDPLSPYLFIMCTEALI  479

Query  2701  WDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGL  2880
              +I++  R+K    + ++R    VSHL FA+D + F +A++++   I+  LK +   SG 
Sbjct  480   MNIKKAERMKQLTGMKVARACPAVSHLLFADDSLFFCKANKEECHTILRILKDYEAVSGQ  539

Query  2881  NINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGM  3060
              IN  KS+I          ++ L+++ GI     +G+YLG+P          FG++ D +
Sbjct  540   QINFQKSSIQFGHKIEESSRQELRDILGIQNLGGMGSYLGLPESLGGSKVQVFGFVQDRL  599

Query  3061  KRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQ  3240
               ++  W     +  G+  +++S ++++P + M V++LP  T   +      F W     
Sbjct  600   NNRVNGWTFRFFTKGGKEVIIKSVITALPNHVMSVYRLPKATVKKLTSAVAQFWWNPGGS  659

Query  3241  NKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKN  3420
              + +H   W+ +C+ KD GGLG +   DFN A+L K  W+L+   + L+ +V + +Y +N
Sbjct  660   TRGMHWKSWDKLCEHKDNGGLGFKDLNDFNTAMLGKQLWRLIEKPNSLFSRVFKGRYYRN  719

Query  3421  KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWW---TGDKPLAFMD  3591
              +        + S+GWRSI   RS+V  G   R+G G S++ W+D W   T  +P     
Sbjct  720   ASPLEPIRSYSPSYGWRSITSARSLVCKGLIKRVGTGSSISVWNDPWIPSTRPRPANKNF  779

Query  3592  EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRS  3771
               + PD   ++ +      +RTWN+  L +L+  D    I   P++   Q+ D   W  +
Sbjct  780   HNSYPDLTVDSLIHQ---ESRTWNLQALRTLVEPDDAKLIEGIPLSR-NQMEDRNGWHFT  835

Query  3772  PTGAFSVRSAFS--HIAGNDEDAMD---------TSWVWKMRVTERCrlflwllmrgrll  3918
               G +SV+S +    I  + E   D          ++ WK++   + R F+W L+ G + 
Sbjct  836   NNGKYSVQSGYQVERIYPDKEKPPDYYGPNVDILKAFCWKVKCPPKLRHFIWQLITGCIA  895

Query  3919  TNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSW  4098
                    +G+  DT+CA CG+ +E++NHV  EC  A+  W  +  P +     + P  S 
Sbjct  896   VTKNLKSRGIQGDTVCARCGNPEESVNHVFFECPPARQVWALSKIPSNPN---IFPTGSL  952

Query  4099  VKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMR----------RA  4248
               N       +N       F +  W IWK RN ++F N    P + ++           A
Sbjct  953   FTNMDHLFWRVNPKMEDHQFAWILWYIWKGRNNKVFSNIDVEPRETLKLAELESRLWNEA  1012

Query  4249  NNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHK  4428
              N+    V   +  +   V   RW C+           TDG++K   G +  G L+    
Sbjct  1013  QNINNPRVAPEVQGRLPLVTTGRW-CF-----------TDGSWKDKDGFSGQGWLST---  1057

Query  4429  GEWLFGFMTNIGVSNSFAAE  4488
                L GF   +G  N  A E
Sbjct  1058  ---LPGFERLLGARNVRAKE  1074



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score =   451 bits (1161),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 292/954 (31%), Positives = 481/954 (50%), Gaps = 31/954 (3%)
 Frame = +1

Query  1678  TSRGLQVLERK-LVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI  1854
             TS    + ERK L  EL++   +EE+ W QKSR  W++ GDRNT ++H  T  +R R+ I
Sbjct  66    TSNSATLQERKNLKAELDQAYMEEEVYWQQKSRVQWLRSGDRNTTYFHAITKGKRYRNNI  125

Query  1855  RMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCG-PKLDTGQMHK-LTR  2025
               L+ + G  +   + I      +F +LF       G  + ++ G P   T  ++  LTR
Sbjct  126   SSLQDMAGVTHRGQRGIGRVAQEYFCNLFTSSPPDLGLYDAVFEGFPIRVTEDINTDLTR  185

Query  2026  EVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILE  2205
             EVT  E+K+A+FD+    +PGPDG  A FY  +W+++K+ I   V++    G +  ++  
Sbjct  186   EVTEEEIKQAMFDIGSHRAPGPDGFSAVFYHQYWDDLKTDIVREVQQFFETGVLDKQLNH  245

Query  2206  SFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRST  2385
             + I LIPK   P   +DFRPI L NV++K+ISKV++NR++  + +LI   Q +F+PGR  
Sbjct  246   TNICLIPKIYPPSGMTDFRPIALCNVAYKVISKVLINRLKIHLHSLITENQQAFIPGRVI  305

Query  2386  ADNIILTQEIVHYMRLKKGKK-GLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLI  2562
              DNII+  E+ H ++ +K +    MA+K D+ KAYD ++W FLE T+   GF    I  I
Sbjct  306   TDNIIIAHEVFHCLKARKRQATSYMAVKTDITKAYDRLEWGFLEETMRRMGFHVKWIQWI  365

Query  2563  MFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKP  2742
             M  V   S S+L NG      +PGRG+RQGDPL+PYLFIL  E LS  +   +  ++   
Sbjct  366   MACVNTVSFSVLINGSPEGYLEPGRGIRQGDPLSPYLFILCAEVLSHMMNRAMVDRSLLG  425

Query  2743  ITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPN  2922
             + +S     V+HL FA+D + F+ A+    + +   L  +   SG  +N+ KS+I     
Sbjct  426   VKISLQAPPVNHLLFADDSLFFSLANARACKKLKKILGDYERASGQAVNLMKSSITFGHK  485

Query  2923  TNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSL  3102
              +  ++  ++N+ GI     +G YLG+P    R     F YI+D +K     W    LS 
Sbjct  486   ISDVVRTQMRNILGIHNEGGIGKYLGMPEQFTRRKSDMFTYIVDKVKAVTQGWSQKYLSP  545

Query  3103  AGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICK  3282
              G+  L++S   +MP+++M VF+LP   C++I+R+   F WG S +NK +H   W  +  
Sbjct  546   GGKEVLLKSIALAMPIFSMNVFRLPKEVCDEINRVLARFWWG-SGENKGMHWYDWKRVSL  604

Query  3283  SKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASW  3462
              K  GGLG R    FN ALL K  W+++ +   L  ++++ +Y  + +  +  +   AS+
Sbjct  605   PKSEGGLGFRDLEKFNQALLGKQVWRILQNPGCLMARILKARYFLDGDILSAELKTKASY  664

Query  3463  GWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDK-PLAFMDEVTIPDSQSEAKVSDF  3639
              W+SI+ GR +V+ G  + IG+G  +N W+D W  D  P A       P  +       F
Sbjct  665   AWKSILYGRDLVKQGMRYIIGDGSLINTWTDPWIPDHTPRA--PRPRTPGLRIGKVNQLF  722

Query  3640  ILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF---SH  3810
                   W+  K+ +++  + I  + A  ++   +  D L W     G ++V+S +   +H
Sbjct  723   SQYGYGWDEQKVRAVIVDEDIPKVLALKLSTTAK-QDLLGWHYKDDGIYTVKSGYWLSTH  781

Query  3811  IAGNDE------DAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCAT  3972
             +   +       +      +W  ++  +   F+W ++   + +     R+ +  D  C  
Sbjct  782   LPTRERMEPTLGNPSLKKKIWNTKLPSKIHHFIWKVLSRSIASGANLKRRHIMPDAQCRR  841

Query  3973  CGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKN--NCCASDWINGCPW  4146
             C +GDET  H+L +C +A+  WR +    +        L+  ++    CC S  +     
Sbjct  842   CCNGDETDKHLLFDCIYAQQIWRASGISNTILTDPRASLEEKIEVCLQCCTSIHLRHLT-  900

Query  4147  GVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN-----LTLDTVEVFLNKKCVHVGK  4311
              + F +  W IWK+RN  IF+N       ++++A        T  T+ V   +  +   +
Sbjct  901   NLPF-WLLWRIWKSRNLLIFQNKQIDGRHVLQQARRDAQEWSTHSTLNVSSGRPNISSQQ  959

Query  4312  --MRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGV  4467
               M+   W+ P  GW+K N D +F      + AG + RD  G +  G    IGV
Sbjct  960   TLMQNQRWKRPPVGWLKCNVDASFVNAETPSKAGWIIRDENGTYK-GAGQGIGV  1012



>ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica]
Length=1380

 Score =   456 bits (1172),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 341/1222 (28%), Positives = 545/1222 (45%), Gaps = 85/1222 (7%)
 Frame = +1

Query  976   VIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFND  1155
             VI ++ Q +    S      + +  Y       +   W D L+  S    PW+ +GDFN 
Sbjct  82    VISSSGQQVTFQTSFEGVLSQFTIVYAATTSTLRRVLWCDLLNIRSNTTMPWMAIGDFNA  141

Query  1156  IADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRAL  1335
             I    EQ G      + C +F  +   C    M T+G  Y+W      R    R+LDR+L
Sbjct  142   ILGAHEQMGGHLPARTSCEDFRSTTELCDFTHMDTTGAFYTWTXGXNVRGYMERRLDRSL  201

Query  1336  WNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIW  1515
              +    + +P      LPR  SDH+ L F   A        RPFRF+  W    ++  + 
Sbjct  202   CDTRWLHSWPYTSCCALPRVVSDHNCLVF--SASAIXLGGXRPFRFQSMWTLHSEFSGLV  259

Query  1516  GRVWSNS------LLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYN  1677
              + W ++      +  ++  +  +    + WN   FG++       + R+  +Q S+  +
Sbjct  260   AKCWQSTVVYGCPMFVMLEKLKALKRCLRVWNSNVFGDVHRNVTFAKERLXNIQNSISSD  319

Query  1678  TSRGLQVLERKLV-TELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI  1854
              +   +  E  +  T + + L+ +E  W  ++R  W+ +GDRNTAF+H     R + SRI
Sbjct  320   GNSQEKFNEEVVAKTAVLDALQMQEAFWHDRARVKWLTEGDRNTAFFHAYARGRHSSSRI  379

Query  1855  RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCG---PKLDTGQMHKLTR  2025
               L       S    I DH+ NF+  L+       G  +   CG   P +   +   L+ 
Sbjct  380   VNLLDGXNXLSSHTAIVDHVVNFYQSLYNSSFTPTGIXD--VCGVIPPMVSEEENLSLSC  437

Query  2026  EVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILE  2205
               +  E++  VF M    + GPDG   +FYQ+ W+ V   +  FV+   + G + P    
Sbjct  438   LPSADEIRSVVFSMDPSSAXGPDGFPGSFYQSCWDIVGXXVIAFVQDFFKRGWLYPNANC  497

Query  2206  SFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRST  2385
             +F+ LIPK +   T + +RPI L N  FKII K++ +R+ PI   +I P Q  FL GR  
Sbjct  498   NFVVLIPKVEGVATIAQYRPIALANFLFKIIXKILXDRLXPIATRIISPQQTXFLKGRRI  557

Query  2386  ADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIM  2565
             +D I L  E  ++M  KK   G   IK+D+ KA+D+++W+FL   L  FG     +  + 
Sbjct  558   SDCIGLVSEXFNFMD-KKAFGGNXGIKVDIAKAFDTLNWDFLLXVLSSFGXSSIFVDWVR  616

Query  2566  FSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPI  2745
               ++ + +S+L NG     F   RG+RQGD  +P  F LA E LS  +           I
Sbjct  617   VLLQSAXLSILVNGTPHGFFSCSRGVRQGDXXSPLXFCLAXEALSRXLSXLFSTXXITXI  676

Query  2746  TLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC---S  2916
             +  RG    +H+ +A+DL +F   +      + N L K+   SG  +N SKS  +    S
Sbjct  677   SAPRGCCPPTHVLYADDLFIFCRGNVRSLCSLRNFLDKYGCASGQLVNASKSTFYLXXSS  736

Query  2917  PNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNML  3096
              +  + + R L    G+       TYLG+PI   +  +  F  ++D  K +L+ WKG + 
Sbjct  737   XHXKAHVSRHLGFXLGVVPF----TYLGVPIFRGKPKRIHFQALVDKAKARLSGWKGKLX  792

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S+AGR  LVQS   S+ +++  V++LP+     +    R+F+W     ++K+  V W+ +
Sbjct  793   SMAGRFQLVQSVYQSLXLHSFSVYQLPSCXLKHLSACARNFIWSGDLSSRKLVTVDWSMV  852

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKY----VKNKNFFATPM  3444
                K  GGLGLR     N   L    W  + S+  LW     +++     +N+N +    
Sbjct  853   XGPKKEGGLGLRDLAXLNLTALLSFGWDALQSY-SLWGSFAXQRFPLSPYRNQNIYLR--  909

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA  3624
                 S  W  + R   I+   + W IG+G  ++FW D W  D+P+      ++   +   
Sbjct  910   ----SSXWHGLKRALPILNNNSRWIIGDGRXVSFWFDKWL-DEPIISXSLFSVISPKVLP  964

Query  3625  KVSDFILPNRTWNV-DKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSA  3801
             +VSD ++  ++W++ D  S+L P  I+  I   P+ +     D L W  SPTG FS  S 
Sbjct  965   RVSD-VIEAQSWSLPDYFSNLFP-SIVQQILRLPLPL-NXXXDKLIWEPSPTGKFSFSSG  1021

Query  3802  FSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGD  3981
             +  I     D      +W+  +  R  +  W L   +L T     R+G++  ++C  C +
Sbjct  1022  YHLIRXRHSDCAWAKVIWQHFIPPRLSILAWRLFHDKLPTEDALQRRGISLASICCLCHN  1081

Query  3982  GDETMNHVLMECSFAKDCWR----RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWG  4149
              +E+  H+   C  ++  WR    +    +    SLV     +V+     S  ++   W 
Sbjct  1082  SEESTAHLFFGCRISRQLWRWLXCQFGTSLPLPDSLVAFWDVYVRKP--FSKQLHNL-WI  1138

Query  4150  VTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGK------  4311
                + T   IWKARN+ IFE     P+   R   +         +N   VH GK      
Sbjct  1139  FAGLXTISAIWKARNKFIFEGR---PIYFHRLCMS---------INSAIVHGGKFIPGYS  1186

Query  4312  ----------------------MRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDH  4425
                                   +  V W PP   W+K NTDG  K N G A+ GG+ R+ 
Sbjct  1187  QGFDTRIIXSLGIQPIPRKAPTILPVLWSPPWFPWVKLNTDGLSKGNPGPAACGGVFRNC  1246

Query  4426  KGEWLFGFMTNIGVSNSFAAEL  4491
              G +L GF   IG  NSF AEL
Sbjct  1247  HGXFLGGFCQRIGHCNSFFAEL  1268



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score =   438 bits (1126),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 252/667 (38%), Positives = 367/667 (55%), Gaps = 42/667 (6%)
 Frame = +1

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             M K+ +PGPDG Q  FYQ  W+ V   ++ FV      G++P    ++ + LI K   PE
Sbjct  1     MGKYKAPGPDGFQPVFYQDCWDIVGDSVSRFVLDFFASGKLPEGTNDAIVVLIAKVLKPE  60

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
               + FRPI+L NV FK I+K +V R++ ++  LI P Q SF+ GR  ADNI++ QE VH 
Sbjct  61    RITQFRPISLCNVLFKTITKTLVMRLKRVISKLIRPAQASFISGRLAADNIVIMQEAVHS  120

Query  2425  MRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWN  2604
             MR KKG+KG M +KLDL KAYD I WEFLE TL     P+  I  IM  V E S+SLLWN
Sbjct  121   MRRKKGRKGWMLLKLDLEKAYDRIRWEFLEDTLRAVRLPEKWIVWIMQCVTEPSMSLLWN  180

Query  2605  GEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLF  2784
                +A                                    K+WKPI+LS+GG  +SH+ 
Sbjct  181   EHSIAR-----------------------------------KDWKPISLSQGGPKLSHIC  205

Query  2785  FAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTG  2964
             FA+DL+LFAEAS  Q R+I   L++F   SG  +++ KS IF S N + ++ + + + +G
Sbjct  206   FADDLILFAEASVAQIRVIRRVLERFCVASGQKVSLEKSKIFFSENVSRDLGKLISDESG  265

Query  2965  ISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSM  3144
             IS +  LG YLG+P+L +R++K TFG IL+ +  +LA WKG  LSLAGR TL ++ LSS+
Sbjct  266   ISSTRELGKYLGMPVLQRRINKDTFGDILEKLTTRLAGWKGRFLSLAGRVTLTKAVLSSI  325

Query  3145  PVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLD  3324
             PV+TM    LP  T + +D++ R FLWG S   +K HL+ W  +CK +  GGLG+RK  D
Sbjct  326   PVHTMSTIALPKSTLDGLDKVSRSFLWGSSVTQRKQHLISWKRVCKPRSEGGLGIRKAQD  385

Query  3325  FNNALLAKLAWQLVTSHDKLWVKVMREKY-VKNKNFFA-TPMIANASWGWRSIMRG-RSI  3495
              N ALL+K+ W+L+  +  LW ++MR  Y V++    A T + +  S  WRS+  G R +
Sbjct  386   MNKALLSKVGWRLIQDYHSLWARIMRCNYRVQDVRDGAWTKVRSVCSSTWRSVALGMREV  445

Query  3496  VELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKL  3675
             V  G +W IG+G  + FW D W  + PLA +     P      +  D       W++  +
Sbjct  446   VIPGLSWVIGDGREILFWMDKWLTNIPLAELLVQEPPAGWKGMRARDLRRNGIGWDMATI  505

Query  3676  SSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS---  3846
             +  +       +++  +       D + W  S  G F V + +S +  ++    D     
Sbjct  506   APYISSYNRLQLQSFVLDDITGARDRISWGESQDGRFKVSTTYSFLTRDEAPRQDMKRFF  565

Query  3847  -WVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSF  4023
               VW +   ER RLFLWL+ +  ++TN ER R+ ++  T+C  C    E++ HVL +C  
Sbjct  566   DRVWSVTAPERVRLFLWLVAQQAIMTNQERHRRHLSTTTICQVCKGAKESIIHVLRDCPA  625

Query  4024  AKDCWRR  4044
              +  W R
Sbjct  626   MEGIWLR  632



>ref|XP_010693635.1| PREDICTED: uncharacterized protein LOC104906563 [Beta vulgaris 
subsp. vulgaris]
Length=1307

 Score =   453 bits (1166),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 362/1225 (30%), Positives = 564/1225 (46%), Gaps = 112/1225 (9%)
 Frame = +1

Query  946   FWRS---SIFNFAVIRNTSQAIHGLVSGPHSNVR--VSFAYVRPNRMAKERFWNDCLSYS  1110
             FWR    + FN A+I   S+ +   ++    NV   + F Y    +  K RFW +  SY 
Sbjct  71    FWRDCNVNPFNLAIIYKASRFLVCSINYLKVNVPFLIVFIYAPAQQNQKARFWEELTSYL  130

Query  1111  SEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQ  1290
             +    P+I++GDFN++++  ++ G       R     +  SA    ++  SG  Y+W ++
Sbjct  131   NLQTLPFIVLGDFNELSNINDKQGGIPFVSQRGDIIQQFLSATSTTEIPFSGSPYTWRKK  190

Query  1291  EGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfr  1470
               G      ++D+ + +    + FP A+      T SDH  L    E       +  PF+
Sbjct  191   VSGPNNVYERIDKGVASAGWLSCFPSARVHHHIFTSSDHCRLSL--EFLPLNMFKVPPFK  248

Query  1471  fegAWLTREDYRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASL  1635
             FE  W  R+DY  +  + W      + +  +V     +   SK+WN+ +FGNIF +   +
Sbjct  249   FEKMWCLRKDYDTLVKKTWCTRFNGSRMFCLVQKCKLLKKKSKEWNQTSFGNIFRQLRIV  308

Query  1636  QARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQ-EELLWFQKSRRMWIQDGDRNTAF  1812
               ++K VQ  + ++ +    + +   +    E L Q +   W Q+S+  +   GD N+ F
Sbjct  309   DQKLKNVQNLLLHSANDCTLLQQYNRLLLKREKLLQFDAAYWQQRSKSNFRFKGDTNSKF  368

Query  1813  YHKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNI--MDGSPNDMYC  1983
             +H     RRNR+ I+ ++   GE  S    I + +++ F   F   +    D   +    
Sbjct  369   FHAHASTRRNRNLIKELVSGRGETISHPTRILEDLTSEFGKRFSHDDASSFDVDEDFHLL  428

Query  1984  GPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVK  2163
              P +       L   V   EVK AV+D+    SPGPDG    F+Q +W  V + +   V+
Sbjct  429   EPVISNEDNQFLCAPVLGEEVKVAVYDLAPDKSPGPDGFPPFFFQKYWTLVGNSVIRAVQ  488

Query  2164  KVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNL  2343
                  G++  +I  + I LIPK D+P TA                     N  RPI  +L
Sbjct  489   AFFHSGQLLKEINHTIIALIPKIDNPSTA---------------------NHFRPI--SL  525

Query  2344  IGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTL  2523
              G                                 G +AIKLD+ KAYD ++W ++  TL
Sbjct  526   CG---------------------------------GWLAIKLDMEKAYDRLEWNYVLVTL  552

Query  2524  VDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSW  2703
                GF    IS I   +   S S+L NG     F P RG+RQGDPL+PYLFIL  E L+ 
Sbjct  553   QKLGFDSKWISWIRSCIESVSFSILANGIPGESFFPSRGIRQGDPLSPYLFILCAELLAR  612

Query  2704  DIQE-KVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGL  2880
              +     +      +++ R G  +  L FA+D M+FA A++     I   L K+   SG 
Sbjct  613   QLAAANEQSDRLIGVSVGRSGIRIPFLMFADDTMIFAAANDRSCIRIKEILDKYCSMSGQ  672

Query  2881  NINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGM  3060
              +N +KS    S N + ++KR   ++  ++ S++LG+YLG PI+ +RV+K TF  ++   
Sbjct  673   MVNFNKSAFQVSDNVSDDVKRNFASILQMTESEDLGSYLGCPIIQERVTKETFATVVSRA  732

Query  3061  KRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQ  3240
               +L  WK N LS AGR  L+Q+ L++   + MQ F LP  T + +D+I RDF W     
Sbjct  733   NSQLTKWKANSLSQAGRAVLIQANLATKANFQMQSFFLPKTTLSRLDKIYRDFFWNKDVS  792

Query  3241  NKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKN  3420
             +K  +L+GW+ +C+ K  GG+G RK    N AL  KL W+LV  ++ +WVK+++ KY KN
Sbjct  793   SKSPNLIGWDRVCRPKVCGGIGFRKAGVNNVALQMKLLWKLVKDNNSMWVKLVKNKYFKN  852

Query  3421  KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPL-AFMDEV  3597
             K+ F     A ASW WR +MR R   + G  W++G+G  ++FW D W     L A +   
Sbjct  853   KSLFEYKPTAVASWQWRQLMRLRETFKKGLRWQLGSGSQISFWHDNWVFQFLLKAVVHRA  912

Query  3598  TIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPT  3777
             + P      KVSD  L NR WNV  L + +P  ++  I +  I + +Q  + L W  SP 
Sbjct  913   SYP---VNFKVSDCFLDNRQWNVSLLRANVPEHMVTTISSLYIPMNDQ-QNKLVWGLSPD  968

Query  3778  GAFSVRSAFSHIAG---NDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGM  3948
             G +SV++      G   +  + ++  W+WK+ V  + ++FLW L    L T     +  +
Sbjct  969   GDYSVKTGALLAQGLLPSPPEEVEFRWIWKVDVPPKIKIFLWKLCNDGLPTKDRLEKSHV  1028

Query  3949  TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDW  4128
                  C  C    ET  H+   C F  D +      +  Q S   P    + N   +S +
Sbjct  1029  FLPQQCVLCTSHCETATHLFCLCPFTSDVF------LHLQASKGWPCLPGLANVSASSSF  1082

Query  4129  ING--------CPWGVTFIYTC-WEIWKARNQRIF-ENTASAPMDIMRRANNLTLDTVEV  4278
             ++             +  I T  W IW  RN+ IF E + S+     R A+    +    
Sbjct  1083  LDVLRLLKASLLKQDLEMIVTVWWFIWFFRNKLIFNEESVSS-----RSASFAIAEIYAK  1137

Query  4279  FLNKKCVHVGKMR--------WVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGE  4434
              L  K    GK             W PP +G  K N DG+ K ++G A+ G + RDH G+
Sbjct  1138  ALRPKSKEGGKGAKGSPRSGPSCLWSPPPSGVAKINFDGS-KLSSGHATLGFVIRDHLGD  1196

Query  4435  WLFGFMTNIGVSNS-FAAELWGLRE  4506
              L     ++G S S   AE WGL E
Sbjct  1197  VLLAGSNSLGCSLSVLQAEAWGLLE  1221



>ref|XP_009123679.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1072

 Score =   447 bits (1149),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 282/868 (32%), Positives = 445/868 (51%), Gaps = 32/868 (4%)
 Frame = +1

Query  1699  LERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-G  1875
             L   + TEL      EE  W Q+SR  W++ GDRNT F+H +T  RR  + I +++ + G
Sbjct  39    LIESIKTELRRAYIDEEQFWRQRSRIQWLKQGDRNTGFFHAATRNRRTINSIPVIEDDQG  98

Query  1876  EWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKA  2055
                 + + IS  IS++F  +F        +        K+       LT      E+K+A
Sbjct  99    AVVYEEQEISRVISDYFQKIFTSNGNHSFTQLQGLLTCKVTPEMNQMLTAIPRDSEIKEA  158

Query  2056  VFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKD  2235
             +  +    +PGPDG  A FYQ++W  V   +T  ++       +  +  E+ I LIPK  
Sbjct  159   MASINGGKAPGPDGFSATFYQSYWHIVGEDVTRDIRSFFTTNSLQAQQNETHIRLIPKTT  218

Query  2236  SPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEI  2415
              P++ +D+RPI L N  +KII+K++  R++P++  LI   Q++F+ GR+  DN+++T E 
Sbjct  219   GPKSVADYRPIALCNTHYKIIAKILTRRLKPLLPALISNTQSAFVAGRAITDNVLITHET  278

Query  2416  VHYMRLKKGKKGL-MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSIS  2592
             +HY+R    KK   MA+K D+ KAYD I+W F+   L   GF    IS IM  +   S +
Sbjct  279   LHYLRTSDAKKYCSMAVKTDMSKAYDRIEWSFVREVLKLLGFDPIWISWIMCCIESVSYT  338

Query  2593  LLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKP-ITLSRGGTG  2769
              L NG      +P RGLRQGDPL+P++FIL  E LS  + EK +     P + ++RG   
Sbjct  339   FLINGSPQGSVKPSRGLRQGDPLSPHIFILCTEVLS-ALCEKGQADGSLPGVRVARGCPA  397

Query  2770  VSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGL  2949
             ++HL FA+D M F ++       +M  L  +   SG  IN  KS I  S  T  E++  +
Sbjct  398   INHLLFADDTMFFCKSKASCVSALMKILSTYEAVSGQRINPQKSAITFSAKTPPEVRARV  457

Query  2950  KNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQS  3129
             K    I     +G YLG+P    R  +  F  I+D +++K  +W    LS AG++ +++S
Sbjct  458   KEAMAIEAEGGIGKYLGLPENFGRKKRDIFAAIVDRIRQKSHSWSTKFLSSAGKQIMLKS  517

Query  3130  ALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGL  3309
              L++MP YTM  FK+P   C  I  +   F W  + + KK+  V W+ +   K AGGLG 
Sbjct  518   VLAAMPCYTMSCFKIPLSLCKQIQSLLTRFWWDANPEKKKMCWVAWSTLALPKYAGGLGF  577

Query  3310  RKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGR  3489
             R    FN+ALLAK+ W+++     L  +V+  KY ++ +F    + A+AS GWRSI+ GR
Sbjct  578   RDVETFNDALLAKIGWRVIKEPQSLLARVLLGKYARDASFLNCSVPASASHGWRSILAGR  637

Query  3490  SIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWN  3663
              I+  G +W +GNG S+N WS+ W + + P   M     P      KVSD + P    W+
Sbjct  638   EILRKGLSWMVGNGESINVWSEPWLSFNSPTQPMGPQ--PFHSMSLKVSDLLCPLTNNWD  695

Query  3664  VDKLSSLLPH--DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF--SHIAGNDED  3831
             +DK+   LP   D I  I+ + +       D+L W    +G++S ++ +    +A   + 
Sbjct  696   LDKIRHHLPQYEDTILQIKTSSVPSL----DTLMWLPESSGSYSTKTGYGLGMLANRGQT  751

Query  3832  AMDTSW-----VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETM  3996
               DTS+     +W +  + + + F+W ++R  +  +    R+G +   +C  CG  ++ +
Sbjct  752   EEDTSFNWLKNIWNIDTSPKIKDFIWKVVRKAIPVSANLERRGFSP-FVCKKCGAPEDDL  810

Query  3997  NHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCC-ASDWINGCPWGVT---FIY  4164
              HV ++C  A + W     P  F  S   P  S V +    A   I   P G+T   + +
Sbjct  811   -HVFLKCPVAAEVWNLV--PTRFAPS---PSLSSVSDMIIGAQGMIPLPPTGLTSPIWPW  864

Query  4165  TCWEIWKARNQRIFENTASAPMDIMRRA  4248
               W +WKARN  IFEN A    +I  ++
Sbjct  865   ILWNLWKARNCLIFENRAFTAQEIALKS  892



>gb|EAZ20803.1| hypothetical protein OsJ_36426 [Oryza sativa Japonica Group]
Length=787

 Score =   438 bits (1127),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 251/803 (31%), Positives = 412/803 (51%), Gaps = 37/803 (5%)
 Frame = +1

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             N PW+++GDFN+     E +     N ++  +F +    C L  +G SGV Y++  +  G
Sbjct  13    NLPWLVLGDFNEALWQFEHFSVRQRNETQMQSFRDVLQTCDLHALGFSGVPYTYDNRREG  72

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             R   R +LDRAL + + + +F  A+   L  T SDH P+       +      +   +E 
Sbjct  73    RNNIRVRLDRALADNDWREMFGNARVSHLTSTRSDHCPISVCFSPEDCRPFHTKCLHYEI  132

Query  1480  AWLTREDYRDIWGRVWS-----NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQAR  1644
              W      +++    WS     + L ++  A+  V      W+K    N+       + R
Sbjct  133   CWEREPSLQEVITDAWSEGVSKSDLGEISTALHRVMTRLHSWSKVKVKNVGKELEKARKR  192

Query  1645  IKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             +  +        S     L R+ +  LNE+L +EE+LW Q+SR  W+++GDRNT F+H  
Sbjct  193   LTSLL------VSDAESSLVRQALDHLNELLYREEMLWLQRSRINWLKEGDRNTRFFHSK  246

Query  1825  TLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
              + R  +++I  L+  +G  +     +    +++F  LF                P LD 
Sbjct  247   GVWRAKKNKISALRDASGTVHHLTNVMEQMATDYFKTLFS-------------ADPNLDH  293

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
              ++  L +E            +    +PGPDG  A F+Q  W  +K  +   VK+    G
Sbjct  294   SRVTTLIQE-----------KIGPLKAPGPDGFPARFFQRNWGLLKEEVVKAVKEFFNTG  342

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P  + E+ I LIPK D P    D+RPI+L NV +K++SK +VNR+RPI+  LI P Q+
Sbjct  343   VMPAGVNETAIVLIPKVDQPIELRDYRPISLCNVLYKVVSKCLVNRLRPILDELISPNQS  402

Query  2362  SFLPGRSTADNIILTQEIVHYMRL-KKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+PGR   DN ++  E  H ++  KK      A KLDL KAYD +DW+FLE ++   GF
Sbjct  403   AFVPGRMITDNALIAFECFHSIQKNKKLSSATCAYKLDLSKAYDRVDWKFLEQSMYKLGF  462

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
                 ++ IM  +     S+ +NG  L+ F P RGLRQGDPL+P+LF+  ++ LS  ++E+
Sbjct  463   AHCWVNWIMSCITSVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFVVDGLSLLLEER  522

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
             V      P+ + R   G+S+L F +D +LF +A+ +Q  ++MN L  ++  +G  IN  K
Sbjct  523   VAQGALSPVHICRRAPGISNLLFTDDTLLFFKATSEQANVVMNVLADYAWCTGQLINQEK  582

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
              +I     +  +++  ++++  +  +     YLG P    R++K  F  + + + +++  
Sbjct  583   CSIMFGEASPPDVQESVRSVLQVGSTSFDDKYLGFPTPEGRMNKGKFQSLQEKLCKRIMQ  642

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W  N LS  G+  L+++ L ++ VY M +FKLP   C+++ ++ R+F WG     +K H 
Sbjct  643   WGENFLSSGGKEILIKAVLQAITVYVMGIFKLPDSICDELTKLTRNFWWGSEKGKRKAHW  702

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
               W+ I K K  GGLG R    FN ALLA+ AW+L+ +   L V+V++ KY  N +   T
Sbjct  703   KSWDCITKPKHCGGLGFRDFRLFNQALLARQAWRLIENPHSLCVQVLKAKYYPNGSLIDT  762

Query  3439  PMIANASWGWRSIMRGRSIVELG  3507
                 NAS GWR+I  G  +++ G
Sbjct  763   SFGGNASSGWRAIEYGLELLKKG  785



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score =   461 bits (1185),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 357/1210 (30%), Positives = 558/1210 (46%), Gaps = 64/1210 (5%)
 Frame = +1

Query  967   NFAVIRNTSQAIHGLVSGP--HSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMM  1140
             N  V+ +  Q +H  +S P     +  +F Y +  R  +   WN   S SS+   PW++ 
Sbjct  662   NCEVLMDHIQCLHVRLSLPWLPHPISATFVYAKCTRQERLELWNCLRSLSSDMQGPWMVG  721

Query  1141  GDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRK  1320
             GDFN I    E+   +  +     +FV +   CGL+D G  G S++W         QR  
Sbjct  722   GDFNTIVSCAERLNGAPPHGGSMEDFVATLFDCGLIDAGFEGNSFTW---TNNHMFQR--  776

Query  1321  LDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTRED  1500
             LDR ++N E  + F   +   L R  SDH PL   C   +        F    AW    D
Sbjct  777   LDRVVYNPEWAHCFSSTRVQHLNRDGSDHCPLLISCATASQKGPSTFRFLH--AWTKHHD  834

Query  1501  YRDIWGRVW-----SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQES  1665
             +     R W     S+ L         +    K WNK+ FG+IF +    +   +  ++ 
Sbjct  835   FLPFVERSWQVPLNSSGLTAFWIKQQRLKRDLKWWNKQIFGDIFEKLKRAEIEAEKREKE  894

Query  1666  VFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNR  1845
                + S   + L  K   +LN  L  EEL W QKS   W+ +G+RNT F+H     +R R
Sbjct  895   FQQDPSSINRNLMNKAYAKLNRQLSIEELFWQQKSGVKWLVEGERNTKFFHLRMRKKRVR  954

Query  1846  SRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPK-LDTGQMHKL  2019
             + I R+    G    D + I +    +F +L   +   D S  D    P+ +       L
Sbjct  955   NNIFRIQDSEGNIYEDPQYIQNSAVQYFQNLLTAEQC-DFSRFDPSLIPRTISITDNEFL  1013

Query  2020  TREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKI  2199
                 ++ E+K+ VF++ K    GPDG  + FYQ  W+ +K  +   V        +P  +
Sbjct  1014  CAAPSLKEIKEVVFNIDKDSVAGPDGFSSLFYQHCWDIIKQDLLEAVLDFFNGTPMPQGV  1073

Query  2200  LESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGR  2379
               + + L+PKK +    SDFRPI+L  V  KI++K + NR+  I+ ++I   Q+ F+ GR
Sbjct  1074  TSTTLVLLPKKPNSCQWSDFRPISLCTVLNKIVTKTLANRLSKILPSIISENQSGFVNGR  1133

Query  2380  STADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISL  2559
               +DNI+L QE+V  +   K + G + +KLD+ KAYD ++W+FL   +  FGF    IS+
Sbjct  1134  LISDNILLAQELVGKLD-AKARGGNVVLKLDMAKAYDRLNWDFLYLMMKQFGFNDRWISM  1192

Query  2560  IMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWK  2739
             I   +     SLL NG  +  F+  RGLRQGD ++P LF+LA + LS  I +    ++  
Sbjct  1193  IKACISNCWFSLLINGSLVGYFKSERGLRQGDSISPLLFVLAADYLSRGINQLFN-RHKS  1251

Query  2740  PITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSP  2919
              + LS     +SHL FA+D+++F        + I+  L+++   SG  +N  KS    + 
Sbjct  1252  LLYLSGCFMPISHLAFADDIVIFTNGCRPALQKILVFLQEYEEVSGQQVNHQKSCFITAN  1311

Query  2920  NTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHT-FGYILDGMKRKLANWKGNML  3096
                   ++ + + TG         YLG P LHK   K T F  ++  ++ +++ W+   L
Sbjct  1312  GCPMTRRQIIAHTTGFQHKTLPVIYLGAP-LHKGPKKVTLFDSLITKIRDRISGWENKTL  1370

Query  3097  SLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDI  3276
             S  GR TL++S LSS+P+Y +QV K P      I+R+   FLWGDS  +K++H   W+ +
Sbjct  1371  SPGGRITLLRSVLSSLPLYLLQVLKPPVVVIEKIERLFNSFLWGDSTNDKRIHWAAWHKL  1430

Query  3277  CKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNK-NFFATPMIAN  3453
                   GGL +R+  D  +A   KL W+  T  + LW K ++ KY   +   +  P + +
Sbjct  1431  TFPCSEGGLDIRRLTDMFDAFSLKLWWRFSTC-EGLWTKFLKTKYCMGQIPHYVHPKLHD  1489

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVS  3633
              S  W+ ++RGR +      WRIG G SL FW D W GD+PL      + P  +++    
Sbjct  1490  -SQVWKRMVRGREVAIQNTRWRIGKG-SLFFWHDCWMGDQPLV----TSFPHFRNDMSTV  1543

Query  3634  DFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI  3813
                     W+VDKL+  LP +++D I   PI   +   D  YW  +  G FS RSA+  I
Sbjct  1544  HNFFNGHNWDVDKLNLYLPMNLVDEILQIPIDRSQ--DDVAYWSLTSNGEFSTRSAWEAI  1601

Query  3814  AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDET  3993
                    +  S +W   +      FLW +    +  ++    KG    + C  C + +E+
Sbjct  1602  RLRKSPNVLCSLLWHKSIPLSISFFLWRVFHNWIPVDIRLKEKGFHLASKCICC-NSEES  1660

Query  3994  MNHVLMECSFAKDCWRRTHHPVSFQYSLVTP------LKSWVKNNCCASDWI-NGCPWGV  4152
             + HVL +   AK  W       SFQ  +  P      L +W      + D++  G    +
Sbjct  1661  LIHVLWDNPIAKQVW--NFFANSFQIYISKPQNVSQILWTWY----LSGDYVRKGHIRIL  1714

Query  4153  TFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVG----KMRW  4320
               ++ CW +W  RN     +       ++ +   L     + +L K     G       W
Sbjct  1715  IPLFICWFLWLERNDAKHRHLGMYSDRVVWKIMKLLRQLQDGYLLKSWQWKGDKDFATMW  1774

Query  4321  VCWQPPET--------------GWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTN  4458
               + PP+T              G  K N DG+ ++N   A+ GG+ RDH G  +F F  N
Sbjct  1775  GLFSPPKTRAAPQILHWVKPVPGEHKLNVDGSSRQNQ-TAAIGGVLRDHTGTLVFDFSEN  1833

Query  4459  IGVSNSFAAE  4488
             IG SNS  AE
Sbjct  1834  IGPSNSLQAE  1843



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score =   456 bits (1174),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 336/1175 (29%), Positives = 534/1175 (45%), Gaps = 116/1175 (10%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESF  1230
             Y   +   K R W            PW+M GDFN+I  + E+        S    F  + 
Sbjct  400   YGDAHSETKHRTWTTMRGLIDNPTTPWLMAGDFNEILFSHEKQCGRMKAQSAMDEFRHAL  459

Query  1231  SACGLLDMGTSGVSYSW----FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
             + CGL D+G  G +++W      QEG     R  LDRA+ N E + +FP A+ I     H
Sbjct  460   TDCGLDDLGFEGDAFTWRNHSHSQEG---YIREWLDRAVANPEWRAMFPAARVINGDPRH  516

Query  1399  SDHHPLKFLCEAgnpprrenrpfrf---egAWLTREDYRDIWGRVWSNSLLDVVGAISEV  1569
             SDH P+    E  N   R          E AWL  E ++++    W     DV   +  +
Sbjct  517   SDHRPVIIELEGKNKGVRGRNGHNDFRFEAAWLEEEKFKEVVKEAW-----DVSAGLQGL  571

Query  1570  TNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEE  1749
                                  + A + GV   +   +S  L  LE++L     + +K+E 
Sbjct  572   L--------------------VHASLAGVAAGLSSWSSNVLGDLEKRL-----KKVKKE-  605

Query  1750  LLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFI  1929
                 +  RR  I           +  ++R    R R+ K+                   +
Sbjct  606   ---LETCRRQPIS----------RDQVVREEVLRYRLEKLE--------------QQNLL  638

Query  1930  DLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAA  2109
             D+  RK  + G+ N+              L  E T  EVK+A+  +    +PGPDG+ A 
Sbjct  639   DVVDRK--VSGAMNE-------------SLRAEFTREEVKEALDAIGDLKAPGPDGMPAG  683

Query  2110  FYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSF  2289
             FY+  W+ V   +T  V +VLR G +P    +  I LIPK   PE   D RPI+L NV +
Sbjct  684   FYKACWDVVGEKVTDEVLEVLRGGAIPEGWNDITIVLIPKVKKPELIKDLRPISLCNVCY  743

Query  2290  KIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-GKKGLMAIK  2466
             K++SKV+ NR++ I+ ++I P Q++F+PGR  +DNI++  E+ HYMR K+ G+ G  A K
Sbjct  744   KLVSKVLANRLKKILPDVISPAQSAFVPGRLISDNILIADEMTHYMRNKRSGQVGYAAFK  803

Query  2467  LDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLR  2646
             LD+ KAYD ++W FL   ++  GF  + ++LIM  V   +  +  NGE    F P RGLR
Sbjct  804   LDMSKAYDRVEWSFLHDMMLKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLR  863

Query  2647  QGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASED  2826
             QGDPL+PYLF+L  E  S  + +         I + +G   VSHL FA+D ++   A+  
Sbjct  864   QGDPLSPYLFLLCAEGFSALLSKTEEEGRLHGIRICQGAPSVSHLLFADDSLILCRANGG  923

Query  2827  QGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIP  3006
             + + +   L+ +   SG  IN  KS +  SPNT+S  K  +     +        YLG+P
Sbjct  924   EAQQLQTILQIYEECSGQVINKDKSAVMFSPNTSSLEKGAVMAALNMQRETTNEKYLGLP  983

Query  3007  ILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGT  3186
             +   R     F Y+ + + +++  WK  +LS AG+  L+++   ++P + M  F+L    
Sbjct  984   VFVGRSRTKIFSYLKERIWQRIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDL  1043

Query  3187  CNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLV  3366
             C+ I ++   + W +  ++ K+H + WN +   K+ GGLG R    FN A+LAK  W+L+
Sbjct  1044  CDQISKMIAKYWWSNQEKDNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLI  1103

Query  3367  TSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNF  3546
                D L  +V+R KY    + F     +N S+ WRSI +G  +++ G  WR+G+G  +N 
Sbjct  1104  QDPDSLCSRVLRAKYFPLGDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRMGDGSKINI  1163

Query  3547  WSDWWTGDKPLAFMDEVTIPDSQS-EAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRAT  3720
             W+D W    P  +  +   P   +   KV + I P   TW+ D LS     + +  I++ 
Sbjct  1164  WADPWI---PRGWSRKPMTPRGANLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSI  1220

Query  3721  PIAVCEQVSDSLYWPRSPTGAFSVRSAFS--------------HIAGNDEDAMDTSW--V  3852
             P+ V  ++ D L W     G F+V+SA+                   N E   D  W  +
Sbjct  1221  PVHV--EMEDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKL  1278

Query  3853  WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
             WK+ V  + + FLW +    L        +GM  DT C  CG  +E   H+  +C   K 
Sbjct  1279  WKLGVPGKIKHFLWRMCHNTLALRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKK  1338

Query  4033  CWRRTH-HPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFE  4209
              W+  +   +       T  K+ +++  C  +         + I   W+ WK RN+    
Sbjct  1339  VWQALNLEELRSMLEQQTSGKNVLQSIYCRPEIER-----TSAIVCLWQWWKERNEVREG  1393

Query  4210  NTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNT  4389
                 +P ++     +   + V + + +K    G+     W+ P   ++K NTDGA+  N 
Sbjct  1394  GIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTGEC--AVWRRPPLNFVKINTDGAYSSNM  1451

Query  4390  GLASAGGLARDHKGEWL-FGFMTNIGVSNSFAAEL  4491
                  G + RD  G  L  G      + ++F AE+
Sbjct  1452  KQGGWGFVIRDQTGAVLQAGAGPAAYLQDAFHAEV  1486



>emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   452 bits (1164),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 354/1244 (28%), Positives = 580/1244 (47%), Gaps = 83/1244 (7%)
 Frame = +1

Query  946   FWRSSIF--NFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              W +S F    ++I+    AI G +   + +  +   Y       +   W +   +  E 
Sbjct  73    IWNTSFFAKKSSIIKRHWIAIKGSLVSHNFDCILINVYNSCLASIRAEVWTEIRDFWKEC  132

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               P +++GDFN++ ++ E+  S   + S    F +      LL++ +S   ++WFR    
Sbjct  133   ALPSLIIGDFNEVLNSSER-RSLIASQSEMTKFRDFVQNLQLLEIPSSSGGFTWFRGNS-  190

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
                 +  LDR   N E   LFP  K  +L R  SDH PL    E         +PFRF+ 
Sbjct  191   ----KSLLDRLFINPEWLILFPGLKLSLLMRGLSDHCPLLVHNE---DKNWGPKPFRFQN  243

Query  1480  AWLTREDYRDIWGRVW-SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
              WL+  +   I   VW ++S +  VG +  V    K WN+E +GNI  R + ++  I+  
Sbjct  244   CWLSDPNCLKIVKEVWQASSGVSAVGKLKAVRKRLKVWNQEEYGNIDNRISKMENLIQQY  303

Query  1657  QESVFYNTSRGLQVLER-KLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLI  1833
              E          ++ E+ K   EL + +K+ E+ W Q +R  W+++GDRNT F+H     
Sbjct  304   DEISNQRILTEDELEEKQKAQVELWKWMKRREVYWAQNARISWLKEGDRNTRFFHTIASN  363

Query  1834  RRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH  2013
             +R ++ I  +++ G+ + D + I     + F  +F   N    +   +    ++   Q  
Sbjct  364   KRRKNSIICIEVKGKESGDPQIIKREAVSHFKKIFAENNYNRPTFKGLSFR-QITDDQAS  422

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
              LT+  +  E+ +AV       +PGPDG    F ++ WE VKS I   V+K      +P 
Sbjct  423   DLTQPFSNKEIDEAVSSCAADKAPGPDGFNFRFIKSAWETVKSDIYAMVRKFHDSSTLPQ  482

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
                 ++ITLI K D+P+  +D+RPI+++   +KII+K++  R++ ++ +LIGP Q S++ 
Sbjct  483   GCNIAYITLIQKIDNPKNFNDYRPISMVGCIYKIIAKLLARRLQGVINSLIGPLQFSYIE  542

Query  2374  GRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             GRS  D  ++  E++ + + K  +  L+  KLD HKAYDSI W FLE  L +  FP    
Sbjct  543   GRSILDGALIASELIDHCKRKSIEAALL--KLDFHKAYDSISWSFLEWVLKEMNFPDQWC  600

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
               IM  V  +++S+L NG   APF+  RGLRQGDPL+ +LF+L  E L+  I +      
Sbjct  601   KWIMNCVSTAAVSILVNGSPCAPFKLQRGLRQGDPLSSFLFVLIAESLNQIIMKATSQNL  660

Query  2734  WKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC  2913
             WK + + +G   V+HL +A+D ++F +A+ +  + +   L  F   SGL IN  KS++  
Sbjct  661   WKGVEVGQGEIIVTHLQYADDTLIFCDANIESLKNVKKALILFQLASGLQINFHKSSLIG  720

Query  2914  SPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNM  3093
                ++  IK   + L    + +   TYLG+PI  +      +  I+  + R+LA WK  M
Sbjct  721   LNTSSGWIKVAAEALL-CKIGEIPFTYLGVPIGGQCSRIQLWDPIIAKISRRLATWKCKM  779

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             LS+ GR TL++S+L S+PVY M ++ +P    N I  + R FLW  S     + LV W+ 
Sbjct  780   LSIGGRLTLIKSSLISLPVYFMSIYPMPQDVVNKIIGLARQFLWAGSDGKNAMPLVAWSV  839

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKY-VKNKNFFATPMIA  3450
             +   K  GG+G+      N ALL K  W+L     +LW K++R KY   N    +   I 
Sbjct  840   LQLPKSLGGMGIGNIKHKNQALLFKWIWRLFDEPSQLWCKIIRAKYKYPNTLTISDIKIP  899

Query  3451  NASWGWRSI----MRGRSIVEL---GAAWRIGNGLSLNFWSDWWTGDKPLA--FMDEVTI  3603
             NA   WRSI    +R + + ++   G    + NG    FW D W G+  L   F    TI
Sbjct  900   NAGGPWRSICASYLRNQDVKDMAIKGVRKNVKNGHDSLFWHDVWIGEATLKSLFPRLFTI  959

Query  3604  PDSQSEAKVSDFILPNR--TWNVDKLSSLLPHDIIDGIRATPIA----VCEQVSDSLYWP  3765
               S + +  S          W+      L P D+I+      +     V  +  D L W 
Sbjct  960   AMSPNGSVASYGFWDGLAWVWSFSWRRMLRPQDLIEKTHLDSLLQQAHVAYEKKDQLIWA  1019

Query  3766  RSPTGAFSVRSAFSHI----AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMER  3933
              S +G FS +S    +         DA++   VW+  V  R  +F+W+ + G++ T  + 
Sbjct  1020  YSSSGKFSTKSFSLEVDKLSPPPHHDAING--VWRGLVPHRIEIFVWMALLGKISTKHKL  1077

Query  3934  WRKGMT--EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVS-------FQYSLVTP  4086
              + G+   +D +C  C +  ET +H+L+ C+FA+  W   H   S       F ++L   
Sbjct  1078  AKIGIIPKDDDICILCSNSSETSDHLLLHCNFARSLW---HWWFSLWNIQWVFPHTLREA  1134

Query  4087  LKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTAS---------------  4221
                W   + C         W   F    W +WK RN RIFE + S               
Sbjct  1135  FDQWQTRSRCV---FFKKAWLTIFFIIVWSVWKERNSRIFEKSESSVKDIQDLILLRLGW  1191

Query  4222  -----------APMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTD  4368
                        +P D++R  + L  +     +    +       + W PP   ++K+N D
Sbjct  1192  WIKGWCDEFPYSPNDVLRSPSCLIWNGANSLMQYPKLQPCP---IVWTPPIENFLKWNVD  1248

Query  4369  GAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
              +       ++ GG+ R+ +G ++  F + I       AE+ G+
Sbjct  1249  ASANPLLSTSAMGGVLRNSQGNFMCLFSSPIPFMEINCAEILGI  1292



>ref|XP_008794416.1| PREDICTED: uncharacterized protein LOC103710479 [Phoenix dactylifera]
Length=1252

 Score =   450 bits (1157),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 341/1176 (29%), Positives = 542/1176 (46%), Gaps = 91/1176 (8%)
 Frame = +1

Query  1051  YVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCL-NFVES  1227
             Y   +  A+   W +  S   +   P ++ GDFN I D QE+ G  S +  R +  F E 
Sbjct  17    YASTDFRARRSLWEEA-SKLVDQGQPMLIAGDFNCIDDPQEKMGGRSFSYQRKVREFQEF  75

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
              S  GL+D+G +G  ++W   + G      +LDRA         F +     LPR  SDH
Sbjct  76    ISTNGLIDLGFTGPRFTWCNNQQGPARVWERLDRAFATAGWIQEFSDYHVKHLPRIASDH  135

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWG---RVWS-----NSLLDVVGAIS  1563
              P+  +C   + P   + PFRFE  WL    Y   WG    VW+     N++  V   + 
Sbjct  136   SPI-LVC--TDRPIPYHCPFRFERLWLC---YPRSWGVVSEVWNMPVRGNAMYRVSRRLE  189

Query  1564  EVTNLSKKWNKETFGNIFGRKASLQARIKGVQ--ESVFYNTSRGLQVLERKLVTELNEVL  1737
                   ++WN+   GNIF R   L+  I  +Q  E+     S+      R  ++  N +L
Sbjct  190   LARRHLRRWNRVEVGNIFRRIEELEEAIANLQLREASGGGLSQAELSELRSFLSMHNALL  249

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHI  1914
              Q+E+ W                         RR R+RIR ++  +G+   D   I   +
Sbjct  250   SQQEIFW-------------------------RRQRNRIRSIRDEDGQSTEDPNMICRVL  284

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH-----KLTREVTMCEVKKAVFDMKKFG  2079
               FF     R    + + + M+    L + ++       L R V+  E+++A++ ++   
Sbjct  285   EQFF-----RTRWTERTGSGMHTELPLSSERVSDVDSLALIRPVSGQEIQEALWSLEGDK  339

Query  2080  SPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDF  2259
             +PGPDG    F++ +W  V   +   +++      + P+   +FI LIPK+ +      F
Sbjct  340   APGPDGFPPVFFRRYWSIVGLDVIEAIQQFFSMAVMSPEWQRTFIALIPKRQNATEPGHF  399

Query  2260  RPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK  2439
             RPI+L +  +KI +K++  R+R I+ ++I P Q +F+ GR+ +DN+++ QE +  +    
Sbjct  400   RPISLCSTLYKITAKILAMRLRGILPSIICPEQGAFIGGRNISDNVLIAQEFMFDLVKAP  459

Query  2440  GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLA  2619
              ++ LM +KLD+ +AYD + WEFL  +L  FGF +  I  +M  V  +S S+L NG    
Sbjct  460   MRRCLMGVKLDMERAYDRMCWEFLRHSLQSFGFHEVWIRWVMGCVMGTSFSILVNGTPSP  519

Query  2620  PFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDL  2799
              FQ   GLRQG PL+P LFI+  + LS  ++  V  +  +     +G T +SHL FA+D 
Sbjct  520   FFQTSVGLRQGCPLSPLLFIICADALSRALRAAVGTQTLEVYRPVQGATPISHLLFADDC  579

Query  2800  MLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSD  2979
             +L A A+     +I   L  +   SG  IN+ KS+I  SP T ++IK G+    G+    
Sbjct  580   LLLARATRQNAHVIRRILLAYCSASGQRINLDKSSILFSPKTKAQIKAGIMETLGVGEQV  639

Query  2980  NLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTM  3159
                TYLG+PIL +R+       +   ++ +L  W+ + LS+ GR TL +S LS++PVY +
Sbjct  640   GTLTYLGVPILGRRMRSGDTITLEHSIRHRLEGWQMHSLSMMGRVTLARSVLSAIPVYLV  699

Query  3160  QVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNAL  3339
                  P  +   ++R+ RDF+WG      +VHLV W  +C+    GGLG+   +    A 
Sbjct  700   SHTVPPVASLRSVERLIRDFIWGRRGDRGRVHLVAWEVVCQPVSCGGLGVPSLVSRREAS  759

Query  3340  LAKLAWQLVTSHDKLWVKVMREKYVK-----NKNFFATPMIANASWGWRSIMRGRSIVEL  3504
             + +LA  L+   D LW  +MR KY             +P+       WR I      V  
Sbjct  760   VMRLAASLMLEPDSLWSSLMRAKYGALTVGIRAGRLQSPI-------WREISARAFSVLP  812

Query  3505  GAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSS  3681
                W IG+G+S++   D W  + P++ +  +         +V D ++P   +W+   +  
Sbjct  813   AIRWAIGDGMSVDVLEDSWVTELPISRLPALVDTSRLLGRRVGDLLVPGEGSWDEVFIRE  872

Query  3682  LLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSH--IAGNDEDAMDTSWVW  3855
                  +++ I A PI    +  D L W   PTG   VR+   H       E  ++  W+W
Sbjct  873   TFGEQLVERILALPIPSRAE-PDRLIW--LPTGRSRVRARDIHAWTRREPERRIEGGWIW  929

Query  3856  KMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDC  4035
             +MRV  R  LFLW +  G L T     R+GM   +LC  C D +ET+ HVL+ C  A  C
Sbjct  930   RMRVHPRVALFLWKVAWGCLPTRSVLARRGMRMGSLCEVCLDAEETVGHVLLRCPTAVQC  989

Query  4036  WRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENT  4215
             WR     +   +  V  +  ++  +       +    G    Y  + IW ARN R+FE  
Sbjct  990   WREASALLPPIWETVEDMLRFLSESIRRP---SDAETGSLVAYLAYHIWLARNDRLFEGG  1046

Query  4216  ASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGW---IKFNTDGAFKRN  4386
                P  +M RA        E+ +       G+ R       ET W      N DG    +
Sbjct  1047  RPTPRVVMERALR---QAAEISMMTALAPPGRTR-------ET-WGTCTAVNFDGGMAED  1095

Query  4387  TGLASAGGLARDHKGEWL-FGFMTNIGVSNSFAAEL  4491
                   G + RDH+G ++  G  +  GVS +  AEL
Sbjct  1096  GASGGVGFVIRDHRGTFIAAGGRSTFGVS-AVGAEL  1130



>emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1379

 Score =   452 bits (1163),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 361/1246 (29%), Positives = 575/1246 (46%), Gaps = 87/1246 (7%)
 Frame = +1

Query  946   FWRSSIFNFAVIRNTSQAIHGL-VSGPHSNVR---VSFAYVRPNRM-AKERFWNDCLSYS  1110
              W  S F+   ++++S   H + +SG  S +    + F    PN + A+   W + +++ 
Sbjct  73    MWNKSAFS---MKSSSVNQHWIAISGSFSRINFECILFNVYNPNTVGARASVWEEIVTFH  129

Query  1111  SEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQ  1290
                  P +++GDFN+  +  ++ GS   +     NF        LL++  S   ++WFR 
Sbjct  130   KTNPLPSLLIGDFNETLEPDDR-GSLLFSNIGTDNFKNFLQVMELLEVSPSNKGFTWFR-  187

Query  1291  EGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfr  1470
               GR+  +  LDR L N E  N FP  +  +L R  SDH PL       +      +PFR
Sbjct  188   --GRS--KSVLDRLLLNPEWINEFPSMRLSLLQRGLSDHCPL---LTNIHTQNWGPKPFR  240

Query  1471  fegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARI  1647
             F+  WLT     +I  + W  S  + ++  +  V    K WN++ FG+I      ++  I
Sbjct  241   FQNCWLTDPHCLEIVNKTWLESTNMPMIDKLRRVKIRLKAWNRDEFGHIDTNIKIMEDEI  300

Query  1648  KGVQESVFYNTSRGLQVLERK--LVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHK  1821
             +   +++        Q +ER+    ++L   +K++EL W Q SR +W++ GDRNT F+H 
Sbjct  301   QKF-DTISNERELDEQEIERRKEAQSDLWMWMKRKELYWAQNSRILWLKHGDRNTKFFHM  359

Query  1822  STLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
                 ++ R+ I  +K+NG        I +    FF ++F  +     +   +    +L  
Sbjct  360   VASNKKRRNFIASIKVNGRRIEKPNQIKEEAVTFFKEIFTEEFTERPTLEGLQFN-QLSQ  418

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
              Q   L +  +  E+  AV       +PGPDG    F +  WE +K  + T V++     
Sbjct  419   NQADSLIQPFSDEEIDYAVNSCASDKAPGPDGFNFKFIKNAWETIKEDVYTLVREFWATS  478

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
             ++P     +FITLIPK D+PE   DFRPI+++   +KII+K++  R++ +M +LIGP Q+
Sbjct  479   KLPKGSNSTFITLIPKIDNPENFKDFRPISMVGCVYKIIAKLMAKRIQRVMSSLIGPLQS  538

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
             S++ GR   D  ++  E++   + KK +  L+  KLD HKAYDS+ W FL+ TL    FP
Sbjct  539   SYVEGRQILDGALVASEVIDLCKRKKMEAILL--KLDFHKAYDSVSWSFLQWTLAQMKFP  596

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
                   +M  V  +S S+L NG    PF+  RGLRQGDPL+P+LF++  E L+  I +  
Sbjct  597   PQWCKWVMACVASASASILINGSPSRPFKLHRGLRQGDPLSPFLFVIIGEALNQLIIKAT  656

Query  2722  RVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKS  2901
             R+  W+ I  SR G  +SHL +A+D ++F++ S D  + I + L  F   SGL +N  KS
Sbjct  657   RLNLWRGIETSRDGPMISHLQYADDTLVFSDTSTDSLKSIKSTLILFQLVSGLQVNFHKS  716

Query  2902  NIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANW  3081
             ++    N +        NL    V     TYLG+PI         +  +++ +  KLA W
Sbjct  717   SLI-GLNISDARANNAANLLQCKVGSIPFTYLGLPIGGNPSRIQFWKPVIEKLCEKLAMW  775

Query  3082  KGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLV  3261
             K  MLS+ GR TL++S+L+S+P+Y M +F +P G    I+ I R FLW   A+ K +  V
Sbjct  776   KSKMLSIGGRLTLIKSSLASLPLYFMSLFPIPKGVVEKINMITRRFLWSGCAEKKTLPPV  835

Query  3262  GWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATP  3441
              W  +   K  GGL +   +  N A+L K  W+     + LW KV++ KY        + 
Sbjct  836   SWKVVQLPKSRGGLNIGNVMHKNLAMLFKWIWRFFQEPNNLWCKVIKSKYNYAAPLTISS  895

Query  3442  MIANASWG-WRSI-------MRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMD--  3591
             +    S G W  I          +S++++G    IGNG +  FW D W    PL  +   
Sbjct  896   LTIPKSGGPWSKICTAILNDQAAKSVMKIGLRKIIGNGGNTLFWLDPWISSHPLKILYPR  955

Query  3592  --EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIID--GIRATPIAVCEQV--SDS  3753
                + I  + S A    +      W+     +L P D I+   + A   +VC  +   D 
Sbjct  956   LFSIAIHPNASVAAHGFWEGYFWVWSFSWRRNLRPRDKIEKANMDALLKSVCPSLLCEDK  1015

Query  3754  LYWPRSPTGAFSVRSAFSH----IAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllT  3921
             L W    +G FS +S  +     +    +DA+    VW+  V  R  +F+W  M G++ T
Sbjct  1016  LAWTHDKSGKFSTKSFNAELDKLLPHVHQDAVKG--VWRGLVPHRIEIFVWSAMIGKINT  1073

Query  3922  NMERWRKGM--TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVS----FQYSLVT  4083
               +    G+   ED+ C  C    ET +H+L+ C FA+  W       S    F  SL  
Sbjct  1074  RHKLATYGIIPVEDSSCPMCNSTPETSDHLLLHCLFAQRIWTWWLDLWSIKWVFPMSLRM  1133

Query  4084  PLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTAS--------------  4221
                 W   N   S +     W   F    W +WK RN RIF N  +              
Sbjct  1134  AFDQWQSTN--KSPFFKKI-WASIFFIVVWSVWKERNDRIFNNKNTSIKDIRDMVLLRLG  1190

Query  4222  ------------APMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNT  4365
                         +P+DI R  + L  +      N+  V         WQ P    IK+N 
Sbjct  1191  WWISGWSEKFPYSPLDIQRNPSCLRWEE-----NRCIVDCSPASVTTWQAPGCSSIKWNV  1245

Query  4366  DGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLR  4503
             D +    T  ++ G + R+  G ++  F + I       AE+  + 
Sbjct  1246  DASVDPRTSCSAIGRVLRNQHGNFMCLFSSPIPPMEINCAEVLAIH  1291



>pir||S65812 RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW15) - Arabidopsis 
thaliana retrotransposon Ta11-1
 gb|AAA75254.1| reverse transcriptase [Arabidopsis thaliana]
Length=1333

 Score =   449 bits (1156),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 347/1209 (29%), Positives = 548/1209 (45%), Gaps = 89/1209 (7%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             VS  Y  P    K   W            PW M+GDFN I  N E+ G      S  L F
Sbjct  103   VSCVYGNPAFSDKHLVWEKITRIGINRKEPWCMLGDFNPILHNGEKRGGPRRGDSSFLPF  162

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQ---RRKLDRALWNLEAQNLFPEAKAIILP  1389
              +   +C +L++ + G  ++W    GG+T +   + +LDR   N      FP +    L 
Sbjct  163   TDMLDSCDMLELPSIGNPFTW----GGKTNEMWIQSRLDRCFGNKNWFRFFPISNQEFLD  218

Query  1390  RTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS----NSLLDVVGA  1557
             +  SDH P+  L             FRF+     + + ++   + W+    N  L V+  
Sbjct  219   KRGSDHRPV--LVRLTKTKEEYRGNFRFDKRLFNQPNVKETIVQAWNGSQRNENLLVLDK  276

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             +    +   +W KE   N   R    +A ++  Q S F         L   L  +L +  
Sbjct  277   LKHCRSALSRWKKENNINSSTRITQARAALELEQSSGFPRAD-----LVFSLKNDLCKAN  331

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHI  1914
               EE+ W QKSR  W+  GD+NT+F+H S    R +  I ++  +NG ++ D        
Sbjct  332   HDEEVFWSQKSRAKWMHSGDKNTSFFHASVKDNRGKQHIDQLCDVNGLFHKDEMNKGAIA  391

Query  1915  SNFFIDLFGRKNIMDGSPNDMY--CGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPG  2088
               +F DLF  K+    S  D++    P++     + L   V+  E+++AVF ++   +PG
Sbjct  392   EAYFSDLF--KSTDPSSFVDLFEDYQPRVTESMNNTLIAAVSKNEIREAVFAIRSSSAPG  449

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
              DG    F+Q +W  +   +T  ++     G  P     + + L+PKK  P+  +D RPI
Sbjct  450   VDGFTGFFFQKYWSIICLQVTKEIQNFFLLGYFPKSWNFTHLCLLPKKKKPDKMTDLRPI  509

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKG-K  2445
             +L +V +KIISK++V R++P + +L+ P Q++F+  R   DNI++  E+VH +R  K   
Sbjct  510   SLCSVLYKIISKIMVRRLQPFLPDLVSPNQSAFVAERLIFDNILIAHEVVHGLRTHKSVS  569

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
             KG +AIK ++ KA+D ++W ++ + L   GF Q  +  IMF +   S S+L N +     
Sbjct  570   KGFIAIKSNMSKAFDRVEWNYVRALLDALGFHQKWVGWIMFMISSVSYSVLINDKAFGNI  629

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
              P RGLRQGDPL+P+LF+L  E L+  +    R      I  S  G  + HL FA+D + 
Sbjct  630   VPSRGLRQGDPLSPFLFVLCSEGLTHLMNRAERQGLLSGIRFSENGPAIHHLLFADDSLF  689

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
               +A +++  +I +  K +   +G  IN  KS+I      + + K  ++   GI+     
Sbjct  690   MCKAVKEEVTVIKSIFKVYGDVTGQRINYDKSSITLGALVDEDCKVWIQAELGITNEGGA  749

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
              TYLG+P            YI D +K +L+ W    LS+ G+ TL+++   ++  Y M  
Sbjct  750   STYLGLPECFSGSKVQLLDYIKDRLKTRLSGWFARTLSMGGKETLLKAFALALLFYAMSC  809

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             FKL   TC ++     DF W      +K H V    +C SK+ GGLG R    FN ALLA
Sbjct  810   FKLTKTTCVNMTSAMSDFWWNALEHKRKTHWVSCEKMCLSKENGGLGFRDIESFNQALLA  869

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             K AW+L+   + L+ +  + +Y   ++F    + A  S+ WRSI+ GR ++  G   ++G
Sbjct  870   KQAWRLLQFPNSLFARFFKSRYYDEEDFLDAELKATPSYAWRSILHGRDLLIKGFRKKVG  929

Query  3526  NGLSLNFWSDWWTGDK----PLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSLL-  3687
             NG S + W D W  D     PL     V +     + +V D I + +R    D+L  L  
Sbjct  930   NGSSTSVWMDPWIYDNDPRLPLQKHFSVNL-----DLRVHDLINVEDRCRRRDRLEELFY  984

Query  3688  PHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF-SHIAGNDEDAMDTSWV----  3852
             P DI   ++  P+     + D   W  S +G +SV+S +      N  + +  + V    
Sbjct  985   PADIEIIVKRNPVV---SMDDFWVWLHSKSGEYSVKSGYWLAFQTNKPELIREARVQPST  1041

Query  3853  -------WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLM  4011
                    W    + + +LFLW ++   L    +  R+GM  D  C  CG+  E++NHVL 
Sbjct  1042  NGLKEKIWSTLTSPKIKLFLWRILSSALPVAYQIIRRGMPIDPRCQVCGEEGESINHVLF  1101

Query  4012  ECSFAKDCWRRTHHPVS------------FQYSLVTPLKSWVKNNCCASDWINGCPWGVT  4155
              CS A+  W  +  P S             QY L    K  +      S W    PW   
Sbjct  1102  TCSLARQVWALSGVPTSQFGFQNSSIFANIQYLLELKGKGLIPEQIKKS-W----PW---  1153

Query  4156  FIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCV-HVGKMRWVC--  4326
                  W +WK R++  FE T  +P+  + +  +   D  E FL +  V  V     VC  
Sbjct  1154  ---VLWRLWKNRDKLFFEGTIFSPLKSIEKIRD---DVQEWFLAQALVASVDAGETVCSA  1207

Query  4327  -----WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFG---FMTNIGVSNS--  4476
                  W+PP  GW+K N  G +     +     + RD  G+ L       +N+ V     
Sbjct  1208  PCPSSWEPPPLGWVKCNISGVWSGKKRVCGGAWVLRDDHGKVLLHSRRAFSNLSVKKDAL  1267

Query  4477  FAAELWGLR  4503
             F    W LR
Sbjct  1268  FCCVKWALR  1276


 Score = 48.5 bits (114),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = +3

Query  732  MIFLSWNCRGVG--NRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLF  905
            M  +SWNC+G+G    LT+      MR +    + FL    N  + +  + + LG++++F
Sbjct  1    MSLVSWNCQGLGWSQDLTIPRLME-MRLSHFPEVLFLMETKNCSNVVVDLQEWLGYERVF  59

Query  906  NVDPLGFAGGLTLF  947
             V+P+G +GGL LF
Sbjct  60   TVNPIGLSGGLALF  73



>ref|XP_010490312.1| PREDICTED: uncharacterized protein LOC104768075 [Camelina sativa]
Length=1251

 Score =   449 bits (1154),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 322/1119 (29%), Positives = 506/1119 (45%), Gaps = 104/1119 (9%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              F+    F  +++  +++ I          + ++F Y  P    ++  W   L  SS  +
Sbjct  36    LFYNQDDFQVSILFESNRLIDIEAVFKGRIIHLTFVYGDPVPKNRDMVWERLLRISSNRS  95

Query  1123  APWIMMGDFNDIADNQEQWGSSSVN-PSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
              PW ++GDFN++  N E+ G   ++ P   L+F      CG L+    G   SW R    
Sbjct  96    TPWFLVGDFNELTGNHEKRGGGELHHPFSFLSFNGMIRDCGFLEFPFIGDCLSW-RGWRD  154

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
             +   R +L RAL N +  +LFP+     LP   SDH PL  +   G    R  R F F+ 
Sbjct  155   KKPIRCRLARALGNEDWHDLFPDTVTEYLPMIASDHKPL--VVNIGAKRPRGKRSFMFDR  212

Query  1480  AWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSK---KWNKETFGNIFGRKA----SL  1635
              W+ +    D     W   L  D    + +V N  K   +W K      +GR+       
Sbjct  213   CWIGKAGLMDAIASRWDRDLDQDSDNFVQKVVNCRKAVSQWRKSQVP--YGRETIEDLKR  270

Query  1636  QARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFY  1815
             Q  +    +S+  +T   LQ         L +    EE+ W+QKS   W++ GD+N+ ++
Sbjct  271   QLEVALADDSIPPSTISELQ-------NRLRQAYGDEEIYWYQKSWSKWMKLGDKNSKYF  323

Query  1816  HKSTLIRRNRSRIR-MLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPK  1992
             H  T  RR R+RI  +   +  W+++   I     ++F DLF   N  +           
Sbjct  324   HALTKQRRARNRITGLFNRDDIWSTEDVDICHTAVSYFEDLFTSTNPENFEEVLREVNTV  383

Query  1993  LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVL  2172
             +       LT   T  EVK  +F M    +PGP+G+ A F+Q  W+ VK+ +   V + L
Sbjct  384   ITAEDNEWLTGPATEAEVKSTLFTMHPDKAPGPNGMTALFFQKAWDIVKTDLVDLVNRFL  443

Query  2173  RDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGP  2352
              +      +  + I LIPK   P   ++ RPI+L NV +KIISK++  R++ ++  LI  
Sbjct  444   VERVFDKDLNRTHICLIPKVAKPTRMAELRPISLCNVGYKIISKILCQRLKRVLPGLISE  503

Query  2353  FQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVD  2529
              Q++F+PGR  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++W+F+ + L  
Sbjct  504   TQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWDFVAALLQK  563

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              GF ++ +S IMF V      +  NG+      P RGLRQGDPL+PYLFIL  E L  +I
Sbjct  564   MGFAESWVSWIMFCVTSVEYRVRINGQPNGLIVPQRGLRQGDPLSPYLFILCTEVLIANI  623

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
             ++  R K    I ++     ++HL FA+D + F +    Q R+I++ LK++   SGL   
Sbjct  624   RKAEREKLITGIKVANKCPPITHLLFADDSLFFCKVDRGQCRVILDILKQYESVSGL---  680

Query  2890  VSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRK  3069
                                          ++LG                F ++ + ++ +
Sbjct  681   ----------------------------PESLGG----------AKTKVFSFVRERIQSR  702

Query  3070  LANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKK  3249
                W  N+LS  GR  +++S  +++P + M  F+LP    + +     +F W  + Q   
Sbjct  703   TNGWTANLLSKGGREVMIKSVATAVPTFVMSSFRLPKTITSKLTSAVANFWWSTNGQTGG  762

Query  3250  VHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNF  3429
             +H + W  +C SK  GGLG R   DFN+ALLAK  W+L+   + L+ +V + +Y +N + 
Sbjct  763   MHWLAWEKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDVPESLFARVFKSRYYRNTHP  822

Query  3430  FATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTG---DKPLAFMDEVT  3600
                    + S+GWRSI   RS+V  G   R+G+G +++ WSD W      +P +    + 
Sbjct  823   LDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPASSKGPLK  882

Query  3601  IPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTG  3780
              P  Q    +      N +W +D L+       +  IRA P+    Q  D   W  + TG
Sbjct  883   DPSLQMNQLIDR---QNNSWRLDMLNEHFDPLDVALIRAIPLG-GNQRDDPFGWHFTKTG  938

Query  3781  AFSVRSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDT  3960
              ++V+S + H A +D             V   C           +  +    R+G+  D 
Sbjct  939   KYTVKSGY-HTARHDV------------VLSGC-----------ISVSANLGRRGIACDV  974

Query  3961  LCATCGDGDETMNHVLMECSFAKDCWRRTHHPV---SFQYSLVTPLKSWVKNNCCASDWI  4131
              C  CG   ET+NH +  C  A+  W   + PV   SF    V                I
Sbjct  975   RCVRCGADSETINHAIFVCPPARQVWALANVPVGPNSFPTESVYANVDHFLGQQNPGAHI  1034

Query  4132  NGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRA  4248
                PW        W IWKARN R+F+N A  P DI+R A
Sbjct  1035  AAFPW------LMWFIWKARNARVFDNIAERPEDIVRVA  1067



>ref|XP_008242862.1| PREDICTED: uncharacterized protein LOC103341160 [Prunus mume]
Length=872

 Score =   438 bits (1127),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 257/765 (34%), Positives = 402/765 (53%), Gaps = 20/765 (3%)
 Frame = +1

Query  2023  REVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKIL  2202
             R  ++ EVK A+F +    +PGPDG  A FYQ +W  V+  I    ++          + 
Sbjct  2     RPFSLEEVKDAIFQLGSLKTPGPDGFPAMFYQKYWLSVQDIIFRSAEEFYTGQSHIRDMN  61

Query  2203  ESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRS  2382
             ++FI LIPK  +PE+ S FRPI+L N S+KI+SK++ NR++ +M +L+   QN+FL  R 
Sbjct  62    KTFIALIPKVLAPESTSQFRPISLCNTSYKILSKLLANRLKSLMPHLVSDSQNAFLADRQ  121

Query  2383  TADNIILTQEIVHYMRLKK-GKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISL  2559
               DN+I+  E  HY++LK+ G K  + IK+D++KAYD ++W+FLE+ L   GF    I L
Sbjct  122   IHDNVIVAHEAFHYLKLKRAGHKYEVGIKIDMNKAYDRVEWDFLEALLQKLGFHSGWIRL  181

Query  2560  IMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWK  2739
             +M  +R  S S+L NG+  + F P RGLRQGDPL+PYLF+L  E LS ++ + V+     
Sbjct  182   VMLCIRTVSFSVLVNGQPGSSFLPSRGLRQGDPLSPYLFLLVCEALSCNLTKLVQDGVIN  241

Query  2740  PITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSP  2919
              I +SR    +SHLFFA+D + F +A E+    +   L  +   SG  IN  KS++  S 
Sbjct  242   GIRVSRRAPILSHLFFADDSLFFIKAEEENCSRLKGLLDDYCLASGQLINYEKSSLMFSA  301

Query  2920  NTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLS  3099
             NT  ++K  + ++ GI   DN G YLGIP+   R  K    YI + + +K+  WK   LS
Sbjct  302   NTPEDVKTNISSIMGIRGFDNSGIYLGIPMTWGRSKKVVLAYIRERVAKKIMGWKQGTLS  361

Query  3100  LAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDIC  3279
             +AG+  L+++  +++P Y M  FK P   CN+I      F WG S     +H   W  +C
Sbjct  362   MAGKEVLIKAIATAVPAYPMMCFKFPKVVCNEISSNIAKFWWGKSEGGNGIHWKSWKALC  421

Query  3280  KSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANAS  3459
              +K  GGLG R   +FN ALLAK +W+++++ + LWV++++ +Y  +  F    +    S
Sbjct  422   LAKGDGGLGFRDLTEFNLALLAKQSWRIISTPNALWVRILKARYYPDCEFKDAVLGHRPS  481

Query  3460  WGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDF  3639
             W W SI+ GR  +   A  +I NG   N W D W  D     +  +T     +   VSD 
Sbjct  482   WIWTSILEGRDALMGRARVQIINGADTNIWGDNWIPDN--GIITPITHVPPNAPQMVSDI  539

Query  3640  I-LPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHI-  3813
             I L NRTW++D++SS L  +    I A PI    Q  D L WP +  G +SV+S +  + 
Sbjct  540   INLHNRTWSLDRVSSYLSWETQKQILAIPIGPSGQ-RDKLVWPWTSNGLYSVKSGYQCLQ  598

Query  3814  -------AGNDEDAMDTS---W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTED  3957
                    +G+   +   S   W  +W +R   + R+FLW  M   + T +  +R+ +T  
Sbjct  599   SAHRYLASGSSHSSHFISNRIWKAIWSVRTLPKIRMFLWRCMSNAIPTRVNLFRRKITAS  658

Query  3958  TLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKN--NCCASDWI  4131
              +C  C   +E++ H L+ C +A+  W  +   +       + L  W+ +  +      +
Sbjct  659   PMCGLCDQYEESIEHALLLCPWAQAVWFGSPMTLRIDTQSFSTLDVWLNSILDLRTESKM  718

Query  4132  NGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLD  4266
                       +  WEIWK R + I E     P  ++  A+   ++
Sbjct  719   EKHDLLTMLSFFLWEIWKTRCKAIMEGCRIDPCKVVETASKAKVE  763



>emb|CCA66180.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score =   451 bits (1160),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 353/1253 (28%), Positives = 581/1253 (46%), Gaps = 98/1253 (8%)
 Frame = +1

Query  946   FWRSSIFNFA--VIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              W  +IFN    VI  +  AI G+ S       +   Y      A+   W   + + +  
Sbjct  74    IWDKNIFNANSNVIHQSWIAISGIFSTDQFECTLITVYNPCEIAARSEVWKQIIEFQNSN  133

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
               P +++GDFN++    E+ GS S + +   +F        LL++ +S  +Y+W+R    
Sbjct  134   PLPCLLVGDFNEVLRPSER-GSLSFSHNGINDFKSFVQELKLLEIPSSSRAYTWYRANS-  191

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
                 +  LDR L + E  +  P  K  IL R  SDH PL       +      +PFRF  
Sbjct  192   ----KSLLDRLLVSPEWVSHCPNIKVSILQRGLSDHCPLLV---HSHIQEWGPKPFRFNN  244

Query  1480  AWLTREDYRDIWGRVWSNS-LLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
              WLT      I    WS+S  + VV  + E     K+WN   FG+I      L+  I   
Sbjct  245   CWLTDPKCMKIVEASWSSSPKISVVEKLKETKKRLKEWNLNEFGSIDANIRKLEDCIANF  304

Query  1657  QESVFYNTSRGLQVLE----RKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
              +       R L   E    R+   +L + +K++E+ W Q+SR  W++ GD+NT F+H  
Sbjct  305   DKEA---DERELDKEELEKRREAQADLWKWMKRKEIYWAQRSRITWLKAGDKNTKFFHAI  361

Query  1825  TLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTG  2004
                ++ ++ +  ++ +G+  +D   I      FF  +F   ++   +  +++   +L   
Sbjct  362   ASNKKRKNMMACIETDGQSTNDPSQIKKEARAFFKKIFKEDHVKRPTLENLHLK-RLSQN  420

Query  2005  QMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGR  2184
             Q + L    T  E+  AV       +PGPDG    F ++ W+ +K+ I   V      G 
Sbjct  421   QANSLITPFTTEEIDTAVSSCASDKAPGPDGFNFKFVKSAWDIIKTDIYGIVNDFWETGC  480

Query  2185  VPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNS  2364
             +P     ++I LIPK D+P +  D+RPI+++   +KI++K++  R++ ++ +LI P Q+S
Sbjct  481   LPQGCNTAYIALIPKIDNPSSLKDYRPISMVGFIYKIVAKLLAKRLQSVISSLISPLQSS  540

Query  2365  FLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             ++ GR   D  ++  EI+     KK     + +KLD HKAYDS+ W FL+ TL    FP 
Sbjct  541   YVKGRQILDGALVASEIIE--SCKKRNIEAILLKLDFHKAYDSVSWNFLQWTLDQMNFPV  598

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
                  I   V  +S S+L NG    PF+  RGLRQGDPL+P+LF+L  E LS  I +   
Sbjct  599   KWCEWIKTCVTSASASILVNGSPTPPFKLHRGLRQGDPLSPFLFVLVGEVLSQMISKATS  658

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
             ++ W+ I     G+ ++HL +A+D ++F EA+ +  + I   L  F   SGL +N  KS+
Sbjct  659   LQLWRGIPACSRGSEITHLQYADDTLMFCEANTNSLKNIQKTLIIFQLVSGLQVNFHKSS  718

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             +     T+S I+    +L    +     +YLG+PI        T+  I+D +++KLA+WK
Sbjct  719   LMGLNVTSSWIQEAANSLM-CKIGTIPFSYLGLPIGDNPARIRTWDPIIDKLEKKLASWK  777

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
             G +LSL GR TL++++LS++P+Y M +F +P G    I+++ R FLW      +   +V 
Sbjct  778   GKLLSLGGRLTLIKASLSNLPLYYMSLFPVPKGVIEKINKLMRAFLWCGDFGKRPFSMVS  837

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W+ + + K +GGLG+   L  N +LL K  W+L  +   +W  ++R KY  +     + +
Sbjct  838   WSIVQQPKTSGGLGIGNILHKNLSLLFKWIWRLFENPSSMWGSIIRSKYNYSSTCSISDL  897

Query  3445  IANASWG-WRSIMR-------GRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMD---  3591
                 S G W+SI          R I   G    +GNG+S  FW D W  ++PL  +    
Sbjct  898   KKPVSGGPWKSICAAVLGHEGARLIAVNGMRKNVGNGISSLFWHDTWLCEQPLKRIAPRL  957

Query  3592  -EVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIID---------GIRATPIAVCEQ  3741
               + I  + S A    +   N  W       L P D+++          +R  P A    
Sbjct  958   FSIAINKNSSIASYGVWEGFNWVWVFSWKRVLRPQDLVEKAHLDELLKSVRLDPNA----  1013

Query  3742  VSDSLYWPRSPTGAFSVRSAFSHIAG----NDEDAMDTSWVWKMRVTERCrlflwllmrg  3909
               D L W    +G FS +S    ++        DA+    VW+  V  R  +F+W+ + G
Sbjct  1014  -DDQLIWAPEKSGRFSTKSFSKELSKMTPPTHSDAVKG--VWRGLVPHRIEVFVWIALLG  1070

Query  3910  rllTNMERWRKGMT--EDTLCATCGDGDETMNHVLMECSFAK-------DCWRRTHHPVS  4062
             ++ +  +    G+   E+ +C  C +G ET +H+L+ C  A+       D W+       
Sbjct  1071  KINSRHKLAAFGIISEEEDICPLCDEGSETSDHLLLHCVEAQKLWAWWLDIWKVKW---V  1127

Query  4063  FQYSLVTPLKSWVKNNCC--ASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMD-  4233
             F  SL+     W    C    S++     W  +F    W IWK RN RIF N++S  M+ 
Sbjct  1128  FPSSLLDAFSQW---KCIKKKSNFFKKV-WAASFFVIIWTIWKERNLRIFHNSSSNAMNL  1183

Query  4234  ---IMRRAN--------NLTLDTVEVFLNKKCVHVGKMRWVC------------WQPPET  4344
                ++ R                 ++  N  C+     R VC            W PP  
Sbjct  1184  QDLVLLRLGWWIGAWDCRFPYSPTDIQRNPLCLEWSDQR-VCAQLLKQQPENDSWVPPPP  1242

Query  4345  GWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLR  4503
               +K+N D +   +   ++ GG+ R+HKGE++  F + +       AE+  + 
Sbjct  1243  QVLKWNVDASVINSNSCSAIGGILRNHKGEFMCVFSSPVPYIEINCAEILAIH  1295



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score =   459 bits (1180),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 367/1193 (31%), Positives = 556/1193 (47%), Gaps = 69/1193 (6%)
 Frame = +1

Query  1021  PHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNP  1200
             PH  V  SF Y +  R+ +   W      S    APW++ GDFN I    E+   +  + 
Sbjct  944   PHP-VFTSFVYAKCTRIERRELWTSLRIISDGMQAPWLVGGDFNSIVSCDERLNGAIPHD  1002

Query  1201  SRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAI  1380
                 +   +   CGLLD G  G S++W      R  QR  LDR ++N E    F   +  
Sbjct  1003  GSMEDLSSTLFDCGLLDAGFEGNSFTW---TNNRMFQR--LDRVVYNQEWAEFFSSTRVQ  1057

Query  1381  ILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAI  1560
              L R  SDH PL   C   N  +R    FRF  AW    D+     + W N+ +   G  
Sbjct  1058  HLNRDGSDHCPLLISCS--NTNQRGPATFRFLHAWTKHHDFISFVEKSW-NTPIHAEGLN  1114

Query  1561  SEVTNLS------KKWNKETFGNIFGRKASLQARIKGVQESVFY--NTSRGLQVLERKLV  1716
             +  T         K WNK  FG+IF  K    A ++  Q  + +  N S   + L  K  
Sbjct  1115  AFWTKQQRLKRDLKWWNKHIFGDIF--KILRLAEVEAEQRELNFQQNPSAANRELMHKAY  1172

Query  1717  TELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDF  1893
              +LN  L  EEL W QKS   W+ +G+RNT F+H     +R R+ I R+    G    + 
Sbjct  1173  AKLNRQLSIEELFWQQKSGVKWLVEGERNTKFFHMRMRKKRMRNHIFRIQDQEGNVLEEP  1232

Query  1894  KTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKL-DTGQMHKLTREVTMCEVKKAVFDMK  2070
               I +    FF +L  +    D S  D    P++  T     L    ++ EVK+AVF++ 
Sbjct  1233  HLIQNSGVEFFQNLL-KAEQCDISRFDPSITPRIISTTDNEFLCATPSLQEVKEAVFNIN  1291

Query  2071  KFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETA  2250
             K    GPDG  + FYQ  W+ +K  +   V    +   +P  I  + + L+PK  +    
Sbjct  1292  KDSVAGPDGFSSLFYQHCWDIIKQDLFEAVLDFFKGSPLPRGITSTTLVLLPKTQNVSQW  1351

Query  2251  SDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMR  2430
             S+FRPI+L  V  KI++K++ NR+  I+ ++I   Q+ F+ GR  +DNI+L QE+V  + 
Sbjct  1352  SEFRPISLCTVLNKIVTKLLANRLSKILPSIISENQSGFVNGRLISDNILLAQELVDKIN  1411

Query  2431  LKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGE  2610
               + + G + +KLD+ KAYD ++WEFL   +  FGF    I++I   +     SLL NG 
Sbjct  1412  -ARSRGGNVVLKLDMAKAYDRLNWEFLYLMMEQFGFNALWINMIKACISNCWFSLLINGS  1470

Query  2611  KLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFA  2790
              +  F+  RGLRQGD ++P LFILA E LS  + +     N     LS     VSHL FA
Sbjct  1471  LVGYFKSERGLRQGDSISPSLFILAAEYLSRGLNQLFSRYN-SLHYLSGCSMSVSHLAFA  1529

Query  2791  EDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGIS  2970
             +D+++F        + I+  L+++   SG  +N  KS    +       ++ +  +TG  
Sbjct  1530  DDIVIFTNGCHSALQKILVFLQEYEQVSGQQVNHQKSCFITANGCPLSRRQIIAQVTGFQ  1589

Query  2971  VSDNLGTYLGIPILHKRVSK-HTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMP  3147
                   TYLG P LHK   K   F  ++  ++ +++ W+  +LS   R TL++S LSS+P
Sbjct  1590  HKTLPVTYLGAP-LHKGPKKVFLFDSLISKIRDRISGWENKILSPGSRITLLRSVLSSLP  1648

Query  3148  VYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDF  3327
             +Y +QV K PA     I+R+   FLWGDS + K++H   WN I      GGL +R   D 
Sbjct  1649  MYLLQVLKPPAIVIEKIERLFNSFLWGDSNEGKRMHWAAWNKINFPCSEGGLDIRNLKDV  1708

Query  3328  NNALLAKLAWQLVTSHDKLWVKVMREKYVKNK-NFFATPMIANASWGWRSIMRGRSIVEL  3504
              +A   KL W+  T  D LW   ++ KY   +   +  P I ++S  W+ I  GR +   
Sbjct  1709  FDAFTLKLWWRFYTC-DSLWTLFLKTKYCLGRIPHYVQPKIHSSSI-WKRITGGRDVTIQ  1766

Query  3505  GAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSL  3684
                W+IG G  L FW D W GD+PL     ++ P  +++           +W+VDKL   
Sbjct  1767  NTRWKIGRG-ELFFWHDCWMGDQPLV----ISFPSFRNDMSFVHKFYKGDSWDVDKLRLF  1821

Query  3685  LPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWVWKMR  3864
             LP ++I  I   P    +Q  D  YW  +  G FS +SA+  I          S +W   
Sbjct  1822  LPVNLIYEILLIPFDRTQQ--DVAYWTLTSNGEFSTKSAWETIRQQQSHNTLGSLIWHRS  1879

Query  3865  VTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRR  4044
             +      F+W  +   +   +    KG+   + C  C + +E++ HVL   S AK  W  
Sbjct  1880  IPLSISFFIWRALNNWIPVELRMKGKGIHLASKCVCC-NSEESLMHVLWGNSVAKQVW--  1936

Query  4045  THHPVSFQYSLVTP------LKSWVKNNCCASDWIN-GCPWGVTFIYTCWEIWKARNQRI  4203
                   FQ  ++ P      L +W      + D++  G    +  I+ CW +W  RN   
Sbjct  1937  AFFAKFFQIYVLNPKHVSHILWAWF----YSGDYVKRGHIRTLLPIFICWFLWLERNDAK  1992

Query  4204  FENTASAP-------MDIMRRANNLTL--------DTVEVFL---NKKCVHVGKMRWVCW  4329
             + ++           M ++R+  + +L        DT    +   N +       + V W
Sbjct  1993  YRHSGLNTDRIVWRIMKLLRQLKDGSLLQQWQWKGDTDIAAMWQYNFQLKLRAPPQIVYW  2052

Query  4330  QPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAE  4488
             + P TG  K N DG+  R+   A++GG+ RDH G+ +FGF  NIG  NS  AE
Sbjct  2053  RKPSTGEYKLNVDGS-SRHGQHAASGGVLRDHTGKLIFGFSENIGTCNSLQAE  2104



>emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   450 bits (1158),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 352/1206 (29%), Positives = 548/1206 (45%), Gaps = 95/1206 (8%)
 Frame = +1

Query  1066  RMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGL  1245
             R+++ + W     Y +E  +P +M+GDFN++ D  ++ GS   +    L+F        L
Sbjct  115   RVSRSKVWTSISDYWAESQSPMLMVGDFNEVLDPSDR-GSGISSQLGVLDFKNFIQQTHL  173

Query  1246  LDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFL  1425
             +++  S   ++WF  +      + KLDR L N E  +LFP  +  IL R  SDH PL   
Sbjct  174   MEISASDGWFTWFSGQA-----KSKLDRLLVNPEWVSLFPSLQVSILRRNLSDHCPLLVK  228

Query  1426  CEAgnpprrenrpfrfegAWLTR----EDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWN  1593
              +  N   R  R       WL+     +  +D+W    S +L D    + E     K WN
Sbjct  229   SDELNWGPRPFRFQN---CWLSHPGCLQIIKDVWASHTSGNLTD---KLKETKKRLKIWN  282

Query  1594  KETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLE----RKLVTELNEVLKQEELLWF  1761
                FG+I      L+ RI  +      +  R LQ+ E    R    EL   L+++E  W 
Sbjct  283   SSEFGHIDRNIEELEDRIHNLD---LISNGRDLQLEELAERRSSQMELWVWLRRKEAFWA  339

Query  1762  QKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFG  1941
             Q SR  WI++GD+NT ++H     R+ ++ I  L  N    SD   I     +FF  +F 
Sbjct  340   QNSRAKWIKEGDKNTKYFHTLASTRKKKNTIPALITNNGVVSDPAGIHHEAVSFFKSIFK  399

Query  1942  RKNIMDGSPNDMYCGPK---LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAF  2112
                  D S   ++ G +   L   Q+ +LT   +  EV +AV       +PGPDG    F
Sbjct  400   E----DFSSRPVFNGLQFRSLSCEQVSQLTEPFSHKEVDEAVESCDPQKAPGPDGYNFRF  455

Query  2113  YQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFK  2292
              +  W+ +K  +   V+     G +P     +FI LI K++ PE  +DFRPI+++   +K
Sbjct  456   IKDSWDIIKLDVYNIVENFWNSGSLPKGSNVAFIALIAKREVPEGLNDFRPISMVGCIYK  515

Query  2293  IISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLD  2472
             II+K++  R++ +M +LIGP+Q+SF+ GR   D  ++  E++   R KK +  L  +KLD
Sbjct  516   IIAKLLARRLQKVMDSLIGPYQSSFIAGRQILDGALIAGELIDTCRRKKVQ--LSILKLD  573

Query  2473  LHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQG  2652
              HKA+DS+ W FL+ TL   GFP      I   +  ++ S+L NG   APF+  RGLRQG
Sbjct  574   FHKAFDSVAWSFLDWTLDKMGFPPRWRMWISSCITSAAASILINGSPTAPFKLHRGLRQG  633

Query  2653  DPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQG  2832
             DPL+P+LF L +E LS  IQ+   +  W+ + +++ G  ++HL +A+D ++F   + D  
Sbjct  634   DPLSPFLFDLVVETLSLVIQKASHLGLWEGVEVTKNGEKITHLQYADDTIIFCPPNLDYL  693

Query  2833  RMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL  3012
               I   L  F   SGL +N  KS+I    + +    +   N     V     TYLG+PI 
Sbjct  694   LNIKKTLILFQLASGLQVNFHKSSIM-GIHVDEIWLQEAANALLCKVGRLPFTYLGLPIG  752

Query  3013  HKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCN  3192
                     +  I+  ++ KLA+WKG MLS+AGR TL+++++SS+P+Y M +F  P G   
Sbjct  753   GNISRLAHWDPIIKKIEGKLASWKGRMLSIAGRITLIKASISSLPLYYMSLFPAPRGVIE  812

Query  3193  DIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTS  3372
              I+++ R+FLW    +   + LV WN +   K++GGL     L+ N +LL K  W+L   
Sbjct  813   AINKLQRNFLWSGELRKSSLALVAWNQVVLPKESGGLNCGNLLNRNISLLFKWIWRLSHD  872

Query  3373  HDKLWVKVMREKYVKNKNFFATPM-IANASWGWRSIM-------RGRSIVELGAAWRIGN  3528
              + LW KV++EKY  +       + I   S  WR I          RS V+      +GN
Sbjct  873   PESLWQKVIKEKYGYSHTTTVHDLCIPKGSGPWRFICASILNHPSARSFVKTKLRKAVGN  932

Query  3529  GLSLNFWSDWWTGDKPLA--FMDEVTIPDSQSE--AKVSDFILPNRTWNVDKLSSLLPHD  3696
             G+   FW D W GD PL   F    TI D+     A    +      WN        P D
Sbjct  933   GVKTLFWLDTWLGDSPLKLRFPRLFTIVDNPMAYIASCGSWCGREWVWNFSWSRVFRPRD  992

Query  3697  I-----IDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWVWKM  3861
                   + G+  + + +     D L W    +GAFSV+S    +            +W  
Sbjct  993   AEEWEELQGLLGS-VCLSPSTDDRLIWTPHKSGAFSVKSCSKELTNTALKPQSKIRIWGR  1051

Query  3862  RVTERCrlflwllmrgrllTNMERWRKGMT------EDTLCATCGDGDETMNHVLMECSF  4023
                      + +     LL  +   +K  T      +D +C  C    ET +H+L+ C F
Sbjct  1052  LWRGLIPPRIEVFSWVALLGKLNSRQKLATLNIIPPDDAVCIMCNGAPETSDHLLLHCPF  1111

Query  4024  AKDCWR----RTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKAR  4191
             A   W       +    F  +L    + W    C   +      W   F    W IWK R
Sbjct  1112  ASSIWLWWLGIWNVSWVFPKNLFEAFEQWY---CHKKNPFFRKVWCSIFSIIIWTIWKER  1168

Query  4192  NQRIFENTASAP--------------------------MDIMRRANNLTLDTVEVFLNKK  4293
             N RIF   + +                           ++++R    L+ D ++      
Sbjct  1169  NARIFRGISCSSNKLQDLVIIRLMWWIKGWGEAFPYSIVEVLRHPQCLSWDYLKAAPAAT  1228

Query  4294  CVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSN  4473
              V V  M    W PP  G +K+N D +   N G ++ GG+ R+ +G ++  F   I    
Sbjct  1229  AVSVDGM---LWSPPNDGVMKWNVDASV--NAGRSAIGGVLRNSQGIFVCVFSCPIPSIE  1283

Query  4474  SFAAEL  4491
               +AE+
Sbjct  1284  INSAEI  1289



>ref|XP_009135908.1| PREDICTED: uncharacterized protein LOC103860050 [Brassica rapa]
Length=1207

 Score =   446 bits (1147),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 334/1121 (30%), Positives = 529/1121 (47%), Gaps = 99/1121 (9%)
 Frame = +1

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
             G  V   +LDRA+ N +  ++FP A++  L    SDH PL  + +      +        
Sbjct  54    GPLVVHCRLDRAVSNSDWSDMFPTARSHYLLFEGSDHRPLLSVFDPTKLKSQR-------  106

Query  1477  gAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK-WNKETFGNIFGRKASLQARIKG  1653
                L R D R              +   SEVT L +K WN+    N+  R ++ +  I  
Sbjct  107   ---LFRYDRR--------------LRHNSEVTILVEKTWNRYKNLNVMERLSNCRKAISK  149

Query  1654  VQESVFYNTSRGLQVLERKLVTELNEVL-----------------KQEELLWFQKSRRMW  1782
               +  F N+ + +  L+  L +EL++ L                 K EE  W Q+SR+MW
Sbjct  150   WSKDQFLNSKKAIDNLKMSLDSELSKPLADDPLISSLNLALLQAYKAEEEYWRQRSRQMW  209

Query  1783  IQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHISNFFIDLFGRKNIMD  1959
             +  GDRNT ++H +   RR R+R  M++   G    + K I++ I+ +F ++F   +   
Sbjct  210   LSLGDRNTGYFHAAARGRRARNRFSMIETAEGTAVFEEKQIAEVIAAYFTEIFSSSSSDC  269

Query  1960  GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVK  2139
                       K+   Q   L    T  E++ A+F +    +PGPDG  A+F+QT W+   
Sbjct  270   TDTVHSALKSKITAEQNEMLIMPPTDFEIRAALFSIHPDKAPGPDGFSASFFQTNWDVTG  329

Query  2140  SHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNR  2319
               +   +++  R G +P  I  + I LIPK  SP+  SD+RPI L NV +K+ISK++  R
Sbjct  330   PAMIKEIQEFFRTGSMPHSINATHIRLIPKITSPKVVSDYRPIALCNVYYKVISKLLSLR  389

Query  2320  MRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKK-GLMAIKLDLHKAYDSI  2496
             ++P++   I   Q++F+PGR+ +DN+++T E +HY++  K KK   MAIK D+ KAYD +
Sbjct  390   LKPVLHCAISENQSAFIPGRAISDNVLITHEFLHYLKTTKSKKRSSMAIKSDMSKAYDRL  449

Query  2497  DWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLF  2676
             +W F+E  L   GF +   + IM  V   S S L N   L    P RG+RQGDPL+PYLF
Sbjct  450   EWSFIECVLSTLGFHEVFTTWIMNCVSSVSYSFLINDAVLGRVVPQRGIRQGDPLSPYLF  509

Query  2677  ILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLK  2856
             IL  E LS    +  +      I +++    V+HL FA+D M F          + + L 
Sbjct  510   ILCSEVLSGLCSKAQQDGTLPGIKIAKNSPSVNHLLFADDTMFFIPTDRRSCAKLKHILT  569

Query  2857  KFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHT  3036
              +   SG  IN  KS+I  +  T S ++  +K++ GI+    +G YLG+P    R  +  
Sbjct  570   LYESASGQRINTDKSSISFAKKTTSLVRNEVKDILGITKEGGVGKYLGLPEHFGRKKRDL  629

Query  3037  FGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRD  3216
             F  I+D +  K  +W    LS AG+  ++++ L+++P + M  F LP G C  I      
Sbjct  630   FASIIDRIVVKAVSWSTRFLSSAGKMVMLKAVLTAVPSFAMTCFLLPVGLCKMIQSALTR  689

Query  3217  FLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKV  3396
             F W  +   KK+  + W+ + K K  GGLG +    FN ALLAKL W+++T+ + L  +V
Sbjct  690   FWWDSNTGKKKMCWLSWDKLTKPKSLGGLGFKDIQTFNIALLAKLPWRMLTNPNCLLSRV  749

Query  3397  MREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDK-  3573
             +  KY          ++  AS GW  I+ GR ++       +G G  +  W+D W     
Sbjct  750   LLGKYCHKAPLLKVQLVKGASHGWTGILAGRDLLASHIGRAVGEGTEIKVWTDAWISTTS  809

Query  3574  ---PLAFMDEVTIPDSQSEAKVSDFILPNR---TWNVDKLSSLLPHDIIDGIRATPIAVC  3735
                P   + E T     ++  VSD I  NR    WN++ +S +LP  + + +   P    
Sbjct  810   RIIPYGPLKEGT-----NDLYVSDLI--NRGTCEWNIEMISRILPEFVEEILTIKPSKT-  861

Query  3736  EQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS-------W---VWKMRVTERCrl  3885
              +  DS  W  + +G +S +S ++  A  D++ +D+S       W   VW +  T + ++
Sbjct  862   -KARDSYIWYPAKSGIYSAKSGYA-AAIADKELLDSSAQLDSFDWHRSVWSISSTPKLQI  919

Query  3886  flwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSF  4065
             F+W  ++G L T     ++GM ++T C  CG   ET  H+L+ C +A   W       SF
Sbjct  920   FIWKAIQGALPTGGNLQKRGMLQNTNCIHCGQ-TETTEHLLLHCPYAAQVWSLIPLAGSF  978

Query  4066  QYSLVTPLKSWVKNNCCASDWINGCPWGVT---FIYTCWEIWKARNQRIFENTASAPMDI  4236
                L   +    +    +  W    P G++   F + CW +W  RN+ +FE   S P   
Sbjct  979   DPGLCLSISEAAQT---SRTWTCLPPSGISSDIFSWVCWNLWTTRNKLLFE---SRPTSA  1032

Query  4237  MRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQ--PPE--TGWIKFNTDGAFKRNT---GL  4395
                A   +L     +L  +       +    Q  PP    G +  NTD A+K+ +   GL
Sbjct  1033  QATATK-SLANAREWLQAQDPAKSSQKHTQNQARPPSIPVGTVTCNTDAAWKKESLTAGL  1091

Query  4396  A----SAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLRE  4506
             A    SA  L R        G      VS++  AE   +RE
Sbjct  1092  AWIFDSASSLTRSD------GCQYQTWVSSALMAEGLAIRE  1126



>ref|XP_010476358.1| PREDICTED: uncharacterized protein LOC104755638 [Camelina sativa]
Length=1553

 Score =   452 bits (1164),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 281/872 (32%), Positives = 443/872 (51%), Gaps = 31/872 (4%)
 Frame = +1

Query  1702  ERKLVTELNEVLKQ----EELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIR-MLK  1866
             E +LV +L   L+Q    EE+ W+QKSR  W++ GD+N+ ++H  T  RR R+RI  +  
Sbjct  416   ECELVFDLQSRLRQAYGDEEIYWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRITGLFN  475

Query  1867  INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEV  2046
              +  W+++   I +   ++F DLF   N  +           +      +LTR  T  EV
Sbjct  476   KDDIWSTEDVDICNTAVSYFEDLFTSTNPTNFEEVLREVQTVITAEDNERLTRPATEAEV  535

Query  2047  KKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIP  2226
             K A+F M    +PG DG+ A F+Q  W  VK+ +   V + L +G     +  + I LIP
Sbjct  536   KSALFMMHPDKAPGSDGMTALFFQKSWGIVKTDLVDLVNRFLVEGVFDKSLNRTHICLIP  595

Query  2227  KKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILT  2406
             K   P   ++ RPI+L NVS+KIISKV+  R++ ++  LI   Q++F+PGR  +DNI++ 
Sbjct  596   KVAKPTRMAELRPISLCNVSYKIISKVLCQRLKGVLPGLISETQSAFVPGRLISDNILIA  655

Query  2407  QEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRES  2583
             QE+ H +R     KG  MAIK D+ KAYD ++W+F+ + L   GF ++ +S IM  +   
Sbjct  656   QEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWDFVAALLRKMGFAESWVSWIMVCITSV  715

Query  2584  SISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGG  2763
                +L NG+      P RGLRQGDPL+PYLFIL  E L  +I++  R K    I ++   
Sbjct  716   EYRVLINGQPNGLIVPERGLRQGDPLSPYLFILCTEVLIANIRKAERDKLITGIKVANKC  775

Query  2764  TGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKR  2943
               ++HL FA+D + F +A  +Q R I++ LK++   SG  IN SKS++      + + K 
Sbjct  776   PPITHLLFADDSLFFCKADREQCRAILDILKQYELVSGQQINFSKSSVQFGHKIDDQTKN  835

Query  2944  GLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLV  3123
              L+ + GI     +G+YLG+P          F ++ + ++ +   W  N+LS  GR  ++
Sbjct  836   ELQGVLGIMTLGGMGSYLGLPESLGGAKTKIFSFVRERIQSRTNGWTANLLSKGGREVMI  895

Query  3124  QSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGL  3303
             +S  + +P + M  F+LP    + +     +F W  + Q+  +H + W  +C SK  GGL
Sbjct  896   KSVATVVPTFVMSCFRLPKTITSKLTSAVANFWWSTNGQSGGMHWLAWEKLCVSKQLGGL  955

Query  3304  GLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMR  3483
             G R   DFN+ALLAK  W+L+ + + L+ +V + +Y +N N        + S+GWRSI  
Sbjct  956   GFRNVDDFNSALLAKQLWRLIDAPESLFARVFKSRYYRNTNPLDPIRSYSPSYGWRSICS  1015

Query  3484  GRSIVELGAAWRIGNGLSLNFWSDWWTG---DKPLAFMDEVTIPDSQSEAKVSDFILPNR  3654
              RS+V  G   R+G+G +++ WSD W      +P      V  P  Q    +        
Sbjct  1016  ARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPAVSKGLVKDPYLQMNHLIDRH---TN  1072

Query  3655  TWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIA------  3816
             TW +D L+       +  IRA P+    +  D   W  + TG ++V+S + H A      
Sbjct  1073  TWRMDMLNEHFDPLDVALIRAIPLGGNSK-DDPFGWHFTKTGKYTVKSGY-HTARHDVVR  1130

Query  3817  -------GNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATC  3975
                    G D   +  S VW+ R   + + F+W ++ G +  +    R+G+  D  C  C
Sbjct  1131  TFAATGSGPDITPLLAS-VWRARCPPKIQHFMWQVLSGCISVSANLGRRGIACDLRCVRC  1189

Query  3976  GDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVT  4155
             G   ET+NH +  C  A+  W   H PV    ++  P +S   N        N       
Sbjct  1190  GADMETINHAIFVCPPARQVWALAHVPVG---TISFPTESIYANVDHFLGKQNPGAHVTA  1246

Query  4156  FIYTCWEIWKARNQRIFENTASAPMDIMRRAN  4251
             F +  W IWKARN R+++N    P DI++ A 
Sbjct  1247  FPWLVWFIWKARNARVYDNIVDRPEDIVKVAE  1278



>ref|XP_010513219.1| PREDICTED: uncharacterized protein LOC104789182 [Camelina sativa]
Length=1754

 Score =   454 bits (1169),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 349/1236 (28%), Positives = 562/1236 (45%), Gaps = 139/1236 (11%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W+ S+    V+ +  + I   V+       ++  Y  P +  +   W + LS   E+ 
Sbjct  509   LMWKESV-TVRVLESDRRMIDARVTWQGKEFFLTCIYGEPAQSERGELW-ERLSRMGEYR  566

Query  1123  A-PWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
                W+M GDFN++ D  E+ G      S C  F +  +ACGL ++   G  +SW+     
Sbjct  567   GQAWMMTGDFNELVDPSEKIGGPERKDSSCEEFRQMLNACGLWEVKHLGYQFSWYGNRND  626

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
               VQ R LDR + N      FP A+A  L +  SDH PL   C       +    F+++ 
Sbjct  627   ELVQCR-LDRTVANQAWMEQFPRAQASYLQKICSDHSPL-VTC-LLGERWKHWASFKYDK  683

Query  1480  AWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK----WNKETFGNIFGRKASLQARI  1647
              W+ RE ++D   + W  S  +   ++ E     +K    W +    +   R   LQ +I
Sbjct  684   RWIQREGFKDTVAQFWRTSGNEQESSMMEKIAGCRKEISIWKRHVKPSSALRIQELQFKI  743

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
                   + +N       L + L  ELN    QEE  W QKSR  W+ +GDRNT F+H +T
Sbjct  744   DAATRQIPFNPQ-----LLKDLKKELNIEYYQEEQFWSQKSRMTWVHEGDRNTKFFHAAT  798

Query  1828  LIRRNRSRIRML--KINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDT  2001
               RR ++RI+ L  +   EW +D   +      +F  LF  +++           P +D 
Sbjct  799   KTRRAQNRIQKLVDEEGFEWYTDV-DLGKVAEAYFRKLFTSEDVGYQLQEMGEVRPTVDD  857

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                  L   V+  EVKKAVF++     PGPDG+    YQ FWE +   +T  V+K    G
Sbjct  858   QMNAGLLAPVSKEEVKKAVFNINPTKCPGPDGMIGYLYQQFWEVMGYQLTGMVQKFFSTG  917

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +   +  + I LIPKK   +   DFRPI+L NV +KII KV+ NRM+ ++ ++I   Q 
Sbjct  918   HMEEDMNRTNICLIPKKQRADRLVDFRPISLCNVIYKIIGKVVANRMKKVLPHIISETQA  977

Query  2362  SFLPGRSTADNIILTQEIVHYMRLK-KGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+ GR  +DNI++  E++H +    K  +  +A+K D+ KAYD ++W FLE T++  GF
Sbjct  978   AFIQGRLISDNILVAHEMIHALNTNAKCSEEYIAVKTDISKAYDRVEWGFLEKTMLTLGF  1037

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
              +  I+L+M  V+     +L N       +P RGLRQGDP++PYLF++  E L  D    
Sbjct  1038  DERWINLVMECVKTVRYQVLINRSPQGEIKPSRGLRQGDPISPYLFVICTEMLIDDA---  1094

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
                        + G  G        DL +  +   DQ   ++  ++++S  SG  +N  K
Sbjct  1095  -----------ASGNKGT-------DLRIENDEELDQ---LIRIVEEYSLASGPRVNYQK  1133

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
             S+I        E +R +K   GI      G YLG+P   K +   +  Y+ D +K K+++
Sbjct  1134  SSITFGRGIPEERRRAIKQRLGIEQEGGQGMYLGLPESFKGLKIESLHYLRDRLKTKVSS  1193

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W+ N LS  G+  +++S   ++P +TM  FKLP   C+ +  I  +F W +  +++ +H 
Sbjct  1194  WQTNYLSPRGKEVMLKSIALALPSFTMSCFKLPVTICHQLAGIMAEFWWKNKRESRGMHW  1253

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
               W  + K K+ GGLG +    FN A+L K  W+++T                       
Sbjct  1254  KAWEHLSKPKEEGGLGFKDIEAFNLAMLGKQLWRMIT-----------------------  1290

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKP---LAFMDEVTIPD  3609
                           R  S++  G    IG+G +++ WS  W   KP   +  M+++  P+
Sbjct  1291  --------------RPTSLLGQGIRAVIGSGETVDIWSHQWLLAKPAKGVTLMNQIP-PE  1335

Query  3610  SQSEAK----VSDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSP  3774
             S+  A     V D +  N R WN + LS+L P +I + I    +   +   D   W  S 
Sbjct  1336  SRRFASRLRYVKDLLEANGREWNRELLSTLFPENINEQILWIRVG-GQGTMDKFAWDYSK  1394

Query  3775  TGAFSVRSAFSHI-----AGNDEDAMDT-------SWVWKMRVTERCrlflwllmrgrll  3918
              G ++V+S +  I     + N +  +D          +W+  V+ + + FLW  +   L 
Sbjct  1395  DGHYTVKSGYRVIMELNKSRNLQQEVDQPNINPIFQQIWQTDVSPKIQHFLWRSVSNCLP  1454

Query  3919  TNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPV-----------SF  4065
                    + + +D  C  C +G ET+NH+L +CSFA+  W  +  P            + 
Sbjct  1455  VAGNMLHRHLAKDGSCQRCANGLETVNHMLFKCSFARLVWAISPIPAPPGGEWSDSIYAN  1514

Query  4066  QYSLVTPLKSWVKN--NCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIM  4239
              Y L+T  K + +   NC  + WI             W +WK+RN   FE       +++
Sbjct  1515  MYHLLTLGKMYNQRDLNCNVAIWIQ------------WRLWKSRNAYQFEGKNQNAKEVV  1562

Query  4240  RRANNLTLDTVEVFLNKKCVHVGKMRW------VCWQPPETGWIKFNTDGAFKRNTGLAS  4401
              RA +   D  E  L+K+      +        + W PP  GW+K N DGA++ ++    
Sbjct  1563  SRAKD---DEEEWNLSKEMRSKPPIAPRPDSCNIKWIPPPMGWVKCNVDGAWRSDSEQCG  1619

Query  4402  AGGLARDHKGE--WLFGFMTNIGVSNSFAAELWGLR  4503
              G + RD + +  WL G      V+     E+ GLR
Sbjct  1620  IGWVLRDEQKKVIWL-GARALPRVNKPLDVEVEGLR  1654



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score =   451 bits (1159),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 306/1030 (30%), Positives = 487/1030 (47%), Gaps = 70/1030 (7%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R +  Y  P    + R W+      +    PW+  GDFN+I    E+             
Sbjct  487   RFTGFYGCPVTAERHRSWDLLRRLGATNYLPWLCCGDFNEILRADEKL------------  534

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
                +   C   D+G +G  Y+W+R        R +LDRAL   +  + F   K I L  T
Sbjct  535   ---AIDTCRFKDLGYTGPKYTWWRNNPMEI--RIRLDRALATADWCSRFLGTKVIHLNPT  589

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVT  1572
              SDH PLK L                       +  +D W R    S        +    
Sbjct  590   KSDHLPLKKLFRFEEMWAEHVN---------CMQTIQDGWQRTCRGSAPFTTTEKLKCTR  640

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
             +    W+K  FG++  +    + ++  + ++     S     L   L  +L+ ++ + E+
Sbjct  641   HKLLGWSKCNFGHLPNQIKITREKLGELLDA---PPSHHTAELRNALTKQLDSLMAKNEV  697

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFI  1929
              W Q SR  W++ GDRN+ F+H     RR R+ I  L+  +G W +  + ++  + N+F 
Sbjct  698   YWRQCSRATWLKAGDRNSKFFHYKASSRRRRNTISALEDEHGHWQTTEQGLTQTVVNYFQ  757

Query  1930  DLFGRK------NIMDGSPNDMYCGPKLDTGQMHKLTREV-TMCEVKKAVFDMKKFGSPG  2088
              LF          ++DG    +       T +M++    V T  E+K A+F M    +PG
Sbjct  758   HLFSSTGSSEYTEVVDGVRGRV-------TEEMNQALLAVFTPEEIKIALFQMHPSKAPG  810

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
             PDG    FYQ +W  V   +   V    + G++  +I  + + LIPK   P+     RPI
Sbjct  811   PDGFSPFFYQKYWPIVGEDVVAAVLHFFKTGKLLKRINFTHVALIPKVHEPKNMMQLRPI  870

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGK  2445
             +L NV +KI +KV+  R++ I+  LI   Q++F+PGR+ +DN I+  E++H M  K +G+
Sbjct  871   SLCNVLYKIGAKVLTTRLKAILPTLISDTQSAFVPGRAISDNSIVAFELLHMMHKKNQGR  930

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
             +G +A+K+D+ KAYD ++W FLE+ +   GF    I LIM  V   S S + NG  +   
Sbjct  931   QGYLALKIDMSKAYDRVEWSFLEALMKGMGFAPRWIQLIMECVTTVSYSFMLNGNPVGYV  990

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
              P RGLRQGDPL+PYLF+L  E LS  I +  R      + L RG   VSHLFFA+D  L
Sbjct  991   IPQRGLRQGDPLSPYLFLLCAEALSSLILQAERRNLLHGVNLCRGAPSVSHLFFADDSFL  1050

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
             F  A +     +    +K+   SG  I++ KS +  S N +   +  L  + G+   D  
Sbjct  1051  FLRADQQDCEQLSIIFQKYEMVSGQKIHLEKSCVSFSINMDRTDQDNLAAVLGVRRVDQH  1110

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
               YLG+P    R  +  F  + + + +K+  WK  +LS AG+  L++    ++P+Y M  
Sbjct  1111  DVYLGLPTHVGRSRRQCFNSLKERIWKKIQGWKAKLLSFAGKEILLKVVAQAVPIYMMNC  1170

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             F +P   CN+I ++   + W +    +K+H + WN +C  K  GGLG R    FN ALLA
Sbjct  1171  FLIPKCLCNEIQQVMARYWWVEQDGQRKIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLA  1230

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             K  W+L+ + + L   +++ +Y KN +     +  + S+ W+S+ + R ++E G+ WRIG
Sbjct  1231  KQLWRLIQTPNSLVACILKARYFKNCSILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIG  1290

Query  3526  NGLSLNFWSDWWTGDKPLAFMDEVTIPDSQ--SEAKVSDFILP-NRTWNVDKLSSLLPHD  3696
             NG S+  W D W    P +   +V+ P  +   EAKV+  I P    W  D L +    +
Sbjct  1291  NGHSVRIWGDRWL---PNSESFQVSSPQVEGFEEAKVNSLINPVTLQWKEDLLQAWFSAE  1347

Query  3697  IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF--------------SHIAGNDEDA  3834
              ++ IR  P++      D L W     G ++VRS                +++ G    A
Sbjct  1348  EVNCIRNIPLSF-RHPPDILIWHFERDGQYTVRSGHDVARRVLLQQDGDDTNMNGGPIVA  1406

Query  3835  MDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVL  4008
              +  W  +WK RV  + R+F+W  +   L T      + ++E   C  CG  +ET+ HVL
Sbjct  1407  CEQVWKKIWKARVPPKVRIFIWRALLNILPTKDNLIHRRISELRGCVFCG-AEETVAHVL  1465

Query  4009  MECSFAKDCW  4038
             + C  A   W
Sbjct  1466  LRCPMAIASW  1475



>gb|AAG03119.1|AC004133_13 F5A9.24 [Arabidopsis thaliana]
Length=1254

 Score =   446 bits (1146),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 296/937 (32%), Positives = 465/937 (50%), Gaps = 28/937 (3%)
 Frame = +1

Query  1030  NVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRC  1209
             N  VS  Y  P+R  + + W             W M GDFNDI  N E+ G    +   C
Sbjct  64    NFCVSCVYGDPDRSKRSQAWERISRIGVGRRDKWCMFGDFNDILHNGEKNGGPRRSDLDC  123

Query  1210  LNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILP  1389
               F E    C L++M   G  ++W  + G   +Q R LDRA  N E    FP +    L 
Sbjct  124   KAFNEMIKGCDLVEMPAHGNGFTWAGRRGDHWIQCR-LDRAFGNKEWFCFFPVSNQTFLD  182

Query  1390  RTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEV  1569
                SDH P+  L +  +        FRF+  +L +ED ++   R WS        ++++ 
Sbjct  183   FRGSDHRPV--LIKLMSSQDSYRGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVADR  240

Query  1570  TNLSKK----WNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
                 +K    W K+   N   +   L+A ++  ++S+ +   + + VL++    +L +  
Sbjct  241   LRACRKSLSSWKKQNNLNSLDKINQLEAALEK-EQSLVWPIFQRVSVLKK----DLAKAY  295

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHI  1914
             ++EE  W QKSR+ W++ G+RN+ ++H +    R R RI  LK +NG   +      +  
Sbjct  296   REEEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKGEVA  355

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCG--PKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPG  2088
             + +F +LF   N       D + G  P++       L  EV+  E+K+AVF +K   +PG
Sbjct  356   AAYFGNLFKSSN--PSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAPG  413

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
             PDG+ A F+Q +W  V + +T+ VKK   DG +P +   + + LIPK   P    D RPI
Sbjct  414   PDGMSALFFQHYWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPI  473

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLK-KGK  2445
             +L +V +KIISK++  R++P +  ++   Q++F+  R   DNI++  E+VH +++  +  
Sbjct  474   SLCSVLYKIISKIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRIS  533

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
                MA+K D+ KAYD ++W +L S L+  GF    ++ IM  V   + S+L N       
Sbjct  534   SEFMAVKSDMSKAYDRVEWSYLRSLLLSLGFHLKWVNWIMVCVSSVTYSVLINDCPFGLI  593

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
                RGLRQGDPL+P+LF+L  E L+  + +       + I  S  G  V HL FA+D + 
Sbjct  594   ILQRGLRQGDPLSPFLFVLCTEGLTHLLNKAQWEGALEGIQFSENGPMVHHLLFADDSLF  653

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
               +AS +Q  ++   LK +   +G  IN++KS+I      + ++K  ++   GI      
Sbjct  654   LCKASREQSLVLQKILKVYGNATGQTINLNKSSITFGEKVDEQLKGTIRTCLGIFTEGGA  713

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
             GTYLG+P            Y+ D +K KL  W    LS  G+  L++S   +MPV+ M  
Sbjct  714   GTYLGLPECFSGSKVDMLHYLKDRLKEKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSC  773

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             FKLP  TC +++     F W     ++K+H   W  +C  KD+GGLG R    FN ALLA
Sbjct  774   FKLPITTCENLESAMASFWWDSCDHSRKIHWQSWERLCLPKDSGGLGFRDIQSFNQALLA  833

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             K AW+L+   D L  ++++ +Y    +F    +    S+GWRSI+ GR ++  G   R+G
Sbjct  834   KQAWRLLHFPDCLLSRLLKSRYFDATDFLDAALSQRPSFGWRSILFGRELLSKGLQKRVG  893

Query  3526  NGLSLNFWSDWWTGDKPL-AFMDEVTIPDSQSEAKVSDFILPNRT--WNVDKLSSL-LPH  3693
             +G SL  W D W  D    A   +  I D   + K    +L  RT  W+ + L  L LP 
Sbjct  894   DGASLFVWIDPWIDDNGFRAPWRKNLIYDVTLKVKA---LLNPRTGFWDEEVLHDLFLPE  950

Query  3694  DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             DI   +R   I      +D   W  + +G FSV+SA+
Sbjct  951   DI---LRIKAIKPVISQADFFVWKLNKSGDFSVKSAY  984



>ref|XP_008801646.1| PREDICTED: uncharacterized protein LOC103715697 [Phoenix dactylifera]
Length=1203

 Score =   444 bits (1143),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 294/1020 (29%), Positives = 494/1020 (48%), Gaps = 16/1020 (2%)
 Frame = +1

Query  1213  NFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPR  1392
              F E  +  GL+D+G  G  Y+W   + G      +LDRA    E    FPE +   LPR
Sbjct  14    EFQEFITVNGLIDLGFVGPRYTWCNNQQGSARVWERLDRAFATAEWIQEFPEYRVNHLPR  73

Query  1393  THSDHHPLKFLCEAgnpprrenrpfrfegAWLTR-EDYRDIWGR-VWSNSLLDVVGAISE  1566
               SDH P+    E   P R   R  +F   +    E   + WG  V  +++  V   +  
Sbjct  74    IASDHSPILVSTEISIPYRCPFRFEKFWCCYPRSWEVVSEAWGMPVRGDAMYRVSRRLEL  133

Query  1567  VTNLSKKWNKETFGNIFGRKASLQARIKGVQ--ESVFYNTSRGLQVLERKLVTELNEVLK  1740
                   +WN+E  GNIF R   ++  I  +Q  E++      G     R L++  + +L+
Sbjct  134   TRRRLIRWNREEVGNIFRRIEEIEEAITRLQSQEALRGGLLAGEMTELRSLLSLHDSLLR  193

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKIN-GEWNSDFKTISDHIS  1917
             Q+E+ W QKSR  WI +GDRNT F+++STLIRR R++IR+++ + G+   +   I   + 
Sbjct  194   QQEIFWRQKSRVQWILEGDRNTKFFYRSTLIRRQRNKIRIIREDDGQLTEEPDRIIRVVE  253

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
              FF   +  +     S +       +   +   L R V+  E+++AV+ +    +PGPDG
Sbjct  254   QFFRARWTEQTGSGISTDLPLPSVGVSAEETSVLIRPVSGREIQEAVWSLAGDKAPGPDG  313

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
                 F++ +W  V   +   +++      +      +F+ LIPK+  P     +RPI+L 
Sbjct  314   FPPVFFRRYWMLVGQDVIEAIQQFFHTAAMSSDWQRTFVALIPKRQDPTEPGHYRPISLC  373

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLM  2457
             +  +K  +K++  R+R I+  LI P Q +F+ GRS  DN+++ QE ++ +     ++ LM
Sbjct  374   STLYKATAKILAVRLRDILPRLISPEQGAFVAGRSITDNVLIAQEFMYDLGRAPRRRSLM  433

Query  2458  AIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGR  2637
              IKLD+ +AYD + W+F++ +   FGF +  I  +M  VR  S ++L NG     F+   
Sbjct  434   GIKLDMERAYDRLSWDFVQHSFQSFGFHETWIRWVMGCVRGPSFAILVNGTPSHFFESSV  493

Query  2638  GLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEA  2817
             GLRQG PL+P LFI   + LS  ++     +  +    +RG   +SHL FA+D +L A+A
Sbjct  494   GLRQGCPLSPLLFITCADSLSRALRGASDSQQLEAYRPARGTRPISHLLFADDSLLLAQA  553

Query  2818  SEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYL  2997
             +    ++I + +  +   SG  +N +K+ I   P    ++K  +  + G+   D+   YL
Sbjct  554   TRQAAQVIRSIVFDYCAASGQRVNFAKTTIHFCPKIIPQVKAAIMEILGVRQQDSGLRYL  613

Query  2998  GIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLP  3177
             G+PI  +R+ +     +    + +L  W+ + LS+ GR TL ++ LSS+P+Y M    LP
Sbjct  614   GVPITGRRLRRGDCLSLETSFRHRLEGWQTHTLSMMGRVTLARTVLSSIPIYLMSSSILP  673

Query  3178  AGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAW  3357
                   ++R+ RDF+WG       +HL+ W  +C+    GGLG+        AL  + A 
Sbjct  674   VALLRSLERLIRDFIWGRRGDRGGIHLMAWEVVCQPIRQGGLGVTSLTLRQEALAMRHAA  733

Query  3358  QLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLS  3537
             + +   D +   +MR KY       +T    ++S  WR I     +V     W +G+G S
Sbjct  734   RFLLEPDSMCSSLMRAKY--GSLLISTRAGRHSSPIWREICARGPLVLSAIRWAVGDGRS  791

Query  3538  LNFWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILPNR-TWNVDKLSSLLPHDIIDGIR  3714
             ++   D W  + P++ M  +   +     +V D I+P    W+   +  +    +   + 
Sbjct  792   IDVLEDSWVTEFPISQMPTMVDTERFQGFRVCDLIVPGEGRWHEGLIREVFGEQLAARVM  851

Query  3715  ATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSH--IAGNDEDAMDTSWVWKMRVTERCrlf  3888
             A P+   E+  D L W   PTG   VR+   H  I    +  +D  W+W++R+  R  LF
Sbjct  852   ALPVPSREE-PDRLIW--EPTGRSGVRARDLHVRIGRMPDRQIDVGWIWRLRLHPRVALF  908

Query  3889  lwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQ  4068
             LW +  G L T     R+G+     C  C D +ET++HVL+ C  A   W        ++
Sbjct  909   LWKVAWGCLPTRSVLVRRGLRMTQFCEVCLDSEETIHHVLLLCPRAVQIWSSLSGLSLWR  968

Query  4069  YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRA  4248
             +  V  L  +++++      +     G+   Y  + IW  RN R+FE   SAP  ++ RA
Sbjct  969   WESVEDLLQFLQDSTRRPSTVRQ---GILAAYLAFHIWLDRNGRLFEGRGSAPRFVVDRA  1025



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score =   436 bits (1120),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 253/774 (33%), Positives = 395/774 (51%), Gaps = 68/774 (9%)
 Frame = +1

Query  2185  VPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNS  2364
             +P  + E+ I L+PK + P + +  RPI+L N  +K++SK++V R+RP M  L+ P Q S
Sbjct  59    LPDHLNETLIALVPKVERPMSMNQLRPISLCNTLYKVVSKILVARLRPCMTKLVSPSQVS  118

Query  2365  FLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             F+ GR   DNII+ QE++H  +  KGKKG +A K+DL KAYD I W              
Sbjct  119   FVLGRQITDNIIVAQEVLHKFKSAKGKKGFIAWKIDLSKAYDRIQWSL------------  166

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
                      +RE    L  NGE    F P  G+RQGDPL+PY+F+L ME+LS  IQ+K++
Sbjct  167   ---------IREYKAIL--NGELTDSFSPQCGIRQGDPLSPYIFVLCMEKLSHLIQQKIQ  215

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
              + WK + + +G   +SHLFFA+DL+LF EA+ DQ   +  CL  F   SG  ++  KS 
Sbjct  216   DRAWKSVQICQGDPHISHLFFADDLILFGEATIDQAWFMKQCLDDFCQLSGQRVSFEKSM  275

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWK  3084
             I  SPNT S++   +  ++G  ++  LG YLG+P++H RV+K T+  ++  ++ +LA+WK
Sbjct  276   ICVSPNTCSDLANSIAAISGSPLTATLGKYLGVPLIHTRVNKQTYQEVIAKIQTRLASWK  335

Query  3085  GNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVG  3264
              + L +A R TL+QS   ++P+YTMQ  KLP    + +D++ + FLWG +    K+HLV 
Sbjct  336   SHTLFMACRMTLLQSVTPAIPIYTMQTAKLPMSVYDKLDQLNKKFLWGHTNNTSKIHLVN  395

Query  3265  WNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPM  3444
             W  +CK K  GGLG+++    N ALLAK  W+L+     LW +                 
Sbjct  396   WEQVCKPKIVGGLGIKRSAWMNQALLAKTGWRLLQHEQGLWSQ-----------------  438

Query  3445  IANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEA  3624
                                     R+G+G ++ FW+D W    PL     + + +   + 
Sbjct  439   ------------------------RVGSGDNVLFWTDRWLSRGPLYQYALIDLSEEMLQL  474

Query  3625  KVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
              V DF L    W+ + L   LP  II  I +   +     +D   W  +P G+FSV+SA+
Sbjct  475   NVCDF-LEEGVWDFNCLRECLPLHIIQLILSVHASFNGSGADRCIWQFTPNGSFSVKSAY  533

Query  3805  SHIAGNDEDAM-DTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGD  3981
             S     +     D  ++W + +  + + FLW++   +LLTN++R ++G+T+   C  C  
Sbjct  534   SSFLPTEASVKWDWQFIWGLLLPPKVKTFLWIVCHQKLLTNVQRQKRGLTQVPTCPKCDY  593

Query  3982  GDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKNNCCASDWI-NGCPWGVTF  4158
               + + H+  +C F+   W       +    L+   K W+  N  +   + NG PW + F
Sbjct  594   PMKAIAHLFKDCPFSLAIWNYLQIGDNSSLDLMD-FKEWLLRNLQSKRKVYNGLPWPLVF  652

Query  4159  IYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPP  4338
                 W IWK R + +F      P ++ +      L+           +V  +  + W  P
Sbjct  653   ALYLWFIWKWRCKGVFYQRFVMPGNLQQLILQYALEWFNATKPPPPSYVPYVVQLHWIAP  712

Query  4339  ETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
               G  K NTDG+    +     GGL RD+ G W+ GF  N+GV +   A+LWG+
Sbjct  713   TYGVCKINTDGSRNSVSRFIGVGGLLRDNYGAWIKGFSVNLGVGSVLEAKLWGI  766



>gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=1613

 Score =   451 bits (1161),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 330/1067 (31%), Positives = 499/1067 (47%), Gaps = 163/1067 (15%)
 Frame = +1

Query  1036  RVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLN  1215
             R S  Y  P    +   W+  ++ S  F  PWI++GDFN++  + E  G    +  R   
Sbjct  501   RCSGIYGSPQFNKRVLLWDYLVAQSMVFQGPWIVLGDFNEVKFSYESKGCQ-FSHQRADM  559

Query  1216  FVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
             F  S    GL D+ T G  +SW+R+        +KLDR   N    ++FPEA A +L R 
Sbjct  560   FATSLGDSGLFDLKTIGRQFSWYRRVKNYVDVAKKLDRVCINNSWLSIFPEAYAEVLNRL  619

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTN  1575
              SDH P+   C+    P+          AW T   YRDI  + W +    + G +SEV  
Sbjct  620   QSDHCPILVRCKGRPQPKGNRPFRFIA-AWATHPGYRDIVNQSWWSGNRGIHGKLSEVQK  678

Query  1576  LSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELL  1755
              S ++N + FGNIF +K  L+ +I  +Q+ +    S  L+  ER+L+ + N  L QEELL
Sbjct  679   NSLEFNSKVFGNIFVKKCELEQQINYLQKRLEVVDSIYLRQKERQLLDDYNNTLVQEELL  738

Query  1756  WFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKI-NGEWNSDFKTISDHISNFFID  1932
             WFQKS   W++ GDRNT F+H  TL RR  ++I  L + +G W +D + +S    +F+  
Sbjct  739   WFQKSIEQWVRFGDRNTRFFHIQTLARRKHNKIHGLFLKDGVWETDPEVLSQEAESFYKS  798

Query  1933  LFGRKNIMD-GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAA  2109
             LF   + +D G   D+   P L+    + LT  VTM EVK AVF M  F +PGPDG QA 
Sbjct  799   LFCHLDDVDLGCLGDVPL-PSLNEKACNNLTAPVTMEEVKAAVFHMNSFKAPGPDGFQAF  857

Query  2110  FYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSF  2289
             F++ +WE +   +   VK+      + P++LE+ + LIPK +SP +  DFRPI+L NV +
Sbjct  858   FFKEYWEIIGLDVWKMVKQAFSGVPLDPRMLETLLVLIPKVESPVSMKDFRPISLCNVVY  917

Query  2290  KIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKL  2469
             KII+KV+VNR+RP +  ++GP Q  F+PGR T DNII+ QE++H+M+  K KKG +  K+
Sbjct  918   KIITKVLVNRLRPHLAEIVGPLQGGFIPGRGTPDNIIIAQEVLHFMKKTKSKKGTLTFKI  977

Query  2470  DLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQ  2649
             DL KAYD +DW    S  VD G                    LW  E +A       + +
Sbjct  978   DLEKAYDRVDW----SHQVDLG--------------------LW--EPVA-------ISR  1004

Query  2650  GDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQ  2829
             G P   +L + A + L +    K +V+N                     +ML  E     
Sbjct  1005  GGPRISHL-MFADDLLLFCKATKRQVQN---------------------VMLVLETFCKA  1042

Query  2830  GRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPI  3009
               M +N ++K       N++ ++  +F               ++ I    +LG YLG+ +
Sbjct  1043  YGMKIN-VEKSKALCSKNVSATRKEVF-------------TGISSIIFVQDLGKYLGVTL  1088

Query  3010  LHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTC  3189
              H RV++  F  +LD ++ +LA+WKG++L+ AGR  LV   ++++P Y MQV   P G  
Sbjct  1089  SHSRVTRLAFNGVLDKIRSRLASWKGSLLNRAGRLCLVNFVVAAIPTYQMQVSIFPKGII  1148

Query  3190  NDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVT  3369
             + ++ + R+FLW      + ++LV W  +   K  GGLG+R     N  LL KL W    
Sbjct  1149  SKLESMMRNFLWKGQVDGRGLNLVSWKVLVTPKKYGGLGIRDPYCVNITLLGKLVWTFFQ  1208

Query  3370  SHDKLWVKVMREKYVKN-KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNF  3546
               +KLWV+++  KY  +  + F+ P   ++   WR + +   +++ G AW IG+ L+ NF
Sbjct  1209  QPNKLWVQLLDAKYRSSLYDCFSYPKNKDSPI-WRCLCKAWEVLKDGFAWCIGD-LNQNF  1266

Query  3547  WSDWWTGDKPLA-FMDEVTIPDSQSEAKVSDFILPN---RTWNVDKLSSLLPHDIIDGIR  3714
             W   W  +  L+  +D V I DS    ++ D    N   R W V     LLP  I     
Sbjct  1267  WFSSWRKEGRLSNEIDYVHISDSN--LRIQDIWSMNKQVRKW-VGIGVGLLPKSI---TL  1320

Query  3715  ATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWVWKMRVTERCrlflw  3894
             A     CE +         PT +F  R                                 
Sbjct  1321  AMVTCGCEAL---------PTASFRFR---------------------------------  1338

Query  3895  llmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRR---THHPVSF  4065
                            +GM+    C  C    E++ H + +C   +  W R   + HP+  
Sbjct  1339  ---------------RGMSSSDKCPRCLSSQESVLHCIRDCPKTQLVWHRLDISCHPLD-  1382

Query  4066  QYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIF  4206
                    LK+W   +     +         F    W IW+ARN  IF
Sbjct  1383  -------LKNWFLYHSREHPF--------KFFSGLWWIWRARNNDIF  1414



>ref|XP_010469706.1| PREDICTED: uncharacterized protein LOC104749719 [Camelina sativa]
Length=1474

 Score =   449 bits (1156),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 305/1028 (30%), Positives = 499/1028 (49%), Gaps = 67/1028 (7%)
 Frame = +1

Query  1237  CGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPL  1416
             CG+L+    G S SW        V R +LDRAL N +   LFP ++   L    SDH P+
Sbjct  5     CGMLEFPCYGESLSWRGNRCNNQVVRCRLDRALGNEDWHTLFPCSRVDYLEMIGSDHRPI  64

Query  1417  KFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWSNSLLDVVGAISEVTNLSK  1584
               L        R  R FRF+  W+ +E +       W R  +  +   V  I    N   
Sbjct  65    --LASCAKADGRHFRQFRFDKRWMGKEGFSGAVESGWNRTKNFRVPMFVDKIKNCRNSIS  122

Query  1585  KWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQ  1764
                K+   N     +SL+  ++  +     + +  + ++E+KL     +    EEL W Q
Sbjct  123   WRRKQNVPNSNTLISSLKMALEEAKNDDSISHAE-IHIIEKKL----KDAYHDEELYWQQ  177

Query  1765  KSRRMWIQDGDRNTAFYHKSTLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFG  1941
             KSR+ W++ GD+NT+F+H ST  RR R++I  +      W+   + +    S++F  LF 
Sbjct  178   KSRKFWLRVGDKNTSFFHASTKQRRTRNKIVGLFDSEDVWDESNEGMERIASDYFNKLFA  237

Query  1942  RKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQT  2121
             + ++   S       P +      +LT++++  EV+KA+F M    +PGPDG+ A F+  
Sbjct  238   QPDVCGISEMVQAVNPFVTERMNRELTKDISEMEVRKALFAMHPEITPGPDGMTALFFHR  297

Query  2122  FWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIIS  2301
             FW  +K  +   V+   R G+  P++ E+ I LIPK D P+  ++F+PI+L NV +KIIS
Sbjct  298   FWPHLKGDLIALVRDFFRTGKFDPRLNETNICLIPKVDVPKRMAEFKPISLCNVGYKIIS  357

Query  2302  KVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKK-GKKGLMAIKLDLH  2478
             K++  +++ I+  +I   Q++F+ GR   DNI++ QE+ H ++  +      +A K D+ 
Sbjct  358   KILCFQLKKILPLIISETQSAFVSGRLITDNILVAQEMFHGLQTNRMCNTEFLAFKTDMS  417

Query  2479  KAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDP  2658
             KAYD ++W+FL++ L+  GF    IS IM+ V   S  +L NG+      P RGL QGDP
Sbjct  418   KAYDRVEWDFLKAALIRLGFDSRWISWIMWCVSSVSYQVLLNGQPRGSILPKRGLWQGDP  477

Query  2659  LAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRM  2838
             L+PYLFIL  E L  +I++  R      I ++R    +SHL F +D + F++A E+Q   
Sbjct  478   LSPYLFILCTEVLIANIKKAEREGKISGIKIARDSPPISHLLFVDDSLFFSKADEEQCST  537

Query  2839  IMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHK  3018
             +M+ +  +S  S   +N+ KS+I       +E+K  +K++ GIS    +G+YLGIP    
Sbjct  538   VMDVIGNYSKASDQEVNLDKSSIMFGKKVPAEVKDKVKSVIGISNEGGMGSYLGIPESLG  597

Query  3019  RVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDI  3198
                   FGY+ D +  ++  W    LS  G+  L++S   ++P + M  FKLP G  + +
Sbjct  598   GSRVQVFGYVRDWLNDRVNGWTAKFLSKGGKEVLLKSVALTLPTHVMSCFKLPQGLTSKL  657

Query  3199  DRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHD  3378
                  +F W    +++ +H V W+ +CK K  G LG      FN+ALLAK  W+L+    
Sbjct  658   TSAISNFWWSSDGKDRGLHWVAWDKMCKDKSEGRLGFWDLEIFNDALLAKQYWRLI----  713

Query  3379  KLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDW  3558
                                     N+ +  RSI   +S+VE G  W IG+G +++ W D 
Sbjct  714   ---------------------QFLNSLFAQRSIFSTKSLVEKGIRWTIGSGFNISVWHDP  752

Query  3559  WTGD---KPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRATPI  3726
             W  D   +P     +   P+      V+  I P  + W++  L   +  + I  I + PI
Sbjct  753   WIPDQHPRPARGRGQHLHPN----LMVNHLINPRTKEWHLPILQEYMDPEDIQIILSLPI  808

Query  3727  AVCEQVSDSLYWPRSPTGAFSVRSAF---SHIAGNDEDAMDTSWV----WKMRVTERCrl  3885
             +   +  D L W  + +G +SV+S +     +  + E   + S +    W++ V  + + 
Sbjct  809   SKYFR-PDRLVWHYTQSGRYSVKSGYKVAQDMKADIEVGPNVSALKAKAWELPVPPKIKH  867

Query  3886  flwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRT------  4047
             F W +  G L   +    +G+  DT+C  C   +E++NH L EC  ++  W R       
Sbjct  868   FFWQIASGSLPVTVRLASRGVNCDTICKRCDLEEESINHTLFECPHSRQVWERIFDGPDM  927

Query  4048  -HHPVSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASA  4224
                P    YS +  +      +       +  PW V      W +WK RN + F+   S 
Sbjct  928   DKFPAGSIYSNLDFIYGKGLAHMALGTTHSSIPWLV------WFLWKDRNSKKFQGLRSE  981

Query  4225  PMDIMRRA  4248
             PMDI+ +A
Sbjct  982   PMDIINQA  989



>ref|XP_009146506.1| PREDICTED: uncharacterized protein LOC103870148 [Brassica rapa]
Length=1206

 Score =   444 bits (1141),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 312/1104 (28%), Positives = 536/1104 (49%), Gaps = 70/1104 (6%)
 Frame = +1

Query  1249  DMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKF-L  1425
             ++ +SG  ++W  +   + + R  LDR+  N     +FP +    + +  SDH P+   L
Sbjct  3     ELSSSGDRFTWAGKRWEKWI-RCCLDRSFGNKAWLEIFPGSNQTFMEKRGSDHRPVWLKL  61

Query  1426  CEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN----SLLDVVGAISEVTNLSKKWN  1593
             C++    R   R  +    +L R D       VWSN    +  +V   I    ++  +W 
Sbjct  62    CDSHEDRRGLFRFDKR---FLRRPDIEKEISEVWSNQHHAAGTNVAQKIRNCRSILSRWK  118

Query  1594  KETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSR  1773
             ++   N   +  SLQ R++  Q S  Y     + ++ R L+       K++EL W QKSR
Sbjct  119   RKENFNAKDKIRSLQLRLEWFQ-SKPYPCRFMVDLITRDLLL----AYKEDELFWKQKSR  173

Query  1774  RMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDF---KTISDHISNFFIDLFGR  1944
               W+  GDR++ F+H S  ++ NRS+ ++LK+  + N D       ++    +F +LF  
Sbjct  174   DKWLVFGDRSSKFFHDS--VKTNRSKNQLLKLKDKNNHDQWSDGAKAEVAVEYFSELFKS  231

Query  1945  KNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTF  2124
              N     P      P++      +LTR+++  EV  A+F +    +PGPDG+ A F+Q +
Sbjct  232   SNPTSYEPAFESFLPRVSGEMNEQLTRQISKDEVTLAIFSICADSAPGPDGMTATFFQKY  291

Query  2125  WEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISK  2304
             W  +   +T+ +++V   G +P +   +++ L+PK  +P+  +D RPI+L +V +K ++K
Sbjct  292   WGILGDQVTSEIQQVFCSGTMPREWNLTYLCLLPKISNPDLMTDLRPISLCSVLYKAVAK  351

Query  2305  VIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMR-LKKGKKGLMAIKLDLHK  2481
             ++V R +P + +++   Q++F+  R  +DNII+  E VH ++   +  K  M +K D+ K
Sbjct  352   ILVKRFQPHLHSIVSVNQSAFVRDRVISDNIIIAHEAVHALKGHPQISKEFMTVKTDMSK  411

Query  2482  AYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPL  2661
             AYD ++W +L S L   GF   ++  +M  V   + S+L N        P RG+RQGDPL
Sbjct  412   AYDRVEWSYLRSLLAALGFDNRVVQWVMMCVTTVTYSVLINDHPFGLITPQRGIRQGDPL  471

Query  2662  APYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMI  2841
             +P+LF+L  E L+  +    R      +  +  G  + HL FA+D +   +AS DQ  ++
Sbjct  472   SPFLFVLCTEGLTHLLNVVERNGLLDGMQFASDGPSIHHLLFADDSLFMCKASHDQATVL  531

Query  2842  MNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKR  3021
                L+ +   +G  IN+ KS+I        E +  ++ + GI        YLG+P     
Sbjct  532   NRILQYYGKATGQTINLQKSSISFGNMVGEETRAQVRVIMGIVSEGGTSKYLGLPECFSG  591

Query  3022  VSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDID  3201
                    +I D  + +L +W    +S  G+  L++S +  MPV+ M VF+LP      I 
Sbjct  592   SKVDMLSFIKDRSQARLDSWYLRQISPGGKEILLKSTVGGMPVFAMSVFRLPKTVTAKIS  651

Query  3202  RICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDK  3381
              +  ++ WGD +  +K+H + W+ +C  KD GG+G R    FN ALLAK  W+++ + D 
Sbjct  652   SMMANYWWGDDSNKRKIHWIAWDKLCLPKDRGGIGFRDLECFNQALLAKQGWKILNAPDC  711

Query  3382  LWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWW  3561
             L  + ++  Y  N +F +  + +  S+ WRSI+ GR +++ G   R+GNG +   W D W
Sbjct  712   LLSRFLKSIYFNNGDFLSATLGSRPSYAWRSILFGRELLQEGIRHRVGNGSATKVWLDKW  771

Query  3562  TGDKPLAFMDEVTIPDSQSEA--KVSDFI-LPNRTWNVDKLSSL-LPHDIIDGIRATPIA  3729
               D P+  +    I +   +   + +D I + +R W+V+KL+ + +P D+   ++  P+ 
Sbjct  772   IED-PVEGLRAPWIKNYSFDVNLRAADLINVESRRWDVNKLAEIFVPADVEIIMKNQPVV  830

Query  3730  VCEQVSDSLYWPRSPTGAFSVRSAF-------SHIAGNDEDAMDT-----SWVWKMRVTE  3873
               E   D + W  + +G  SV+SA+         +A     A+ +        WK++ + 
Sbjct  831   NKE---DFVSWRFNKSGQISVKSAYWLATDMKMRMALPQAFALPSLNGLIEKAWKVQTSP  887

Query  3874  RCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHH  4053
             + R+F+W  +   L  +     +GM  D  C TCGD  E++NH++  C FA+  W  +  
Sbjct  888   KLRIFIWRALSDALPVSDLIIGRGMKIDGRCQTCGDEGESINHLIFLCPFARQVWVLSPI  947

Query  4054  PV---SFQYSLVTP----LKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFEN  4212
             P     F  S V      L +  K+    S+     PW V      W IWK RN  +FEN
Sbjct  948   PYPREGFSTSSVFANFEFLFNIRKSRNVQSEEGRVWPWVV------WNIWKRRNGFLFEN  1001

Query  4213  TASAPMDIMRRANNLTLDTVEVF-----------LNKKCVHVGKMRWVCWQPPETGWIKF  4359
                 P+++  +A     D  E F           L+K    V + RW    PP+ GW   
Sbjct  1002  RCYNPLEVSAKA---VRDAEEWFVAQSIEKEWKELDKITPPVPERRWF---PPKPGWKMC  1055

Query  4360  NTDGAFKRNTGLASAGGLARDHKG  4431
             N    F  N  +A  G + R+ +G
Sbjct  1056  NVGFTFDGNKKIAGGGWVLRNERG  1079



>ref|XP_009101684.1| PREDICTED: uncharacterized protein LOC103827880 [Brassica rapa]
Length=1295

 Score =   445 bits (1145),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 331/1196 (28%), Positives = 541/1196 (45%), Gaps = 89/1196 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
              FWR  I +  +I ++   I  ++S   + V VSF Y  P    +   W+  +  +    
Sbjct  57    LFWRQDI-DLQIISSSKNLIDTVISYKGATVYVSFVYGEPEVSNRNIIWDSLIDLAQTRT  115

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
             + W++ GDFN+I DN E+ G           F    ++C L D+  SG+S SW  +    
Sbjct  116   SAWLLTGDFNEIVDNSEKSGGPERAEGSFGAFRNMLASCNLFDLQHSGISLSWRGKRRTH  175

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
              V  R LDR+L N    + FP  +   L    SDH  L  + ++    R     F     
Sbjct  176   LVYCR-LDRSLVNPAWSDSFPSGRCQYLGFEASDHRTLITVFDSAKRRRNRLFRFDRRLR  234

Query  1483  WLTREDYRDIWGRVW-SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
                 E+ +++    W SN    V   +++       W +E     F  K  +    + + 
Sbjct  235   --DNEEVKELIANTWNSNPEASVNSRLAQCRRALSTWTREQH---FNSKEKINKLKQNLD  289

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
             E++     +G   L   L  EL    K EE  W Q+SR MW+  GDRN+ ++H     R+
Sbjct  290   EAM--TDPQGNDDLIALLNAELMLAYKAEEEFWRQRSRIMWLSLGDRNSGYFHAVAKGRK  347

Query  1840  NRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKN--IMDGSPNDMYCG---PKLDT  2001
              R+R+ +++  NG    + + I+  I+ +F ++F   N    +G   ++      P +  
Sbjct  348   ARNRMSVIEDSNGIAYYEEEQIASQITAYFTEMFSSLNSDATEGDTREIVGSAIRPSVSE  407

Query  2002  GQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
                 +L+      E+K A+F +    + GPDG  A+F+ + W  V + +   ++   R G
Sbjct  408   SANARLSAIPNTAEIKTALFLIHPDKALGPDGFSASFFHSNWSTVGTSLIREIQAFFRTG  467

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P     +++ LIPK    +  SD+RPI L NV++K+I+K++  R++PI++++I   Q+
Sbjct  468   LLPTVTNVTYVRLIPKSTGAKLVSDYRPIALCNVAYKVITKILSLRLKPILQDIISETQS  527

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGK-KGLMAIKLDLHKAYDSIDWEFLESTLVDFGF  2538
             +F+PGR+ +DN+++T EI+H ++  +   +  MA+K D+ KAYD ++W F+E  L  FGF
Sbjct  528   AFVPGRAISDNVLITHEILHSLKTSEAVIRCSMAVKTDMSKAYDRLEWRFIEEVLTRFGF  587

Query  2539  PQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEK  2718
                 + LIM  V   + S L N        P RG+RQGDPL+PYLFIL  E LS      
Sbjct  588   AAPFVHLIMQCVTSVAYSFLINDSVHGKIIPSRGIRQGDPLSPYLFILCGEVLSGLCLRA  647

Query  2719  VRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSK  2898
              R+ +   + ++     ++HL FA+D M F    +     +M  + K+   SG  IN SK
Sbjct  648   QRIGHLSGLRVAIPAPRINHLLFADDTMFFLGTDDLSCISLMEIIHKYRRSSGQMINASK  707

Query  2899  SNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLAN  3078
             S+IF S  T   I+  +K+  GI     +G YLG+P    R  +  F  I+D ++++ A 
Sbjct  708   SSIFFSAMTPQVIRERVKSHLGIEKEGGVGKYLGLPEHFGRRKRDLFTGIVDRIRQQAAC  767

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W    LS                         PA +     R  R   W           
Sbjct  768   WCSRQLS-------------------------PADSGGMSPRKKRKMFW-----------  791

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
             V W  +   K  GGLG+R    FN ALLAK +W++++  D L  +V+R KY    +F   
Sbjct  792   VAWETLTAPKALGGLGIRDIQAFNTALLAKQSWRIISKPDCLLSRVLRGKYCSKVSFLEV  851

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTG----DKPLAFMDEVTIP  3606
               + +AS GWR I+ GR ++       IG+G S   W D W       +P+   +E    
Sbjct  852   EPLKSASHGWRGILAGRDLLATNLGKAIGDGESTRIWKDPWLSPLLPTRPIGPANE----  907

Query  3607  DSQSEAKVSDFILPNRT-WNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGA  3783
                 +  V+DF+    T WN+ ++  +LP+ + D +   P  +   V DS  W  S +G 
Sbjct  908   -EHQDLVVADFLCRGNTDWNIQRIKEVLPNYLTDILNVKPSIM--GVPDSFVWLASRSGV  964

Query  3784  FSVRSAFSHIAGNDEDAMDT------------SWVWKMRVTERCrlflwllmrgrllTNM  3927
             ++ +S + ++A + E A +               +W  ++  +  LFLW +M+G L    
Sbjct  965   YTAKSGY-YVAASMELAANRVEARPLPDQNLYKSIWASKIPPKLHLFLWKIMQGALALGE  1023

Query  3928  ERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLKSWVKN  4107
                R+G+  +  C  CG+  ET +H+ + C F +  W        F   L          
Sbjct  1024  NLARRGILNNISCRHCGE-PETTDHLFLHCVFTRQIWSSHIWSSPFDPRLHATFAEAFIG  1082

Query  4108  NCCASDWINGCPWGVT---FIYTCWEIWKARNQRIFENTASAPMDIMRRANNLTLDTVEV  4278
             +  A+   N  P GV    F +  W IW ARN  +FEN    P +I+  AN + L     
Sbjct  1083  STAAT---NLPPLGVATNLFPWITWGIWTARNYYVFENRVFTPKEII--ANAIRLAREWS  1137

Query  4279  FLNKKCVHVGKMRWVCWQPP--ETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWL  4440
                         +     PP   + ++   TD A++  +  A  G +  DH+  WL
Sbjct  1138  IAQTSPYSSSSPQLSRTLPPTLTSPFVVCFTDAAWQAGSKKAGCGWIFTDHRDAWL  1193



>gb|EEC68887.1| hypothetical protein OsI_37529 [Oryza sativa Indica Group]
Length=1765

 Score =   450 bits (1158),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 286/966 (30%), Positives = 474/966 (49%), Gaps = 49/966 (5%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             V+F Y  P    + R W+   +     + PW ++GDFN+     E +  +     +  +F
Sbjct  573   VTFVYGEPRVENRHRMWSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDF  632

Query  1219  VESFSACGLLDMGTSGVSYSW-FRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRT  1395
              +    C L D+G  GV +++  ++EG R V+ R LDR + + + ++++  A+ + L   
Sbjct  633   RDVLQDCELHDLGFKGVPHTYDNKREGWRNVKVR-LDRVVADDKWRDIYSTAQVVHLVSP  691

Query  1396  HSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVW-----SNSLLDVVGAI  1560
              SDH P+       +P +   +   +E  W    +   +    W        L D+  A+
Sbjct  692   CSDHCPILLNLVVKDPHQLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKAL  751

Query  1561  SEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLK  1740
             ++V    + W++    N+ GR+  L+   K + E +  N  R    + R     +NE+L 
Sbjct  752   AKVMTALRSWSRAKVKNV-GRE--LEKARKKLAELIESNADR---TVIRNATDHMNELLY  805

Query  1741  QEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHIS  1917
             +EE+LW Q+SR  W++D DRNT F+H   + R  +++I  L+  N   +S    +    +
Sbjct  806   REEMLWLQRSRVNWLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMAT  865

Query  1918  NFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDG  2097
              +F D++     ++          K+      KL  + T  E+ +A+F +    SPGPDG
Sbjct  866   EYFQDVYTADPNLNPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDG  925

Query  2098  IQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLL  2277
               A FYQ  W  +K+ I   V++  + G +P  + ++ I LIPKK+ P    DFRPI+L 
Sbjct  926   FPARFYQRNWGTIKADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLC  985

Query  2278  NVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKGL  2454
             NV +K++SK +VNR+RPI+ +L+   Q++F+ GR   DN +L  E  H M+  KK     
Sbjct  986   NVVYKVVSKCLVNRLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAA  1045

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
              A KLDL KAYD +DW FLE  +   GF +  ++ IM  V      + +NG  L  F P 
Sbjct  1046  CAYKLDLSKAYDRVDWRFLEMAMNKLGFARRWVNWIMKCVTSVRYMVKFNGTLLQSFAPT  1105

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RGLRQGDPL P+LF+   + LS  ++EKV   +  P  + R   G+SHL FA+D +LF +
Sbjct  1106  RGLRQGDPLLPFLFLFVADGLSLLLKEKVAQNSLTPFKVCRAAPGISHLLFADDTLLFFK  1165

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A + +  ++   L  ++  +G  IN +K +I     +   +   +  +            
Sbjct  1166  AHQREAEVVKEVLSSYAMGTGQLINPAKCSILMGGASTPAVSEAISEI------------  1213

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
                P+   R    TF  +   + +++  W  N LS  G+  L+++ + ++PVY M +FKL
Sbjct  1214  --FPVERDR----TFQSLQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKL  1267

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P    +D+ ++ ++F W      +K H   W+ + K K  GGLG R    FN ALLA+ A
Sbjct  1268  PESVIDDLTKLTKNFWWDSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQA  1327

Query  3355  WQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGL  3534
             W+L+T  D L  +V++ KY  + +   T   +N+S  WRSI  G  +++ G  WR+GNG 
Sbjct  1328  WRLITYPDSLCARVLKAKYFPHGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGN  1387

Query  3535  SLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILPNRTWNVDKLSSLLPHDIIDGI  3711
             S+  W D W    P           +    K VSD I  + +W+V K+     H++   +
Sbjct  1388  SIRIWRDSWL---PRDHSRRPITGKANCRLKWVSDLITEDGSWDVPKIHQYF-HNLDAEV  1443

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAG--NDEDA-------MDTSW--VWK  3858
                         D + W     G FSVRSA+   A   N E++       ++ +W  +WK
Sbjct  1444  ILNICISSRSEEDFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWK  1503

Query  3859  MRVTER  3876
              +V ++
Sbjct  1504  CKVPQK  1509



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score =   452 bits (1163),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 349/1155 (30%), Positives = 535/1155 (46%), Gaps = 60/1155 (5%)
 Frame = +1

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PW++ GDFN I    E+   ++ +     +F  +   CGLLD G  G S++W       
Sbjct  890   GPWMVGGDFNSIVSTVERLNGAAPHVGSMEDFASTLFDCGLLDAGFEGNSFTW---TNNH  946

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
               QR  LDR ++N E    F   +   L R  SDH PL   C   +        F    A
Sbjct  947   MFQR--LDRVVYNPEWAQCFSSTRVQHLNRDGSDHCPLLISCNTASQKGASTFRFLH--A  1002

Query  1483  WLTREDYRDIWGRVWSNSLLDV-VGAI----SEVTNLSKKWNKETFGNIFGRKASLQARI  1647
             W    D+     R W   +    + A       +    K WNK  FG+IF +    +   
Sbjct  1003  WTKHHDFLPFVTRSWQTPIQGSGLSAFWFKQQRLKRDLKWWNKHIFGDIFEKLRLAEEEA  1062

Query  1648  KGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKST  1827
             +  +    +N S   + L  K   +LN  L  EEL W QKS   W+ +G+ NT F+H   
Sbjct  1063  EKKEIEFQHNPSLTNRNLMHKAYAKLNRQLSIEELFWQQKSGVKWLVEGENNTKFFHMRM  1122

Query  1828  LIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTG  2004
               +R RS I  ++   G    D  +I    ++FF DL   +N  D S  D    P++ + 
Sbjct  1123  RKKRVRSHIFQIQDSEGNVFDDIHSIQKSATDFFRDLMQAENC-DLSRFDPSLIPRIISS  1181

Query  2005  QMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
               ++ L     + E+K+AVF++ K    GPDG  + FYQ  W+ +K+ +   V    R  
Sbjct  1182  ADNEFLCAAPPLQEIKEAVFNINKDSVAGPDGFSSLFYQHCWDIIKNDLLDAVLDFFRGS  1241

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +P  +  + + L+PKK +    S++RPI+L  V  KI++K++ NR+  I+ ++I   Q+
Sbjct  1242  PLPRGVTSTTLVLLPKKPNACHWSEYRPISLCTVLNKIVTKLLANRLSKILPSIISENQS  1301

Query  2362  SFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFP  2541
              F+ GR  +DNI+L QE++  +   K + G + +KLD+ KAYD ++W+FL   +  FGF 
Sbjct  1302  GFVNGRLISDNILLAQELIGKID-AKSRGGNVVLKLDMAKAYDRLNWDFLYLMMEHFGFN  1360

Query  2542  QNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKV  2721
              + I++I   +     SLL NG     F+  RGLRQGD ++P LFILA + LS  +    
Sbjct  1361  AHWINMIKSCISNCWFSLLINGSLAGYFKSERGLRQGDSISPMLFILAADYLSRGLNHLF  1420

Query  2722  RVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKS  2901
                +     LS     +SHL FA+D+++F        + I++ L+++   SG  +N  KS
Sbjct  1421  SCYS-SLQYLSGCQMPISHLSFADDIVIFTNGGRSALQKILSFLQEYEQVSGQKVNHQKS  1479

Query  2902  NIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSK-HTFGYILDGMKRKLAN  3078
                 +   +   ++ + + TG        TYLG P LHK   K   F  ++  ++ +++ 
Sbjct  1480  CFITANGCSLSRRQIISHTTGFQHKTLPVTYLGAP-LHKGPKKVLLFDSLISKIRDRISG  1538

Query  3079  WKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHL  3258
             W+  +LS  GR TL++S LSS+P+Y +QV K P      IDR+   FLWGDS + KK+H 
Sbjct  1539  WENKILSPGGRITLLRSVLSSLPMYLLQVLKPPVTVIERIDRLFNSFLWGDSTECKKMHW  1598

Query  3259  VGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFAT  3438
               W  I      GGLG+RK  D   A   KL W+  T  + LW + +R KY   +     
Sbjct  1599  AEWAKISFPCAEGGLGIRKLEDVCAAFTLKLWWRFQTG-NSLWTQFLRTKYCLGRIPHHI  1657

Query  3439  PMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQS  3618
                 + S  W+ ++ GR +      W+IG G  L FW D W GDKPLA     + P+ Q+
Sbjct  1658  QPKLHDSHVWKRMISGREMALQNIRWKIGKG-DLFFWHDCWMGDKPLA----ASFPEFQN  1712

Query  3619  EAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRS  3798
             +           TW+VDKL S LP  +++ I   P     +  D  YW  +  G FS RS
Sbjct  1713  DMSHGYHFYNGDTWDVDKLRSFLPTILVEEILQVPFDKSRE--DVAYWTLTSNGDFSTRS  1770

Query  3799  AFSHIAGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCG  3978
             A+  I          S++W   +      FLW  +   +   +    KG+   + C  C 
Sbjct  1771  AWEMIRQRQTSNALCSFIWHRSIPLSISFFLWKTLHNWIPVELRMKEKGIQLASKCVCC-  1829

Query  3979  DGDETMNHVLMECSFAKDCWRRTHHPVSFQYSLVTPLK------SWVKNNCCASDWINGC  4140
             + +E++ HVL E   AK  W        FQ  +  P        +W      + D++   
Sbjct  1830  NSEESLIHVLWENPVAKQVW--NFFAQLFQIYIWNPRHVSQIIWAWY----VSGDYVRKG  1883

Query  4141  PWGVTF-IYTCWEIWKARNQRIFENTASAP-------MDIMRRANNLTL--------DT-  4269
              + V   ++ CW +W  RN     +T           M   R+  + +L        DT 
Sbjct  1884  HFRVLLPLFICWFLWLERNDAKHRHTGLYADRVIWRTMKHCRQLYDGSLLQQWQWKGDTD  1943

Query  4270  VEVFLNKKCVHV--GKMRWVCWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLF  4443
             +   L     H      + + W+ P  G  K N DG+  RN   A+ GG+ RDH G+ +F
Sbjct  1944  IATMLGFSFTHKQHAPPQIIYWKKPSIGEYKLNVDGS-SRNGLHAATGGVLRDHTGKLIF  2002

Query  4444  GFMTNIGVSNSFAAE  4488
             GF  NIG  NS  AE
Sbjct  2003  GFSENIGPCNSLQAE  2017



>ref|XP_009107566.1| PREDICTED: uncharacterized protein LOC103833219 [Brassica rapa]
Length=1182

 Score =   441 bits (1133),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 322/1116 (29%), Positives = 522/1116 (47%), Gaps = 94/1116 (8%)
 Frame = +1

Query  1231  SACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHH  1410
             +AC L+++ + G  ++W        V  R LDR   N      FP A    L +  SDH 
Sbjct  3     NACKLVELQSHGNGFTWSGLRSNSWVHTR-LDRCFGNTAWFKKFPCANQSFLDKRGSDHR  61

Query  1411  P-LKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKK  1587
             P L  L +                   ++  Y+  W R +   LL+V G  + V N    
Sbjct  62    PVLIHLID-------------------SQHSYKG-WFR-FDRRLLEVDGVKANVEN---A  97

Query  1588  WNKE-TFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQ  1764
             W  + T GN     ASL  R+K  +        R L  L+++   EL +  + EEL W+Q
Sbjct  98    WCLDGTSGN-----ASLSNRLKACR--------RSLSGLKKQ--QELVKAQRDEELYWWQ  142

Query  1765  KSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDH---ISNFFIDL  1935
             KS+  W+  GD+N+ F+H S  +R +R+R  + K+      +  + +D      +F+ +L
Sbjct  143   KSKDKWLARGDKNSRFFHTS--VRASRARNSLDKLLNPQGVEVYSEADKGKVAVDFYTNL  200

Query  1936  FGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFY  2115
             F   N    S       P++ T    +LTR V+  E++ AVF +    +PGPDG+ A F+
Sbjct  201   FRSSNPAPFSEWFQDLQPRVSTLMNGELTRPVSAAEIRDAVFSINPSKAPGPDGMSALFF  260

Query  2116  QTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKI  2295
             Q+FW  V++ +   V++    G +P +   + + LIPK   P+T SD RPI+L +V +K+
Sbjct  261   QSFWTTVEAQVVREVQRFFHFGVLPKEWNYTHLCLIPKTPEPKTVSDLRPISLCSVIYKV  320

Query  2296  ISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKG-LMAIKLD  2472
             ISK++V+R+RP M  LI P Q++F+  R  +DNI +  E+VH + +        M +K D
Sbjct  321   ISKIMVSRLRPWMPGLISPTQSAFVAERLMSDNITIAHEMVHSLGVVDTPASEQMVVKTD  380

Query  2473  LHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQG  2652
             + KAYD ++W +L S L+  GF    +  +M  V   + S+L N +     +P RGLRQG
Sbjct  381   MSKAYDRVEWGYLRSVLLALGFDLRWVQWVMKCVTTVTYSVLINDQPHGMIEPQRGLRQG  440

Query  2653  DPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQG  2832
             DPL+P+LF+L  E L   +    R ++   +     G  + HL FA+D +   +A+E+Q 
Sbjct  441   DPLSPFLFVLCTEGLPHLLSNAERRQSISGMKFGVRGPSIHHLLFADDCLFSCKANEEQS  500

Query  2833  RMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPIL  3012
              ++MN L ++   +G  IN  KS+I    +   E    +K++ GI        YLG+P  
Sbjct  501   NVLMNILGRYGAATGQVINPQKSSIMFGKSVRKENNIRVKHILGIEAEGGEAKYLGLPEC  560

Query  3013  HKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCN  3192
                     F Y+ + M R+++ W    LS AG+  ++++  S++PV  M VFK+P     
Sbjct  561   FNGSKVKLFSYLKEKMGRRISGWHARTLSQAGKEVMIKAVASALPVSAMSVFKIPKTVTT  620

Query  3193  DIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTS  3372
              +     +F W      +K+H + W  +C  KD GG+G +    FN ALLAK AW+L+  
Sbjct  621   SLSSALANFWWSAVEHKRKIHWISWEKMCLPKDLGGMGFKDLESFNKALLAKQAWRLINL  680

Query  3373  HDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWS  3552
                L  +V++ KY +   F    +    S+ WRS++ G+ ++  G    +GNG  L  W+
Sbjct  681   ESCLMSQVLKGKYFEGTCFVKAQLGKRPSYAWRSVLEGKDLLVQGLKVAVGNGSLLKVWT  740

Query  3553  DWWTGDK------PLAFMDEVTIPDSQSEAKVSDFI-LPNRTWNVDKLSSL-LPHDIIDG  3708
             D W  D       PL       +     E +VS+ I    R W+  KLS L +P D++  
Sbjct  741   DPWLEDDNGICRPPLRKQRFFNV-----ELQVSELINYHTRRWSRRKLSELFVPRDMMIL  795

Query  3709  IRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF--SHIAGNDEDAMDTSW----------V  3852
              +  P+ + E   DS  W  + +G +SV+S +  +    N E   D             V
Sbjct  796   EKNQPV-ISEH--DSWVWRHTKSGLYSVKSGYELAFTMKNVELIRDQQVLPSLNPLKDRV  852

Query  3853  WKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
             W +    + ++F+W  + G L        +GM  D  C TCG   E++NHVL  C+FA+ 
Sbjct  853   WNLLAPSKLKVFIWKALSGALSVLDGLRDRGMKCDLECQTCGQTGESINHVLFSCTFARQ  912

Query  4033  CWRRTHHPV------SFQ-YSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKAR  4191
              W  T  P       SF  ++ V  L S+ +      +     PW        W +WK R
Sbjct  913   VWAMTRFPSPPAGFDSFSIFANVNYLISFWETKKHVFEATRNFPW------VLWYLWKNR  966

Query  4192  NQRIFENTASAPMDIMRRANNLTLD-TVEVFLNKKCVHVGKMRWV----CWQPPETGWIK  4356
             N  +FE      + +  +A            L ++  +  + R +     W+ P   ++K
Sbjct  967   NNLLFEGALFESVQVCTKAEEEASQWYAAQSLERRSTNDNRNRLIQASAAWKRPPENFVK  1026

Query  4357  FNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIG  4464
              N    ++    +A A  + RD +G  L     + G
Sbjct  1027  CNIGFKWEYKKKIAGAAWVVRDSRGTVLLHSRRSFG  1062



>gb|AAO00713.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1557

 Score =   432 bits (1112),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 302/1052 (29%), Positives = 494/1052 (47%), Gaps = 99/1052 (9%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVS-GPHSNV-RVSFAYVRPNRMAKERFWNDCLSYSSE  1116
              FW  S+ +  ++    + I   +   P+  +   +F Y  P    + + W+   S    
Sbjct  503   LFWHESV-HVEILNKNERFIDAYIRLSPNDPLWHATFVYGEPRVENRHKMWSLLNSIKQS  561

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
              N  W+++GDFN+     E +     + ++   F +    C L D+G SG+ +++  + G
Sbjct  562   SNLSWLVIGDFNEALWQFEHFSRKPRSDAQMQAFRDVLDTCELHDLGISGLPHTYDNRRG  621

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
             G    + +LDRAL + E ++LF + +   L    S+H P+                    
Sbjct  622   GWNNVKVRLDRALADDEWRDLFSQYQVQHLVSPCSNHCPI--------------------  661

Query  1477  gAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
                                 +L + G++ +     + W+K+ + NI GR+  L+   K +
Sbjct  662   --------------------VLKLHGSVPD-----QSWSKKKYKNI-GRE--LEKTRKKL  693

Query  1657  QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
                +   T +      R+    +NE+L +EE+LW Q+SR  W+++GDRNT F+H     R
Sbjct  694   SNLLEAGTDKAAI---RQTSDYMNELLYREEMLWLQRSRVNWLKEGDRNTKFFHNRVAWR  750

Query  1837  RNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH  2013
               +++I  L+   G ++     +    + +F D+F     +D SP      PK+     +
Sbjct  751   AKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSPVTRLIQPKVTEEMNN  810

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
             +L  E +  E+  A+F +    +PG DG  A FYQ  W  +K+ I   VK+    G +  
Sbjct  811   RLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWGCIKNDIVRAVKEFFHSGIMLE  870

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
              + ++ I LIPK + P    DFRPI+L NV +K++SK +VNR+RP +  LI   Q++F+P
Sbjct  871   GVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKCLVNRLRPFLDELISKNQSAFVP  930

Query  2374  GRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNL  2550
              R   DN +L  E  H++ R K  +    A KLDL KAYD +DW FLE ++  +GF    
Sbjct  931   RRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKAYDRVDWRFLEQSMYKWGFSHCW  990

Query  2551  ISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVK  2730
             +S +M     + IS + +              +G    P+LF+   + LS  ++EKV   
Sbjct  991   VSWVM-----TCISTVCD--------------KGTRCDPFLFLFVADGLSLLLEEKVEQG  1031

Query  2731  NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
                PI +     G+SHL FA+D +LF +A   Q + I      ++  +G  IN +K +I 
Sbjct  1032  AISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIKEVFGSYATSTGQLINPTKCSIL  1091

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGN  3090
                +     +  + N   I+ ++    YLG+P    R+ K  F  + + + +K+  W  N
Sbjct  1092  FGNSLPIASRDAITNCLQIASTEFEDKYLGLPTPGGRMHKGRFQSLRERIWKKILQWGEN  1151

Query  3091  MLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWN  3270
              LS  G+  L+++ + ++PVY M +FKLP   C D+  + R+F WG     +K H   W 
Sbjct  1152  YLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTSLTRNFWWGAEKGKRKTHWKAWK  1211

Query  3271  DICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIA  3450
              + KSK  GGLG +    FN ALLA+ AW+L+ + D L  +V++ KY  N +   T    
Sbjct  1212  SLTKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSLCARVLKAKYYPNGSIVDTSFGG  1271

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-  3627
             NAS GW++I  G  +V+ G  WRIGNG S+  W D W    P         P +    K 
Sbjct  1272  NASPGWQAIEHGLELVKKGIIWRIGNGRSVRVWQDPWL---PRDLSRRPITPKNNCRIKW  1328

Query  3628  VSDFILPNRTWNVDKLSSL-LPHD--IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRS  3798
             V+D +L N  W+ +K++ + LP D  II  +R +         D + W     G FSVR+
Sbjct  1329  VADLMLDNGMWDANKINQIFLPVDVEIILKLRTS----SRDEEDFIAWHPDKLGNFSVRT  1384

Query  3799  AFSHIAGN--DEDA--------MDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRK  3942
             A+  +A N   E+A        +  +W  +WK  V  + ++F W      L T   + ++
Sbjct  1385  AY-RLAENWAKEEASSSSSDVNIRKAWELLWKCNVPSKVKIFTWRATSNCLPTWDNKKKR  1443

Query  3943  GMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
              +     C  CG   E   H L  C  AK  W
Sbjct  1444  NLEISDTCVICGMEKEDTMHALCRCPQAKHLW  1475


 Score = 57.0 bits (136),  Expect(2) = 5e-128, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query  717  SPDVSMIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFD  896
            +P  +M  LSWNCRG+GN  TV    +L+++     +   ET+   VD+IK++ ++LG  
Sbjct  429  APSGAMNCLSWNCRGIGNATTVQELCALVKEASSQFVFLCETR-QPVDKIKRLRNRLGLR  487

Query  897  KLFNVDPLGFAGGLTLF  947
                V   G +GGL LF
Sbjct  488  GFAGVSSDGMSGGLALF  504



>emb|CCA66198.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   444 bits (1141),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 341/1128 (30%), Positives = 547/1128 (48%), Gaps = 52/1128 (5%)
 Frame = +1

Query  946   FWRSSIF--NFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              WR+S F  +F+       A+ G V     N  +   Y   + + +E  WN    + S  
Sbjct  73    LWRASKFRMDFSRCERNWIAVGGCVLSSDFNCLLINIYNSCDDVIREETWNSLFEFCSNS  132

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
             N P ++ GDFN++  ++++ GS  ++ S  L F    +   L+++      Y+WFR    
Sbjct  133   NLPCLIAGDFNEVLSSKDR-GSHQIDESSSLKFRNFINNLRLIEVSPVEGWYTWFRGNS-  190

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfeg  1479
                 R KLDR L   E    FP     IL R+ SDH PL       +      RPF+F+ 
Sbjct  191   ----RSKLDRVLVQAEWIEKFPALAVSILNRSISDHCPLLL---QSSIVDWGPRPFKFQD  243

Query  1480  AWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
              WL+ +   +I  + W  S  L ++  + +V    K WN E+FGNI    A++  R   +
Sbjct  244   VWLSHKGCMEIVEKAWIQSKELTLMQKLKKVKLDLKTWNSESFGNI---DANILLREAEI  300

Query  1657  QESVFYNTSRGLQVLERKLVT----ELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKS  1824
             Q+      SR L+  E K       EL E LK++E+ W Q+SR  W++ GDRNT F+H  
Sbjct  301   QKWDSEANSRDLEPEEIKTRAQAQLELWEWLKKKEIYWAQQSRIKWLKSGDRNTKFFHIC  360

Query  1825  TLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTG  2004
               IRR+++ I  + + G+   D   I +    +F +LF  ++  +          KL   
Sbjct  361   ASIRRSKNNISSILLQGKKIEDPIIIKEEAVKYFKNLF-TEDFKERPTFTNLSFKKLSES  419

Query  2005  QMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGR  2184
             Q   ++   +  E+ +AV       SPGPDG    F +  W+ +K    + +++    G 
Sbjct  420   QAFSISAPFSTTEIDEAVASCNPSKSPGPDGFNFKFIKASWDLIKHDFYSIIQEFWHTGI  479

Query  2185  VPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNS  2364
             +P     +FI LI K +SP    DFRPI+++   +KIISK++  R++ +M +L+GP Q+S
Sbjct  480   LPRGSNVAFIALIAKIESPSGFKDFRPISMVGCVYKIISKLLAGRLKQVMNDLVGPHQSS  539

Query  2365  FLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQ  2544
             F+ GR   D+I++  E+  +   K+ KK  + +K+D HKA+DS+ W FL+ TL   GFP 
Sbjct  540   FIEGRQILDSILIASEL--FESCKRRKKATVMLKIDFHKAFDSVSWSFLDWTLSQMGFPP  597

Query  2545  NLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVR  2724
                  I   V  ++ S+L NG    PF+  RGLRQGDPL+P+LF+L +E ++  I++   
Sbjct  598   RWKKWISSCVSSAAASVLLNGSPSLPFKLQRGLRQGDPLSPFLFVLVVEVMNLMIKKAES  657

Query  2725  VKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSN  2904
             + +W+ I +++ G  ++HL FA+D +LFA  + +    I   L  F   SGL IN  KS 
Sbjct  658   LNSWQGIEITKNGPILTHLQFADDTILFAPHNMEALENIKKTLILFQLSSGLKINFHKSE  717

Query  2905  IFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTF-GYILDGMKRKLANW  3081
             +         ++R  KNL    V     TYLG+P+     SK +F   +++ + +KL+ W
Sbjct  718   LLGINVPQDWMQRAAKNLC-CKVGSFPITYLGMPV-GGSCSKLSFWDPLIEKISKKLSLW  775

Query  3082  KGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLV  3261
             KGN+LSL GR TL++++L ++P+Y M +F +P G  + I RI R+FLW      K + L+
Sbjct  776   KGNLLSLGGRLTLIKASLLNLPIYYMSLFPMPQGVIDKITRIQRNFLWSGGLNKKSLALI  835

Query  3262  GWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATP  3441
              W+     K  GGL +   L  N  LL K  W+     + LW +++  KY   K    + 
Sbjct  836   KWSYAQLPKIFGGLNIGNLLARNLGLLFKWIWRYFQEPNALWRQIIEAKYGYPKELCISD  895

Query  3442  MIANASWG-WRSIMRG-------RSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAF-MDE  3594
             +    + G W+ I          R ++  G   R+ NG S  FW D W  +  L F    
Sbjct  896   LELLKNGGPWKLICNSLLKKEEVRELINQGLRMRVSNGESTRFWHDIWIDNSALKFQFPR  955

Query  3595  VTIPDSQSEAKVS---DFILPNRTWNVDKLSSLLPHDIIDGIRATP----IAVCEQVSDS  3753
             + +   Q  A VS    F      W +     L   D ++          I + ++  D 
Sbjct  956   LFLIAEQPLAVVSSMGQFQGNEWRWLIPWSRELRSRDQVEWETLCSLLQNIKISKEGEDV  1015

Query  3754  LYWPRSPTGAFSVRSAFSHIAGNDEDAMD--TSWVWKMRVTERCrlflwllmrgrllTNM  3927
             L W    +G FSV+S +S ++ +    ++     +WK  V  R  +F WL +  R+ T  
Sbjct  1016  LIWRHDKSGIFSVKSFYSKLSQSSGLTVERVVPRLWKGLVPYRIEVFFWLALLERINTKN  1075

Query  3928  ERWRKGMT--EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQY----SLVTPL  4089
             +  R G+   EDT+C  C    E + H+ + C +A++ W       +  +    SLV   
Sbjct  1076  KLSRLGIIPPEDTMCPLCSSWAEDVAHLFLFCPYAREIWGWWLKIWNLNWVWPSSLVLAF  1135

Query  4090  KSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMD  4233
             + W   +  +++ +    W  +F    W +WK RN RIF N AS  M+
Sbjct  1136  EQW---SFPSANKLFKKVWAASFQIIVWSLWKERNARIFNNKASPAME  1180



>ref|XP_010495329.1| PREDICTED: uncharacterized protein LOC104772406 [Camelina sativa]
Length=1131

 Score =   438 bits (1127),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 303/1005 (30%), Positives = 482/1005 (48%), Gaps = 77/1005 (8%)
 Frame = +1

Query  1312  RRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLT  1491
             R +LDRAL N +  +LFP+     LPR  SDH PL     A  P  R N  F     W+ 
Sbjct  129   RCRLDRALGNEDWHDLFPDTITEYLPRVASDHMPLLGCIGAKRPRGRRNFMFDRR--WVG  186

Query  1492  REDYRDI----WGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQ  1659
             +E   +     WG          V  +         W KE     +GR   L   IK   
Sbjct  187   KEGLMEAISSGWGAPPVRGSPSFVNKVVSCRRAISCWRKEQ--APYGR--VLIEDIKKEL  242

Query  1660  ESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRR  1839
             E+   + +   +V+  +L   L E  K EE+ W+ KSR  W++ GD+NT ++H  T  RR
Sbjct  243   EAAHADDTTSPKVIA-ELTGRLREAYKDEEMHWYLKSRNRWMRVGDKNTKYFHAQTKQRR  301

Query  1840  NRSRIRMLKINGE-WNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHK  2016
              R+RI  L    + W++D  T+ +   ++F DLF   N        +     +      +
Sbjct  302   ARNRIVGLYDKHDVWSTDDVTVKETAVSYFGDLFSTINPSSFDEVLLEVKSVITAVDNER  361

Query  2017  LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPK  2196
             LT   T  EV+KA+F M    +PGPDG+ A F+Q  WE VK+ + + V     +      
Sbjct  362   LTAPATEAEVRKALFMMHPDKAPGPDGMTALFFQKAWEVVKTDLVSLVNSFFEENAFESG  421

Query  2197  ILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPG  2376
             + ++ I LIPK   P   ++ RPI+L NV +K++SKV+ NR++ I+  LI   Q++F+PG
Sbjct  422   LNQTHICLIPKVTKPTRMAELRPISLCNVGYKVLSKVLCNRLKTILPRLISETQSAFVPG  481

Query  2377  RSTADNIILTQEIVHYMRLKKGKKG-LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLI  2553
             R  +DNI++ QE+ H +R     KG  MAIK D+ KAYD ++W FL +     GF +  I
Sbjct  482   RLISDNILIAQEMFHGLRTNNSCKGKFMAIKTDMSKAYDRVEWGFLGALFRRMGFAEKWI  541

Query  2554  SLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKN  2733
             S IM  V      +L NG+      P RGLRQGDPL+PYLFIL  E L  +I++    K 
Sbjct  542   SWIMLCVSSVQYQVLVNGQPHGQIIPERGLRQGDPLSPYLFILCTEVLIANIRKAEVDKR  601

Query  2734  WKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFC  2913
                I ++     ++HL FA+D + F +  +DQ  ++++ LK++   SG  IN +KS++  
Sbjct  602   ITGIKVANKCPPITHLLFADDSLFFFKVYKDQCGVVLDILKQYEAASGQQINFAKSSLQF  661

Query  2914  SPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNM  3093
                 +   +  ++ + GIS    +G+YLGIP            ++ D ++ +   W   +
Sbjct  662   GHTVDDPARLEMQGILGISNLGGMGSYLGIPESLGGSKTKVVSFVRDRLQSRTTGWTARL  721

Query  3094  LSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWND  3273
             LS  G+  +V+S  +++P + M  ++LP    + +     +F W  S Q           
Sbjct  722   LSKGGKEVMVKSVATAVPSFVMSCYRLPKTITSKLTSAVANFWWSTSGQR----------  771

Query  3274  ICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIAN  3453
                     GL                 W+L+   D L+ +V + +Y +N N        +
Sbjct  772   --------GL-----------------WRLIEFPDSLFARVFKSRYYRNSNPMEPLRFYS  806

Query  3454  ASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEVTIPDSQSEAKV  3630
              S+GWRSI+  RS+V +G   R+G+G +++ WSD W     P   +   +  D      +
Sbjct  807   PSYGWRSIVSARSLVNIGLIKRVGSGDTIDIWSDPWIPAQSPRPALQNGSPVDPN--LSL  864

Query  3631  SDFILPN-RTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS  3807
             S FI P+ RTW  D+L        +  I+A P++   +  DSL W  + +G +SV+S + 
Sbjct  865   SHFIDPSTRTWRRDRLIEHFDSVDVPLIQAIPLSSYPK-GDSLGWHFTKSGRYSVKSGYD  923

Query  3808  HI------------AGNDEDAMDTSWVWKMRVTERCrlflwllmrgrllTNMERWRKGMT  3951
              +            +G D   +  + VW++R   + + F+W  + G +  +    R+G+ 
Sbjct  924   TVRLGVPSFFKAFGSGPDITTL-LAGVWQVRCPPKLKHFMWQALTGCISVSANLRRRGVA  982

Query  3952  EDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPVSFQY----SLVTPLKSWVKNNCCA  4119
              D  C+ CG  +ET+NHVL  C  A+  W + H PV  Q+    S+   +  ++  N   
Sbjct  983   CDVGCSRCGAEEETVNHVLFLCPPARQAWAQAHVPVGPQHFPTESVYANVDHFIGRNNPG  1042

Query  4120  SDWINGCPWGVTFIYTCWEIWKARNQRIFENTASAPMDIMRRANN  4254
             S  ++  PW        W IWKARN ++FEN    P +++R A  
Sbjct  1043  SQ-VDFFPW------LMWYIWKARNAKVFENRTEHPDEVVRLAEG  1080



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score =   436 bits (1122),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 286/1058 (27%), Positives = 510/1058 (48%), Gaps = 45/1058 (4%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPH-SNVRVSFAYVRPNRMAKERFWNDCLSYSSEF  1119
              FWRS  +   ++  +   IH L++  + S   ++  Y  P+   +   W      S   
Sbjct  18    LFWRSG-WGVRLLSYSVGHIHVLITESNDSQFYLTGFYGHPDTQQRNHSWELLRRLSYTV  76

Query  1120  NAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGG  1299
                W+++GDFN+I  ++++ G       +  NF  +   C L     +G  ++W R+   
Sbjct  77    QGAWVVVGDFNEILFSKDKRGGRERPQGQMNNFKMALEDCRLSSTRFTGYPFTWARRYPD  136

Query  1300  RTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgn----pprrenrpf  1467
              +V   +LDR + N      +       L    SDH+P+  L EA         + +R F
Sbjct  137   GSVVEERLDRCVANGVFFGRYSHLTTSHLVAVGSDHYPI--LVEACVDDPEAGAKRSRRF  194

Query  1468  rfegAWLTREDYRDIWGRVW--SNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQA  1641
              FE  W    ++  +    W  ++ +  V  ++S      K WN   FGN+  +      
Sbjct  195   HFEEMWTKEPEFNKVIEEAWKVTDGVESVSNSLSLCAKELKTWNHIHFGNVRKQLTHAYK  254

Query  1642  RIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHK  1821
              +  +Q  +  +      VL+ K+   ++++L+++E++W Q+SR +W+++GD+NT F+H 
Sbjct  255   ELTALQGRLTTDQ----HVLKAKVEETISDLLEKQEIMWRQRSRVVWLKEGDKNTHFFHG  310

Query  1822  STLIRRNRSRI-RMLKINGEWNSDFKTISDHISNFFIDLFGRK--NIMDGSPNDMYCGPK  1992
                 R  R+R+  +   N  W ++ + I D   ++F  LF       M+   N++   P 
Sbjct  311   RASSRSKRNRVCGIFDANQAWQTEEQRIGDLFCDYFKTLFSSSGGQQMERILNEVR--PV  368

Query  1993  LDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVL  2172
             + +    +L +  T  E++  +F M    +PG DG+ A F+Q +W  V   +     ++L
Sbjct  369   ITSAMNDRLLQAFTREELEHTLFQMFPTKAPGHDGMPALFFQKYWHIVGDKVAKKCLQIL  428

Query  2173  RDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGP  2352
                    +   + I LIPK   P T S+FRPI+L    +K+I+K I NR++ ++ ++I  
Sbjct  429   NGEGSVREFNHTLIALIPKVKMPTTVSEFRPISLCTTVYKMIAKTIANRLKTVLPHVITE  488

Query  2353  FQNSFLPGRSTADNIILTQEIVHYMR-LKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVD  2529
              Q++F+P R   DN++   EI++ ++ +KK +   MA+KLD+ KAYD ++W FL + ++ 
Sbjct  489   TQSAFVPNRMILDNVMAAFEIMNTIKGVKKRRDVQMALKLDMAKAYDRVEWVFLRAMMLK  548

Query  2530  FGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDI  2709
              GF    +S +M  +  ++ S+LW G  +    P RGLRQG PL+PYLF++  E  S  +
Sbjct  549   LGFSATWVSKVMDCISTTTFSVLWKGTPVGHIMPQRGLRQGCPLSPYLFLICTEGFSCLL  608

Query  2710  QEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNIN  2889
                 R  +   + ++RG   V+HL FA+D +LF +A+      +    + +   +G  IN
Sbjct  609   HGAERRGDLVGVQVARGAPSVTHLLFADDSILFMKATNKACMALETLFQTYEEVTGQQIN  668

Query  2890  VSKSNIFCSPNTNS---EIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGM  3060
              SKS +  SPN      ++  G  N+  +   +N   YLG+P +  +  K  F ++ D +
Sbjct  669   YSKSALSLSPNATRADFDMIEGGLNVPVVRCHEN---YLGLPTIAGKGRKQLFQHLKDKL  725

Query  3061  KRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQ  3240
              + ++ WK  +LS AG+  L+++ L ++P Y+M  F++P G C +++ I   F W  +  
Sbjct  726   WKHISGWKEKLLSRAGKEILIKAVLQAIPTYSMSCFQIPKGLCKELNGIMARFWWAKAKD  785

Query  3241  NKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKN  3420
              + +H V W  +CKSK AGGLG R    FN ALLAK  W+++ + + L  ++ R +Y  +
Sbjct  786   KRGIHWVKWELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRARYHPS  845

Query  3421  KNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSD-WWTGDKPLAFMDEV  3597
               F    +  N S+ W S+  G+ ++  G  WR+G+G+S+  ++D W         M   
Sbjct  846   VPFLEAEVGTNPSFIWGSLQWGKELLNKGVRWRVGSGVSIQVYTDKWLPAPSCFKIMSPP  905

Query  3598  TIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPT  3777
              +P S    +V D    +  WNV  L  +     +D I   P+A      D L W     
Sbjct  906   QLPLS---TRVCDLFTSSGQWNVPLLKDIFWDQEVDAILQIPLASLAG-HDCLIWHYERN  961

Query  3778  GAFSVRSAFSHIAGNDEDAMDTS-----------W--VWKMRVTERCrlflwllmrgrll  3918
             G +SV+S +  +A  ++D M              W  +W +++  + + FLW      L 
Sbjct  962   GMYSVKSGY-RLARLEKDKMSGEPSARVDLNSKFWKKIWALKIPNKIKFFLWRCAWDFLP  1020

Query  3919  TNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKD  4032
                  + + +    +C  C    E++ H +  C  AK+
Sbjct  1021  CGQILFNRKIAPTPICPKCHRKAESVLHAVWLCEAAKE  1058



>gb|AAP54692.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1585

 Score =   433 bits (1113),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 302/1052 (29%), Positives = 494/1052 (47%), Gaps = 99/1052 (9%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVS-GPHSNV-RVSFAYVRPNRMAKERFWNDCLSYSSE  1116
              FW  S+ +  ++    + I   +   P+  +   +F Y  P    + + W+   S    
Sbjct  531   LFWHESV-HVEILNKNERFIDAYIRLSPNDPLWHATFVYGEPRVENRHKMWSLLNSIKQS  589

Query  1117  FNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEG  1296
              N  W+++GDFN+     E +     + ++   F +    C L D+G SG+ +++  + G
Sbjct  590   SNLSWLVIGDFNEALWQFEHFSRKPRSDAQMQAFRDVLDTCELHDLGISGLPHTYDNRRG  649

Query  1297  GRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfe  1476
             G    + +LDRAL + E ++LF + +   L    S+H P+                    
Sbjct  650   GWNNVKVRLDRALADDEWRDLFSQYQVQHLVSPCSNHCPI--------------------  689

Query  1477  gAWLTREDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
                                 +L + G++ +     + W+K+ + NI GR+  L+   K +
Sbjct  690   --------------------VLKLHGSVPD-----QSWSKKKYKNI-GRE--LEKTRKKL  721

Query  1657  QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
                +   T +      R+    +NE+L +EE+LW Q+SR  W+++GDRNT F+H     R
Sbjct  722   SNLLEAGTDKAAI---RQTSDYMNELLYREEMLWLQRSRVNWLKEGDRNTKFFHNRVAWR  778

Query  1837  RNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMH  2013
               +++I  L+   G ++     +    + +F D+F     +D SP      PK+     +
Sbjct  779   AKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSPVTRLIQPKVTEEMNN  838

Query  2014  KLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPP  2193
             +L  E +  E+  A+F +    +PG DG  A FYQ  W  +K+ I   VK+    G +  
Sbjct  839   RLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWGCIKNDIVRAVKEFFHSGIMLE  898

Query  2194  KILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLP  2373
              + ++ I LIPK + P    DFRPI+L NV +K++SK +VNR+RP +  LI   Q++F+P
Sbjct  899   GVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKCLVNRLRPFLDELISKNQSAFVP  958

Query  2374  GRSTADNIILTQEIVHYM-RLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNL  2550
              R   DN +L  E  H++ R K  +    A KLDL KAYD +DW FLE ++  +GF    
Sbjct  959   RRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKAYDRVDWRFLEQSMYKWGFSHCW  1018

Query  2551  ISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVK  2730
             +S +M     + IS + +              +G    P+LF+   + LS  ++EKV   
Sbjct  1019  VSWVM-----TCISTVCD--------------KGTRCDPFLFLFVADGLSLLLEEKVEQG  1059

Query  2731  NWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIF  2910
                PI +     G+SHL FA+D +LF +A   Q + I      ++  +G  IN +K +I 
Sbjct  1060  AISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIKEVFGSYATSTGQLINPTKCSIL  1119

Query  2911  CSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGN  3090
                +     +  + N   I+ ++    YLG+P    R+ K  F  + + + +K+  W  N
Sbjct  1120  FGNSLPIASRDAITNCLQIASTEFEDKYLGLPTPGGRMHKGRFQSLRERIWKKILQWGEN  1179

Query  3091  MLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWN  3270
              LS  G+  L+++ + ++PVY M +FKLP   C D+  + R+F WG     +K H   W 
Sbjct  1180  YLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTSLTRNFWWGAEKGKRKTHWKAWK  1239

Query  3271  DICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIA  3450
              + KSK  GGLG +    FN ALLA+ AW+L+ + D L  +V++ KY  N +   T    
Sbjct  1240  SLTKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSLCARVLKAKYYPNGSIVDTSFGG  1299

Query  3451  NASWGWRSIMRGRSIVELGAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-  3627
             NAS GW++I  G  +V+ G  WRIGNG S+  W D W    P         P +    K 
Sbjct  1300  NASPGWQAIEHGLELVKKGIIWRIGNGRSVRVWQDPWL---PRDLSRRPITPKNNCRIKW  1356

Query  3628  VSDFILPNRTWNVDKLSSL-LPHD--IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRS  3798
             V+D +L N  W+ +K++ + LP D  II  +R +         D + W     G FSVR+
Sbjct  1357  VADLMLDNGMWDANKINQIFLPVDVEIILKLRTS----SRDEEDFIAWHPDKLGNFSVRT  1412

Query  3799  AFSHIAGN--DEDA--------MDTSW--VWKMRVTERCrlflwllmrgrllTNMERWRK  3942
             A+  +A N   E+A        +  +W  +WK  V  + ++F W      L T   + ++
Sbjct  1413  AY-RLAENWAKEEASSSSSDVNIRKAWELLWKCNVPSKVKIFTWRATSNCLPTWDNKKKR  1471

Query  3943  GMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
              +     C  CG   E   H L  C  AK  W
Sbjct  1472  NLEISDTCVICGMEKEDTMHALCRCPQAKHLW  1503


 Score = 55.1 bits (131),  Expect(2) = 2e-127, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +3

Query  729  SMIFLSWNCRGVGNRLTVSHAKSLMRDNQVGAICFLETKTNNVDRIKKMADKLGFDKLFN  908
            +M  LSWNCRG+GN  TV    +L+++     +   ET+   VD+IK++ ++LG      
Sbjct  461  AMNCLSWNCRGIGNATTVQELCALVKEASSQFVFLCETR-QPVDKIKRLRNRLGLRGFAG  519

Query  909  VDPLGFAGGLTLF  947
            V   G +GGL LF
Sbjct  520  VSSDGMSGGLALF  532



>gb|EEE61581.1| hypothetical protein OsJ_15963 [Oryza sativa Japonica Group]
Length=1494

 Score =   445 bits (1144),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 307/1026 (30%), Positives = 502/1026 (49%), Gaps = 43/1026 (4%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
              +F Y  P    +   WN         + PW+M+GDFN+     E       +  +  +F
Sbjct  348   ATFVYGEPKAQNRHEMWNLLRRIRLNASDPWLMIGDFNEAMWQIEHRSRVKHSERQMRDF  407

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
              E    C L D+G  GV +++   +      + +LDRA+ +   + +F +A  + L    
Sbjct  408   REVLVECDLQDIGFQGVPWTYDNNQASPNNVKVRLDRAVASPVWRAMFDQANIMHLTTAC  467

Query  1399  SDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSN-----SLLDVVGAIS  1563
             SDH PL          RR ++   FE  W   + +  I    W +     +L DV   ++
Sbjct  468   SDHVPLLLEKGGNMQQRRRSKINCFEAVWERVKSFNSIEHESWDDGGLAKNLGDVRTKLA  527

Query  1564  EVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLE---RKLVTELNEV  1734
                   K+W+++  GNI   K S++   + ++E       RG +  E    +L   L E+
Sbjct  528   YTMENLKRWSRDKIGNI---KKSIERCRRELEEMRM----RGREDSEPDVHRLKIFLQEL  580

Query  1735  LKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDH  1911
             L +EE+ W Q+SR  W+++GDRNT ++H     R  ++ I+ L+  +G   S  + + + 
Sbjct  581   LHREEIWWKQRSRITWLKEGDRNTRYFHLKASWRARKNLIKKLRRSDGMMCSKEEELGEI  640

Query  1912  ISNFFIDLFGRKNIMD-GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPG  2088
               +FF DL+ +   ++ G   +M+  PK+       LT+  T  E+  A+F +    +PG
Sbjct  641   ARSFFRDLYTKDESLNPGELLNMF-EPKITDEMNGMLTKPFTDEEISDALFQIGPLKAPG  699

Query  2089  PDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPI  2268
             PDG  A F+Q  W  +K  +   V++    G     + ++ I +IPK ++P    DFRP+
Sbjct  700   PDGFPARFFQRNWGVLKRDVIEGVREFFETGEWKEGMNDTVIVMIPKTNAPVEMKDFRPV  759

Query  2269  TLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYM-RLKKGK  2445
             +L NV +K+++K +VNR+RP+++ +I   Q++F+PGR   DN ++  E  H + +  +  
Sbjct  760   SLCNVIYKVVAKCLVNRLRPLLQEIISETQSAFVPGRMITDNALVAFECFHSIHKCTRES  819

Query  2446  KGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPF  2625
             +   A+KLDL KAYD +DW FL+  L   GF       IM  V     S+  NG  L PF
Sbjct  820   QDFCALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEPF  879

Query  2626  QPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLML  2805
              P RGLR+GDPL PYLF+   + LS  +Q +   +  +P+ + R   GVSHL FA+D +L
Sbjct  880   YPTRGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLLFADDSLL  939

Query  2806  FAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNL  2985
             F +A   Q   I   L  +   +G  IN  + ++  S     E + G+K +  +  +   
Sbjct  940   FFKAEVIQATRIKEALDLYERCTGQLINPKECSLLFSALCPQERQDGIKAVLQVERTCFD  999

Query  2986  GTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQV  3165
                LG+P    R+    F  I +  +++L +W    LSLAG+  L++S   ++P YTM V
Sbjct  1000  DKCLGLPTPDGRMKAEQFQPIKERFEKRLTDWSERFLSLAGKEALIKSVAQALPTYTMGV  1059

Query  3166  FKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLA  3345
             FK+P   C + +++ R+F WG     KKVH + W  +   K  GGLG R    FN ALLA
Sbjct  1060  FKMPERFCEEYEQLVRNFWWGHEKGEKKVHWIAWEKLTSPKLLGGLGFRDIRCFNQALLA  1119

Query  3346  KLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIG  3525
             + AW+L+ S D L  +V++ KY  N     T   + +S  W+ I+ G  +++ G  WRIG
Sbjct  1120  RQAWRLIESPDSLCARVLKAKYYPNGTITDTAFPSVSSPTWKGIVHGLELLKKGLIWRIG  1179

Query  3526  NGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK---VSDFILPN-RTWNVDKLSSLLPH  3693
             +G     W + W     +A  + + I + ++  +   V + I+ + +TWN   +  ++  
Sbjct  1180  DGSKTKIWRNHW-----VAHGENLKILEKKTWNRLIYVRELIVTDTKTWNEPLIRHIIRE  1234

Query  3694  DIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFS---HIAGNDEDAMDTS------  3846
             +  D I    I   E+  D   W    TG FSVRS +    ++A    +   +S      
Sbjct  1235  EDADEILKIRIPQREE-EDFPAWHYEKTGIFSVRSVYRLAWNLARKTSEQASSSSGGADG  1293

Query  3847  ---W--VWKMRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLM  4011
                W  VWK  V  + R+F W L + RL T   + ++ +     C  CG  +ET  H  +
Sbjct  1294  RKIWDNVWKANVQPKVRVFAWKLAQDRLATWENKKKRKIEMFGTCPICGQKEETGFHATV  1353

Query  4012  ECSFAK  4029
             EC+ AK
Sbjct  1354  ECTLAK  1359



>gb|EEC79647.1| hypothetical protein OsI_20882 [Oryza sativa Indica Group]
Length=1784

 Score =   447 bits (1151),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 269/842 (32%), Positives = 429/842 (51%), Gaps = 17/842 (2%)
 Frame = +1

Query  1039  VSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNF  1218
             V+F Y  P    + R W+   S     N PW+++GDFN+     E +     +  +   F
Sbjct  103   VTFVYGEPRVEHRHRMWSMLNSIKQSSNLPWLVLGDFNETLWQFEHFSKKKRSEVQMQAF  162

Query  1219  VESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTH  1398
              +      L D+G  G+ Y++  +  G    R +LDR + +   +++F  ++   L    
Sbjct  163   RDVLQTYELHDLGFKGLPYTYDNKREGINNVRVRLDRVVADDGWRDMFRSSQVEHLISPC  222

Query  1399  SDHHP--LKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWS-----NSLLDVVGA  1557
             S+H P  LKF  +   P RR+   +     W    +  ++    W+     + L D+  A
Sbjct  223   SNHCPVVLKFCVDTNQPARRKCLHYEIF--WEREAELVEVIDESWAALGDKSDLADISRA  280

Query  1558  ISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVL  1737
             +S+V      W++    N+       + R+  + ES     SR +    R     L+E+L
Sbjct  281   LSQVMAKLHSWSRRKCKNVGREIEKGRKRLAELIES--GADSRSI----RSASDNLHELL  334

Query  1738  KQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHI  1914
              +EE+LW Q+SR  W+++GDRNT F+H   + R  ++RI  LK   G  +S    + D  
Sbjct  335   YREEMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDREGTVHSTTAKLEDMA  394

Query  1915  SNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPD  2094
             + +F ++F    ++D S        K+       L  E    E+  A+F +    +PGPD
Sbjct  395   TEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQIGPLKAPGPD  454

Query  2095  GIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITL  2274
             G  A FYQ  W  +K+ I   VK     G +P  + ++ I LIPK + P    DFRPI+L
Sbjct  455   GFPARFYQRHWGFMKNDIVRAVKLFFDTGVMPEGVNDTAIVLIPKIEQPMELRDFRPISL  514

Query  2275  LNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRL-KKGKKG  2451
              NV +K++SK +VNR+RPI+  L+ P Q++F+ GR   DN IL  E  H ++  +K +  
Sbjct  515   CNVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRMITDNAILAFECFHSIQKNRKPESA  574

Query  2452  LMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQP  2631
               A KLDL KAYD +DW FLE +L   GF    +  IM  +     S+ +NG  L+ F P
Sbjct  575   ACAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFNGTLLSTFAP  634

Query  2632  GRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFA  2811
              RGLRQGDPL+P+LF+   + LS  +++KV      P+ + R   G+SHL FA+D +LF 
Sbjct  635   SRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLLFADDTLLFF  694

Query  2812  EASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGT  2991
             +A   Q + +   +  ++  +G  IN +K +I    ++  + +  ++    I+ S     
Sbjct  695   KADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQIANSGFEDR  754

Query  2992  YLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFK  3171
             YLG P    R+ K  F  + + + ++L  W  N+LS  G+  L++S + ++PVY M +FK
Sbjct  755   YLGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAIPVYVMGIFK  814

Query  3172  LPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKL  3351
             LP   C ++ ++ R+F WG     +K H   W  + + K  GGLG R    FN ALLA+ 
Sbjct  815   LPESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRLFNQALLARQ  874

Query  3352  AWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNG  3531
             AW+L+ + D L  +V++ KY  N +   T    NAS  W++I  G S+++ G  WRIGNG
Sbjct  875   AWRLIVNPDSLCARVLKAKYFPNGSLVDTSFGGNASPVWKAIEYGLSLLKEGIIWRIGNG  934

Query  3532  LS  3537
              S
Sbjct  935   KS  936


 Score =   431 bits (1109),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 256/764 (34%), Positives = 394/764 (52%), Gaps = 19/764 (2%)
 Frame = +1

Query  1531  NSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERK  1710
             + L D+  A+S+V      W++    N+       + R+  + ES   +TS       R 
Sbjct  970   SDLADISRALSQVMAKLHSWSRRKCKNVGREIEKGRKRLAELIESGADSTSI------RS  1023

Query  1711  LVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNS  1887
                 L+E+L +EE+LW Q+SR  W+++GDRNT F+H   + R  ++RI  LK   G  +S
Sbjct  1024  ASDNLHELLYREEMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDREGTVHS  1083

Query  1888  DFKTISDHISNFFIDLFGRKNIMDGSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDM  2067
                 + D  + +F ++F    ++D S        K+       L  E    E+  A+F +
Sbjct  1084  TTAKLEDMATEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQI  1143

Query  2068  KKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPET  2247
                 + GPDG  A FYQ  W  +K+ I   VK     G +P  + ++ I LIPK + P  
Sbjct  1144  GPLKALGPDGFPARFYQRHWGFMKNDIVRAVKLFFDTGVMPEGVNDTAIVLIPKIEQPME  1203

Query  2248  ASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYM  2427
               DFRPI+L NV +K++SK +VNR+RPI+  L+ P Q++F+ GR   DN IL  E  H +
Sbjct  1204  LRDFRPISLCNVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRMITDNAILAFECFHSI  1263

Query  2428  RL-KKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWN  2604
             +  +K +    A KLDL KAYD +DW FLE +L   GF    +  IM  +     S+ +N
Sbjct  1264  QKNRKPESAACAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFN  1323

Query  2605  GEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLF  2784
             G  L+ F P RGLRQGDPL+P+LF+   + LS  +++KV      P+ + R   G+SHL 
Sbjct  1324  GTLLSTFAPSRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLL  1383

Query  2785  FAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTG  2964
             FA+D +LF +A   Q + +   +  ++  +G  IN +K +I    ++  + +  ++    
Sbjct  1384  FADDTLLFFKADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQ  1443

Query  2965  ISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSM  3144
             I+ S     YLG P    R+ K  F  + + + ++L  W  N+LS  G+  L++S + ++
Sbjct  1444  IANSSFEDRYLGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAI  1503

Query  3145  PVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLD  3324
             PVY M +FKLP   C ++ ++ R+F WG     +K H   W  + + K  GGLG R    
Sbjct  1504  PVYVMGIFKLPESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRL  1563

Query  3325  FNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVEL  3504
             FN ALLA+ AW+L+ + D L  +V++ KY  N +   T    NAS  W++I  G S+++ 
Sbjct  1564  FNQALLARQAWRLIVNPDSLCARVLKAKYFPNGSLVDTSFGGNASPVWKAIEYGLSLLKE  1623

Query  3505  GAAWRIGNGLSLNFWSDWWTGDKPLAFMDEVTIPDSQSEAK-VSDFILPNRTWNVDKLSS  3681
             G  WRIGNG S+  W D W    P  F             K VSD +  N  W+  +++ 
Sbjct  1624  GIIWRIGNGKSVRIWRDPWL---PRDFSRRPITRKGNCRLKWVSDLLSENGAWDETRVNQ  1680

Query  3682  L-LPHD--IIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAF  3804
             + LP D   I  IR +      Q  D + W     G FSVRSA+
Sbjct  1681  VFLPVDAETICSIRVS----SRQEDDFVAWHPDKHGKFSVRSAY  1720



>ref|XP_010674085.1| PREDICTED: uncharacterized protein LOC104890338 [Beta vulgaris 
subsp. vulgaris]
Length=1568

 Score =   445 bits (1145),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 344/1201 (29%), Positives = 547/1201 (46%), Gaps = 81/1201 (7%)
 Frame = +1

Query  1075  KERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDM  1254
             +   W +   +      P +++GDFN++   +E+ GS  ++ +   NF +      LL++
Sbjct  305   RTEVWKEITEFIQSNMLPCLIIGDFNEVLRAKER-GSLLLSQTGVTNFKQFVQESHLLEI  363

Query  1255  GTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEA  1434
              ++   ++WFR        +  LDR   + E  + FP  K  +L R  SDH PL    + 
Sbjct  364   PSTCGGFTWFRSNS-----KSILDRLFVHSEWISKFPALKVTLLQRGLSDHCPLLVHSKE  418

Query  1435  gnpprrenrpfrfegAWLTREDYRDIWGRVWSNSL-LDVVGAISEVTNLSKKWNKETFGN  1611
              N   +  R       WLT      I   VW  S  L  V  + EV    K WN + FGN
Sbjct  419   LNWGPKPFRFQN---CWLTDPRCLKIVNNVWQKSAALHTVEKLREVKKQLKTWNHDEFGN  475

Query  1612  IFGRKASLQARIKGVQESVFYNTSRGL--QVLE--RKLVTELNEVLKQEELLWFQKSRRM  1779
             I      L+  I+ +      N  R L  Q LE  +K  +EL   +K++E+ W Q SR  
Sbjct  476   IDSSIKRLEEEIQKLDR---INNLRDLDDQELEERKKAQSELWMWIKRKEMYWAQNSRIT  532

Query  1780  WIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDFKTISDHISNFFIDLFGRKNIMD  1959
             W+++GDRNT F+H     +R ++ I  + I G+   +   I    + FF  +F  +++  
Sbjct  533   WLKEGDRNTKFFHAIASNKRRKNFIASIDIGGQIIDEPSRIKFEATAFFKSIFKEEHVRR  592

Query  1960  GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVK  2139
                 ++     +   Q  +LT   +  E+  AV       +PGPDG    F ++ WE VK
Sbjct  593   PVFENLNF-KHVSQEQASQLTLPFSCEEIDSAVASCSVDKAPGPDGFNFKFIKSAWEIVK  651

Query  2140  SHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNR  2319
               I   V        +P     ++ITLIPK ++P +  D+RPI+++   +KII+KV+  R
Sbjct  652   HDIYEIVHNFWASAHLPKGCNTAYITLIPKVENPTSLKDYRPISMVGSIYKIIAKVMARR  711

Query  2320  MRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGLMAIKLDLHKAYDSID  2499
             ++ ++ +LIGP Q+S++ GR   D  ++  E++   + K G + ++  KLD HKAYDSI 
Sbjct  712   LQKVVNSLIGPLQSSYIEGRQILDGALVAGEVIDSYK-KSGNEAIL-FKLDFHKAYDSIS  769

Query  2500  WEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGLRQGDPLAPYLFI  2679
             W FL+ TL    FP      IM  V  +S S+L NG    PF+  RGLRQGDPL+P+LF+
Sbjct  770   WSFLKWTLEQMKFPPKWCEWIMTCVTTASASILINGSPCTPFKLKRGLRQGDPLSPFLFV  829

Query  2680  LAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASEDQGRMIMNCLKK  2859
             L  E L+  I + V    W  + + + G  V+HL +A+D ++F+EA  +  + I   L  
Sbjct  830   LIGEVLNQVIAKAVEKGLWSGVEVCKNGLKVTHLQYADDTLIFSEAKMESLKNIKKALIL  889

Query  2860  FSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGIPILHKRVSKHTF  3039
             F   SGL +N  KS+I     +   I     +L    + +   TYLG+PI         +
Sbjct  890   FHLASGLQVNFHKSSIIGMNTSKEWILEAASSLL-CKIGNIPFTYLGLPIGGNLSRLQAW  948

Query  3040  GYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAGTCNDIDRICRDF  3219
               I+D +  KLA+WKG MLS+ GR TL++S+L+++P+Y M +F +P G    +++I R F
Sbjct  949   DPIIDKISHKLASWKGKMLSIGGRITLIKSSLANLPLYYMSLFSIPKGVVEKMNKITRQF  1008

Query  3220  LWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQLVTSHDKLWVKVM  3399
             LW  S + + + LV WN I   K  GGL +   +  N A+L+K  W+ +      W  V+
Sbjct  1009  LWSGSMEKRSLPLVAWNIIQLPKSLGGLSIGNIIHKNIAMLSKWIWRFLQDPSPFWCAVI  1068

Query  3400  REKYVKNKNFFATPM-IANASWGWRSI-------MRGRSIVELGAAWRIGNGLSLNFWSD  3555
             REKY    N     + +      WR I          +SI+  G    IG G    FW D
Sbjct  1069  REKYKYAPNISILDLDVPKFGGPWRHICAAILHHTNAKSILCNGIRKNIGRGSQTRFWLD  1128

Query  3556  WWTGDKPLAF----MDEVTIPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIID----GI  3711
              W    PL      +  ++I  + +      +   N  W         P D  +     +
Sbjct  1129  PWLSSTPLKSDFPRLFAISINPNATVDSYGFWEGFNWVWTFSWKREFRPQDRSEKKRLDM  1188

Query  3712  RATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW--VWKMRVTERCrl  3885
             R   +   ++  D L W  +  G FS +S    +       +  +   VWK  V  R  +
Sbjct  1189  RLQQVHPSQEARDQLVWAHTKAGNFSTKSITLELDKMHPPVIHDAIKGVWKGLVPHRIEV  1248

Query  3886  flwllmrgrllTNMERWRKGM--TEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHPV  4059
             F+WL + G++ T  +    G+   E+ LC  C    ET +H+L+ CS +   W    +  
Sbjct  1249  FVWLALMGKINTRSKLAGIGIINAENNLCPLCLMEPETSDHLLLHCSVSSKLWSWWLNLW  1308

Query  4060  SFQYSLVTPLKS------WVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFENTAS  4221
               ++   + L+       W K     S       W   F    W IWK RN+R+F NTAS
Sbjct  1309  QVKWVFPSSLREAFTQWYWPKKVSFFSK-----VWSTIFFIMLWSIWKERNKRVFSNTAS  1363

Query  4222  --------------------------APMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWV  4323
                                       +P DIMR   +L     ++  + K   +     +
Sbjct  1364  SIKDMKELVLLRLGWWISGWKEKFPYSPCDIMRNPASLQWRGNQMTDSHK---LSSKEDI  1420

Query  4324  CWQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAELWGLR  4503
              WQPP +   K+N D + +     ++ GG+ R+ KG +   F + I       AE+  + 
Sbjct  1421  IWQPPSSHVFKWNVDASVQPFGSRSAIGGVLRNQKGNFRCLFSSPIPYMEINCAEILAIH  1480

Query  4504  E  4506
             +
Sbjct  1481  K  1481



>ref|XP_008358855.1| PREDICTED: uncharacterized protein LOC103422573 [Malus domestica]
Length=1419

 Score =   440 bits (1132),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 330/1199 (28%), Positives = 525/1199 (44%), Gaps = 69/1199 (6%)
 Frame = +1

Query  1024  HSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPS  1203
             H   +  F Y   + + +   W   +S   +   PW+ + DF  I    EQ G    + +
Sbjct  98    HIPXQFXFVYASTSXIKRRDLWAXFISLRPQTQVPWMAIXDFXAIXGAHEQMGGGRPSQA  157

Query  1204  RCLNFVESFSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAII  1383
              C  F      C    + TSG +++W      R    R+LDR+L ++   + +P +  I 
Sbjct  158   SCAEFXNMSDTCNFTHLNTSGAAFTWSNGWRSRGRTERRLDRSLCDISWFDSWPHSNCIX  217

Query  1384  LPRTHSDHHPLKFLCEAgnpprrenrpfrfegAWLTREDYRDIWGRVWSNS------LLD  1545
             LP+  SDH+PL F           +RPFRF+  W+    +R+     W N+      +  
Sbjct  218   LPKVVSDHNPLIF--SGSRVLXNGHRPFRFQSMWVQHPSFRETVTHCWXNTVVYGCPMFI  275

Query  1546  VVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGL--QVLERKLV-  1716
             ++  +  +    ++WN   FG++  R A+ +  +  +Q+ +   +  G+   + E ++V 
Sbjct  276   ILQKLKALKTCLRQWNFSXFGDVHNRXANARHNLXMIQQRI---SXEGIXNDLFEEEIVX  332

Query  1717  -TELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLKINGEWNSDF  1893
              T   E L+ +E  W  ++R  W+   DRN++F+H    I+ + S I  +       +D 
Sbjct  333   KTTXMESLQMQEXFWKDRARVKWLTKXDRNSSFFHAYAXIKSSSSHIXCILDGNNLLTDP  392

Query  1894  KTISDHISNFFIDLFGRKNIMDGSPNDMYC---GPKLDTGQMHKLTREVTMCEVKKAVFD  2064
               I +HI NF+   FG      G   D  C    P +   +   L+   T  E+K+AVF 
Sbjct  393   LAIENHIVNFYQTXFGSSFXPSGI--DEVCEVIQPMVTDSENDLLSALPTBEEIKEAVFS  450

Query  2065  MKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPE  2244
             +     PGPD     FY   W+ V   +  FVK+  +   + P    +F+ LI K +   
Sbjct  451   LSASSXPGPDXFPGFFYHHCWDIVSFDVIXFVKQFFQSNWLYPNXNSNFLVLIXKVEXAI  510

Query  2245  TASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHY  2424
             + + FRPI L N  FKII K++  R+  +++ +I P Q +F+P R   D I L     + 
Sbjct  511   SMTHFRPIALANFLFKIIPKILAXRLSHVVQRIISPHQAAFIPXRRITDCIXLVSXCFNV  570

Query  2425  MRLKKGKKGLMAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWN  2604
             +  KK + G M +K D+ KA+D++DW F    L +FG     I      +R + +S+L N
Sbjct  571   LX-KKTRGGNMGVKXDIAKAFDTLDWSFXLRVLTNFGXSTCFIDWXSTILRSAKLSILIN  629

Query  2605  GEKLAPFQPGRGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLF  2784
             G     F   RG+RQGDP +P L  LA E LS  +         KP    RG    SH+ 
Sbjct  630   GSPHGFFSCSRGVRQGDPJSPLLXCLAEEALSRGLSRLQLDGLTKPTFAPRGCIXXSHVL  689

Query  2785  FAEDLMLFAEASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTG  2964
             +A+DL +F  +     R +     ++S  SG  IN +KS  +   +T+   K   ++  G
Sbjct  690   YABDLFIFCRSDGXTLRNLQGFFBRYSRASGQFINXAKSTFYLG-STSRHRKXVXESYLG  748

Query  2965  ISVSDNLGTYLGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSM  3144
                      Y  +PI   +        + D  K KL  WK  +LS+ GR  L QS   SM
Sbjct  749   FKXGKXPFVYXXVPIFCGKPKXSXLQALADKAKAKLTGWKXKLLSMXGRVQLTQSVFQSM  808

Query  3145  PVYTMQVFKLPAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLD  3324
              +++  V+K P+     + R  R+F+W     +K    V W  IC  K+ GGLGLR    
Sbjct  809   LLHSFXVYKWPSSLLRXLSRCARNFIWSGXVTSKXXVTVSWXQICAXKNEGGLGLRDLGS  868

Query  3325  FNNALLAKLAWQLVTSHDKLWVKVMREKYVKNKNFFATPMIANASW-GWRSIMRGRSIVE  3501
              N   L KL W ++T+ D  W    R ++  +   ++     ++ W G +SI+    I+ 
Sbjct  869   LNTTALLKLGWLIITT-DSPWSIYJRXRFKLHGRLYSCSYXRSSIWPGIKSILH---ILF  924

Query  3502  LGAAWRIGNGLSLNFWSDWWTGDKPLA-FMDEVTIPDSQSEAKVSDFILPNRTWNVDKLS  3678
                 W IGNG + + W D W  DKP+   +    I  S S  KVS+ I+    W +  + 
Sbjct  925   QNCRWVIGNGSTTSLWVDKWL-DKPIVDVVGATXIAPSXSRTKVSN-IIXMGXWVIPSIF  982

Query  3679  SLLPHDIIDGIRATPIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSWVWK  3858
             S    D+   I   P+ + E   D L W  S +G FS    +  +          S +W 
Sbjct  983   SXXFPDLTKEILEMPLPIDED-KDVLIWEXSXSGXFSFSDGYEIVRHRFPVKSWASIIWX  1041

Query  3859  MRVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCW  4038
               +  R  + +W ++  +L T  +  R+G+    +C  C    E+++H+   C FA+  W
Sbjct  1042  PFIPPRYSILVWKILFNKLPTEDQLQRRGIXLAPICQLCHKNSESIBHLFSSCXFAQCAW  1101

Query  4039  RRTHHPVSFQYSLVTPLKSWVKNNCCASD-WINGCP----------WGVTFIYTCWEIWK  4185
             R           L T   + +      SD W+              W  +  +    IWK
Sbjct  1102  RW----------LATQFGTXIXPXGSLSDLWLXFLSKRFSPHLXNVWLASGFFLLMAIWK  1151

Query  4186  ARNQRIFENTASAPMDI-------MRRANNLTLDTVEVFLNKK-CVHVGKMRWVC-----  4326
              RN+  FE    +   +       +R+   LT   V   L+++  V +G     C     
Sbjct  1152  MRNKVKFEGKPPSFSRLCRSTXAWIRQVGALTPGHVRGXLDRQLLVSLGISPNXCKAPSI  1211

Query  4327  ----WQPPETGWIKFNTDGAFKRNTGLASAGGLARDHKGEWLFGFMTNIGVSNSFAAEL  4491
                 W PP   W K NTDG  K N G A+ GG+ RD  G +L GF  ++G   SF AEL
Sbjct  1212  VXXXWHPPPXSWXKVNTDGLAKGNPGXAACGGVFRDSXGYFLGGFSLSLGHRTSFYAEL  1270



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score =   424 bits (1090),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 259/692 (37%), Positives = 370/692 (53%), Gaps = 45/692 (7%)
 Frame = +1

Query  2455  MAIKLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPG  2634
             MAIK+DL KAYD + W F+  TL +   P  LI LIM  +  +S+++LW+GE    F P 
Sbjct  1     MAIKVDLEKAYDRLSWNFIYETLTELALPIGLIQLIMECITSTSMNILWHGELTDDFSPS  60

Query  2635  RGLRQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAE  2814
             RG+RQGDPL+PY+F+L +ERLS  I + +   +WKPI LSR GT +SHLFF +DL+LFAE
Sbjct  61    RGVRQGDPLSPYIFVLCVERLSHGIYQSIHQDHWKPIRLSRLGTPLSHLFFTDDLLLFAE  120

Query  2815  ASEDQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTY  2994
             A+  Q + I + L  F   SG  +N SK++++ S N    +   +    G +V+ +LG Y
Sbjct  121   ATSGQAQCINSVLGDFCLSSGTKVNQSKTHVYFSKNVPDAVATRIWRDLGYTVTKDLGKY  180

Query  2995  LGIPILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKL  3174
             LG+P+LH RVS+ T+  ILD   +KL  W  + LSLAGR TL QS L ++P+Y MQ   L
Sbjct  181   LGMPLLHSRVSQQTYQGILDKTDQKLLGWAASQLSLAGRITLTQSVLQAVPIYAMQTTNL  240

Query  3175  PAGTCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLA  3354
             P      +D+ICR FLW  + + +K+ LV W++IC+ K AGGLG ++    N ALL K+A
Sbjct  241   PGSIKTKLDQICRRFLWSGNDELRKMSLVSWHNICQPKMAGGLGFKRLDIMNEALLLKVA  300

Query  3355  WQLVTSHDKLWVKVMREKY-VKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNG  3531
             W L+T  +KL V+V+  KY V       T      S  W+S+ R     + G  W +GNG
Sbjct  301   WHLITEPNKLCVQVLSTKYGVPPLEIPHTLPTRYGSHLWKSVGRVWDYAKRGIRWIVGNG  360

Query  3532  LSLNFWSDWWTGDKPLAFMDEVT--IPDSQSEAKVSDFILPNRTWNVDKLSSLLPHDIID  3705
               + FW D W    PL   D     IP   S+  V+DF+  + +WN  K S +LPH  + 
Sbjct  361   WKVKFWWDCW-ATTPLTLADLAIHPIPPDLSDLYVADFVSTDGSWNWPKFSHILPHQAVM  419

Query  3706  GIRAT-PIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTSW--VWKMRVTER  3876
              I +  P + C  V D +YW  SP G F+V+SA+  +  +     D+ W   W  +  + 
Sbjct  420   IIASIHPPSACNGV-DQVYWAASPQGDFTVKSAYDLLDQSRGQERDSYWKIAWSWKGPQS  478

Query  3877  CrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWRRTHHP  4056
              ++F+WL++  RL T  E   + +  +  C  CG G E   HVL +C ++K         
Sbjct  479   IKIFIWLVLHNRLKTRAELATRRLNIEPSCERCGAGLENTIHVLHDCPYSKA--------  530

Query  4057  VSFQYSLVTPLKSWVKNNCCASDWINGCPWGVTFIYTCWEIWKARNQRIFE----NTASA  4224
                  SL T L                  W V F    W +W  RN+ IF      +++ 
Sbjct  531   ---STSLGTKL------------------WRVIFGVAIWRLWFWRNRFIFTKDHWESSAI  569

Query  4225  PMDIMRRANNLTLDTVEVFLNKKCVHVGKMRWVCWQPPETGWIKFNTDGAFKRNTGLASA  4404
              +DI  RA  +      +    K       +W+ W  P   W+K NTDGA K+ +  A A
Sbjct  570   ALDIKVRAAEIQQCNSSLTATDKS---RVEKWIRWGAPTWPWVKLNTDGA-KKPSDHAGA  625

Query  4405  GGLARDHKGEWLFGFMTNIGVSNSFAAELWGL  4500
             G L RD+KG W  G+  N+G  +  +AELWGL
Sbjct  626   GELIRDYKGVWQIGYCANLGFCSVTSAELWGL  657



>ref|XP_009353199.1| PREDICTED: uncharacterized protein LOC103944460 [Pyrus x bretschneideri]
Length=1429

 Score =   439 bits (1130),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 334/1168 (29%), Positives = 529/1168 (45%), Gaps = 162/1168 (14%)
 Frame = +1

Query  1048  AYVRPNRMAKERFWNDCLSYSSEFNAPWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVES  1227
              Y    R+ K  FW+  +++ +  + PWI  GDFN+   + E+ G   V  +R     E 
Sbjct  64    VYGTSYRVEKNLFWDWMVNHFTPTDIPWICGGDFNEFLWDYEKSGGVEVLYNRPRFLEEF  123

Query  1228  FSACGLLDMGTSGVSYSWFRQEGGRTVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDH  1407
              S+  L+D+G +G  ++W     G  V+ R LDR + N + Q L+P ++ +      SDH
Sbjct  124   LSSSQLMDLGFNGPIFTWRGLRKGDWVEER-LDRVMANEKWQQLWPNSQVMHETVLASDH  182

Query  1408  HPLKFLCEAgnpprrenrpfrfegAWLTREDYRDI----WGRVWSNSLLDV-VGAISEVT  1572
              P+  +  + +  ++  + FRFE  W++ E+ + +    W R    S ++  V +++E  
Sbjct  183   CPI--VLSSTSDGQKGRKMFRFEAFWVSEEECKKLVEMCWDRRHHGSPVNRWVRSLNECR  240

Query  1573  NLSKKWNKETFGNIFGRKASLQARIKGVQESVFYNTSRGLQVLERKLVTELNEVLKQEEL  1752
                 +WN+  F     R   L +++  +Q     N         R++  +++E+  QEE 
Sbjct  241   YRLSRWNRTKFMGRGSRIHDLLSQLDSLQRDWGPNYDE-----IREISRQIDELRLQEES  295

Query  1753  LWFQKSRRMWIQDGDRNTAFYHKSTLIRRNRSRIRMLK-INGEWNSDFKTISDHISNFFI  1929
              W Q+SR  W+++GD NT F+H STL RR R++I  L+  NG W  +   +   + N F 
Sbjct  296   YWCQRSRVKWLREGDANTQFFHSSTLQRRRRNKIVKLRDENGNWVENPTQVRHLVDNHFS  355

Query  1930  DLFGRKNIMD-GSPNDMYCGPKLDTGQMHKLTREVTMCEVKKAVFDMKKFGSPGPDGIQA  2106
              +F      + GS  D    P + T     LT  VT  E+K+A  +M    +PGPDG Q 
Sbjct  356   SVFSSAEDRNWGSLLDC-INPSVSTEMNEALTAPVTEKEIKEAAGNMGGLKAPGPDGFQG  414

Query  2107  AFYQTFWEEVKSHITTFVKKVLRDGRVPPKILESFITLIPKKDSPETASDFRPITLLNVS  2286
              FYQT+WE VK  ++                                   FRPI+L N S
Sbjct  415   IFYQTYWEIVKEDVSAL---------------------------------FRPISLCNYS  441

Query  2287  FKIISKVIVNRMRPIMKNLIGPFQNSFLPGRSTADNIILTQEIVHYMRLKKGKKGL-MAI  2463
             +KI+SK++ NR++ ++  +I P QN+F+ GR   D I +  E+ HY++ +K K    M I
Sbjct  442   YKILSKILANRLKVLLPKIISPSQNAFVAGRQIQDCIGIAHEMFHYLKGRKTKNRFEMGI  501

Query  2464  KLDLHKAYDSIDWEFLESTLVDFGFPQNLISLIMFSVRESSISLLWNGEKLAPFQPGRGL  2643
             KLD+ KAYD ++W+FL++                             GE    F P RGL
Sbjct  502   KLDMQKAYDRVEWDFLDAA----------------------------GES---FAPSRGL  530

Query  2644  RQGDPLAPYLFILAMERLSWDIQEKVRVKNWKPITLSRGGTGVSHLFFAEDLMLFAEASE  2823
             RQGDPL+PYLFIL  E LS  +Q  V     + + +   G  +SHLFF +D +LF  A  
Sbjct  531   RQGDPLSPYLFILVGEVLSKLLQGAVDQGRLEGVKIGGSGPVISHLFFTDDTLLFLRADV  590

Query  2824  DQGRMIMNCLKKFSGKSGLNINVSKSNIFCSPNTNSEIKRGLKNLTGISVSDNLGTYLGI  3003
                R + + L KF   SG  +N+ KS++F   N        + N  G++V  N GTYLG+
Sbjct  591   KNCRNLKHLLDKFCVASGQKVNLEKSSVFFGANVPKVNADQMGNALGMAVVSNPGTYLGV  650

Query  3004  PILHKRVSKHTFGYILDGMKRKLANWKGNMLSLAGRRTLVQSALSSMPVYTMQVFKLPAG  3183
             P +  R  K    Y+   +  KL  WK + LS A +  L+++ + ++P Y M +FK PA 
Sbjct  651   PAIWGRSKKRGLAYVKGRVMEKLQGWKQSTLSRADKEVLIKAVIQAIPAYPMCIFKFPAA  710

Query  3184  TCNDIDRICRDFLWGDSAQNKKVHLVGWNDICKSKDAGGLGLRKCLDFNNALLAKLAWQL  3363
              C ++D +   F WG     +K+H V    +   KD GGLG R  ++FN+ALLAK  W+L
Sbjct  711   ICQELDVLVAGFWWGCKEGAQKIHWVSKEVLGLPKDLGGLGFRNFMEFNDALLAKQCWRL  770

Query  3364  VTSHDKLWVKVMREKYVKNKNFFATPMIANASWGWRSIMRGRSIVELGAAWRIGNGLSLN  3543
             +T  D LW +V++ +Y  + + +       ASW                           
Sbjct  771   ITEPDSLWARVIKAQYFPHCSIWDAKKGGRASW---------------------------  803

Query  3544  FWSDWWTGDKPLAFMDEVTIPDSQSEAKVSDFILP-NRTWNVDKLSSLLPHDIIDGIRAT  3720
                D W    PL     V         +VS  I   +  WN+  L   +  + +  I  T
Sbjct  804   ---DRWLPSLPLGHPVLVGQVAVTPSLRVSALICSESERWNLSFLQPFISREALKAIEET  860

Query  3721  PIAVCEQVSDSLYWPRSPTGAFSVRSAFSHIAGNDEDAMDTS-----------W--VWKM  3861
             P+    + +D L W  S  G +SV+S +  + G      D             W  +WK+
Sbjct  861   PLGDLSR-NDRLIWALSKNGTYSVKSGYRWLQGRSLARRDKRRPSVRGVPMAFWKGIWKL  919

Query  3862  RVTERCrlflwllmrgrllTNMERWRKGMTEDTLCATCGDGDETMNHVLMECSFAKDCWR  4041
              V  + R FLWL M   L T    +R+  +  + C  C   DET+ H+ + CS+ +  W 
Sbjct  920   EVPPKLRHFLWLTMHNCLPTREALYRRRSSLTSTCPICCCHDETIEHIFLSCSWVEPIW-  978

Query  4042  RTHHPVSFQYSL-VTPLKSWVKNNCCASDWI------NGCPWGVT------FIYTCWEIW  4182
                   +  Y L    L SW+       +WI      N C +G T       ++TCW IW
Sbjct  979   ---FGGALGYKLDRLSLPSWL-------EWIQKVFSPNLCNFGDTMWRQSYIVFTCWCIW  1028

Query  4183  KARNQRIFENTASAPMDIMRRANNLTLDTVEVFLNKKCV--------HVGKMRWVCWQPP  4338
             KAR   +F+  +  P+ ++   +      +  F   K +             +   W  P
Sbjct  1029  KARCDLVFKGMSVNPLKVLADVSA----AMSSFFGAKAMAGVRGGGEGRRGTQLARWCAP  1084

Query  4339  ETGWIKFNTDGAFKRNTGLASAGGLARD  4422
              + ++K N D ++ +   +   G +A+D
Sbjct  1085  ASPFVKINVDASWSKALKMGFVGLIAQD  1112



>gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam: rvt.hmm, score: 
42.57) [Arabidopsis thaliana]
Length=1662

 Score =   442 bits (1138),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 302/1047 (29%), Positives = 496/1047 (47%), Gaps = 76/1047 (7%)
 Frame = +1

Query  943   FFWRSSIFNFAVIRNTSQAIHGLVSGPHSNVRVSFAYVRPNRMAKERFWNDCLSYSSEFN  1122
               W+ S+   + +    + I   +S  + N  +S  Y  P +  +   W    + S   N
Sbjct  451   LLWKDSV-RLSNLYQDDRHIDVHISINNINFYLSRVYGHPCQSERHSLWTHFENLSKTRN  509

Query  1123  APWIMMGDFNDIADNQEQWGSSSVNPSRCLNFVESFSACGLLDMGTSGVSYSWFRQEGGR  1302
              PWI++GDFN+I  N E+ G    +      F    S C L D+ + G  +SW  +    
Sbjct  510   DPWILIGDFNEILSNNEKIGGPQRDEWTFRGFRNMVSTCDLKDIRSIGDRFSWVGERHSH  569

Query  1303  TVQRRKLDRALWNLEAQNLFPEAKAIILPRTHSDHHPLKFLCEAgnpprrenrpfrfegA  1482
             TV +  LDRA  N E   LFP A+   L  T SDH PL    E     +     F     
Sbjct  570   TV-KCCLDRAFINSEGAFLFPFAELEFLEFTGSDHKPLFLSLEKTETRKMRPFRFDKRLL  628

Query  1483  WLT--REDYRDIWGRVWSNSLLDVVGAISEVTNLSKKWNKETFGNIFGRKASLQARIKGV  1656
              +   +   +  W +  +     +   +        K   ++  N   R   LQA +   
Sbjct  629   EVPHFKTYVKAGWNKAINGQRKHLPDQVRTCRQAMAKLKHKSNLNSRIRINQLQAALDKA  688

Query  1657  QESVFYNTSRGLQVLERKLVTELNEVLKQEELLWFQKSRRMWIQDGDRNTAFYHKSTLIR  1836
               SV     R +  ++R    EL    + EE  W QKSR  W+++GDRNT F+H  T  R
Sbjct  689   MSSVNRTERRTISHIQR----ELTVAYRDEERYWQQKSRNQWMKEGDRNTEFFHACTKTR  744

Query  1837  RNRSRIRMLK-INGEWNSDFKTISDHISNFFIDLFGRKNIMDGSPNDM--YCGPK-LDTG  2004
              + +R+  +K   G      K I  H   FF  ++      +G P  +  + G K + T 
Sbjct  745   FSVNRLVTIKDEEGMIYRGDKEIGVHAQEFFTKVYES----NGRPVSIIDFAGFKPIVTE  800

Query  2005  QMHK-LTREVTMCEVKKAVFDMKKFGSPGPDGIQAAFYQTFWEEVKSHITTFVKKVLRDG  2181
             Q++  LT++++  E+  A+  +    +PGPDG+ A FY++ WE V   +   VK   R  
Sbjct  801   QINDDLTKDLSDLEIYNAICHIGDDKAPGPDGLTARFYKSCWEIVGPDVIKEVKIFFRTS  860

Query  2182  RVPPKILESFITLIPKKDSPETASDFRPITLLNVSFKIISKVIVNRMRPIMKNLIGPFQN  2361
              +   I  + I +IPK  +PET SD+RPI L NV +KIISK +V R++  +  ++   Q 
Sbjct  861   YMKQSINHTNICMIPKITNPETLSDYRPIALCNVLYKIISKCLVERLK