BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15306_g1_i1 len=3398 path=[1:0-2191 2193:2192-3239 3241:3240-3243
3245:3244-3267 3269:3268-3397]

Length=3398
                                                                      Score     E

ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          717   0.0      
gb|ADH04267.1|  MYC1a transcription factor                              717   0.0      
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          715   0.0      
gb|ADH04268.1|  MYC1b transcription factor                              714   0.0      
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          706   0.0      
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               704   0.0      
gb|AGZ94899.1|  MYC transcription factor 2                              702   0.0      
emb|CAF74710.1|  MYC transcription factor                               697   0.0      Solanum tuberosum [potatoes]
gb|AGL98101.1|  transcription factor MYC2-like protein                  694   0.0      
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          683   0.0      
gb|AGL98100.1|  transcription factor MYC2                               677   0.0      
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          677   0.0      
emb|CDP13028.1|  unnamed protein product                                678   0.0      
gb|AAQ14332.1|AF283507_1  MYC2                                          671   0.0      Catharanthus roseus [chatas]
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          669   0.0      
gb|ADH04262.1|  bHLH1 transcription factor                              669   0.0      
gb|ADH04269.1|  MYC2a transcription factor                              667   0.0      
gb|ADH04263.1|  bHLH2 transcription factor                              662   0.0      
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          661   0.0      Vitis vinifera
gb|AIO09733.1|  transcription factor MYC2                               647   0.0      
gb|AHN63211.1|  transcription factor MYC2                               642   0.0      
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              632   0.0      Ricinus communis
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          632   0.0      
ref|NP_001288107.1|  uncharacterized protein LOC101261048               630   0.0      
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    631   0.0      
ref|XP_010104300.1|  hypothetical protein L484_023250                   629   0.0      
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          622   0.0      
emb|CAF74711.1|  MYC transcription factor                               621   0.0      Solanum tuberosum [potatoes]
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          614   0.0      
gb|KGN60384.1|  Transcription factor AtMYC2                             613   0.0      
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    613   0.0      
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like          612   0.0      
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          609   0.0      
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               607   0.0      
gb|AGQ80897.1|  MYC1                                                    605   0.0      
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          606   0.0      
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          605   0.0      
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                603   0.0      
gb|ACO53628.1|  bHLH domain protein                                     605   0.0      Gossypium hirsutum [American cotton]
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                603   0.0      
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          602   0.0      
gb|KDP34321.1|  hypothetical protein JCGZ_12669                         598   0.0      
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          598   0.0      
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             595   0.0      
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          592   0.0      
gb|EPS57820.1|  hypothetical protein M569_16997                         584   0.0      
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     587   0.0      Phaseolus vulgaris [French bean]
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               588   0.0      
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          581   0.0      
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          581   0.0      Lotus japonicus
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          578   0.0      
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                577   0.0      
gb|AIT39751.1|  transcription factor MYC2                               577   0.0      
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               578   0.0      
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             577   0.0      
gb|ADL36595.1|  BHLH domain class transcription factor                  576   0.0      
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          567   0.0      
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             566   0.0      
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   566   0.0      
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               564   0.0      
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     564   0.0      
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          557   0.0      
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          550   8e-179   
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               549   8e-178   
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               548   1e-177   
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             547   3e-176   
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     544   6e-175   Rheum australe [Himalayan rhubarb]
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          540   9e-175   
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          540   4e-174   
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          542   4e-174   
dbj|BAA25078.1|  RD22BP1                                                537   1e-173   Arabidopsis thaliana [mouse-ear cress]
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    538   1e-173   
ref|XP_003612909.1|  BHLH transcription factor                          539   1e-173   
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          535   8e-173   
ref|NP_174541.1|  transcription factor MYC2                             534   1e-172   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           533   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003628820.1|  Transcription factor MYC2                          534   3e-172   
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               533   3e-172   
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    531   3e-171   
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          530   4e-171   
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          530   3e-170   
ref|XP_002893732.1|  ATMYC2                                             528   4e-170   
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          527   5e-170   
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          528   7e-170   
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             527   8e-170   
gb|ABD59338.1|  G-box element binding protein                           527   2e-169   Pisum sativum [garden pea]
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             523   3e-168   
gb|ABS11038.1|  MYC                                                     522   4e-168   Brassica oleracea var. gemmifera
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    521   1e-167   
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          521   9e-167   
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          516   7e-165   
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             512   4e-164   
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          512   5e-163   
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               509   6e-162   
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               507   2e-161   
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           500   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193522.1|  transcription factor MYC4                             500   4e-160   Arabidopsis thaliana [mouse-ear cress]
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            504   4e-160   Oryza sativa [red rice]
ref|NP_001065478.1|  Os10g0575000                                       503   1e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          499   2e-159   
ref|XP_002868032.1|  basic helix-loop-helix family protein              499   2e-159   
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     498   1e-158   Phaseolus vulgaris [French bean]
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          496   6e-158   
dbj|BAJ33793.1|  unnamed protein product                                494   2e-157   
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          492   2e-156   
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             493   2e-156   
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          488   4e-155   
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    488   4e-155   
gb|AAD15818.1|  transcription factor MYC7E                              491   8e-155   Zea mays [maize]
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               490   1e-154   
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          486   3e-153   
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          484   7e-153   
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          482   5e-152   
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          483   7e-152   
dbj|BAJ86015.1|  predicted protein                                      480   4e-151   
dbj|BAJ91022.1|  predicted protein                                      478   3e-150   
dbj|BAJ91674.1|  predicted protein                                      478   3e-150   
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          474   6e-150   
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          478   8e-150   
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          475   1e-149   
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          471   1e-148   
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               469   3e-148   
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             465   2e-146   
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             464   6e-146   
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               462   4e-145   
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             461   5e-145   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           461   5e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             460   2e-144   
gb|EEC67493.1|  hypothetical protein OsI_34761                          460   1e-143   Oryza sativa Indica Group [Indian rice]
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    444   8e-139   
emb|CDX84081.1|  BnaC08g07580D                                          441   4e-138   
gb|EEE51454.1|  hypothetical protein OsJ_32566                          447   7e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810          431   6e-133   
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          431   3e-132   
gb|KHN04880.1|  Transcription factor MYC2                               422   6e-132   
gb|AEJ88337.1|  putative MYC protein                                    414   3e-128   
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like          410   9e-128   
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             408   9e-126   
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    380   8e-116   
gb|KHN38923.1|  Transcription factor MYC2                               379   9e-116   
gb|KHM99168.1|  Transcription factor MYC2                               369   8e-113   
gb|AFZ93650.1|  transcription factor MYC2                               312   1e-93    
ref|XP_010463090.1|  PREDICTED: transcription factor MYC2-like          312   3e-91    
gb|AAF04917.1|AF011557_1  jasmonic acid 3                               281   1e-81    Solanum lycopersicum
gb|KHN18804.1|  Transcription factor MYC4                               277   5e-81    
gb|KHM99167.1|  Transcription factor MYC4                               273   2e-80    
emb|CDY58502.1|  BnaA06g40330D                                          276   2e-78    
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like          266   4e-78    
emb|CDX77688.1|  BnaC07g19420D                                          275   5e-78    
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          280   5e-77    Sorghum bicolor [broomcorn]
gb|EPS60924.1|  hypothetical protein M569_13876                         273   2e-76    
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    273   2e-76    
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    271   2e-75    Brassica oleracea
ref|XP_009776798.1|  PREDICTED: transcription factor MYC2-like          259   5e-75    
emb|CDY35179.1|  BnaA09g18160D                                          270   5e-75    
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          269   6e-75    
emb|CDY03195.1|  BnaC09g19610D                                          268   1e-74    
emb|CDY44507.1|  BnaC01g10420D                                          268   4e-74    
emb|CDX78808.1|  BnaA01g08750D                                          266   8e-74    
emb|CCQ71910.1|  transcription factor MYC2                              255   8e-73    
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          260   9e-71    
gb|EPS71023.1|  hypothetical protein M569_03732                         255   4e-70    
ref|XP_003612908.1|  Transcription factor MYC2                          240   1e-68    
gb|AGO03813.1|  JAMYC2                                                  242   3e-68    
gb|KEH27718.1|  basic helix loop helix (BHLH) family transcriptio...    239   4e-68    
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          249   2e-67    
ref|XP_006662628.1|  PREDICTED: transcription factor MYC2-like          244   5e-67    
ref|XP_006601141.1|  PREDICTED: transcription factor MYC2-like          235   7e-66    
gb|AEB35606.1|  MYC2                                                    224   8e-64    
gb|AEB35601.1|  MYC2                                                    224   1e-63    
gb|AEB35568.1|  MYC2                                                    223   1e-63    
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        235   1e-63    
gb|AEB35597.1|  MYC2                                                    223   1e-63    
gb|AEB35671.1|  MYC2                                                    223   1e-63    
emb|CDY35183.1|  BnaA09g18200D                                          235   1e-63    
gb|AEB35692.1|  MYC2                                                    223   2e-63    
gb|AEB35565.1|  MYC2                                                    223   2e-63    
gb|AEB35567.1|  MYC2                                                    223   2e-63    
gb|AEB35595.1|  MYC2                                                    223   3e-63    
gb|AEB35580.1|  MYC2                                                    223   3e-63    
gb|AEB35674.1|  MYC2                                                    222   3e-63    
gb|AEB35658.1|  MYC2                                                    222   4e-63    
gb|AEB35575.1|  MYC2                                                    222   5e-63    
gb|AEB35656.1|  MYC2                                                    221   6e-63    
gb|AEB35694.1|  MYC2                                                    221   7e-63    
gb|AEB35703.1|  MYC2                                                    221   7e-63    
gb|AEB35706.1|  MYC2                                                    221   8e-63    
gb|AEB35571.1|  MYC2                                                    221   8e-63    
emb|CDY26910.1|  BnaA05g18020D                                          231   8e-63    
gb|AEB35676.1|  MYC2                                                    221   9e-63    
gb|AEB35587.1|  MYC2                                                    221   9e-63    
gb|AEB35578.1|  MYC2                                                    221   1e-62    
gb|AEB35640.1|  MYC2                                                    221   1e-62    
gb|AEB35604.1|  MYC2                                                    221   1e-62    
gb|AEB35577.1|  MYC2                                                    220   2e-62    
gb|AEB35592.1|  MYC2                                                    220   2e-62    
emb|CDX73261.1|  BnaC05g28450D                                          230   2e-62    
gb|AEB35660.1|  MYC2                                                    220   2e-62    
gb|AEB35649.1|  MYC2                                                    220   2e-62    
gb|AEB35596.1|  MYC2                                                    220   2e-62    
gb|AEB35678.1|  MYC2                                                    220   2e-62    
emb|CDY03185.1|  BnaC09g19710D                                          231   3e-62    
gb|AEB35570.1|  MYC2                                                    219   4e-62    
gb|AEB35657.1|  MYC2                                                    218   8e-62    
gb|AGO03814.1|  JAMYC4                                                  223   7e-61    
gb|AEB35573.1|  MYC2                                                    214   2e-60    
gb|ACM48567.1|  JAMYC                                                   230   2e-60    Taxus cuspidata [ichii]
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          227   2e-60    
gb|ABR16623.1|  unknown                                                 222   4e-58    Picea sitchensis
ref|XP_010481407.1|  PREDICTED: transcription factor bHLH28-like        218   7e-58    
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    219   3e-57    
emb|CDX77699.1|  BnaC07g19530D                                          207   3e-56    
emb|CDY59973.1|  BnaA09g53560D                                          214   3e-56    
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        213   3e-56    
ref|XP_009101672.1|  PREDICTED: transcription factor bHLH28-like        206   7e-56    
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        212   2e-55    
emb|CDY33482.1|  BnaA06g35910D                                          204   3e-55    
emb|CDY03183.1|  BnaC09g19730D                                          211   3e-55    
ref|XP_009139989.1|  PREDICTED: transcription factor MYC4-like          205   4e-55    
gb|AEB35681.1|  MYC2                                                    199   5e-55    
ref|XP_006279851.1|  hypothetical protein CARUB_v10028430mg             210   5e-55    
gb|AEB35702.1|  MYC2                                                    198   7e-55    
gb|AEB35566.1|  MYC2                                                    198   9e-55    
gb|AEB35699.1|  MYC2                                                    197   1e-54    
ref|XP_002865159.1|  predicted protein                                  206   2e-53    
gb|AEB35693.1|  MYC2                                                    194   3e-53    
gb|AEB35704.1|  MYC2                                                    194   3e-53    
gb|EMS55891.1|  Transcription factor MYC4                               201   8e-53    
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        202   4e-52    
ref|XP_008392629.1|  PREDICTED: transcription factor MYC2-like          195   2e-51    
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   197   4e-50    
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             197   4e-50    
ref|NP_199495.1|  calcium-binding transcription factor NIG1             194   3e-49    Arabidopsis thaliana [mouse-ear cress]
emb|CBI34590.3|  unnamed protein product                                187   6e-49    
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               192   1e-48    
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               191   2e-48    Vitis vinifera
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             189   3e-48    
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    189   5e-48    
gb|KHN15898.1|  Transcription factor bHLH14                             189   1e-47    
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          189   1e-47    
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          188   2e-47    
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2-like          187   3e-47    
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             187   5e-47    
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          186   7e-47    
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    186   1e-46    
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               186   1e-46    
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          186   2e-46    Vitis vinifera
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          185   2e-46    
gb|KDP28433.1|  hypothetical protein JCGZ_14204                         185   2e-46    
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        184   4e-46    
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    184   6e-46    
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          182   6e-46    
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               184   6e-46    
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          181   1e-45    
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    182   2e-45    
ref|XP_004305712.1|  PREDICTED: uncharacterized protein LOC101296219    181   2e-45    
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          181   2e-45    
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          181   2e-45    
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          181   2e-45    
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          182   3e-45    
ref|XP_002529965.1|  DNA binding protein, putative                      182   3e-45    Ricinus communis
ref|XP_010100678.1|  hypothetical protein L484_023447                   182   3e-45    
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             181   3e-45    
ref|XP_007161222.1|  hypothetical protein PHAVU_001G052200g             176   4e-45    
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          181   4e-45    
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          180   1e-44    
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             180   2e-44    
gb|ABK94979.1|  unknown                                                 179   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    179   2e-44    
emb|CDX77694.1|  BnaC07g19480D                                          173   2e-44    
ref|XP_002301432.1|  basic helix-loop-helix family protein              179   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          180   3e-44    
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   180   3e-44    
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    179   4e-44    
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620          176   2e-43    
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     176   2e-43    
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          176   2e-43    
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          174   4e-43    
ref|XP_010100202.1|  hypothetical protein L484_015347                   176   5e-43    
ref|XP_001765254.1|  predicted protein                                  179   6e-43    
ref|XP_002518914.1|  DNA binding protein, putative                      175   7e-43    
gb|AEG74014.1|  lMYC4                                                   174   1e-42    
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          174   1e-42    
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          173   2e-42    
ref|XP_002529968.1|  transcription factor, putative                     168   3e-42    
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         173   3e-42    
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          172   6e-42    
ref|XP_009101673.1|  PREDICTED: transcription factor bHLH28-like        169   7e-42    
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               171   8e-42    
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          171   1e-41    
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        170   3e-41    
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          169   3e-41    
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          168   7e-41    
gb|AEW07707.1|  hypothetical protein 0_9408_01                          159   1e-40    
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             168   1e-40    
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13             170   1e-40    
gb|AEG74015.1|  lMYC5                                                   167   2e-40    
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          167   2e-40    
ref|XP_004309579.1|  PREDICTED: transcription factor MYC2-like          166   3e-40    
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             169   3e-40    
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          167   3e-40    
gb|AFB33094.1|  hypothetical protein 0_9408_01                          157   3e-40    
gb|AFB33098.1|  hypothetical protein 0_9408_01                          157   3e-40    
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        168   5e-40    
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    166   5e-40    
gb|AEW07706.1|  hypothetical protein 0_9408_01                          156   6e-40    
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        165   7e-40    
gb|AFB33089.1|  hypothetical protein 0_9408_01                          156   7e-40    
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             166   7e-40    
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    166   8e-40    
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        167   1e-39    
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    165   1e-39    
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    164   1e-39    
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    165   1e-39    
emb|CDP08667.1|  unnamed protein product                                166   2e-39    
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    164   3e-39    
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    163   3e-39    
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    164   3e-39    
ref|XP_001754025.1|  predicted protein                                  165   3e-39    
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          163   4e-39    
gb|ACF05947.1|  MYC1                                                    163   4e-39    
ref|XP_009770264.1|  PREDICTED: transcription factor bHLH13-like        165   5e-39    
gb|ACF19982.1|  MYC2                                                    163   5e-39    
ref|XP_006852614.1|  hypothetical protein AMTR_s00021p00226670          164   5e-39    
ref|XP_009627739.1|  PREDICTED: transcription factor bHLH13-like        164   6e-39    
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          162   7e-39    
gb|EMT33615.1|  Transcription factor MYC2                               162   8e-39    
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             161   9e-39    
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             162   9e-39    
emb|CDP08631.1|  unnamed protein product                                161   1e-38    
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          162   1e-38    
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          162   1e-38    
ref|XP_004229991.1|  PREDICTED: transcription factor bHLH13-like        163   2e-38    
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             161   2e-38    
ref|XP_002320222.1|  basic helix-loop-helix family protein              160   2e-38    
ref|XP_009608279.1|  PREDICTED: transcription factor bHLH13-like        162   4e-38    
ref|XP_011093025.1|  PREDICTED: transcription factor bHLH13-like ...    162   5e-38    
ref|XP_011093027.1|  PREDICTED: transcription factor bHLH13-like ...    162   5e-38    
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        161   6e-38    
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          159   7e-38    
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          158   7e-38    
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    159   9e-38    
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    159   1e-37    
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          159   1e-37    
gb|AEG74013.1|  lMYC3                                                   159   1e-37    
ref|XP_010559123.1|  PREDICTED: transcription factor ABA-INDUCIBL...    160   2e-37    
gb|ADK91082.1|  LMYC2                                                   159   2e-37    
gb|AHG95274.1|  mys transcription factor                                149   2e-37    
ref|XP_009781532.1|  PREDICTED: transcription factor bHLH13-like        160   2e-37    
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like          157   2e-37    
gb|ADK56287.1|  LMYC1                                                   158   2e-37    
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          157   3e-37    
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                156   3e-37    
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          157   3e-37    
gb|ABR16436.1|  unknown                                                 159   3e-37    
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             157   3e-37    
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like          157   3e-37    
gb|AHG95269.1|  mys transcription factor                                147   4e-37    
ref|XP_010506659.1|  PREDICTED: transcription factor ABA-INDUCIBL...    159   4e-37    
gb|KDP22548.1|  hypothetical protein JCGZ_26379                         157   4e-37    
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          157   4e-37    
gb|AHG95271.1|  mys transcription factor                                147   5e-37    
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                    157   5e-37    
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          155   5e-37    
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like          156   7e-37    
ref|XP_011093944.1|  PREDICTED: transcription factor bHLH13-like        158   7e-37    
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g             158   8e-37    
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like          155   8e-37    
ref|XP_002882073.1|  basic helix-loop-helix family protein              157   8e-37    
ref|XP_006339721.1|  PREDICTED: transcription factor bHLH13-like        158   8e-37    
dbj|BAH20404.1|  AT1G01260                                              155   8e-37    
gb|KGN55667.1|  hypothetical protein Csa_3G002860                       156   8e-37    
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like        158   1e-36    
ref|NP_566078.1|  transcription factor ABA-INDUCIBLE bHLH-TYPE          157   1e-36    
ref|XP_010518324.1|  PREDICTED: transcription factor ABA-INDUCIBL...    157   1e-36    
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like          155   1e-36    
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        154   1e-36    
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          156   1e-36    
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               156   1e-36    
ref|XP_001765161.1|  predicted protein                                  159   1e-36    
gb|KHN16427.1|  Transcription factor bHLH13                             156   2e-36    
ref|XP_006397843.1|  hypothetical protein EUTSA_v10001374mg             156   2e-36    
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          154   2e-36    
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like        155   3e-36    
emb|CDY70013.1|  BnaCnng66320D                                          149   3e-36    
gb|AAM19778.1|  At2g46510/F13A10.4                                      155   3e-36    
ref|XP_009401987.1|  PREDICTED: transcription factor bHLH13-like        156   4e-36    
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        154   4e-36    
ref|XP_007161224.1|  hypothetical protein PHAVU_001G052400g             150   4e-36    
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          154   5e-36    
ref|XP_010480459.1|  PREDICTED: transcription factor bHLH13-like        155   5e-36    
gb|AHG95270.1|  mys transcription factor                                144   6e-36    
ref|XP_006307052.1|  hypothetical protein CARUB_v10008640mg             155   6e-36    
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          152   6e-36    
ref|NP_171634.1|  transcription factor bHLH13                           155   6e-36    
gb|AAM10932.1|AF488559_1  putative bHLH transcription factor            155   7e-36    
ref|XP_010474717.1|  PREDICTED: transcription factor bHLH13-like        155   7e-36    
ref|XP_010508006.1|  PREDICTED: transcription factor ABA-INDUCIBL...    154   8e-36    
ref|XP_010457144.1|  PREDICTED: transcription factor bHLH13             155   8e-36    
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             152   1e-35    
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          152   1e-35    
ref|XP_003553791.1|  PREDICTED: transcription factor bHLH13-like        154   1e-35    
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             152   1e-35    
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             152   1e-35    
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          151   2e-35    
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          151   2e-35    
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    154   2e-35    
ref|XP_004301652.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    150   2e-35    
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          150   3e-35    
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             151   4e-35    
emb|CDX90021.1|  BnaA10g00610D                                          152   4e-35    
ref|XP_007051527.1|  Myc2 bHLH protein isoform 1                        152   4e-35    
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          149   5e-35    
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          151   5e-35    
ref|XP_002892077.1|  basic helix-loop-helix family protein              152   6e-35    
ref|XP_009119682.1|  PREDICTED: transcription factor bHLH13             151   8e-35    
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        150   8e-35    
ref|XP_001752627.1|  predicted protein                                  154   8e-35    
ref|XP_002302637.2|  basic helix-loop-helix family protein              151   9e-35    
ref|XP_006491293.1|  PREDICTED: transcription factor bHLH13-like        151   1e-34    
ref|XP_010522910.1|  PREDICTED: transcription factor bHLH13-like        151   1e-34    
ref|XP_009617148.1|  PREDICTED: transcription factor MYC4-like          147   1e-34    
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                150   1e-34    
ref|XP_006444826.1|  hypothetical protein CICLE_v10019339mg             151   1e-34    
ref|XP_010544844.1|  PREDICTED: transcription factor ABA-INDUCIBL...    150   2e-34    
ref|XP_011083013.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    149   2e-34    
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like          149   2e-34    
ref|XP_007200616.1|  hypothetical protein PRUPE_ppa008004mg             146   2e-34    
ref|XP_011023168.1|  PREDICTED: transcription factor bHLH13-like        150   3e-34    
ref|XP_010523814.1|  PREDICTED: transcription factor ABA-INDUCIBL...    149   3e-34    
ref|XP_004172828.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    150   3e-34    
gb|KGN56417.1|  hypothetical protein Csa_3G119500                       149   4e-34    
ref|XP_006443887.1|  hypothetical protein CICLE_v10019816mg             149   4e-34    
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          148   4e-34    
ref|XP_004133809.1|  PREDICTED: transcription factor bHLH13-like        149   4e-34    
ref|XP_010100069.1|  hypothetical protein L484_005743                   149   4e-34    
gb|KDO68498.1|  hypothetical protein CISIN_1g010728mg                   149   4e-34    
ref|XP_002282584.2|  PREDICTED: transcription factor bHLH3              148   4e-34    
ref|XP_009354912.1|  PREDICTED: transcription factor bHLH3-like         148   4e-34    
gb|KHN44989.1|  Transcription factor bHLH3                              146   6e-34    
emb|CBI17963.3|  unnamed protein product                                148   6e-34    
ref|XP_010100724.1|  hypothetical protein L484_023493                   149   6e-34    
gb|KDP26171.1|  hypothetical protein JCGZ_22265                         143   6e-34    
ref|XP_008372342.1|  PREDICTED: transcription factor bHLH3-like         148   7e-34    
ref|XP_008235723.1|  PREDICTED: transcription factor bHLH3              147   8e-34    
ref|XP_002521010.1|  DNA binding protein, putative                      147   8e-34    
gb|KEH23875.1|  ABA-inducible bHLH-type transcription factor            147   9e-34    
ref|XP_006293427.1|  hypothetical protein CARUB_v10025360mg             148   9e-34    
gb|KHG04474.1|  Transcription factor bHLH13 -like protein               148   1e-33    
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...    147   1e-33    
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...    147   1e-33    
ref|XP_004289915.1|  PREDICTED: transcription factor bHLH3-like         147   1e-33    
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like          147   2e-33    
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          147   2e-33    
emb|CDY34468.1|  BnaC01g21650D                                          146   2e-33    
ref|XP_006418406.1|  hypothetical protein EUTSA_v10007139mg             147   2e-33    
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like          147   2e-33    
ref|XP_008353557.1|  PREDICTED: transcription factor MYC4-like          142   2e-33    
ref|XP_010038016.1|  PREDICTED: transcription factor bHLH3              146   2e-33    
ref|XP_008437879.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    147   3e-33    
ref|XP_004493757.1|  PREDICTED: transcription factor bHLH3-like         146   3e-33    
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...    143   3e-33    
ref|XP_009146001.1|  PREDICTED: transcription factor bHLH3              145   3e-33    
emb|CDY32242.1|  BnaA01g17420D                                          145   3e-33    
ref|XP_010679205.1|  PREDICTED: transcription factor bHLH3-like         145   4e-33    
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          144   5e-33    
ref|XP_010556598.1|  PREDICTED: transcription factor bHLH13-like        146   5e-33    
ref|XP_008461882.1|  PREDICTED: transcription factor bHLH3              145   5e-33    
ref|XP_006594010.1|  PREDICTED: transcription factor bHLH3-like         145   5e-33    
ref|XP_002306828.2|  basic helix-loop-helix family protein              144   6e-33    
gb|EYU40715.1|  hypothetical protein MIMGU_mgv1a020739mg                145   7e-33    
ref|XP_010451453.1|  PREDICTED: transcription factor bHLH3-like         141   8e-33    
emb|CBI33883.3|  unnamed protein product                                142   8e-33    
ref|XP_007144718.1|  hypothetical protein PHAVU_007G179100g             144   9e-33    
gb|KEH18633.1|  ABA-inducible bHLH-type transcription factor            145   1e-32    
ref|XP_004151980.1|  PREDICTED: transcription factor bHLH3-like         144   1e-32    
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          143   1e-32    
ref|XP_011026018.1|  PREDICTED: transcription factor bHLH3-like         144   1e-32    
gb|KDP28477.1|  hypothetical protein JCGZ_14248                         144   1e-32    
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...    142   2e-32    
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          143   2e-32    
gb|KHN06316.1|  Transcription factor bHLH13                             144   2e-32    
gb|EYU38884.1|  hypothetical protein MIMGU_mgv1a003886mg                144   2e-32    
ref|XP_003528790.1|  PREDICTED: transcription factor bHLH13-like        144   2e-32    
ref|XP_010554450.1|  PREDICTED: transcription factor bHLH3              142   3e-32    
ref|XP_009803066.1|  PREDICTED: transcription factor bHLH3              142   3e-32    
ref|XP_011028761.1|  PREDICTED: transcription factor bHLH3-like         142   3e-32    
ref|XP_002302066.1|  basic helix-loop-helix family protein              142   3e-32    
ref|XP_008790159.1|  PREDICTED: transcription factor bHLH13-like        143   4e-32    
gb|AEB35563.1|  MYC2                                                    139   5e-32    
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          141   5e-32    
gb|AEB35467.1|  MYC2                                                    139   5e-32    
gb|AEB35522.1|  MYC2                                                    139   5e-32    
gb|AEB35550.1|  MYC2                                                    139   6e-32    
gb|AEB35549.1|  MYC2                                                    139   6e-32    
gb|AEB35556.1|  MYC2                                                    139   6e-32    
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    142   6e-32    
ref|XP_009407318.1|  PREDICTED: transcription factor bHLH13-like        142   8e-32    
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          141   8e-32    
gb|KEH24682.1|  ABA-inducible bHLH-type transcription factor            142   9e-32    



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/610 (67%), Positives = 476/610 (78%), Gaps = 43/610 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+S VD   P +LGWGDGYYKGEEDK  R    S
Sbjct  87    NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  3015  SPA---EQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG    TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  147   SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  206

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW++G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS DL
Sbjct  207   QALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSSDL  266

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGV--DVNTSVQENSIP  2494
             MNKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P+S++    D+NT V+ NS+P
Sbjct  267   MNKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDPSSAAVQVKDLNT-VEANSVP  320

Query  2493  SS-SVKEIVFRNENSIPSSTGNN-HHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             SS S K++VF NEN+  S      HH  Q +Q +FTRELNFSEFGFDG++NN N +    
Sbjct  321   SSNSSKQVVFDNENNGHSCDNQQQHHSRQQTQGFFTRELNFSEFGFDGSSNNRNGNSSL-  379

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGN----SCQFLGGDEskskkktatlkaSNEEGML  2155
                 SCKPE+GEILNFG+S TK++ NGN       F  G+E+K KK++   + SNEEGML
Sbjct  380   ----SCKPESGEILNFGDS-TKKSANGNLFSGQSHFGAGEENKKKKRSPASRGSNEEGML  434

Query  2154  SFGSGMVKssggigigds-------sDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGR  1999
             SF SG +  +    +  S       SDHSDLEASVVKEA+S R VE     EKRP+KRGR
Sbjct  435   SFVSGTILPAASGAMKSSGCVGEDSSDHSDLEASVVKEAESSRVVE----PEKRPKKRGR  490

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL
Sbjct  491   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKL  550

Query  1818  ETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP------KKTTTPHKIPDMDVDVKVMGW  1657
             +T+E+  +DLK Q + LKKEL +K+ R P P P        + T  KI D+D+DVK++GW
Sbjct  551   QTTETDREDLKSQIEDLKKELDSKDSRRPGPPPPNQDHKMSSHTGSKIVDVDIDVKIIGW  610

Query  1656  DAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLR  1477
             DAMIRIQC KKNHPAARLMVALK+LDL+V HASVSV+NDLMIQQA VKMG+RLY ++QLR
Sbjct  611   DAMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLR  670

Query  1476  LALISKLAET  1447
             +AL S++AET
Sbjct  671   IALTSRVAET  680



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/610 (67%), Positives = 477/610 (78%), Gaps = 43/610 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+S VD   P +LGWGDGYYKGEEDK  R    S
Sbjct  87    NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  3015  SPA---EQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG  + TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  147   SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  206

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW++G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS DL
Sbjct  207   QALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSSDL  266

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGV--DVNTSVQENSIP  2494
             MNKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P+S++    D+NT V+ NS+P
Sbjct  267   MNKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDPSSAAVQVKDLNT-VEANSVP  320

Query  2493  SS-SVKEIVFRNENSIPSSTGNN-HHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             SS S K++VF NEN+  S      HH  Q +Q +FTRELNFSEFGFDG++NN N +    
Sbjct  321   SSNSSKQVVFDNENNGHSCDNQQQHHSRQQTQGFFTRELNFSEFGFDGSSNNRNGNSSL-  379

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGN----SCQFLGGDEskskkktatlkaSNEEGML  2155
                 SCKPE+GEILNFG+S TK++ NGN       F  G+E+K KK++   + SNEEGML
Sbjct  380   ----SCKPESGEILNFGDS-TKKSANGNLFSGQSHFGAGEENKKKKRSPASRGSNEEGML  434

Query  2154  SFGSGMVKssggigigds-------sDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGR  1999
             SF SG +  +    +  S       SDHSDLEASVVKEA+S R VE     EKRP+KRGR
Sbjct  435   SFVSGTILPAASGAMKSSGCVGEDSSDHSDLEASVVKEAESSRVVE----PEKRPKKRGR  490

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL
Sbjct  491   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKL  550

Query  1818  ETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP------KKTTTPHKIPDMDVDVKVMGW  1657
             +T+E+  +DLK Q + LKKEL +K+ R P P P        + T  KI D+D+DVK++GW
Sbjct  551   QTTETDREDLKSQIEDLKKELDSKDSRRPGPPPPNQDHKMSSHTGSKIVDVDIDVKIIGW  610

Query  1656  DAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLR  1477
             DAMIRIQC KKNHPAARLMVALK+LDL+V HASVSV+NDLMIQQA VKMG+RLY ++QLR
Sbjct  611   DAMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLR  670

Query  1476  LALISKLAET  1447
             +AL S++AET
Sbjct  671   IALTSRVAET  680



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/609 (67%), Positives = 476/609 (78%), Gaps = 42/609 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+SVVD + P +LGWGDGYYKGEEDK  R    S
Sbjct  86    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  3015  SPA---EQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG    TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  146   SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  205

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW++G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS DL
Sbjct  206   QALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSCDL  265

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVN--TSVQENSIP  2494
             MNKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P SS+ V+V    +V+ NS+P
Sbjct  266   MNKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDP-SSAAVEVQDLNTVKANSVP  319

Query  2493  SS-SVKEIVFRNENSIPSSTGNN--HHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrng  2323
             SS S K++VF NEN+  SS      H   +   +FTRELNFSEFGFDG++NN N +    
Sbjct  320   SSNSSKQVVFDNENNGHSSDNQQQQHSKHETQGFFTRELNFSEFGFDGSSNNRNGNSSL-  378

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGN----SCQFLGGDEskskkktatlkaSNEEGML  2155
                 SCKPE+GEILNFG+S TK++ NGN       F  G+E+K+KK++   + SNEEGML
Sbjct  379   ----SCKPESGEILNFGDS-TKKSANGNLFSGQSHFGAGEENKNKKRSPASRGSNEEGML  433

Query  2154  SFGSGMVKssggigigds------sDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRK  1996
             SF SG +  +    +  S      SDHSDLEASVVKEA+S R VE     EKRP+KRGRK
Sbjct  434   SFVSGTILPAASGAMKSSGGVGEDSDHSDLEASVVKEAESSRVVE----PEKRPKKRGRK  489

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL+
Sbjct  490   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQ  549

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKK------TTTPHKIPDMDVDVKVMGWD  1654
              +E+  ++LK Q + LKKEL++K+ R P P P        + T  KI D+D+DVK++GWD
Sbjct  550   NTETDREELKSQIEDLKKELASKDSRRPGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWD  609

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC KKNHPAARLMVALK+LDL+V HASVSV+NDLMIQQA VKMG+RLY ++QLR+
Sbjct  610   AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRI  669

Query  1473  ALISKLAET  1447
             AL S++AET
Sbjct  670   ALTSRVAET  678



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/609 (67%), Positives = 476/609 (78%), Gaps = 42/609 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+SVVD + P +LGWGDGYYKGEEDK  R    S
Sbjct  86    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  3015  SPA---EQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG  + TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  146   SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  205

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW++G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS DL
Sbjct  206   QALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSCDL  265

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVN--TSVQENSIP  2494
             MNKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P SS+ V+V    +V+ NS+P
Sbjct  266   MNKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDP-SSAAVEVQDLNTVKANSVP  319

Query  2493  SS-SVKEIVFRNENSIPSSTGNN--HHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrng  2323
             SS S K++VF NEN+  SS      H   +   +FTRELNFSEFGFDG++NN N +    
Sbjct  320   SSNSSKQVVFDNENNGHSSDNQQQQHSKHETQGFFTRELNFSEFGFDGSSNNRNGNSSL-  378

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGN----SCQFLGGDEskskkktatlkaSNEEGML  2155
                 SCKPE+GEILNFG+S TK++ NGN       F  G+E+K+KK++   + SNEEGML
Sbjct  379   ----SCKPESGEILNFGDS-TKKSANGNLFSGQSHFGAGEENKNKKRSPASRGSNEEGML  433

Query  2154  SFGSGMVKssggigigds------sDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRK  1996
             SF SG +  +    +  S      SDHSDLEASVVKEA+S R VE     EKRP+KRGRK
Sbjct  434   SFVSGTILPAASGAMKSSGGVGEDSDHSDLEASVVKEAESSRVVE----PEKRPKKRGRK  489

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL+
Sbjct  490   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQ  549

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKK------TTTPHKIPDMDVDVKVMGWD  1654
              +E+  ++LK Q + LKKEL +K+ R P P P        + T  KI D+D+DVK++GWD
Sbjct  550   NTETDREELKSQIEDLKKELVSKDSRRPGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWD  609

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC KKNHPAARLMVALK+LDL+V HASVSV+NDLMIQQA VKMG+RLY ++QLR+
Sbjct  610   AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRI  669

Query  1473  ALISKLAET  1447
             AL S++AET
Sbjct  670   ALTSRVAET  678



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/618 (66%), Positives = 470/618 (76%), Gaps = 53/618 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LIDGARETWTYAIFWQ+SVVDF+ PS+LGWGDGYYKGEEDK KR    S
Sbjct  98    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLAVS  157

Query  3015  SPA---EQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG PA TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  158   SPAYIAEQEHRKKVLRELNSLISGAPAGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  217

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  SSSPIW++G +KL +S CER RQAQ FGL+T+VCIPS+NGVVELGST+LI+QS DL
Sbjct  218   QALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQSSDL  277

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTS---VQENSI  2497
             MNKVRVLFNF+N       GS SWA  PENDPSALWLTEP SSSG++V  S   VQ NS+
Sbjct  278   MNKVRVLFNFSND-----FGSGSWAVQPENDPSALWLTEP-SSSGMEVRESLNTVQTNSV  331

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ----------YFTRELNFSEFGFDGAnn  2350
             PSS S K+I + NEN+  S  G + ++ Q  Q          +FTRELNFSEFGFDG   
Sbjct  332   PSSNSNKQIAYGNENNHQSGNGQSCYNQQQQQNNPPQQQTQGFFTRELNFSEFGFDG---  388

Query  2349  nhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkk--------  2194
                N  +N N+S SCKPE+GEILNFG+S  K   + N   F G  +  + ++        
Sbjct  389   ---NSNKNENASLSCKPESGEILNFGDSTKKSASSANVNLFTGQSQFGAVEENNNNKNKK  445

Query  2193  -tatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLA  2032
              +AT + SNEEGMLSF SG V        G G G+ S+HSDLEASVVKEADS R VE   
Sbjct  446   RSATSRGSNEEGMLSFVSGTVLPSSGMKSGGGRGEDSEHSDLEASVVKEADSSRVVE---  502

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  503   -PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  561

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH---KIPDMD  1681
             I+YINELKSKL+ +ES  +DLK Q + LKKE  ++ P  P PN     + H   KI D+D
Sbjct  562   ISYINELKSKLQNTESDKEDLKSQIEDLKKE--SRRPGPPPPNQDLKMSSHTGGKIVDVD  619

Query  1680  VDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTR  1501
             +DVK++GWDAMIRIQC KKNHPAARLM AL +LDL+V HASVSV+NDLMIQQA VKMG+R
Sbjct  620   IDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSR  679

Query  1500  LYNQDQLRLALISKLAET  1447
              Y ++QLR+AL SK+AET
Sbjct  680   HYTEEQLRVALTSKIAET  697



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 473/616 (77%), Gaps = 50/616 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LIDGARETWTYAIFWQ+SVVDF+ PS+LGWGDGYYKGEEDK KR    S
Sbjct  90    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  3015  SPA---EQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG P  TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  150   SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  209

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  SSSPIW++G +KL +S CER RQAQ FGL+T+VCIPS+NGVVELGST+LI+QS DL
Sbjct  210   QALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQSSDL  269

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTS---VQENSI  2497
             MNKVRVLFNF+N D+GS     SWA  PE+DPSALWLT+P SSSG++V  S   VQ NS+
Sbjct  270   MNKVRVLFNFSN-DLGS----GSWAVQPESDPSALWLTDP-SSSGMEVRESLNTVQTNSV  323

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ---------YFTRELNFSEFGFDGAnnn  2347
             PSS S K+I + NEN+ PS  G + ++ Q  +         +FTRELNFSEFGFDG++N 
Sbjct  324   PSSNSNKQIAYGNENNHPSGNGQSCYNQQQQKNPPQQQTQGFFTRELNFSEFGFDGSSNR  383

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGN------SCQFLGGDEskskkktat  2185
             + N      SS SCKPE+GEILNFG+S  K   + N        QF  G+E+ +K K  +
Sbjct  384   NGN------SSVSCKPESGEILNFGDSTKKSASSANVNLFTGQSQFGAGEENNNKNKKRS  437

Query  2184  lka--SNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLAAA  2026
               +  SNEEGMLSF SG V        G G G+ S+HSDLEASVVKEADS R VE     
Sbjct  438   ATSRGSNEEGMLSFVSGTVLPSSGMKSGGGGGEDSEHSDLEASVVKEADSSRVVE----P  493

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+
Sbjct  494   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIS  553

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH---KIPDMDVD  1675
             YINELKSKL+ +ES  +DLK Q + LKKE S +    P PN     + H   KI D+D+D
Sbjct  554   YINELKSKLQNTESDKEDLKSQIEDLKKE-SRRPGPPPPPNQDLKMSSHTGGKIVDVDID  612

Query  1674  VKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLY  1495
             VK++GWDAMIRIQC KKNHPAARLM AL +LDL+V HASVSV+NDLMIQQA VKMG+R Y
Sbjct  613   VKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSRHY  672

Query  1494  NQDQLRLALISKLAET  1447
              ++QLR+AL SK+AET
Sbjct  673   TEEQLRVALTSKIAET  688



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 472/616 (77%), Gaps = 50/616 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LIDGARETWTYAIFWQ+SVVDF+ PS+LGWGDGYYKGEEDK KR    S
Sbjct  90    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  3015  SPA---EQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG P  TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  150   SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  209

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  SSSPIW++G +KL +S CER RQAQ FGL+T+VCIPS+NGVVELGST+LI+QS DL
Sbjct  210   QALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQSSDL  269

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTS---VQENSI  2497
             MNKVRVLFNF+N D+GS     SWA  PE+DPSALWLT+P SSSG++V  S   VQ NS+
Sbjct  270   MNKVRVLFNFSN-DLGS----GSWAVQPESDPSALWLTDP-SSSGMEVRESLNTVQTNSV  323

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ---------YFTRELNFSEFGFDGAnnn  2347
             PSS S K+I + NEN+ PS  G + ++ Q  +          FTRELNFSEFGFDG++N 
Sbjct  324   PSSNSNKQIAYGNENNHPSGNGQSCYNQQQQKNPPQQQTQGLFTRELNFSEFGFDGSSNR  383

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGN------SCQFLGGDEskskkktat  2185
             + N      SS SCKPE+GEILNFG+S  K   + N        QF  G+E+ +K K  +
Sbjct  384   NGN------SSVSCKPESGEILNFGDSTKKSASSANVNLFTGQSQFGAGEENNNKNKKRS  437

Query  2184  lka--SNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLAAA  2026
               +  SNEEGMLSF SG V        G G G+ S+HSDLEASVVKEADS R VE     
Sbjct  438   ATSRGSNEEGMLSFVSGTVLPSSGMKSGGGGGEDSEHSDLEASVVKEADSSRVVE----P  493

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+
Sbjct  494   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIS  553

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH---KIPDMDVD  1675
             YINELKSKL+ +ES  +DLK Q + LKKE S +    P PN     + H   KI D+D+D
Sbjct  554   YINELKSKLQNTESDKEDLKSQIEDLKKE-SRRPGPPPPPNQDLKMSSHTGGKIVDVDID  612

Query  1674  VKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLY  1495
             VK++GWDAMIRIQC KKNHPAARLM AL +LDL+V HASVSV+NDLMIQQA VKMG+R Y
Sbjct  613   VKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSRNY  672

Query  1494  NQDQLRLALISKLAET  1447
              ++QLR+AL SK+AET
Sbjct  673   TEEQLRVALTSKIAET  688



>emb|CAF74710.1| MYC transcription factor [Solanum tuberosum]
Length=692

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/615 (66%), Positives = 473/615 (77%), Gaps = 51/615 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LIDGARETWTYAIFWQ+SVVDF+ PS+LGWGDGYYKGEEDK KR    S
Sbjct  92    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLAVS  151

Query  3015  SPA---EQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG PA TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  152   SPAYIAEQEHRKKVLRELNSLISGAPAGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  211

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  SSSPIW++G +KL +S CER RQAQ FGL+T+VCIPS+NGVVELGST+LI++S DL
Sbjct  212   QALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVESSDL  271

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTS---VQENSI  2497
             MNKVRVLFNF+N D+GS     SWA  PE+DPSALWLTEP SSSG++V  S   VQ NS+
Sbjct  272   MNKVRVLFNFSN-DLGS----GSWAVQPESDPSALWLTEP-SSSGMEVRESLNTVQTNSV  325

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHD----------SQPSQYFTRELNFSEFGFDGAnn  2350
             PSS S K+I + NEN+  S  G + ++           Q   +FTRELNFSEFGFDG++N
Sbjct  326   PSSNSNKQIAYANENNHQSGNGQSCYNLQQQQNNPPQQQTQGFFTRELNFSEFGFDGSSN  385

Query  2349  nhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDE---------skskk  2197
              + N      +S SCKPE+GEILNFG+S  K   + N   F G  +         +K+KK
Sbjct  386   RNGN------ASLSCKPESGEILNFGDSTKKSASSANVNLFTGQSQFGAVEENNNNKNKK  439

Query  2196  ktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLA  2032
             ++AT + SNEEGMLSF SG V        G G G+ S+HSDLEASVVKEADS R VE   
Sbjct  440   RSATSRGSNEEGMLSFVSGTVLPSSGMKSGGGGGEDSEHSDLEASVVKEADSSRVVE---  496

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  497   -PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  555

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDV  1672
             I+YINELKSKL+ +ES  +DLK Q + LKKE  ++ P  P PN +      KI D+D+DV
Sbjct  556   ISYINELKSKLQNTESDKEDLKSQIEDLKKE--SRRPGPPPPN-QDLKIGGKIVDVDIDV  612

Query  1671  KVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYN  1492
             K++GWDAMI IQC KKNHPAARLM AL +LDL+V HASVSV+NDLMIQQA VKMG+R Y 
Sbjct  613   KIIGWDAMIGIQCNKKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSRHYT  672

Query  1491  QDQLRLALISKLAET  1447
             ++QLR+AL SK+AET
Sbjct  673   EEQLRVALKSKIAET  687



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/607 (66%), Positives = 470/607 (77%), Gaps = 43/607 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+SVVD   P +LGWGDGYYKGEEDK  R    S
Sbjct  78    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPFVLGWGDGYYKGEEDKAGRKLAVS  137

Query  3015  SPA---EQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLIS     TD++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  138   SPAYIAEQEHRKKVLRELNSLISCTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSGLPG  197

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW++G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS DL
Sbjct  198   QALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSSDL  257

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             MNKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P S + V V      N++PSS
Sbjct  258   MNKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDP-SPAAVQVK---DLNTVPSS  308

Query  2487  -SVKEIVFRNENS--IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNS  2317
              S K++VF NEN+  I  +   +H   Q   +FTRELNFSEFGFDG++NN N +      
Sbjct  309   NSSKQVVFDNENNGHICDNQQQHHSQQQTQGFFTRELNFSEFGFDGSSNNRNGNSSV---  365

Query  2316  SHSCKPEAGEILNFGESVTKRNGNGN----SCQFLGGDEskskkktatlkaSNEEGMLSF  2149
               SCKPE+GEILNFG+S TK++ NGN       F  G+E+K+KK++   + SNEEGMLSF
Sbjct  366   --SCKPESGEILNFGDS-TKKSANGNLFSGQSHFGAGEENKNKKRSPASRGSNEEGMLSF  422

Query  2148  GSGMVKssggigigds-------sDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRKP  1993
              SG +  +    +  S       SDHSDLEASVVKEA+S R VE     EKRP+KRGRKP
Sbjct  423   VSGTILPAASGAMKSSGCVGEDSSDHSDLEASVVKEAESSRVVE----PEKRPKKRGRKP  478

Query  1992  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLET  1813
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL+ 
Sbjct  479   ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQN  538

Query  1812  SESYIDDLKIQAQSLKKELSTKEPRHPDPNPKK-----TTTPHKIPDMDVDVKVMGWDAM  1648
             +E+  +DLK Q + LKKEL++++   P P P +     + T  KI D+D+DVK++GWDAM
Sbjct  539   TETDREDLKSQIEDLKKELASEDSWRPGPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAM  598

Query  1647  IRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLAL  1468
             +RIQC KKNHPAARLMVALK+LDLEV HASVSV+NDLMIQQA VKMG+RLY ++QLR+AL
Sbjct  599   VRIQCNKKNHPAARLMVALKELDLEVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIAL  658

Query  1467  ISKLAET  1447
              S++AET
Sbjct  659   TSRVAET  665



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/600 (65%), Positives = 462/600 (77%), Gaps = 39/600 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRL  LI+GARE+WTYAIFWQ+SVVD+ GPS+LGWGDGYYKGEE+ GKR + AS
Sbjct  92    NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENTGKR-KTAS  150

Query  3015  SPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             SPAEQ HRKKVLRELNSLISGP A+TD++VDEEVTDTEWFFL+SMT +F+NGSGLPGQA 
Sbjct  151   SPAEQEHRKKVLRELNSLISGPQATTDDAVDEEVTDTEWFFLISMTQNFVNGSGLPGQAL  210

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              SSSP+W++G D+L +S CERARQAQ FGL+T+VCIPSSNGVVELGST+LI QS DLMNK
Sbjct  211   YSSSPVWVTGSDRLAASHCERARQAQGFGLQTLVCIPSSNGVVELGSTELIFQSSDLMNK  270

Query  2658  VRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVN--------TSVQEN  2503
             VR+LFNFN    G  +GS SWA   +NDPSALWLT+P SSSG DV         T+ Q +
Sbjct  271   VRILFNFN----GMETGSGSWALA-DNDPSALWLTDP-SSSGPDVKDSLNNNSATNAQAS  324

Query  2502  SIPSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrn  2326
             S PS+ + K++VF NEN   SST   +   Q   +  RELNFSEFG++G++N        
Sbjct  325   SFPSTLTSKQLVFSNENP-NSSTLTENPQLQSQGFVARELNFSEFGYNGSSNGR------  377

Query  2325  gNSSHSCKPEAGEILNFGESVTKR--NGNGNSCQFLGGDEskskkktatlkaSNEEGMLS  2152
               +S +CK E GEILNFGES  +   +GNGN    L   E KSKK+++  + SN+EGMLS
Sbjct  378   --NSGTCKRETGEILNFGESSRRSVCSGNGN---LLAVQEDKSKKRSSKSRGSNDEGMLS  432

Query  2151  FGSGMV----KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             F SG++               SDHSDLEASVVKE +S  V      EKRPRKRGRKPANG
Sbjct  433   FTSGVILPSSGVKADNVGAVESDHSDLEASVVKEVESSRV---VDPEKRPRKRGRKPANG  489

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+++ ES
Sbjct  490   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQSVES  549

Query  1803  YIDDLKIQAQSLKKELSTKEPRH-PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTK  1627
               ++L+ Q + +KKEL TK+ R  P P      + +   DMD+DVK++GWDAMIR+QC+K
Sbjct  550   DKEELRSQLELVKKELGTKDMRSAPPPAHDLNMSSNVKVDMDIDVKIIGWDAMIRVQCSK  609

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             KNHPAA+LM+AL++LDL+V HASVSV+NDLMIQQA VKM  R Y+QDQLR+ALISK+AET
Sbjct  610   KNHPAAKLMLALRELDLDVHHASVSVVNDLMIQQATVKMEGRFYSQDQLRVALISKVAET  669



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/605 (64%), Positives = 466/605 (77%), Gaps = 41/605 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQTLIDGARE WTYAIFWQ+SVVDFA PS+LGWGDGYYKGEEDK KR   + 
Sbjct  70    NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFASPSVLGWGDGYYKGEEDKNKRKTASF  129

Query  3015  SP---AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SP    EQAHRKKVLRELNSLISG      +++VDEEVTDTEWFFL+SMT SF+NGSGLP
Sbjct  130   SPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGLP  189

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G A  SSSPIW++G ++L +S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI Q+ D
Sbjct  190   GLAMYSSSPIWVTGAERLAASHCERARQAQGFGLQTIVCIPSANGVVELGSTELIFQTAD  249

Query  2670  LMNKVRVLFNFNNPDMGSI--SGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             LMNKV+VLFNFN  DMG+   SGS S A   E DPSALWLT+P +SS V+V  S   N++
Sbjct  250   LMNKVKVLFNFN-IDMGATTGSGSGSCAIHAEPDPSALWLTDP-ASSAVEVKDS---NTV  304

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             PSS S K++VF NENS      N + +SQ +Q +FTRELNFSE+GFDG+N  + N     
Sbjct  305   PSSNSSKQLVFGNENS-----ENGNQNSQQTQGFFTRELNFSEYGFDGSNTRNGNAN---  356

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG----------DEskskkktatlkaS  2173
              SS SCKPE+GEILNFG+S  +   + N   F G           +++K+KK++   + S
Sbjct  357   -SSRSCKPESGEILNFGDSTKRSASSANGSLFSGQSQFGPGSAEENKNKNKKRSPASRGS  415

Query  2172  NEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             N+EGMLSF SG++    ++G  G G  SD SDLEASVVKEADS  V      EK+PRKRG
Sbjct  416   NDEGMLSFVSGVILPSSNTGKSGGGGDSDQSDLEASVVKEADSSRV---VDPEKKPRKRG  472

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA+INELKSK
Sbjct  473   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKSK  532

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             ++ S+S  ++L+ Q +SL+KEL+ K   +  P P  +    KI DMD+DVKV+GWDAMIR
Sbjct  533   VQNSDSDKEELRNQIESLRKELANKGSNYTGPPP--SNQDLKILDMDIDVKVIGWDAMIR  590

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             IQ  KKNHPAARLM AL +LDL+V HASVSV+N+LMIQQA VKMG+RLY Q+QLR++L S
Sbjct  591   IQSNKKNHPAARLMAALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQEQLRISLTS  650

Query  1461  KLAET  1447
             ++AE+
Sbjct  651   RIAES  655



>ref|XP_009587276.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
 gb|ADH04270.1| MYC2b transcription factor [Nicotiana tabacum]
Length=658

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/606 (65%), Positives = 464/606 (77%), Gaps = 40/606 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQTLIDGARE WTYAIFWQ+SVVDF  PS+LGWGDGYYKGEEDK KR   A 
Sbjct  69    NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFVSPSVLGWGDGYYKGEEDKNKRKTAAF  128

Query  3015  SP---AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SP    EQ HRKKVLRELNSLISG      +++VDEEVTDTEWFFL+SMT SF+NGSGLP
Sbjct  129   SPDFITEQEHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGLP  188

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G A  SSSPIW++G+++L +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI QS D
Sbjct  189   GLAMYSSSPIWVTGRERLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIFQSAD  248

Query  2670  LMNKVRVLFNFNNPDMGSI--SGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             LMNKV++LF+FN  DMG+   SGS S A   E DPS LWLT+P SS  V+V  S   N++
Sbjct  249   LMNKVKILFDFN-IDMGATTGSGSGSCAIQAEPDPSTLWLTDPPSSV-VEVKDS--SNTV  304

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             PSS S K++VF NENS      N + +SQ +Q +FTRELNFSE+GFDG+N    N   N 
Sbjct  305   PSSNSSKQLVFGNENS-----ENVNQNSQQTQGFFTRELNFSEYGFDGSNTRSGNGNVN-  358

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG-----------DEskskkktatlka  2176
              SS SCKPE+GEILNFG+S TKRN +  +     G           +++K+KK++   + 
Sbjct  359   -SSRSCKPESGEILNFGDS-TKRNASSANGSLFSGQSQFGPGPAEENKNKNKKRSPASRG  416

Query  2175  SNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKR  2005
             SNEEGMLSF SG++    ++G  G G  SDHSDLEASVVKEADS  V      EKRPRKR
Sbjct  417   SNEEGMLSFVSGVILPSSNTGKSGGGGDSDHSDLEASVVKEADSSRV---VDPEKRPRKR  473

Query  2004  GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKS  1825
             GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA+INELKS
Sbjct  474   GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKS  533

Query  1824  KLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMI  1645
             K++ S+S  D+L+ Q +SL+ EL+ K   +  P P       KI DMD+DVKV+GWDAMI
Sbjct  534   KVQNSDSDKDELRNQIESLRNELANKGSNYTGPPPPNQDL--KIVDMDIDVKVIGWDAMI  591

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             RIQ  KKNHPAARLM AL +LDL+V HASVSV+N+LMIQQA VKMG+RLY Q+QLR++L 
Sbjct  592   RIQSNKKNHPAARLMAALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQEQLRISLT  651

Query  1464  SKLAET  1447
             S++AE+
Sbjct  652   SRIAES  657



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/625 (64%), Positives = 469/625 (75%), Gaps = 56/625 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGA+E WTYAIFWQ+SVVD+ GPS+LGWGDGYY+GEEDKGKR  P S
Sbjct  82    NQETLQQRLQTLIDGAQEYWTYAIFWQSSVVDYGGPSVLGWGDGYYRGEEDKGKRKNPLS  141

Query  3015  SPA-----EQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
             S +     EQ HRKKVLRELNSLI+GP  S+D++VDEEVTDTEWFFL+SMT SF+NGSGL
Sbjct  142   SSSTNSLLEQEHRKKVLRELNSLIAGPQGSSDDAVDEEVTDTEWFFLISMTQSFVNGSGL  201

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PGQA  +SSP+W++G D+L S+ CERA+QAQ FGL+T+VCIPS+NGVVELGST+LI QS 
Sbjct  202   PGQALYNSSPVWVAGADRLASTHCERAQQAQGFGLQTVVCIPSANGVVELGSTELIFQSS  261

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSV------  2512
             DLMNKVRVLFNFNN DMGS SGS SW   PE+DPSALWLT+P SSS   V  SV      
Sbjct  262   DLMNKVRVLFNFNNMDMGSGSGSGSWPVQPESDPSALWLTDP-SSSAAGVKESVNNNNNT  320

Query  2511  --QENSIPSSS-VKEIVFRNENSIPSST--------GNNHHDS--QPSQYFTRELNFSEF  2371
               Q +SIPSS+  K+++F N+N+  SST         N HH+S  Q   ++TRELNFSE+
Sbjct  321   TGQGSSIPSSANNKQMLFGNDNNPSSSTLTDNPRNILNAHHNSSQQSGGFYTRELNFSEY  380

Query  2370  GFDGAnnnhnndlrngNSSHSCKPEAGEILNF-GESVTKRNGNGNSCQFLG------GDE  2212
             GF+G          N   + +CKPE GEILNF GES  KR+ + N   F G      GDE
Sbjct  381   GFEG----------NSVRNATCKPETGEILNFGGESTAKRSCSANGNLFSGQSPFGVGDE  430

Query  2211  skskkktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADSRAV  2044
             SKSKK++   + SN+EGMLSF SG++          G G  SDHSDLEASV KEADS  V
Sbjct  431   SKSKKRSPVSRGSNDEGMLSFTSGVILPSSGVVKSSGGGGDSDHSDLEASVAKEADSSRV  490

Query  2043  ETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  1864
                   EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL
Sbjct  491   ---VDPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  547

Query  1863  LGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH---PDPNPKKTTTPH--  1699
             LGDAI+YINELKSKL   ES  ++L+ Q  SLKKEL++KE R+   P P+       H  
Sbjct  548   LGDAISYINELKSKLHNMESDKEELRNQIDSLKKELTSKEARNFAPPPPDKDLKLASHQG  607

Query  1698  -KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
              K  DMD+DVK++GW+AMIR+Q +K NHPAAR+M ALKDLDLE+ HASVSV+NDLMIQQ 
Sbjct  608   SKSLDMDIDVKIIGWEAMIRVQSSKNNHPAARIMGALKDLDLELLHASVSVVNDLMIQQN  667

Query  1521  AVKMGTRLYNQDQLRLALISKLAET  1447
              V+MG R Y Q+QL++AL S++AET
Sbjct  668   TVRMGKRFYTQEQLKIALTSRVAET  692



>gb|AAQ14332.1|AF283507_1 MYC2 [Catharanthus roseus]
Length=699

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/628 (63%), Positives = 479/628 (76%), Gaps = 67/628 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKR--NRP  3022
             NQE LQQRLQTLIDGARE+WTYAIFWQ+SVV+FAGPS+LGWGDGYYKGEEDKGKR  +  
Sbjct  84    NQENLQQRLQTLIDGARESWTYAIFWQSSVVEFAGPSVLGWGDGYYKGEEDKGKRKNSSS  143

Query  3021  ASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             ASS AEQ HRKKVLRELNSLI+GP  + D++VDEEVTDTEWFFL+SMT SF++GSGLPGQ
Sbjct  144   ASSFAEQEHRKKVLRELNSLIAGPQGTADDAVDEEVTDTEWFFLISMTQSFVSGSGLPGQ  203

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +S+P+W++G  +L  S C+RARQAQ+FGL+T+VCIPS+NGVVELGST+LI QS DLM
Sbjct  204   ALYNSNPVWVTGAGRLAVSHCDRARQAQSFGLQTLVCIPSANGVVELGSTELIFQSSDLM  263

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDV--------NTSVQ  2509
             NKVR+LFNFNN D+GS SG   W   PENDPS+LWLT+P S SGV V        NTSVQ
Sbjct  264   NKVRILFNFNNIDLGSSSGP--W---PENDPSSLWLTDP-SPSGVGVKEGVNTNNNTSVQ  317

Query  2508  ENSIPSSSVKEIVFRNENSIPSST--------------GNNHHDSQPSQ--YFTRELNFS  2377
              NSIPS + +++VF N ++ P+++               N+  ++Q  Q  +FTRELNFS
Sbjct  318   GNSIPSGNKQQLVFGNNDNHPTTSTLTDHPGAGAVNSYNNSSQNAQQPQGSFFTRELNFS  377

Query  2376  EFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN---GNGN----SCQFLG  2221
             E+GF+          R+   + +CKPE+GEILNFG ESVTK+N   GNGN      QF  
Sbjct  378   EYGFE----------RSSVKNGNCKPESGEILNFGGESVTKKNSVSGNGNLFSVQSQFGA  427

Query  2220  GDEskskkkta-tlkaSNEEGMLSFGSGMV------KssggigigdssDHSDLEASVVKE  2062
             G+E+K+KK+ +   + SN+EGMLSF SG+V        S G G G  SDHSDLEASVVKE
Sbjct  428   GEENKNKKRPSPVSRGSNDEGMLSFTSGVVLPSTGVVKSSGGGGGGDSDHSDLEASVVKE  487

Query  2061  ADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSK  1882
             A+S  V      EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSK
Sbjct  488   AESSRV---VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSK  544

Query  1881  MDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPR---HPDPNPKKT  1711
             MDKASLLGDAI+YINELK+KL+T+E+  D+LK Q  SLKKEL++KE R    PD +  K+
Sbjct  545   MDKASLLGDAISYINELKAKLQTTETDKDELKNQLDSLKKELASKESRLLSSPDQD-LKS  603

Query  1710  TTPHKIP--DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +    +   DMD+DVK++G +AMIR+Q +K NHPAAR+M ALKDLDLE+ HASVSV+NDL
Sbjct  604   SNKQSVGNLDMDIDVKIIGREAMIRVQSSKNNHPAARVMGALKDLDLELLHASVSVVNDL  663

Query  1536  MIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             MIQQ  V+MG+R Y Q+QLR+AL S++A
Sbjct  664   MIQQNTVRMGSRFYTQEQLRIALTSRIA  691



>ref|XP_009800420.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=659

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/605 (64%), Positives = 465/605 (77%), Gaps = 38/605 (6%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQTLIDGARE WTYAIFWQ+SVVDFA PS+LGWGDGYYKGEEDK KR   + 
Sbjct  70    NQESLQQRLQTLIDGAREGWTYAIFWQSSVVDFASPSVLGWGDGYYKGEEDKNKRKTASF  129

Query  3015  SP---AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SP    EQAHRKKVLRELNSLISG      +++VDEEVTDTEWFFL+SMT SF+NGSGLP
Sbjct  130   SPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGLP  189

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G A  SSSPIW++G ++L +S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI Q+ D
Sbjct  190   GLAMYSSSPIWVTGTERLAASHCERARQAQGFGLQTIVCIPSANGVVELGSTELIFQTAD  249

Query  2670  LMNKVRVLFNFNNPDMGSI--SGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             LMNKV+VLFNFN  DMG+   SGS S A   E DPSALWLT+P SS  V+V  S   N++
Sbjct  250   LMNKVKVLFNFN-IDMGATTGSGSGSCAIQAEPDPSALWLTDPASSV-VEVKDS--SNTV  305

Query  2496  PS-SSVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             PS ++ K++VF NENS      N + +SQ +Q +FTRELNFSE+GFDG+N  + N   N 
Sbjct  306   PSRNTSKQLVFGNENS-----ENGNQNSQQTQGFFTRELNFSEYGFDGSNTRYGNGNAN-  359

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG----------DEskskkktatlkaS  2173
              SS SCKPE+GEILNFG+S  +   + N   F G           +++K+KK++   + S
Sbjct  360   -SSRSCKPESGEILNFGDSTKRSACSANGSLFSGQSQFGPGPAEENKNKNKKRSPASRGS  418

Query  2172  NEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             N+EG+LSF SG++    ++G  G G  SD SDLEASVVKEADS  V      EK+PRKRG
Sbjct  419   NDEGILSFVSGVILPSSNTGKSGGGGDSDQSDLEASVVKEADSSRV---VDPEKKPRKRG  475

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA+INELKSK
Sbjct  476   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKSK  535

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             ++ S+S  ++L+ Q +SL+ EL+ K   +  P P  +    KI DMD+DVKV+GWDAMIR
Sbjct  536   VQNSDSDKEELRNQIESLRNELANKGSNYTGPPP--SNQELKIVDMDIDVKVIGWDAMIR  593

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             IQ  KKNHPAARLM AL +LDL+V HASVSV+N+LMIQQA VKMG+RLY Q+QLR++L S
Sbjct  594   IQSNKKNHPAARLMTALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQEQLRISLTS  653

Query  1461  KLAET  1447
             ++AE+
Sbjct  654   RIAES  658



>gb|ADH04262.1| bHLH1 transcription factor [Nicotiana benthamiana]
Length=680

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/609 (66%), Positives = 471/609 (77%), Gaps = 41/609 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLIDGARETWTYAIFWQ+SVVD   P LL WGDGYYKGEEDK  R    S
Sbjct  86    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPILLVWGDGYYKGEEDKANRKLAVS  145

Query  3015  SPA---EQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             SPA   EQ HRKKVLRELNSLISG    T+++VDEEVTDTEWFFL+SMT SF+NGSGLPG
Sbjct  146   SPAYIAEQEHRKKVLRELNSLISGTQTGTNDAVDEEVTDTEWFFLISMTPSFVNGSGLPG  205

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  +SSPIW+ G +KL +S CERARQAQ FGL+TMVCIPS+NGVVELGST+LI+QS D+
Sbjct  206   QALYNSSPIWVFGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQSSDI  265

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSG--VDVNTSVQENSIP  2494
             +NKVRVLFNFNN D+GS     SWA  PE+DPSALWLT+P+ ++    D+NT V+ NS+P
Sbjct  266   INKVRVLFNFNN-DLGS----GSWAVQPESDPSALWLTDPSPAAVPVKDLNT-VEANSVP  319

Query  2493  -SSSVKEIVFRNENSIPSSTGNNHHDSQPSQ--YFTRELNFSEFGFDGAnnnhnndlrng  2323
              S+S K++VF NEN+  S      H SQ     +FTRELNFSEFGFDG NN  N +    
Sbjct  320   PSNSSKQLVFDNENNGQSCDNQQQHHSQQQTQGFFTRELNFSEFGFDGCNNIRNGN----  375

Query  2322  NSSHSCKPEAGEILNFGESVTKR-NGNGNSCQ--FLGGDEskskkktatlkaSNEEGMLS  2152
              SS SCKPE+GEILNF +S  K  NGN  SCQ  F  G+E+K+KK++A  + SNEEGMLS
Sbjct  376   -SSVSCKPESGEILNFCDSPKKSANGNLFSCQSHFGAGEENKNKKRSAASRGSNEEGMLS  434

Query  2151  FGSGMVKssggigigd-------ssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRK  1996
             F SG +  +    +         SSDHSDLEAS+VKEA+S R VE     EKRP+KRGRK
Sbjct  435   FVSGTILPAASGAMKSIGCVAEGSSDHSDLEASLVKEAESSRVVE----PEKRPKKRGRK  490

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL+
Sbjct  491   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQ  550

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNP------KKTTTPHKIPDMDVDVKVMGWD  1654
              +E+  ++LK Q + LKKEL++K+ R P P P        + T  K+ D+D+DVKV+GWD
Sbjct  551   NTETDRENLKSQIEDLKKELASKDSRRPGPPPPNQDHKMSSHTGSKVVDVDIDVKVIGWD  610

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMI +QC K NHPAARLMVALK+LDL+V HASVSV+NDLMIQQA VKMG+RLY ++QLR+
Sbjct  611   AMISVQCNKNNHPAARLMVALKELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRI  670

Query  1473  ALISKLAET  1447
             AL S++AET
Sbjct  671   ALTSRVAET  679



>gb|ADH04269.1| MYC2a transcription factor [Nicotiana tabacum]
Length=659

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/605 (64%), Positives = 464/605 (77%), Gaps = 38/605 (6%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQTLIDGAR+ WTYAIFWQ+SVVDFA PS+LGWGDGYYKGEEDK KR   + 
Sbjct  70    NQESLQQRLQTLIDGARKGWTYAIFWQSSVVDFASPSVLGWGDGYYKGEEDKNKRKTASF  129

Query  3015  SP---AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SP    EQAHRKKVLRELNSLISG      +++VDEEVTDTEWFFL+SMT SF+NGSGLP
Sbjct  130   SPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGLP  189

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G A  SSSPIW++G ++L  S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI Q+ D
Sbjct  190   GLAMYSSSPIWVTGTERLAVSHCERARQAQGFGLQTIVCIPSANGVVELGSTELIFQTAD  249

Query  2670  LMNKVRVLFNFNNPDMGSI--SGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             LMNKV+VLFNFN  DMG+   SGS S A   E DPSALWLT+P SS  V+V  S   N++
Sbjct  250   LMNKVKVLFNFN-IDMGATTGSGSGSCAIQAEPDPSALWLTDPASSV-VEVKDS--SNTV  305

Query  2496  PS-SSVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             PS ++ K++VF NENS      N + +SQ +Q +FTRELNFSE+GFDG+N  + N   N 
Sbjct  306   PSRNTSKQLVFGNENS-----ENVNQNSQQTQGFFTRELNFSEYGFDGSNTRYGNGNAN-  359

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG----------DEskskkktatlkaS  2173
              SS SCKPE+GEILNFG+S  +   + N   F G           +++K+KK++   + S
Sbjct  360   -SSRSCKPESGEILNFGDSTKRSACSANGSLFSGQSQFGPGPAEENKNKNKKRSPASRGS  418

Query  2172  NEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             N+EG+LSF SG++    ++G  G G  SD SDLEASVVKEADS  V      EK+PRKRG
Sbjct  419   NDEGILSFVSGVILPSSNTGKSGGGGDSDQSDLEASVVKEADSSRV---VDPEKKPRKRG  475

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA+INELKSK
Sbjct  476   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKSK  535

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             ++ S+S  +DL+ Q +SL+ EL+ K   +  P P  +    KI DMD+DVKV+GWDAMIR
Sbjct  536   VQNSDSDKEDLRNQIESLRNELANKGSNYTGPPP--SNQELKIVDMDIDVKVIGWDAMIR  593

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             IQ  KKNHPAARLM AL +LDL+V HASVSV+N+LMIQQA VKMG+RLY Q+QLR++L S
Sbjct  594   IQSNKKNHPAARLMTALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQEQLRISLTS  653

Query  1461  KLAET  1447
             ++AE+
Sbjct  654   RIAES  658



>gb|ADH04263.1| bHLH2 transcription factor [Nicotiana benthamiana]
Length=657

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/605 (63%), Positives = 459/605 (76%), Gaps = 40/605 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQTLIDGARE WTYAIFWQ+SVVDF   S+LGWGDGYYKGEEDK KR   + 
Sbjct  70    NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFTTHSVLGWGDGYYKGEEDKNKRKTASF  129

Query  3015  SP---AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SP    EQAHRKKVLRELN LISG      +++VDEEVTDTEWFFL+SMT SF+NGSGLP
Sbjct  130   SPDFITEQAHRKKVLRELNCLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGLP  189

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G A  SSSPIW++G ++L +S CERARQAQ FGL+T+VCIPS NGVVELGST+LI Q+ D
Sbjct  190   GLAMYSSSPIWVTGAERLAASHCERARQAQGFGLQTIVCIPSGNGVVELGSTELIFQTAD  249

Query  2670  LMNKVRVLFNFNNPDMGSI--SGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             LMNKV+VLFNFN  DMG+   SGS S A   E D SALWLT+P +SS V+V  S   N++
Sbjct  250   LMNKVKVLFNFN-IDMGATTGSGSGSCAIQAEPDTSALWLTDP-ASSAVEVKDS--SNTV  305

Query  2496  PSS-SVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrng  2323
             PSS S K++VF NENS      N + +SQ +Q +FTRELNFSE+GFDG+N  + N     
Sbjct  306   PSSNSSKQLVFGNENS-----ENGNQNSQQTQGFFTRELNFSEYGFDGSNTRNGNVN---  357

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG----------DEskskkktatlkaS  2173
              SS SC+PE+GEILNFG+S  +   + N   F G           +++K+KK++   + S
Sbjct  358   -SSRSCQPESGEILNFGDSTKRSASSANGSLFSGQSQFGPGPAEENKNKNKKRSPASRGS  416

Query  2172  NEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             N+EGMLSF SG++    ++G  G G  SD SDLEASVVKEADS  V      EK+PRKRG
Sbjct  417   NDEGMLSFVSGVILPSSNTGKSGGGGDSDQSDLEASVVKEADSSRV---VDPEKKPRKRG  473

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA+INELKSK
Sbjct  474   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKSK  533

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             ++ S+S  ++L+ Q +SL+ EL+ K   +  P P       KI DMD+DVKV+GWDAMIR
Sbjct  534   VQNSDSDKEELRNQIESLRNELANKGSNYTGPPP--LNQELKIVDMDIDVKVIGWDAMIR  591

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             IQ  KKNHPAA+LM AL +LDL+V HASVSV+N+LMIQQA VKMG+RLY Q+QLR++L S
Sbjct  592   IQSNKKNHPAAKLMAALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQEQLRISLTS  651

Query  1461  KLAET  1447
             ++AE+
Sbjct  652   RIAES  656



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/618 (60%), Positives = 451/618 (73%), Gaps = 53/618 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LI+GARE+WTYAIFWQ+SV DF+G SLLGWGDGYYKGEEDKGKR    S
Sbjct  63    NQETLQQRLQALIEGARESWTYAIFWQSSV-DFSGASLLGWGDGYYKGEEDKGKRKMTPS  121

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvdeevtd-tEWFFLVSMTHSFINGSGLPGQAF  2839
             S +EQ HRKKVLRELNSLISG AS+ +   +E    TEWFFLVSMT SF+NG+GLPGQA 
Sbjct  122   SVSEQEHRKKVLRELNSLISGTASSSDDAVDEEVTDTEWFFLVSMTQSFVNGAGLPGQAL  181

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              +SSP+W+ G ++L+SSPCERARQAQ FGL+TMVCIPS+NGVVELGST+LI QS DLMNK
Sbjct  182   FNSSPVWVVGTERLMSSPCERARQAQVFGLQTMVCIPSANGVVELGSTELIYQSSDLMNK  241

Query  2658  VRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS---  2488
             VRVLFNFNN ++GS    A+     E+DPS+LW+++PTS+  V++  SV   +  +S   
Sbjct  242   VRVLFNFNNLEVGSWPIGAAAPDQGESDPSSLWISDPTSN--VEIKDSVNATATGASNPI  299

Query  2487  ----SVKEIVFRNENSIPSSTGNNHHDS-----------QPSQYFTRELNFSEFGFDGAn  2353
                 + K I F N    PSS+    + S               +FTRELNFSEFGFDG  
Sbjct  300   GNQQNSKSIQFEN----PSSSSLTENPSIMHNPQQQQQIHTQGFFTRELNFSEFGFDG--  353

Query  2352  nnhnndlrngNSSHSCKPEAGEILNFGE---SVTKRNGNGNSCQFLGGDEskskkktatl  2182
                  +     + HS KPE+GEILNFG+   S    NGN  S       E   K+++ T 
Sbjct  354   -----NNGRNGNLHSLKPESGEILNFGDSKRSSCSANGNMFSGHSQVVAEENKKRRSPTS  408

Query  2181  kaSNEEGMLSFGSGMVKssggigigd----ssDHSDLEASVVKEAD-SRAVETLAAAEKR  2017
             + S EEGMLSF SG++  S  +         SDHSDLEASVV+EAD SR VE     EKR
Sbjct  409   RGSAEEGMLSFTSGVILPSSCVVKSSGGGGDSDHSDLEASVVREADSSRVVE----PEKR  464

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YIN
Sbjct  465   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  524

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH-----PDPNPKKTTTPH---KIPDMD  1681
             EL++KL+++ES  +DL+ +  S+KKEL++K+ ++     P P+     + H   K+ +MD
Sbjct  525   ELRTKLQSAESDKEDLQKEVNSMKKELASKDSQYSGSSRPPPDQDLKMSNHHGSKLVEMD  584

Query  1680  VDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTR  1501
             +DVK++GWDAMIRIQC+KKNHPAA+LM ALK+LDL+V HASVSV+NDLMIQQA VKMG+R
Sbjct  585   IDVKIIGWDAMIRIQCSKKNHPAAKLMGALKELDLDVNHASVSVVNDLMIQQATVKMGSR  644

Query  1500  LYNQDQLRLALISKLAET  1447
              Y QDQLRLAL SK A++
Sbjct  645   FYTQDQLRLALSSKFADS  662



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/584 (63%), Positives = 432/584 (74%), Gaps = 53/584 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRL  LI+GARE+WTYAIFWQ+SVVD+ GPS+LGWGDGYYKGEE+KGKR + AS
Sbjct  68    NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENKGKR-QTAS  126

Query  3015  SPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             SPAEQ HRKKVLRELNSLISGP  + D++VDE+VTDTEWFFL+SMT SF+NGSGLPGQA 
Sbjct  127   SPAEQDHRKKVLRELNSLISGPPTAVDDAVDEDVTDTEWFFLISMTQSFVNGSGLPGQAL  186

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              SSSP+W++G D+L +S C+RARQA  FGL+T+VC+P SNGVVELGST+ I QS DLMNK
Sbjct  187   YSSSPVWVTGTDRLAASHCDRARQAHGFGLQTLVCVPCSNGVVELGSTEPIFQSSDLMNK  246

Query  2658  VRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSVK  2479
             VRVLFNFN   + + S SASWA   +NDPSALWLT+P+SS+  D+NTS    ++P     
Sbjct  247   VRVLFNFNFNGIETCSASASWALGGDNDPSALWLTDPSSSTA-DINTSA---TLP-----  297

Query  2478  EIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrngNSSHSCK  2302
              I F NEN  PSS+      +  SQ +F +ELNFSE GF               +S +CK
Sbjct  298   -IKF-NENPNPSSSSLTESPNVQSQGFFNKELNFSEIGF--------------RNSVNCK  341

Query  2301  PEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMVKssg  2122
              E+GEILNFGES  +             D    K+       + EEGMLSF SG++    
Sbjct  342   RESGEILNFGESAKR------------SDVVVVKESKKRSPMAAEEGMLSFTSGVL--LK  387

Query  2121  gigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQR  1942
                    SDHSDLEASVVKEADS  V      EKRPRKRGRKPANGREEPLNHVEAERQR
Sbjct  388   ADNNTIESDHSDLEASVVKEADSSRV---VNPEKRPRKRGRKPANGREEPLNHVEAERQR  444

Query  1941  REKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK  1762
             REKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK++ +ES  D+L+ + +SLK+
Sbjct  445   REKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESDKDELRSELESLKR  504

Query  1761  ELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDL  1582
                          P     P KI DMD+DVK++GWDAMIR+QC+KKNHPAA+LMVAL++L
Sbjct  505   ATPAPA-------PAPAPAPAKI-DMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALREL  556

Query  1581  DLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             DL+V HASVSV+ DLMIQQA VKM  RLY Q+QLRLALISK+AE
Sbjct  557   DLDVHHASVSVVKDLMIQQATVKMEGRLYTQEQLRLALISKVAE  600



>gb|AHN63211.1| transcription factor MYC2 [Salvia miltiorrhiza f. alba]
Length=592

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/586 (62%), Positives = 431/586 (74%), Gaps = 56/586 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLI-DGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA  3019
             NQETLQQRL +LI D A E+WTYAIFWQ+SVVD+ GPS+LGWGDGYYKGEE+KGKR + A
Sbjct  59    NQETLQQRLLSLIEDAAHESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENKGKR-QTA  117

Query  3018  SSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SSPAEQ HRKKVLRELNSLISGP  + D++VDE+VTDTEWFFL+SMT SF+NGSGLPGQA
Sbjct  118   SSPAEQDHRKKVLRELNSLISGPPTAVDDAVDEDVTDTEWFFLISMTQSFVNGSGLPGQA  177

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
               SSSP+W++G D+L +S C+RARQA  FGL+T+VC+P SNGVVELGST+ I QS DLMN
Sbjct  178   LYSSSPVWVTGTDRLAASHCDRARQAHGFGLQTLVCVPCSNGVVELGSTEPIFQSSDLMN  237

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
             KVRVLFNFN   + + S SASWA   +NDPSALWLT+P+SS+  D+NTS    ++P    
Sbjct  238   KVRVLFNFNFNGIETSSASASWALGGDNDPSALWLTDPSSSTA-DINTSA---TLP----  289

Query  2481  KEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrngNSSHSC  2305
               I F NEN  PSS+      +  SQ +F +ELNFSE GF               +S +C
Sbjct  290   --IKF-NENPNPSSSSLTESPNVQSQGFFNKELNFSEIGF--------------RNSVNC  332

Query  2304  KPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMVKss  2125
             K E+GEILNFGES  +             D    K+       + EEGMLSF SG++   
Sbjct  333   KRESGEILNFGESAKR------------SDVVVVKESKKRSPMAAEEGMLSFTSGVL--L  378

Query  2124  ggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQ  1945
                     SDHSDLEASVVKEADS  V      EKRPRKRGRKPANGREEPLNHVEAERQ
Sbjct  379   KADNNTIESDHSDLEASVVKEADSSRV---VNPEKRPRKRGRKPANGREEPLNHVEAERQ  435

Query  1944  RREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLK  1765
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK++ +ES  D+L+ + +SLK
Sbjct  436   RREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESDKDELRSELESLK  495

Query  1764  KELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKD  1585
             +                   P KI DMD+DVK++GWDAMIR+QC+KKNHPAA+LMVAL++
Sbjct  496   RATPAP---------APAPAPAKI-DMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRE  545

Query  1584  LDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             LDL+V HASVSV+ DLMIQQA VKM  RLY Q+QLRLALISK+AE+
Sbjct  546   LDLDVHHASVSVVKDLMIQQATVKMEGRLYTQEQLRLALISKVAES  591



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/615 (60%), Positives = 452/615 (73%), Gaps = 52/615 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LI+GARE+WTYAIFWQ+S  D++G S+LGWGDGYYKGEEDKGK    ++
Sbjct  69    NQETLQQRLQALIEGARESWTYAIFWQSSY-DYSGASVLGWGDGYYKGEEDKGKGKSKST  127

Query  3015  SP--AEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S   AEQ HRKKVLRELNSLISGP A TD++VDEEVTDTEWFFLVSMT SF+NG GLPGQ
Sbjct  128   SSSIAEQEHRKKVLRELNSLISGPTAITDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPGQ  187

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF + SP+W++G ++L SS CERARQ Q FGL+T+VCIPS+NGVVELGST+LI QS DLM
Sbjct  188   AFFNGSPVWVAGLERLASSSCERARQGQIFGLQTLVCIPSANGVVELGSTELIYQSIDLM  247

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKVRVLFNFN+ + GS    A+     ENDPS+LW+++P S SG+++      +++PSS 
Sbjct  248   NKVRVLFNFNSLEAGSWPMGAN-PDQGENDPSSLWISDP-SQSGIEIKDG--NSTVPSSG  303

Query  2484  VKEI-------------VFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEF-GFDGAnnn  2347
             V  +             V  N + +  +    H  +Q   +FTRELNF E+ GFDG    
Sbjct  304   VGGVNNNSQHGSKGIQSVNPNSSCVTDNPSGTHMQNQQQSFFTRELNFGEYNGFDG----  359

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESV-TKRNGNGN----SCQFLGGDEskskkktatl  2182
                      +++  KPE+GEILNFGES  +  + NGN      QF   +E  +KK++ T 
Sbjct  360   ------RNGNTNVLKPESGEILNFGESKRSSYSANGNLFPGHSQF-ATEEKNTKKRSPTS  412

Query  2181  kaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKR  2017
             + SNEEGMLSF SG+V          G    SDHSDLEASVV+E +S R VE     EKR
Sbjct  413   RGSNEEGMLSFTSGVVLPSSGGVKSSGGTGDSDHSDLEASVVRETESSRVVE----PEKR  468

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI 
Sbjct  469   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIK  528

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPK---KTTTPH--KIPDMDVDV  1672
             EL++KL+T+ES  ++L+ + +S+KKE  +K+ R   P P    K +  H  K  DMD+DV
Sbjct  529   ELRTKLQTAESDKEELEKEVESMKKEFLSKDSRPGSPPPDKELKMSNNHGSKAIDMDIDV  588

Query  1671  KVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYN  1492
             K++GWDAMIRIQC+KKNHPAARLM ALKDLDL+V HASVSV+NDLMIQQA VKMG+R+Y 
Sbjct  589   KIIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQATVKMGSRIYT  648

Query  1491  QDQLRLALISKLAET  1447
             Q+QLRLAL +K+ ET
Sbjct  649   QEQLRLALSTKVGET  663



>ref|XP_010275210.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=666

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/621 (61%), Positives = 448/621 (72%), Gaps = 57/621 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ+TLQQRLQTLI+GARE+WTYAIFWQ+SV D +G SLLGWGDGYYKGEEDK KR R   
Sbjct  62    NQDTLQQRLQTLIEGARESWTYAIFWQSSV-DMSGASLLGWGDGYYKGEEDKMKR-RVTV  119

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             SPAEQ HRKKVLRELNSLISG PAS DE VDEEVTDTEWFFLVSMT SFINGSGLPGQAF
Sbjct  120   SPAEQEHRKKVLRELNSLISGVPASADEPVDEEVTDTEWFFLVSMTQSFINGSGLPGQAF  179

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              +SSP+W++G ++L SS CERARQ Q FGLRTMVCIPS+NGVVELGST+LI  S DLMNK
Sbjct  180   FASSPVWLAGGERLASSSCERARQGQIFGLRTMVCIPSANGVVELGSTELIFHSSDLMNK  239

Query  2658  VRVLFNF--NNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGV--DVNTSVQENSIPS  2491
             VRVLFNF  NN DMG    S S A   ENDPS+LWL++P+S   +   VNT+   ++  +
Sbjct  240   VRVLFNFNNNNSDMGPW--STSQADQGENDPSSLWLSDPSSMIEIKDSVNTAPAASAAAA  297

Query  2490  SSV----KEIV--FRNENSIPSSTGNN-------------HHDSQPSQYFTRELNFSEFG  2368
             ++V    +EI    + EN  PSS   N             HH  Q   +FTRELNFSEFG
Sbjct  298   ATVTPSNQEITKPIQFENQSPSSLTENPSTISVQTQHQNHHHQQQTQSFFTRELNFSEFG  357

Query  2367  FDGAnnnhnndlrngNSSHSCKPEAGEILNFGE---SVTKRNGN---GNSCQFLGGDEsk  2206
             ++G+            S+ SCKPE+GEILN+GE   +    NGN    NS QF+  D+  
Sbjct  358   YEGS-------SARNGSAQSCKPESGEILNYGERKKNSCSANGNLFSNNSQQFVADDK--  408

Query  2205  skkktatlkaSNEEGMLSFGSGMVK----ssggigigdssDHSDLEASVVKEADSRAVET  2038
              KK++A+ K  N EGMLSF SG+V          G    SD SDL+ASV +   SR  E 
Sbjct  409   -KKRSASSKGGNNEGMLSFTSGVVLPSSCVVKSSGGTADSDQSDLDASVREAESSRVGE-  466

Query  2037  LAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1858
                 EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG
Sbjct  467   ---PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  523

Query  1857  DAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKE----PRHPDPNPKKTT-TPHKI  1693
             DAIAYINEL++KL+ +ES  + L+ Q  SLKKEL+       P   D + K +     K+
Sbjct  524   DAIAYINELRTKLQAAESNKEGLQSQVDSLKKELAASRYSGSPPQADQDLKISNHQVSKL  583

Query  1692  PDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVK  1513
              DM+++VK++GW+AMIRIQC KKNHPAARLM ALK+LDL+V +ASVSV+ DLMIQQA VK
Sbjct  584   LDMEIEVKILGWEAMIRIQCNKKNHPAARLMTALKELDLDVHYASVSVVKDLMIQQATVK  643

Query  1512  MGTRLYNQDQLRLALISKLAE  1450
             M +R+Y Q+QLR+AL SK+ +
Sbjct  644   MSSRVYTQEQLRIALSSKVGD  664



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/601 (61%), Positives = 442/601 (74%), Gaps = 45/601 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQE+LQQRLQ LIDGARE+W YAIFWQ+SVVDFA  ++LGWGDGYYKGEEDK KR   +S
Sbjct  56    NQESLQQRLQALIDGARESWAYAIFWQSSVVDFASQTVLGWGDGYYKGEEDKNKRRGSSS  115

Query  3015  SPA----EQAHRKKVLRELNSLISGPAstd-----esvdeevtdtEWFFLVSMTHSFING  2863
             S A    EQ HRKKVLRELNSLISG  ++      ++VDEEVTDTEWFFL+SMT SF+NG
Sbjct  116   SAANFVAEQEHRKKVLRELNSLISGVQASAGNGTDDAVDEEVTDTEWFFLISMTQSFVNG  175

Query  2862  SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLIL  2683
             +GLPG A  SSSPIW++G +KL +S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI 
Sbjct  176   NGLPGLAMYSSSPIWVTGTEKLAASQCERARQAQGFGLQTIVCIPSANGVVELGSTELIF  235

Query  2682  QSFDLMNKVRVLFNFNNPDMGSISGSAS----WAAPPENDPSALWLTEPTSSSGVDVNTS  2515
             QS DLMNKV+ LFNFN  DMGS++GS S     A  PE DPSALWLT+P SSS V+   S
Sbjct  236   QSSDLMNKVKYLFNFN-IDMGSVTGSGSGSGSCAVHPEPDPSALWLTDP-SSSVVEPKDS  293

Query  2514  VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnnd  2335
             +  +S   S   ++V+ NENS        +       +FT+ELNFS +GFDG++N +   
Sbjct  294   LIHSS---SRDVQLVYGNENS-------ENQQQHCQGFFTKELNFSGYGFDGSSNRNK--  341

Query  2334  lrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka-----SN  2170
                  +  SCKPE+ EILNFG+S  + +G        G  E    K     ++     +N
Sbjct  342   -----TGISCKPESREILNFGDSSKRFSGQSQLGPGPGLMEENKNKNKNKKRSLGSRGNN  396

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             EEGMLSF SG++  +  +G    SDHSDLEASVVKEA       +   EK+PRKRGRKPA
Sbjct  397   EEGMLSFVSGVILPTSTMGKSGDSDHSDLEASVVKEA-------VVEPEKKPRKRGRKPA  449

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK++ S
Sbjct  450   NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNS  509

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCT  1630
             +   ++L+ Q + L+KEL+ K   +   +P       KI DMD+DVKV+GWDAMIRIQC+
Sbjct  510   DLDKEELRSQIECLRKELTNKGSSNYSASP-PLNQDVKIVDMDIDVKVIGWDAMIRIQCS  568

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             KKNHPAARLM ALKDLDL+V HASVSV+NDLMIQQA VKMG+RLY Q+QLR+AL SK+AE
Sbjct  569   KKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQATVKMGSRLYAQEQLRIALTSKIAE  628

Query  1449  T  1447
             +
Sbjct  629   S  629



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/619 (61%), Positives = 452/619 (73%), Gaps = 57/619 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LI+GARE WTYAIFWQ+S  D++G ++LGWGDGYYKGEEDKGK    AS
Sbjct  69    NQETLQQRLQALIEGARENWTYAIFWQSSY-DYSGTAVLGWGDGYYKGEEDKGKGKLKAS  127

Query  3015  S--PAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S   AEQ HRKKVLRELNSLISG  S TD++VDEEVTDTEWFFLVSMT SF+NG GLPGQ
Sbjct  128   SSTAAEQEHRKKVLRELNSLISGSTSPTDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPGQ  187

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +SSP+W++G D+L +S CERARQ Q FGL+TMVCIPS+NGVVELGST+LI QS DLM
Sbjct  188   AFFNSSPVWVAGSDRLATSICERARQGQVFGLQTMVCIPSANGVVELGSTELITQSSDLM  247

Query  2664  NKVRVLFNFNNP-DMGSISGSASWAAPPENDPSALWLTEPTSSSGVD-------------  2527
             NKVRVLFNFNN  + GS S S + A   ENDPS+LW+ +P  ++G++             
Sbjct  248   NKVRVLFNFNNGIEAGSWSMSNNTADQGENDPSSLWINDP--NNGIELKESNNNSNNNNT  305

Query  2526  ------VNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGF  2365
                   +  S+Q    PSSS    +  N +SI         + Q    F   LNFS++GF
Sbjct  306   SHQNQQIQKSIQFCDNPSSSS---LTENPSSIHVGNHQQQQNHQQGHSFC--LNFSDYGF  360

Query  2364  DGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLG----GDEskskk  2197
             DG+++  N +     SSH  KPE+GEILNFGES  KR+GNGN   F G    G E   KK
Sbjct  361   DGSSSVRNGNS----SSHLLKPESGEILNFGES--KRSGNGN--LFSGNSQIGVEENKKK  412

Query  2196  ktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLA  2032
             ++ T + SNEEGMLSF SG++          G    SDHSDLEASVVKEADS R VE   
Sbjct  413   RSPTSRGSNEEGMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEASVVKEADSSRVVE---  469

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  470   -PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  528

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKK-----TTTPHKIPD  1687
             I+YINEL++KL+ ++S  ++L+ + +++KKELS+K+ R   P P +         +K+ +
Sbjct  529   ISYINELRTKLQNADSEKEELQKELEAMKKELSSKDSRSAPPAPDQDLKMSNHLGNKLVE  588

Query  1686  MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMG  1507
             +++DVK++GWDAMIRIQC KKNHPAARLM ALK+LDL+V HASVSV+NDLMIQQA VKMG
Sbjct  589   LEIDVKIIGWDAMIRIQCNKKNHPAARLMAALKELDLDVHHASVSVVNDLMIQQATVKMG  648

Query  1506  TRLYNQDQLRLALISKLAE  1450
             +R Y Q+QLR+AL SK  +
Sbjct  649   SRFYTQEQLRIALTSKFGD  667



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/625 (58%), Positives = 446/625 (71%), Gaps = 65/625 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETLQQRLQ LI+GARE+WTYAIFWQ+S  D++G S+LGWGDGYYKG+E+KG+ +++  
Sbjct  79    NQETLQQRLQALIEGARESWTYAIFWQSSY-DYSGASVLGWGDGYYKGDEEKGRGKSKTT  137

Query  3018  SSPAEQAHRKKVLRELNSLISGPA----stdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             SS AEQ HRKKVLRELNSLISG A     + ++VDEEVTDTEWFFLVSMT SF+NG GLP
Sbjct  138   SSAAEQEHRKKVLRELNSLISGSAPSADDSVDAVDEEVTDTEWFFLVSMTQSFVNGGGLP  197

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQAF +SSP+W++G D L SS CERARQ Q FGL+T+VCIPS NGVVELGST++I +S D
Sbjct  198   GQAFFNSSPVWVAGADSLGSSTCERARQGQIFGLQTIVCIPSENGVVELGSTEVIFESSD  257

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPP-ENDPSALWLTEPTSSSGVDVNTSVQENSIP  2494
             LMNKVRVLFNF+N + G      SW     ENDPS+ W++EP+S+  +  + +   N+  
Sbjct  258   LMNKVRVLFNFSNMEAG------SWPLDQGENDPSSFWISEPSSAVELKDSANPSSNTNQ  311

Query  2493  SSSVKEIVFRNENSIPSSTGNNHHDS-------------QPS-----------QYFTREL  2386
               S K  V + EN+ PSS+    + S             +P+            +FTREL
Sbjct  312   QISSKSTVVQFENN-PSSSSLTENPSATAAVAAAAGSIQKPNGNSTNNNNQTQSFFTREL  370

Query  2385  NFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNG---NSCQFLGGD  2215
             NFSE+GFDG          +  S  + KPE+GEILNFGES    N  G   N   F   +
Sbjct  371   NFSEYGFDG---------NSVKSGGNLKPESGEILNFGESKRSSNNGGLFANQTPFAVVE  421

Query  2214  EskskkktatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEAD-S  2053
             E+  KK++ T + S+EEGMLSF SG++                SD+SDLEASVV+EAD S
Sbjct  422   ETNKKKRSPTSRGSHEEGMLSFTSGVILPSSGVMKSSNNGTADSDNSDLEASVVREADSS  481

Query  2052  RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  1873
             R VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK
Sbjct  482   RVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  537

Query  1872  ASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH--  1699
             ASLLGDAI+YINELKSKL+ +ES  +DL+ Q  S+ KEL+ K+   P  +P  + + H  
Sbjct  538   ASLLGDAISYINELKSKLQGAESDKEDLQKQIDSV-KELAGKDSSRPPTDPDLSMSNHHG  596

Query  1698  --KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQ  1525
               K+ D+D+DVK++GWDAMIR+QC+KKNHPAAR M ALK+LDL+V HASVSV+NDLMIQQ
Sbjct  597   SSKLIDLDIDVKIIGWDAMIRMQCSKKNHPAARFMSALKELDLDVNHASVSVVNDLMIQQ  656

Query  1524  AAVKMGTRLYNQDQLRLALISKLAE  1450
             A VKMG+R Y QDQLRLAL +K+ +
Sbjct  657   ATVKMGSRFYTQDQLRLALSAKVGD  681



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/613 (62%), Positives = 446/613 (73%), Gaps = 50/613 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVV-DFAGPSLLGWGDGYYKGEEDKGKRNRPA  3019
             NQE+LQQRLQ LIDGARE+W YAIFWQ+S   DFA PS+LGWGDGYYKGEE+K KR   +
Sbjct  57    NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKGEENKNKRRASS  116

Query  3018  SSP---AEQAHRKKVLRELNSLISGPAstde------svdeevtdtEWFFLVSMTHSFIN  2866
             SS    AEQ HRKKVLRELNSLISG  +         +VDEEVTDTEWFFL+SMT SF N
Sbjct  117   SSANFVAEQEHRKKVLRELNSLISGVQAAGAGSGGDDAVDEEVTDTEWFFLISMTQSFAN  176

Query  2865  GSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLI  2686
             G+GLPG A  SSSPIW++G +KL  S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI
Sbjct  177   GNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTELI  236

Query  2685  LQSFDLMNKVRVLFNFNNPDMGSISGSAS--WAAPPENDPSALWLTEPTSSSGVDVNTSV  2512
              +S DLMNKV+ LFNFN  DMGS++GS S   A  PE DPSALWLT+P+SS         
Sbjct  237   FESSDLMNKVKYLFNFN-IDMGSVTGSGSGSCAVHPETDPSALWLTDPSSSV-----VEA  290

Query  2511  QENSIPSSSVK-EIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnnd  2335
             +++ I SSS   ++VF NENS  + T N  H  Q   +FT+ELNFS +GFDG++  + N 
Sbjct  291   KDSLINSSSRDVQLVFVNENS-ENGTQNQQHSQQTQGFFTKELNFSGYGFDGSSTRNKNG  349

Query  2334  lrngNSSHSCKPEAGEILNFGESVTKRNGN--GNSCQF-----LGGDEskskkk------  2194
                  SS SCKPE  EILNFG+S +KR+G+      QF     LG  E    K       
Sbjct  350   N----SSISCKPETREILNFGDS-SKRSGSLFSGQSQFGPGTGLGLMEENKNKNNNNNKK  404

Query  2193  -tatlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAA  2026
              +   + +NEEGMLSF SG++    + G  G G  SDHSDLEASVVKEA       +   
Sbjct  405   RSLASRGNNEEGMLSFVSGVILPTSTMGKSGGGGDSDHSDLEASVVKEA-------IVEP  457

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA
Sbjct  458   EKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  517

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKV  1666
             YINELKSK++ S+   ++L+ Q +SL+KEL+ K       +   +    KI DMD+DVKV
Sbjct  518   YINELKSKVQNSDLDKEELRSQIESLRKELANK-GSSNYSSSPPSNQDLKIVDMDIDVKV  576

Query  1665  MGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQD  1486
             +GWDAMIRIQC+KKNHPAARLM ALKDLDL+V HASVSV+NDLMIQQA VKMG+RLY Q+
Sbjct  577   IGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQATVKMGSRLYAQE  636

Query  1485  QLRLALISKLAET  1447
             QL +AL SK AE+
Sbjct  637   QLTIALTSKFAES  649



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 447/608 (74%), Gaps = 44/608 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVV-DFAGPSLLGWGDGYYKGEEDKGKRNRPA  3019
             NQE+LQQRLQ LIDGARE+W YAIFWQ+S   DFA PS+LGWGDGYYKGEE+K KR   +
Sbjct  57    NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKGEENKNKRRASS  116

Query  3018  SSP---AEQAHRKKVLRELNSLISG------PAstdesvdeevtdtEWFFLVSMTHSFIN  2866
             SS    AEQ HRKKVLRELNSLISG       +  D++VDEEVTDTEWFFL+SMT SF N
Sbjct  117   SSTNFVAEQEHRKKVLRELNSLISGVQATGAGSGGDDAVDEEVTDTEWFFLISMTQSFAN  176

Query  2865  GSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLI  2686
             G+GLPG A  SSSPIW++G +KL  S CERARQAQ FGL+T+VCIPS+NGVVELGST+LI
Sbjct  177   GNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTELI  236

Query  2685  LQSFDLMNKVRVLFNFNNPDMGSISGSAS--WAAPPENDPSALWLTEPTSSSGVDVNTSV  2512
              +S DLMNKV+ LFNFN  DMGS++GS S   A  PE DPSALWLT+P+SS         
Sbjct  237   FESSDLMNKVKYLFNFN-IDMGSVTGSGSGSCAVHPEPDPSALWLTDPSSSV-----VEA  290

Query  2511  QENSIPSSSVK-EIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnnd  2335
             +++ I SSS   ++VF NENS  + T N  H  Q   +FT+ELNFS +GFDG++  + N 
Sbjct  291   KDSLINSSSRDVQLVFGNENS-ENGTQNQQHSQQTQGFFTKELNFSGYGFDGSSTRNKNG  349

Query  2334  lrngNSSHSCKPEAGEILNFGESVTKRN---------GNGNSCQFLGGDEskskkktatl  2182
                  SS SCKPE  EILNFG+S  K           G G     +  +++ +KK++   
Sbjct  350   N----SSISCKPETREILNFGDSSKKSGSLFSGQSQFGPGTGLGLMEENKNNNKKRSLAS  405

Query  2181  kaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPR  2011
             + +NE+GMLSF SG++    + G  G G + DHSDLEASVVKEA       +   E++PR
Sbjct  406   RGNNEKGMLSFVSGVILPTSTMGKSGGGGNFDHSDLEASVVKEA-------IVEPERKPR  458

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL
Sbjct  459   KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  518

Query  1830  KSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDA  1651
             KSK++ S+   ++L+ Q +SL+KEL+ K       +   +    KI DMD+DVKV+GWDA
Sbjct  519   KSKVQNSDLDKEELRSQIESLRKELANK-GSSNYSSSPPSNQDLKIVDMDIDVKVIGWDA  577

Query  1650  MIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLA  1471
             MIRIQC+KKNHPAARLM ALKDLDL+V HASVSV+NDLMIQQA VKMG+RLY Q+QL +A
Sbjct  578   MIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQATVKMGSRLYAQEQLTIA  637

Query  1470  LISKLAET  1447
             L SK AE+
Sbjct  638   LTSKFAES  645



>ref|XP_011028179.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=659

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/608 (57%), Positives = 429/608 (71%), Gaps = 41/608 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK--RNRP  3022
             NQETLQQRLQ LI+GARE+WTYAIFWQ+S  D +G S+LGWGDGYYKGEEDKGK      
Sbjct  65    NQETLQQRLQALIEGARESWTYAIFWQSSY-DNSGASVLGWGDGYYKGEEDKGKGRMKNS  123

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtd-tEWFFLVSMTHSFINGSGLPGQ  2845
             ASS AEQ HRKKVLRELNSLI+GP+S  +   +E    TEWFFLVSMT SF+NGSGLPGQ
Sbjct  124   ASSAAEQEHRKKVLRELNSLIAGPSSVADDAVDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  183

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +  P+W++G ++L +SPCERARQ Q FGL+T+VCIPS+NGVVELGST+LI +S DLM
Sbjct  184   ALFNGRPVWVAGSERLGTSPCERARQGQVFGLQTLVCIPSANGVVELGSTELIFRSSDLM  243

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKV+VLFNFN+ ++GS     +     ENDPS+LWLT+P +  G   N  +Q  +    +
Sbjct  244   NKVKVLFNFNSLEVGSWPIETANTDQGENDPSSLWLTDPETKDG---NAGIQSTTPAHQT  300

Query  2484  VKEIVFRNENSIPSSTGN-------------NHHDSQPSQYFTRELNFSEFG-FDGAnnn  2347
                    + +S+   +G                        FTRELNF E   +DG+   
Sbjct  301   GNSNNHHSSSSLTDHSGGIHHVQNHHSHQQQQQQQMHTQSLFTRELNFGEHSTYDGSTVR  360

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESV-TKRNGNGNSCQFLGGDEskskkktatlkaSN  2170
             +        +SH  KPE+GEILNFGES  +  + NGN    L  +ES  KKK+   +   
Sbjct  361   NG-------NSHLLKPESGEILNFGESKRSTSSANGNFYSGLVTEESNKKKKSPASRGGK  413

Query  2169  EEGMLSFGSGMVKssggigigd-----ssDHSDLEASVVKEADS-RAVETLAAAEKRPRK  2008
             EEGMLSF SG++ SS G+          SDHSD+EASVVKEADS R VE     EKRPRK
Sbjct  414   EEGMLSFTSGVILSSSGLVKSSGGTVGDSDHSDVEASVVKEADSSRVVE----PEKRPRK  469

Query  2007  RGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK  1828
             RGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK
Sbjct  470   RGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELK  529

Query  1827  SKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH--KIPDMDVDVKVMGWD  1654
             +KL+++ES  ++L+ Q +++K+EL +K+   P     K +  H  ++ DMD+DVK+ GWD
Sbjct  530   TKLQSAESSKEELENQVETMKRELVSKDSSPPPNQELKMSNDHGGRLIDMDIDVKISGWD  589

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC K NHPAARLM ALKDLDL+V +A+V+VMNDLMIQQA VKMG R Y Q++L++
Sbjct  590   AMIRIQCCKMNHPAARLMSALKDLDLDVQYANVTVMNDLMIQQATVKMGNRYYTQEELKV  649

Query  1473  ALISKLAE  1450
             A+ +K+ +
Sbjct  650   AISTKVGD  657



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/637 (58%), Positives = 449/637 (70%), Gaps = 81/637 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQTLI+GA+E WTYAIFWQ+S  D++G ++LGWGDGYYKGEEDKGK + + +
Sbjct  64    NQETLMQRLQTLIEGAQENWTYAIFWQSSY-DYSGGTVLGWGDGYYKGEEDKGKEKAKSS  122

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SS AEQ HRKKVLRELNSLISG P S  ++VDE VTDTEWF+LVSMT SFI+G GLPGQA
Sbjct  123   SSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPGQA  182

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW++G D+L SS CERARQ Q FGL+TMVCIPS+NGVVELGS+DLILQS DLMN
Sbjct  183   FFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGSSDLILQSSDLMN  242

Query  2661  KVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             KVRVLFNFNN ++ +  ISG        ENDPS+LW++EP SS+ +++   V   S P+ 
Sbjct  243   KVRVLFNFNNLEVETWPISG----VDQGENDPSSLWISEP-SSNAIEIANPVPSASAPTP  297

Query  2487  S-----------VKEIVFRNENSIPSSTG---------NNHHDSQPSQ---YFT-RELNF  2380
             S            + I   N++S+   T            H  SQP+Q   +FT RELNF
Sbjct  298   STTNSQPISKITTETIENPNKSSVVVETPSSSVPPPSQKTHRQSQPTQTQSFFTNRELNF  357

Query  2379  SEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNG----------NGNSCQ  2230
             SEFG++              +S S KPE+GEILNFGES  KR+           +GNS  
Sbjct  358   SEFGYENG-------RLKEGNSTSLKPESGEILNFGES--KRSSSYPNTDNNLPSGNS--  406

Query  2229  FLGGDEskskkktatlkaSNEEGMLSF-------GSGMVKssggigigdssDHSDLEASV  2071
               GGDE   KK++ T + SNEEGMLSF        SG VK          SDHSDLEASV
Sbjct  407   LFGGDE-NKKKRSPTSRGSNEEGMLSFTSVVILPSSGGVK---SGVCAGDSDHSDLEASV  462

Query  2070  VKEAD-SRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1894
             ++EA+ SR VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP
Sbjct  463   IREAESSRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  518

Query  1893  NVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH-------  1735
             NVSKMDKASLLGDAI+YINEL+ KL+T+ES  +DL+ Q  S+KK + +   +        
Sbjct  519   NVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKDSCMSSSN  578

Query  1734  ---PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTH  1564
                PD + K +   H   + D+DVK++ WDAMIRIQ +KKNHPAARLM AL++LDL++ H
Sbjct  579   QPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEELDLDINH  638

Query  1563  ASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             AS+SV+NDLMIQQA VKMG+RLY Q+QLR+AL+SK+ 
Sbjct  639   ASISVVNDLMIQQATVKMGSRLYTQEQLRIALLSKIG  675



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/636 (58%), Positives = 449/636 (71%), Gaps = 80/636 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQTLI+GA+E WTYAIFWQ+S  D++G ++LGWGDGYYKGEEDKGK + + +
Sbjct  72    NQETLMQRLQTLIEGAQENWTYAIFWQSSY-DYSGGTVLGWGDGYYKGEEDKGKEKAKSS  130

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SS AEQ HRKKVLRELNSLISG P S  ++VDE VTDTEWF+LVSMT SFI+G GLPGQA
Sbjct  131   SSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPGQA  190

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW++G D+L SS CERARQ Q FGL+TMVCIPS+NGVVELGS+DLILQS DLMN
Sbjct  191   FFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGSSDLILQSSDLMN  250

Query  2661  KVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             KVRVLFNFNN ++ +  ISG        ENDPS+LW++EP SS+ +++   V   S P+ 
Sbjct  251   KVRVLFNFNNLEVETWPISG----VDQGENDPSSLWISEP-SSNAIEIANPVPSASAPTP  305

Query  2487  S------VKEIVFRNENSIPSST-------------GNNHHDSQPSQ---YFT-RELNFS  2377
             S      + ++  R EN   SS                 H  SQP+Q   +FT RELNFS
Sbjct  306   STTNSQPISKLQQRIENPNKSSVVVETPSSSVPPPSQKTHRQSQPTQTQSFFTNRELNFS  365

Query  2376  EFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNG----------NGNSCQF  2227
             EFG++              +S S KPE+GEILNFGES  KR+           +GNS   
Sbjct  366   EFGYENG-------RLKEGNSTSLKPESGEILNFGES--KRSSSYPNTDNNLPSGNS--L  414

Query  2226  LGGDEskskkktatlkaSNEEGMLSF-------GSGMVKssggigigdssDHSDLEASVV  2068
              GGDE   KK++ T + SNEEGMLSF        SG VK          SDHSDLEASV+
Sbjct  415   FGGDE-NKKKRSPTSRGSNEEGMLSFTSVVILPSSGGVK---SGVCAGDSDHSDLEASVI  470

Query  2067  KEAD-SRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  1891
             +EA+ SR VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN
Sbjct  471   REAESSRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  526

Query  1890  VSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH--------  1735
             VSKMDKASLLGDAI+YINEL+ KL+T+ES  +DL+ Q  S+KK + +   +         
Sbjct  527   VSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKDSCMSSSNQ  586

Query  1734  --PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHA  1561
               PD + K +   H   + D+DVK++ WDAMIRIQ +KKNHPAARLM AL++LDL++ HA
Sbjct  587   PPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEELDLDINHA  646

Query  1560  SVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             S+SV+NDLMIQQA VKMG+RLY Q+QLR+AL+SK+ 
Sbjct  647   SISVVNDLMIQQATVKMGSRLYTQEQLRIALLSKIG  682



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/637 (58%), Positives = 449/637 (70%), Gaps = 81/637 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQTLI+GA+E WTYAIFWQ+S  D++G ++LGWGDGYYKGEEDKGK + + +
Sbjct  73    NQETLMQRLQTLIEGAQENWTYAIFWQSSY-DYSGGTVLGWGDGYYKGEEDKGKEKAKSS  131

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SS AEQ HRKKVLRELNSLISG P S  ++VDE VTDTEWF+LVSMT SFI+G GLPGQA
Sbjct  132   SSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPGQA  191

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW++G D+L SS CERARQ Q FGL+TMVCIPS+NGVVELGS+DLILQS DLMN
Sbjct  192   FFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGSSDLILQSSDLMN  251

Query  2661  KVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             KVRVLFNFNN ++ +  ISG        ENDPS+LW++EP SS+ +++   V   S P+ 
Sbjct  252   KVRVLFNFNNLEVETWPISG----VDQGENDPSSLWISEP-SSNAIEIANPVPSASAPTP  306

Query  2487  S-----------VKEIVFRNENSIPSSTG---------NNHHDSQPSQ---YFT-RELNF  2380
             S            + I   N++S+   T            H  SQP+Q   +FT RELNF
Sbjct  307   STTNSQPISKITTETIENPNKSSVVVETPSSSVPPPSQKTHRQSQPTQTQSFFTNRELNF  366

Query  2379  SEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNG----------NGNSCQ  2230
             SEFG++              +S S KPE+GEILNFGES  KR+           +GNS  
Sbjct  367   SEFGYENG-------RLKEGNSTSLKPESGEILNFGES--KRSSSYPNTDNNLPSGNS--  415

Query  2229  FLGGDEskskkktatlkaSNEEGMLSF-------GSGMVKssggigigdssDHSDLEASV  2071
               GGDE   KK++ T + SNEEGMLSF        SG VK          SDHSDLEASV
Sbjct  416   LFGGDE-NKKKRSPTSRGSNEEGMLSFTSVVILPSSGGVK---SGVCAGDSDHSDLEASV  471

Query  2070  VKEAD-SRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1894
             ++EA+ SR VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP
Sbjct  472   IREAESSRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  527

Query  1893  NVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH-------  1735
             NVSKMDKASLLGDAI+YINEL+ KL+T+ES  +DL+ Q  S+KK + +   +        
Sbjct  528   NVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKDSCMSSSN  587

Query  1734  ---PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTH  1564
                PD + K +   H   + D+DVK++ WDAMIRIQ +KKNHPAARLM AL++LDL++ H
Sbjct  588   QPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEELDLDINH  647

Query  1563  ASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             AS+SV+NDLMIQQA VKMG+RLY Q+QLR+AL+SK+ 
Sbjct  648   ASISVVNDLMIQQATVKMGSRLYTQEQLRIALLSKIG  684



>ref|XP_010273162.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
 ref|XP_010273163.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=658

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/615 (58%), Positives = 437/615 (71%), Gaps = 52/615 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLI+GARE+WTYAIFWQ+SV D +G SLLGWGDGYYKGEEDK KR +   
Sbjct  62    NQETLQQRLQTLIEGARESWTYAIFWQSSV-DISGASLLGWGDGYYKGEEDKMKR-KVTV  119

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             SPAEQ HRKKVLRELNSLISG P S D++VDEEVTDTEWFFLVSMT SFING+GLPGQAF
Sbjct  120   SPAEQEHRKKVLRELNSLISGAPPSADDTVDEEVTDTEWFFLVSMTQSFINGAGLPGQAF  179

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              +SSP+W++G ++L SS CERARQ Q FGL+TMVCIPS+NGV+ELGST+LI QS DLMNK
Sbjct  180   FASSPLWLAGSERLASSSCERARQGQIFGLQTMVCIPSANGVLELGSTELIFQSSDLMNK  239

Query  2658  VRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSVK  2479
             V+VLFNFNNP+ G  S + +     ENDPS+LW+++P+     +   +    S  +   +
Sbjct  240   VKVLFNFNNPESGPWSTTQTDQG--ENDPSSLWISDPSMLDIKESVNAAPAASAVAPPNQ  297

Query  2478  EIV--FRNENSIPSSTGNN-------------HHDSQPSQYFTRELNFSEFGFDGAnnnh  2344
             EI    + EN   S+   N             H   Q   +FTRE+NFS+FG +G+    
Sbjct  298   EISKPIQIENQSTSNLTENPSTISLQTKHQSHHQQQQTQGFFTREINFSDFGLEGSTTKK  357

Query  2343  nndlrngNSSHSCKPEAGEILNFGES---VTKRNG---NGNSCQFLGGDEskskkktatl  2182
                      + SCKPE+GE++NFG S   ++  NG   + +S QF+  D+    KK  + 
Sbjct  358   GV-------TQSCKPESGELMNFGGSRGNMSSANGALFSNHSQQFVADDK----KKKCSA  406

Query  2181  kaSNEEGMLSFGSGMVKssggigigd----ssDHSDLEASVVKEADSRAVETLAAAEKRP  2014
              +  EEGMLSF SG V  S  +         SD SDLEASV +   SR  E     EK+P
Sbjct  407   SSRGEEGMLSFTSGAVVPSACVMKSSGENLDSDQSDLEASVREVESSRVGE----PEKKP  462

Query  2013  RKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINE  1834
             RKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINE
Sbjct  463   RKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINE  522

Query  1833  LKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKK-------TTTPHKIPDMDVD  1675
             L++KL+ +ES  + L+ Q   LKK+L+++    P P P K       +   +K  +M++D
Sbjct  523   LRAKLQAAESDKEALQTQVDCLKKDLTSRIYPGPSPQPDKDRDGKISSQQGNKALEMEID  582

Query  1674  VKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLY  1495
             VK++GW+AM+RIQC KKNHPAARLM ALKDLDL+V +ASVSV+ DLMIQQA VKM +R+Y
Sbjct  583   VKILGWEAMVRIQCNKKNHPAARLMSALKDLDLDVHYASVSVVKDLMIQQATVKMSSRVY  642

Query  1494  NQDQLRLALISKLAE  1450
              Q+QLR+AL SK+A+
Sbjct  643   TQEQLRIALSSKVAD  657



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/621 (56%), Positives = 438/621 (71%), Gaps = 52/621 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D++G ++LGWG+G+YK E DKGK + +  
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSY-DYSGGTVLGWGEGFYKDERDKGKAKAKTT  136

Query  3018  SSPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             +S A+Q +RKKVLRELNSLISG   ++ D  VD+EVTDTEWFFLVSMT SF+ G GLPGQ
Sbjct  137   TSAADQEYRKKVLRELNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVPGGGLPGQ  196

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF  S+P+W++G D+L +SPCERARQ Q FGL+T+VC+P++NGVVELGST+LI QS DL 
Sbjct  197   AFFHSTPVWVAGPDRLAASPCERARQGQAFGLQTLVCVPTANGVVELGSTELIYQSSDLT  256

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKVRVLFNFNN ++GS   S   A   ENDPS+LW+ +P+S++ ++V   V    + S+ 
Sbjct  257   NKVRVLFNFNNLEVGSWPMSGGGADQGENDPSSLWINDPSSTT-IEVKDPVNMTPVTSAP  315

Query  2484  V--------KEIVF-----------RNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFD  2362
                      K I F            N ++I           Q   +FTRELNFS++G+D
Sbjct  316   TSTSTQPVSKPIQFESHQPSSSSLSENPSAIQLQQSQQQVQQQTQSFFTRELNFSDYGYD  375

Query  2361  GAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG--------DEsk  2206
             G+           ++S+S KPE+GEIL+FGES  KR+    + +   G        D + 
Sbjct  376   GS-------SVKNSNSNSLKPESGEILSFGES--KRSSYSANGKLFSGHSQIAAAEDNNS  426

Query  2205  skkktatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEADSRAVE  2041
              KK++   + SN+EG+LSF SG++         G G    SDHSDLEASVV+E DS  V 
Sbjct  427   KKKRSPPSRGSNDEGILSFSSGVILPSSGVVKSGGGGAADSDHSDLEASVVRETDSSRV-  485

Query  2040  TLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  1861
                  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL
Sbjct  486   --VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  543

Query  1860  GDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEP---RHPDPNPKKTTTPHKIP  1690
             GDAI+YINELK+KL+T ES  +DL+ Q +S+ ++L  K+       D    K     K+ 
Sbjct  544   GDAISYINELKAKLQTVESDKEDLQKQLESMNQDLGCKDSSSLSDQDLKMSKHQASSKLI  603

Query  1689  DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKM  1510
             D+D+DVK++GWDAMIRIQC KKNHPAARLM +LK+LDL+V HAS+SV+NDLMIQQA VKM
Sbjct  604   DLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDLDVHHASISVVNDLMIQQATVKM  663

Query  1509  GTRLYNQDQLRLALISKLAET  1447
             G+R+Y QDQLRLAL SK+ ++
Sbjct  664   GSRIYTQDQLRLALSSKIGDS  684



>gb|AGQ80897.1| MYC1 [Lithospermum erythrorhizon]
Length=636

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/609 (60%), Positives = 433/609 (71%), Gaps = 48/609 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP------SLLGWGDGYYKG-EEDKG  3037
             NQE+LQQRLQTLI+GA E+WTYAIFWQ+SVVD++G       ++LGW DGYYKG +E KG
Sbjct  49    NQESLQQRLQTLIEGAPESWTYAIFWQSSVVDYSGSGSGPGSTILGWADGYYKGGDEHKG  108

Query  3036  KRNRPAS-SPA---EQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHS  2875
             KR   +  SPA   EQ HRKKVL ELNSLISG    S D  VDEEVTDTEWFFL+SMT S
Sbjct  109   KRRTSSEYSPAFMAEQEHRKKVLHELNSLISGQQAGSDDGGVDEEVTDTEWFFLISMTQS  168

Query  2874  FINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGST  2695
             F NGSGLPGQA   S PIWI+G +KL+ S C+RARQA+T GL+TMV IPS+NGVVELGST
Sbjct  169   FENGSGLPGQALSGSDPIWIAGGEKLVDSNCDRARQARTLGLQTMVFIPSANGVVELGST  228

Query  2694  DLILQSFDLMNKVRVLFNFNNPDM---GSISGSASWAAPPENDPSALWLTEPTSSSGVDV  2524
              LI QS DLMNKV+VLFNF N ++   GS SGS SW   PENDPS  WL +P  ++    
Sbjct  229   ALIYQSEDLMNKVKVLFNFGNGNLDLEGSRSGSESWPVQPENDPSKFWLNDPAPAAVKGT  288

Query  2523  NTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQ---YFTRELNFSEFGFDGAn  2353
             N             K+I   NEN+  S+   NH     +Q   + T+ELNFS FG +G  
Sbjct  289   NV-----------CKQIPLGNENNSFSTLTENHSSIDVAQNLGHLTKELNFSGFGING--  335

Query  2352  nnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQ----FLGGDEskskkktat  2185
                 N+ RNG + ++CK E+GEILNFGES    +GN N       F G  E K+KK++  
Sbjct  336   ----NNCRNGENENNCKSESGEILNFGESNRSNDGNRNMVYGKSVFGGEGEIKAKKRSLA  391

Query  2184  lkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKR  2005
              + SN+EGMLSF S MVKSSG +        SD EASVVKEA+S  V      EKRPRKR
Sbjct  392   SRGSNDEGMLSFTSAMVKSSGCVADSY---DSDHEASVVKEAESSMVAV--DPEKRPRKR  446

Query  2004  GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKS  1825
             GRKPANGR EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL DAI+YI ELKS
Sbjct  447   GRKPANGRLEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAISYITELKS  506

Query  1824  KLETSESYIDDLKIQAQSLKKEL--STKEPRHPDPNPKKTTTPH-KIPDMDVDVKVMGWD  1654
             KL+ SES  +DLK Q + LKK+L  STKE R     P    T + KI D+D+DVK++GWD
Sbjct  507   KLQKSESAREDLKSQVEFLKKDLSSSTKESRKGSAPPTSRGTKNTKIVDIDIDVKIIGWD  566

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQ +K+NHPAA+LM AL++ DLEV HASVSV+NDLMIQQA VKMG R++ Q+QLR 
Sbjct  567   AMIRIQSSKRNHPAAKLMAALQEHDLEVHHASVSVVNDLMIQQATVKMGGRIFTQEQLRS  626

Query  1473  ALISKLAET  1447
             AL S++AET
Sbjct  627   ALTSRVAET  635



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/594 (59%), Positives = 444/594 (75%), Gaps = 27/594 (5%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETLQQRLQ LIDGARE+WTYAIFWQ+S  D++G S+LGWGDGYYKGEEDKGK + +  
Sbjct  69    NQETLQQRLQALIDGARESWTYAIFWQSSY-DYSGGSVLGWGDGYYKGEEDKGKGKAKMV  127

Query  3018  SSPAEQAHRKKVLRELNSLISGPAst-desvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SS AEQAHRKKVLRELNSLISG A+  D++VDEEVTDTEWFFLVSMT SF+NG GLP QA
Sbjct  128   SSAAEQAHRKKVLRELNSLISGSAAGPDDAVDEEVTDTEWFFLVSMTQSFVNGVGLPSQA  187

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW+SG D+L +S CERARQ + FGL+TMVCIPS NGVVE+GST+LI ++ DLMN
Sbjct  188   FYHSTPIWVSGADRLSASACERARQGRVFGLQTMVCIPSPNGVVEMGSTELIHRTSDLMN  247

Query  2661  KVRVLFNFNNPDMGS-ISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQENSIP  2494
             KV++LFNFNN +  S ISG+ + A+     ENDPS++W++EP+S+  +++  S+   ++P
Sbjct  248   KVKILFNFNNLETSSWISGTTAAASAADEGENDPSSMWISEPSST--IEMKDSIT-TTVP  304

Query  2493  SSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRE--LNFSEFGFDG--Annnhnndlrn  2326
             SS+V     R+EN   SS   N    Q S +   +  LNFS++GF+   + N        
Sbjct  305   SSNVPAKPIRSENPSSSSLTENMSTIQQSHHKQSQSFLNFSDYGFESNPSKNTTATATVT  364

Query  2325  gNSSHSCKPEAGEILNFGESVTKRNGN--GNSCQFLGGDEskskkktatlkaSNEEGMLS  2152
              +++ S KPE+G +LNFG      NG+      Q++  +E   KK++   ++SN+EG+LS
Sbjct  365   TSTTPSFKPESGGMLNFG------NGSLFSGHSQYVT-NEQNEKKRSPASRSSNDEGILS  417

Query  2151  FGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEP  1972
             F SG++  S G      SDHSDLEASV++E DS   ++L   EKRPRKRGRKPANGREEP
Sbjct  418   FTSGVILPSSGKVKSGDSDHSDLEASVIREVDS-CTKSLEP-EKRPRKRGRKPANGREEP  475

Query  1971  LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDD  1792
             LNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDA++YINELKSKL+ +ES   D
Sbjct  476   LNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTD  535

Query  1791  LKIQAQSLKKELSTKEPR-HPDPNPKKTTT-PHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
             +    + LKKE+  K+   + +PN +       K+ DM+++VK+MGWDAMIRIQ  KKNH
Sbjct  536   MGKHLELLKKEMGGKDVGCYTNPNDEDLKIGKRKVMDMEIEVKIMGWDAMIRIQSNKKNH  595

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             PAARLM A KDLDLE+ HASVSV+NDLMIQQA VKMG+R Y Q+QL++AL++++
Sbjct  596   PAARLMTAFKDLDLEMLHASVSVVNDLMIQQATVKMGSRFYTQEQLKMALVARV  649



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 ref|XP_004164415.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/594 (59%), Positives = 443/594 (75%), Gaps = 27/594 (5%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETLQQRLQ LIDGARE+WTYAIFWQ+S  D++G S+LGWGDGYYKGEEDKGK + +  
Sbjct  69    NQETLQQRLQALIDGARESWTYAIFWQSSY-DYSGGSVLGWGDGYYKGEEDKGKGKAKMV  127

Query  3018  SSPAEQAHRKKVLRELNSLISGPAst-desvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             SS AEQAHRKKVLRELNSLISG A+  D++VDEEVTDTEWFFLVSMT SF+NG GLP QA
Sbjct  128   SSAAEQAHRKKVLRELNSLISGSAAGPDDAVDEEVTDTEWFFLVSMTQSFVNGVGLPSQA  187

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW+SG D+L +S CERARQ + FGL+TMVCIPS NGVVE+GST+LI ++ DLMN
Sbjct  188   FYHSTPIWVSGADRLSASACERARQGRVFGLQTMVCIPSPNGVVEMGSTELIHRTSDLMN  247

Query  2661  KVRVLFNFNNPDMGS-ISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQENSIP  2494
             KV++LFNFNN +  S ISG+ + A+     ENDPS++W++EP+S+  +++  S+   ++P
Sbjct  248   KVKILFNFNNLETSSWISGTTAAASAADEGENDPSSMWISEPSST--IEMKDSIT-TTVP  304

Query  2493  SSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRE--LNFSEFGFDG--Annnhnndlrn  2326
             SS+V     R+EN   SS   N    Q S +   +  LNFS++GF+     N        
Sbjct  305   SSNVPAKPIRSENPSTSSLTENMSTIQQSHHKQSQSFLNFSDYGFESNPTKNTTATATAT  364

Query  2325  gNSSHSCKPEAGEILNFGESVTKRNGN--GNSCQFLGGDEskskkktatlkaSNEEGMLS  2152
              +++ S KPE+G +LNFG      NG+      Q++  +E   KK++   ++SN+EG+LS
Sbjct  365   TSTTPSFKPESGGMLNFG------NGSLFSGHSQYVT-NEQNEKKRSPASRSSNDEGILS  417

Query  2151  FGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEP  1972
             F SG++  S G      SDHSDLEAS ++E DS   ++L   EKRPRKRGRKPANGREEP
Sbjct  418   FTSGVILPSSGKVKSGDSDHSDLEASAIREVDS-CTKSLEP-EKRPRKRGRKPANGREEP  475

Query  1971  LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDD  1792
             LNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDA++YINELKSKL+ +ES   D
Sbjct  476   LNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTD  535

Query  1791  LKIQAQSLKKELSTKEPR-HPDPNPKKTTT-PHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
             +    + LKKE+  K+   + +PN +   T   K+ DM+++VK+MGWDAMIRIQ  KKNH
Sbjct  536   MGKHLELLKKEMGGKDLGCYSNPNDEDLKTGKRKVMDMEIEVKIMGWDAMIRIQSNKKNH  595

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             PAARLM A KDLDLE+ HASVSV+NDLMIQQA VKMG+R Y Q+QL++AL++++
Sbjct  596   PAARLMTAFKDLDLEMLHASVSVVNDLMIQQATVKMGSRFYTQEQLKMALVARV  649



>ref|XP_006385657.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP63454.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=630

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/599 (58%), Positives = 425/599 (71%), Gaps = 51/599 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK--RNRP  3022
             NQETLQQRLQ LI+GARE+WTYAIFWQ+S  D +G S+LGWGDGYY GEEDKGK      
Sbjct  64    NQETLQQRLQALIEGARESWTYAIFWQSSY-DCSGASVLGWGDGYYIGEEDKGKGRMKNS  122

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtd-tEWFFLVSMTHSFINGSGLPGQ  2845
             ASS AEQ HRKKVLRELNSLI+GP+S  +   +E    TEWFFLVSMT SF+NGSGLPGQ
Sbjct  123   ASSAAEQEHRKKVLRELNSLIAGPSSVTDDAVDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  182

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  + SP+W++G ++L +SPCERARQ Q FGL+T+VCIPS+NGVVELGST+LI QS DLM
Sbjct  183   ALFNGSPVWVAGSERLGTSPCERARQGQVFGLQTLVCIPSANGVVELGSTELIFQSSDLM  242

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKV+VLFNFN+ ++GS     +     ENDPS+LWLT+P +  G           IPS++
Sbjct  243   NKVKVLFNFNSLEVGSWPIGTTNTDQGENDPSSLWLTDPETKDG--------NAGIPSTT  294

Query  2484  VKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSE-----FGFDGAnnnhnndlrngN  2320
                    ++ +  ++  ++   SQPS       ++SE       F GA            
Sbjct  295   PA-----HQTANNNNHHSSSKSSQPSTAAAAADSYSESFHSRVEFWGAQ-----------  338

Query  2319  SSHSCKPEAGEILNFGESV-TKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGS  2143
                   PE+GEILNFGES  +  + NGN    L  +ES  KKK+   +  NEEGMLSF S
Sbjct  339   -----HPESGEILNFGESKRSPSSANGNFYSGLVTEESNKKKKSPASRGGNEEGMLSFTS  393

Query  2142  GMVKssggigigd-----ssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRKPANGR  1981
             G++ SS G+          SDHSDLEASVVKEADS R VE     EKRPRKRGRKPANGR
Sbjct  394   GVILSSSGLVKSSGGTGGDSDHSDLEASVVKEADSSRVVE----PEKRPRKRGRKPANGR  449

Query  1980  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESY  1801
             EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK+KL+++ES 
Sbjct  450   EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKTKLQSAESS  509

Query  1800  IDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH--KIPDMDVDVKVMGWDAMIRIQCTK  1627
              ++L+ Q +S+K+EL +K+   P     K +  H  ++ DMD+DVK+ GWDAMIRIQC K
Sbjct  510   KEELENQVESMKRELVSKDSSSPPNQELKMSNDHGGRLIDMDIDVKISGWDAMIRIQCCK  569

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
              NHPAARLM ALKDLDL+V +A+V+VMNDLMIQQA VKMG R Y Q++L++A+ +K+ +
Sbjct  570   MNHPAARLMSALKDLDLDVQYANVTVMNDLMIQQATVKMGNRYYTQEELKVAISTKVGD  628



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/610 (59%), Positives = 450/610 (74%), Gaps = 43/610 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             +QE+LQQRLQ LI+GARE+WTYAIFWQ+S  D++  ++LGWGDGYYKGEEDKGK    AS
Sbjct  78    SQESLQQRLQALIEGARESWTYAIFWQSSY-DYSATTVLGWGDGYYKGEEDKGKAKLKAS  136

Query  3015  SP--AEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S   AEQ HRKKVLRELNSLISG A+ TD++VDEEVTDTEWFFLVSMT SF++GSGLPGQ
Sbjct  137   SSSVAEQEHRKKVLRELNSLISGSAAPTDDAVDEEVTDTEWFFLVSMTQSFVDGSGLPGQ  196

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +SSP+W++G D+L SS CERA+QAQ FGL+T+VCIPS+NGVVELGST+LI QS D+M
Sbjct  197   AFFNSSPVWVAGPDRLESSMCERAKQAQVFGLQTLVCIPSANGVVELGSTELITQSSDIM  256

Query  2664  NKVRVLFNFN-NPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVN----------T  2518
             NKVRVLFNFN   + GS   S + A   ENDPS+LW+++P   +GV+             
Sbjct  257   NKVRVLFNFNIEIEAGSWCMSNNTADQGENDPSSLWISDP--HAGVEFKESSNTTTTTNH  314

Query  2517  SVQENSIPSSSVKEIVFRNENSI---PSS--TGNNHHDSQPSQYFTRE-LNFSEFGFDGA  2356
             +  +N     S++    R+ +S+   PSS   GN+H   Q  Q      LNFS++GFD  
Sbjct  315   TSNQNQQTQKSIQFCDNRSSSSLTENPSSIPAGNHHQQQQSHQQGQSLCLNFSDYGFD--  372

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktat--l  2182
                 ++     +SSH  KPE+GEILNFGES  KR+GNGN   F G      + K  +   
Sbjct  373   --ESSSVRNGNSSSHLLKPESGEILNFGES--KRSGNGN--LFTGNSPFAVENKKRSPNS  426

Query  2181  kaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKR  2017
             + SNEE MLSF SG++          G    SDHSDLEASVVKEADS R VE     EKR
Sbjct  427   RGSNEEAMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEASVVKEADSSRVVE----PEKR  482

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             PRKRGRKPANGREEPLNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDAI+YIN
Sbjct  483   PRKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAISYIN  542

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTT-TPHKIPDMDVDVKVMG  1660
             ELKSKL++++   ++++ Q ++LKK LS+K P   D + K +  T +K+ D++++VK++G
Sbjct  543   ELKSKLQSADLEKEEMQSQLEALKKNLSSKAPPPHDQDLKISNHTGNKLIDLEIEVKIIG  602

Query  1659  WDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQL  1480
             WDAMI+IQC+KKNHPAA+LMVALK+LDL+V HASVSV+ DLMIQQA VKMG+R + Q+QL
Sbjct  603   WDAMIQIQCSKKNHPAAKLMVALKELDLDVHHASVSVVKDLMIQQANVKMGSRFFTQEQL  662

Query  1479  RLALISKLAE  1450
             + AL +KL +
Sbjct  663   KSALTTKLGD  672



>ref|XP_006368399.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP64968.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=647

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/599 (60%), Positives = 434/599 (72%), Gaps = 42/599 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR-P  3022
             NQETLQQRLQTLI+GA E W YAIFWQ+S  D++G S+LGWGDGYYKGEEDKGK R R  
Sbjct  60    NQETLQQRLQTLIEGACEGWAYAIFWQSSY-DYSGASVLGWGDGYYKGEEDKGKTRTRNS  118

Query  3021  ASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             ASS  EQ HRK VLR+LNSLI+GP + TD+++DEEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  119   ASSAVEQEHRKTVLRKLNSLIAGPNSVTDDAIDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  178

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  + SP+W++G ++L +SPCERARQ Q FGL+T+VCIPS++GVVELGST+LI QS DLM
Sbjct  179   ALFNGSPVWVAGSERLGASPCERARQGQVFGLQTLVCIPSASGVVELGSTELIFQSSDLM  238

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKVRVLF+FN+ ++ S     +     ENDPS+ WLT+P +  G   N  +  N   S  
Sbjct  239   NKVRVLFDFNSLEVVSWPIGTTNTDQGENDPSSFWLTDPETKDG---NGGIPWNLNGSDQ  295

Query  2484  VKEIVFRNENSIPSST----GNNH---HDSQP---SQYFTRELNFSEFG-FDGAnnnhnn  2338
              K     +  S  S T    G +H   H  QP      FTRELNF E   +DG++  +  
Sbjct  296   NKNNHHSSNQSSSSLTDHLGGIHHAQNHQQQPIHARSLFTRELNFGECSTYDGSSVRNG-  354

Query  2337  dlrngNSSHSCKPEAGEILNFGESV-TKRNGNGNSCQFLGGDEskskkktatlkaSNEEG  2161
                   +SH  KPE+GEILNFGES  T  + NGN    L  +E+  KK++      NEEG
Sbjct  355   ------NSHLTKPESGEILNFGESKRTASSANGNFYSGLVTEENNKKKRSVG----NEEG  404

Query  2160  MLSFGSGMVK-----ssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGR  1999
             MLSF SG++           G G  SDHSDLEASVVKEADS R VE     EKRPRKRGR
Sbjct  405   MLSFTSGVILPSSCILKSSGGTGGDSDHSDLEASVVKEADSSRVVE----PEKRPRKRGR  460

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI+EL++KL
Sbjct  461   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIDELRTKL  520

Query  1818  ETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH--KIPDMDVDVKVMGWDAMI  1645
             +++ES  ++L+ Q +S+K+EL +K+   P     K +     K+ DMD+DVK+ GWDAMI
Sbjct  521   QSAESSKEELEKQVESMKRELVSKDSSPPPKEELKMSNNEGVKLIDMDIDVKISGWDAMI  580

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLAL  1468
             RIQC KKNHPAARLM AL+DLDL+V +A+VSVMNDLMIQQA VKMG+R Y Q++LR+A+
Sbjct  581   RIQCCKKNHPAARLMSALRDLDLDVQYANVSVMNDLMIQQATVKMGSRFYTQEELRVAI  639



>ref|XP_011018569.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=647

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/604 (59%), Positives = 431/604 (71%), Gaps = 42/604 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKR--NRP  3022
             NQETLQQRLQTLI+GA E WTYAIFWQ+S  D++G S+LGWGDGYYKG+EDKGK      
Sbjct  60    NQETLQQRLQTLIEGACEGWTYAIFWQSSY-DYSGASVLGWGDGYYKGDEDKGKTRTKNS  118

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstdesv-deevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             ASS  EQ HRK VLR+LNSLI+GP+S  +   DEEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  119   ASSAVEQEHRKTVLRKLNSLIAGPSSVTDDAIDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  178

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  + SP+W++G ++L +SPCERARQ Q FGL+T+VCIPS++GVVELGST+LI QS DLM
Sbjct  179   ALFNGSPVWVAGSERLGASPCERARQGQVFGLQTLVCIPSASGVVELGSTELIFQSSDLM  238

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSS  2485
             NKVRVLF+FN+ ++ S     +     ENDPS+ WLT+P +  G   N  +  N   +  
Sbjct  239   NKVRVLFDFNSLEVVSWPIGTTNTDQGENDPSSFWLTDPETKDG---NGGIPWNLNGNDQ  295

Query  2484  VKEIVFRNENSIPSST----GNNH---HDSQP---SQYFTRELNFSEFG-FDGAnnnhnn  2338
              K     +  S  S T    G +H   H  QP      FTRELNF E   +DG++  +  
Sbjct  296   NKNNHHSSNQSSSSLTDHLGGIHHVQNHQQQPIHAQSLFTRELNFGERSTYDGSSVRNG-  354

Query  2337  dlrngNSSHSCKPEAGEILNFGESV-TKRNGNGNSCQFLGGDEskskkktatlkaSNEEG  2161
                   +SH  KPE+GEILNFGES  T  + NGN    L  +E+  KK+       NEEG
Sbjct  355   ------NSHLMKPESGEILNFGESKRTASSANGNFYSGLVTEENNKKKRAGG----NEEG  404

Query  2160  MLSFGSGMVK-----ssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGR  1999
             MLSF SG++           G G  SDHSDLEASVVKEADS R VE     EKRPRKRGR
Sbjct  405   MLSFTSGVILPSSCILKSSGGTGGDSDHSDLEASVVKEADSSRVVE----PEKRPRKRGR  460

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI+EL++KL
Sbjct  461   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIDELRTKL  520

Query  1818  ETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH--KIPDMDVDVKVMGWDAMI  1645
             +++ES  ++L+ Q +S+K+EL +K    P     K +     K+ DMD+DVK+ GWDAMI
Sbjct  521   QSAESSKEELEKQVESMKRELVSKNSSPPPKEELKMSNNQGVKLIDMDIDVKISGWDAMI  580

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             RIQC KKNHPAARLM AL+DLDL+V +A+VSVMNDLMIQQA VKMG+R Y Q++LR+A+ 
Sbjct  581   RIQCCKKNHPAARLMSALRDLDLDVQYANVSVMNDLMIQQATVKMGSRFYTQEELRVAIS  640

Query  1464  SKLA  1453
             +K+ 
Sbjct  641   TKVG  644



>gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/627 (59%), Positives = 446/627 (71%), Gaps = 61/627 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRL TLI+GARE+WTYAIFWQ+S  D+ G S+LGWGDGYYKGEEDKGK    ++
Sbjct  65    NQETLQQRLLTLIEGARESWTYAIFWQSSY-DYNG-SVLGWGDGYYKGEEDKGKGKSKST  122

Query  3015  S--PAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S    EQ HRKKVLRELNSLISG    TD++VDEEVTDTEWFFLVSMT SF+NG GLPG 
Sbjct  123   SSSAVEQEHRKKVLRELNSLISGSNTVTDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPGH  182

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF + SP+W++G D+L +SPCERARQ Q FGL+T+VCIPS+NGVVELGST+LI QS DLM
Sbjct  183   AFFNGSPVWVAGSDRLSASPCERARQGQVFGLQTLVCIPSANGVVELGSTELIYQSSDLM  242

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGV---DVNTSV------  2512
             NKVRVLFNFN+ ++GS    A+     END S+LW+++P S SG+   D N++V      
Sbjct  243   NKVRVLFNFNSVEVGSWPMGAN-PDQGENDTSSLWISDP-SQSGIEMKDGNSTVPSSVCN  300

Query  2511  -QENSIPSSSVKEIVFRNENS----------IPSSTGNNHHDSQPSQYFTRELNFSEF-G  2368
                NS   +  K I   N NS                N    +Q   +FTRELNF ++ G
Sbjct  301   NTNNSNNQNGSKGIPLGNPNSSSLTETPNMQQNHQQQNQQQMTQTQSFFTRELNFGDYSG  360

Query  2367  FDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN---GNGN----SCQFLGGDEs  2209
             FDG++  +        +S+  KPE+GEILNFGES  KR+    NGN      QF   D +
Sbjct  361   FDGSSARNG-------NSNLLKPESGEILNFGES--KRSSCSANGNFFSGHSQFTAEDNN  411

Query  2208  kskkkta----tlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKEADS  2053
              +         T + SNEEGMLSF SG++          G    SDHSDLEASVV+E DS
Sbjct  412   NNNSNKKKRSPTSRGSNEEGMLSFTSGVILPSSGVVKSSGGTGDSDHSDLEASVVRETDS  471

Query  2052  -RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  1876
              R +E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD
Sbjct  472   SRVIE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  527

Query  1875  KASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKE----PRHPDPNPKKTT  1708
             KASLLGDAI+YI EL++KL+T+ES  ++L+ Q +S+KKE ++K+    P  PD   K ++
Sbjct  528   KASLLGDAISYIKELRTKLQTAESEKEELEKQVESIKKEFASKDSRPGPPPPDQELKMSS  587

Query  1707  TPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQ  1528
                K+ +MD+DVK++GWDAMIRIQC KKNHPAARLM ALK+LDL+V HASVSV+NDLMIQ
Sbjct  588   GGSKLIEMDIDVKIIGWDAMIRIQCCKKNHPAARLMAALKELDLDVHHASVSVVNDLMIQ  647

Query  1527  QAAVKMGTRLYNQDQLRLALISKLAET  1447
             QA VKMG+R Y Q+QLRLAL +K+ +T
Sbjct  648   QATVKMGSRFYTQEQLRLALSTKVGDT  674



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/636 (57%), Positives = 441/636 (69%), Gaps = 75/636 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETL QRLQTLI+GA+E WTYAIFWQ+S  D++G ++LGWGDGYYKGEEDKGK    +S
Sbjct  75    NQETLMQRLQTLIEGAQENWTYAIFWQSSY-DYSGGTVLGWGDGYYKGEEDKGKEKAKSS  133

Query  3015  SPAE-QAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             S    Q HRKKVLRELNSLISG P S  ++VDE VTDTEWF+LVSMT SF++G GLPGQA
Sbjct  134   SSKAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFVSGLGLPGQA  193

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+PIW++G D+L SS CERARQ Q FGL+TMVCIPS+NGVVELGS+DLI QS DLMN
Sbjct  194   FFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGSSDLIFQSSDLMN  253

Query  2661  KVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             KVRVLFNFNN ++ +  ISG        ENDPS+LW++EP SS+ +++   V   S P+ 
Sbjct  254   KVRVLFNFNNLEVETWPISG----VDQGENDPSSLWISEP-SSNAIEITNPVPSASAPTP  308

Query  2487  SV-----------KEIVFRNENSIPSSTG---------NNHHDSQPSQ---YFT-RELNF  2380
             S            + I   N++S+   T            H  SQP+Q   +FT RELNF
Sbjct  309   STTNSQPISKITTETIENPNKSSVVVETPSSSVPPPSQKTHRQSQPNQTQSFFTNRELNF  368

Query  2379  SEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN----------GNSCQ  2230
             SE GF+              +S S KPE+GEILNFGES  KR+ +          GNS  
Sbjct  369   SELGFENGRLKDR-------NSTSLKPESGEILNFGES--KRSSSYPNTDNNLPSGNS--  417

Query  2229  FLGGDEskskkktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEASVVKE  2062
               GGDE+K K+   +  + NEEGMLSF SG++               SDHSDLEASV++E
Sbjct  418   LFGGDENKKKRSPTSRGS-NEEGMLSFTSGVILPSSGGVKSGVCAGDSDHSDLEASVIRE  476

Query  2061  ADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1885
              +S R VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS
Sbjct  477   VESSRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  532

Query  1884  KMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH----------  1735
             KMDKASLLGDAI+YINEL+ KL+T+ES  +DL+ Q  S+KK + +   +           
Sbjct  533   KMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKDSCVSSSNQPP  592

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
             PD + K +   H   + D+DVK++ WDAMIRIQ +KKNHPAARLM AL++LDL++ HAS+
Sbjct  593   PDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEELDLDINHASI  652

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             SV+NDLMIQQA VKMG+RLY Q+QLR+AL SK+  T
Sbjct  653   SVVNDLMIQQATVKMGSRLYTQEQLRIALSSKIGAT  688



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/607 (58%), Positives = 425/607 (70%), Gaps = 55/607 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLI+GA E+WTYAIFWQ+S    +  SLLGWGDGYYKGEEDKGK   P  
Sbjct  68    NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAPKE  127

Query  3015  -SPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
              S AEQ HRKKVLRELNSLISGP+++ + VDEEV+DTEWFFLVSMT SF++GSGLPGQAF
Sbjct  128   MSSAEQDHRKKVLRELNSLISGPSASADDVDEEVSDTEWFFLVSMTQSFLSGSGLPGQAF  187

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              +SSP+W++G D+L  S CERARQ Q FGL+T+VCIPS+NGVVEL ST++I Q+ DLM K
Sbjct  188   LNSSPVWVAGADRLSDSTCERARQGQVFGLQTLVCIPSANGVVELASTEVIFQNSDLMKK  247

Query  2658  VRVLFNFNNPDMGSISGSASWAA-PPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
             VR LFNFNNPD G       W     ENDPS+LWL   +S    D + +V   S  +S  
Sbjct  248   VRDLFNFNNPDAG------FWPLNQGENDPSSLWLNPSSSIEIKDTSNAVALVSANASLS  301

Query  2481  KEIVFRNENS-----IPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrngN  2320
             K + F    S      PS+    H  +  +Q +F RELNF                    
Sbjct  302   KTMPFETPGSSTLTETPSAAAAAHVPNPKNQGFFPRELNF--------------------  341

Query  2319  SSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSG  2140
              S+S KPE+GEIL+FGES  K + NG+    +  +E+  K+++   ++S ++GMLSF SG
Sbjct  342   -SNSLKPESGEILSFGES-KKSSYNGSYFPGVAAEETNKKRRSPASRSSIDDGMLSFTSG  399

Query  2139  MV---------KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPAN  1987
             ++           +GG   G  S++SDLEASVVKEADSR VE     EKRPRKRGRKPAN
Sbjct  400   VIIPASNIKSGAVAGGGASGGDSENSDLEASVVKEADSRVVE----PEKRPRKRGRKPAN  455

Query  1986  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSE  1807
             GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSKL   E
Sbjct  456   GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLSELE  515

Query  1806  SYIDDLKIQAQSLKK--ELSTK----EPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMI  1645
             S   +L+ Q + +KK  EL+TK     P  P  N +   T  K+ D++++VK++GWDAMI
Sbjct  516   SEKGELEKQLELVKKELELATKSPSPPPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMI  575

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             RIQC+KKNHPAARLM ALK+LDL+V HASVSV+NDLMIQQA V MG R Y Q+QL  AL 
Sbjct  576   RIQCSKKNHPAARLMAALKELDLDVNHASVSVVNDLMIQQATVNMGNRFYTQEQLLSALS  635

Query  1464  SKLAETL  1444
             SK+   L
Sbjct  636   SKIGNAL  642



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/616 (57%), Positives = 440/616 (71%), Gaps = 43/616 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQ LIDGARE+WTYAIFWQ+S  D++G ++LGWG+G+YK E DK K + +  
Sbjct  78    NQETLMQRLQALIDGARESWTYAIFWQSSY-DYSGAAVLGWGEGFYKDERDKVKAKAKTT  136

Query  3018  SSPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             +S AEQ +RKKVLR+LNSLISG   ++ D++VD+EVTDTEWFFLVSMT SF+NG GLPGQ
Sbjct  137   TSAAEQEYRKKVLRDLNSLISGADTSADDDAVDQEVTDTEWFFLVSMTQSFVNGGGLPGQ  196

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF  S+P+W++G D+L +SPCERARQ Q FGL+TMVC+P++NGVVELGST+LI QS DLM
Sbjct  197   AFFHSTPVWVAGPDRLAASPCERARQGQVFGLQTMVCVPTANGVVELGSTELIYQSSDLM  256

Query  2664  NKVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSS---GVDVNTSVQENS  2500
             NKVRVLF+FNN ++GS  +SG A+ A   ENDPS+LWL +P++++      VNTS   N+
Sbjct  257   NKVRVLFDFNNLEVGSWPMSGGAT-ADQGENDPSSLWLNDPSTTTMEMKDPVNTSATTNT  315

Query  2499  IPSSSVKEIVFRNEN------------SIPSSTGNNHHDSQPSQYFTRELNFSEFG-FDG  2359
                   K + F N               +P          Q   +FT ELNFS++  +DG
Sbjct  316   SNQLISKPVQFDNHPSSSSLSENPSPIQVPQLQQQVQQQQQTQSFFTGELNFSDYNVYDG  375

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG-------DEsksk  2200
             +      +  + ++SHS KPE+GEILNFGES  + + + N   FLG        D +  K
Sbjct  376   S---SVKNSNSNSNSHSLKPESGEILNFGES-KRSSYSANGKLFLGHSQMTAAEDNNSKK  431

Query  2199  kktatlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLAA  2029
             K++   + SN+EG+LSF SG++           G  SDHSDLEASVV+EADS  V     
Sbjct  432   KRSPPSRGSNDEGILSFSSGVILPSSCVVKSSGGADSDHSDLEASVVREADSSRV---VD  488

Query  2028  AEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
              EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI
Sbjct  489   QEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  548

Query  1848  AYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPD---PNPKKTTTPHKIPDMDV  1678
             AYINELK KL+T E+  ++L+ Q +S+ K+L  K+ R         +      K+ DMD+
Sbjct  549   AYINELKLKLQTVETDKEELQNQLESMNKDLPCKDSRSSGSIMSEDELKGCSSKLLDMDI  608

Query  1677  DVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRL  1498
             DVK++G DAMIRIQC KKNHPAARLM ALK+LD++V +ASVSV+NDLMIQQA VKMG+R+
Sbjct  609   DVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVHYASVSVVNDLMIQQATVKMGSRI  668

Query  1497  YNQDQLRLALISKLAE  1450
             Y QD LRLAL SK+ +
Sbjct  669   YTQDHLRLALHSKVGD  684



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/603 (57%), Positives = 418/603 (69%), Gaps = 64/603 (11%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFA-GPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             QE LQQRL  LIDGARE WTYAIFWQ S  DF   PS L WGDGYYKGEEDK KR + AS
Sbjct  1     QENLQQRLSALIDGARECWTYAIFWQNSAADFGLPPSALSWGDGYYKGEEDKEKR-KTAS  59

Query  3015  SPAEQAHRKKVLRELNSLISG-----PAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             S AEQ HRKKVLRELNSL+SG     P     +VDEEVTDTEWFFL+SMT +F NGSG+P
Sbjct  60    SYAEQEHRKKVLRELNSLVSGQQASSPDDDGAAVDEEVTDTEWFFLISMTQTFENGSGIP  119

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQA  +SSP+W++G ++L  + C+RARQA  +GLRT+VCIPSSNGVVELGST +I QS D
Sbjct  120   GQAMFASSPVWVAGPERLAEANCDRARQALGYGLRTLVCIPSSNGVVELGSTSVIFQSSD  179

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPS  2491
             L+ KV+ LFNFN  D  S+SG+ SW    + DP+ALWLT+  SSSGV+            
Sbjct  180   LVRKVKSLFNFNCTDDASVSGTGSWGTG-DGDPAALWLTDHPSSSGVEAK----------  228

Query  2490  SSVKEIVFRNENSIPSSTGNNHHDSQPSQYFT-RELNFSEFGFDGAnnnhnndlrngNSS  2314
                +++VF NEN  P S  +N      S + + R+LNFS+F F G+      +     ++
Sbjct  229   ---QQMVFGNEN--PKSMADN------SIFLSSRDLNFSDFRFGGSIAATMKN-----TA  272

Query  2313  HSCKPEAGEILNFGESV-TKRN------GNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
               CKPE+GEILNFGE+  TK N       N N+        SK+KK++   + SNEEG+L
Sbjct  273   PPCKPESGEILNFGEATSTKTNLFTPQPDNNNTTV------SKTKKRSPQSRGSNEEGIL  326

Query  2154  SFGSGMVKssggigigdssD---------HSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             SF S ++  S        +          HSDLEAS+VK ADS  V      EKRPRKRG
Sbjct  327   SFTSAVIAPSSSGIPKTDNTGGCNVESDDHSDLEASIVKGADSSRV---FDPEKRPRKRG  383

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK
Sbjct  384   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSK  443

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             L+ SE  +D+L+ Q +SLKKE +  +P    P    T +      +D++VK++G DAMI+
Sbjct  444   LQNSEMDVDELRSQLESLKKEHNDSDP----PTGYTTASATNNVSVDIEVKIIGRDAMIQ  499

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             +QC K+NHPAA+LM A ++LDL+V HASVSV+N+LMIQQA VKMG++ + QD LRLAL+S
Sbjct  500   VQCGKRNHPAAQLMTAFRELDLDVHHASVSVVNELMIQQATVKMGSKYFTQDHLRLALMS  559

Query  1461  KLA  1453
             KLA
Sbjct  560   KLA  562



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/607 (58%), Positives = 421/607 (69%), Gaps = 55/607 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQTLI+GA E+WTYAIFWQ+S    +  SLLGWGDGYYKGEEDKGK   P  
Sbjct  68    NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAPKE  127

Query  3015  -SPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
              S AEQ HRKKVLRELNSLISGP  + + VDEEV+DTEWFFLVSMT SF++GSGLPGQAF
Sbjct  128   MSSAEQDHRKKVLRELNSLISGPFRSADDVDEEVSDTEWFFLVSMTQSFLSGSGLPGQAF  187

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              +SSP+W++G D+L  S  ERARQ Q FG++T+VCIPS+NGVVEL ST++I Q+ DLM K
Sbjct  188   LNSSPVWVAGADRLSDSTSERARQGQVFGVQTLVCIPSANGVVELASTEVIFQNSDLMKK  247

Query  2658  VRVLFNFNNPDMGSISGSASWAA-PPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
             VR LFNFNNPD G       W     ENDPS+LWL   +S    D + +V   S  +S  
Sbjct  248   VRDLFNFNNPDAGF------WPLNQGENDPSSLWLNPSSSIEIKDTSNAVALVSANASLS  301

Query  2481  KEIVFRNENS-----IPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnhnndlrngN  2320
             K + F    S      PS+    H  +  +Q +F RELNFS                   
Sbjct  302   KTMPFETPGSSTLTETPSAAAAAHVPNPKNQGFFPRELNFS-------------------  342

Query  2319  SSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSG  2140
               +S KPE+GEIL+FGES  K + NG+    +  +E+  K+++   ++S ++GMLSF SG
Sbjct  343   --NSLKPESGEILSFGES-KKSSYNGSYFPGVAAEETNKKRRSPASRSSIDDGMLSFTSG  399

Query  2139  MV---------KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPAN  1987
             ++           +GG   G  S++SDLEASVVKEADSR VE     EKRPRKRGRKP N
Sbjct  400   VIIPASNIKSGAVAGGGASGGDSENSDLEASVVKEADSRVVE----PEKRPRKRGRKPGN  455

Query  1986  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSE  1807
             GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSKL   E
Sbjct  456   GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLSELE  515

Query  1806  SYIDDLKIQAQSLKK--ELSTK----EPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMI  1645
             S   +L+ Q + +KK  EL+TK     P  P  N +   T  K+ D++++VK++GWDAMI
Sbjct  516   SEKGELEKQLELVKKELELATKSPSPPPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMI  575

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             RIQC+KKNHPAARLM ALK+LDL+V HASVSV+NDLMIQQA V MG R Y Q+QLR A  
Sbjct  576   RIQCSKKNHPAARLMAALKELDLDVNHASVSVVNDLMIQQATVNMGNRFYTQEQLRSARS  635

Query  1464  SKLAETL  1444
             SK+   L
Sbjct  636   SKIGNAL  642



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/617 (56%), Positives = 432/617 (70%), Gaps = 46/617 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D++G ++LGWG+G+YK E DK K + +  
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSY-DYSGSAILGWGEGFYKDERDKVKAKAKTT  136

Query  3018  SSPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             +S AEQ +RKKVLR+LNSLISG   ++ D  VD+EVTDTEWFFL+SMT SF+NG GLPGQ
Sbjct  137   TSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLISMTQSFVNGGGLPGQ  196

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF  S+P+W++G D+L +SPCERARQ + FGL+TMVC+P++NGVVELGST+LI QS DLM
Sbjct  197   AFFHSTPVWVAGPDRLAASPCERARQGKVFGLQTMVCVPTANGVVELGSTELIYQSSDLM  256

Query  2664  NKVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSS--GVD-VNTSVQENS  2500
             NK RVLF+FNN ++GS  +SG  + A   ENDPS+ WL +P++++    D VNTS   N+
Sbjct  257   NKARVLFDFNNLEVGSCPMSGGGATADQGENDPSSFWLNDPSTTTMEAKDPVNTSATTNT  316

Query  2499  IPSSSVKEIVFRNEN------------SIPSSTGNNHHDSQPSQYFTRELNFSEF-GFDG  2359
                   K   F N               +P          Q   +FT ELNFS + G+DG
Sbjct  317   SNQLISKPAQFDNHPSSSSLSENPSPIQVPQLQQQVQQQQQTQSFFTMELNFSNYDGYDG  376

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG--------DEsks  2203
             +     +   + ++SHS KPE+GEILNFGES  KR+    + +   G        D +  
Sbjct  377   S-----SVKNSNSNSHSLKPESGEILNFGES--KRSSYSANGKLFSGHSQITAAEDNNSK  429

Query  2202  kkktatlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLA  2032
             KK++   + SN+EG+LSF SG++           G  SDHSDLEASVV+EADS  V    
Sbjct  430   KKRSPPSRGSNDEGILSFSSGVILPSSCVVKSSGGADSDHSDLEASVVREADSSRV---V  486

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  487   DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  546

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPD---PNPKKTTTPHKIPDMD  1681
             I+YINELK KL+T E+  ++L+ Q +S+   L  K+ R         +      K+ DMD
Sbjct  547   ISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSRSSGSIMSEEELKGCSSKLLDMD  606

Query  1680  VDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTR  1501
             +DVK++G DAMIRIQC KKNHPAARLM ALK+LD++V HASVSV+NDLMIQQA VKMG+R
Sbjct  607   IDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVHHASVSVVNDLMIQQATVKMGSR  666

Query  1500  LYNQDQLRLALISKLAE  1450
             +Y QD LRLAL SK+ E
Sbjct  667   IYTQDHLRLALHSKVGE  683



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/611 (58%), Positives = 427/611 (70%), Gaps = 65/611 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK---RNR  3025
             NQETLQQRLQTLI+GARE+WTYAIFWQ+S    +G SLLGWGDGYYKGEEDK K   +  
Sbjct  60    NQETLQQRLQTLIEGARESWTYAIFWQSSYDYSSGTSLLGWGDGYYKGEEDKVKAKGKTP  119

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
               +S AEQ HRKKVLRELNSLISGP+++ + VDEEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  120   KTTSSAEQDHRKKVLRELNSLISGPSASVDDVDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  179

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +SSP+W++G D+L  S CERA Q Q FGL+T+VCIPS+NGVVEL ST++I Q+ DLM
Sbjct  180   AFFNSSPVWVAGPDRLSESVCERAHQGQMFGLQTLVCIPSANGVVELASTEVIFQNPDLM  239

Query  2664  NKVRVLFNF-NNPDMGSIS-GSASWAAPPENDPSALWLT-EPTSSSGV-----DVNTSVQ  2509
             NKVR LFNF NNP+ GS +    +     ENDPS+LWL  E   SS V      VN ++Q
Sbjct  240   NKVRDLFNFNNNPETGSWALNCVATTDQGENDPSSLWLNPEIRDSSTVAPPNSTVNKTLQ  299

Query  2508  ENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlr  2329
               +  SS++ +        +P S G          +F+RELNF                 
Sbjct  300   FETPGSSTLTDTPSAAAVHVPKSNGQG--------FFSRELNF-----------------  334

Query  2328  ngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSF  2149
                 S+S KPE+GEIL+FGES  K + NG+    +   E  +KK++   ++S ++GMLSF
Sbjct  335   ----SNSLKPESGEILSFGES-KKSSYNGSFFPGVVAIEENNKKRSPVSRSSIDDGMLSF  389

Query  2148  GS---GMVK--ssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
              S     +K  S G    G  SDHSDLEAS+VK+ADSR +E     EKRPRKRGRKPANG
Sbjct  390   TSLPAANIKSGSGGAGAGGGDSDHSDLEASMVKQADSRVME----PEKRPRKRGRKPANG  445

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL   +S
Sbjct  446   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLNGLDS  505

Query  1803  YIDDLKIQAQSLKK--ELSTKEPRHP-----------DPNPKKTTTPHKIPDMDVDVKVM  1663
                +L+ Q  S KK  EL+TK P  P           +   KKTTT  K+ D++++VK++
Sbjct  506   EKGELEKQLDSAKKELELATKNPPPPPPPPPGLPPSNNEEAKKTTT--KLADLEIEVKII  563

Query  1662  GWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQ  1483
             GWDAMIRIQC+KKNHPAARLM ALKDLDLEV HASVSV+NDLMIQQA V MG + Y Q+Q
Sbjct  564   GWDAMIRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLMIQQATVNMGNKFYTQEQ  623

Query  1482  LRLALISKLAE  1450
             L  AL SK+ +
Sbjct  624   LLSALSSKVGD  634



>gb|ACN21638.1| putative basic helix-loop-helix protein BHLH22 [Lotus japonicus]
Length=641

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/624 (57%), Positives = 435/624 (70%), Gaps = 56/624 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA-  3019
             NQ+TLQQRLQ LI+GARETWTYAIFWQ S  D++G SLLGWGDGYYKGEEDK K    A 
Sbjct  30    NQDTLQQRLQALIEGARETWTYAIFWQPSY-DYSGTSLLGWGDGYYKGEEDKAKAKAKAK  88

Query  3018  ---SSPAEQAHRKKVLRELNSLISGPAs--tdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                +S AEQ HR+KVLR+LNSLISG ++  +D++VDEEVTDTEWFFLVSMT SF+NG GL
Sbjct  89    AKATSSAEQEHRRKVLRDLNSLISGSSAPASDDAVDEEVTDTEWFFLVSMTQSFVNGGGL  148

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              GQA+ +S+P+W++G D+L +S CERARQ Q FG++T+VC+PS+NGVVELGST+LI Q+ 
Sbjct  149   AGQAYFNSTPVWVAGADRLAASACERARQGQLFGIQTLVCVPSANGVVELGSTELIYQNS  208

Query  2673  DLMNKVRVLFNFNNP--DMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNT---SVQ  2509
             DLMNKV+VLFNF+N   D+GS S +       ENDPSALWL +P       V+T   +  
Sbjct  209   DLMNKVKVLFNFSNSNLDLGS-SWTLGSTTTAENDPSALWLADPDPDGRDSVSTVAPTTA  267

Query  2508  ENSIPS------SSVKEIVFRNENS-----IPSSTGNNHHDSQ----PSQYFTRELNFSE  2374
               SIPS      S  K + F    S      PS+    +  SQ     S +F+RE+NFSE
Sbjct  268   SVSIPSHHNNDQSIAKTLQFETPVSSTLTETPSAVNLTNQPSQNQRNQSSFFSREMNFSE  327

Query  2373  FGFDGAnnnhnndlrngNSSHS-CKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskk  2197
             + FD          +NG+S+H   KPE+GEIL+FG+S    N      QF+   E  +  
Sbjct  328   YSFDA---------KNGSSNHQHLKPESGEILSFGDSKRTPNFFSGQSQFVPAVEENNNG  378

Query  2196  ktat--lkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAVETLA  2032
             K  +   ++SN++GMLSF SG++    +      G  S+HSDLEASVVKEADS     L 
Sbjct  379   KKRSPNSRSSNDDGMLSFTSGVILPSSNLKSSTGGGDSEHSDLEASVVKEADS---SRLV  435

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  436   EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  495

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPR-----HPDPNPKK-----TTTP  1702
             I+YI ELK+KL++SES    L+ Q  ++KKEL     +      P PN  K     +++ 
Sbjct  496   ISYITELKTKLQSSESDKTGLQKQFDAMKKELEKTSEQSSSPTPPPPNKNKSFSSSSSSS  555

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
             ++I   D+DVK++GWDAMIR+QC+KKNHPAA LM AL +LDLEV HASVSV+ND MIQQA
Sbjct  556   NQILVEDIDVKIIGWDAMIRVQCSKKNHPAAILMAALMELDLEVNHASVSVVNDTMIQQA  615

Query  1521  AVKMGTRLYNQDQLRLALISKLAE  1450
              VKMG+R Y Q+QLR AL SK  +
Sbjct  616   TVKMGSRFYTQEQLRSALSSKFGD  639



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/622 (56%), Positives = 438/622 (70%), Gaps = 55/622 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D +G S+LGWG+G+YK E DK K     +
Sbjct  74    NQETLMQRLQALIEGARESWTYAIFWQSSY-DMSGASVLGWGEGFYKDERDKVKTKPKTT  132

Query  3015  -SPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              S  EQ +RKKVLR+LNSLISG   ++ D  VD+EVTDTEWFFLVSMT +F+NG GLPGQ
Sbjct  133   TSLVEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQNFVNGGGLPGQ  192

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF  S+P+W++G D+L +S CERARQ Q FGL+TMVC+P++NGVVELGST+LI QS DLM
Sbjct  193   AFFHSNPVWVAGPDRLAASSCERARQGQVFGLQTMVCVPTANGVVELGSTELIFQSSDLM  252

Query  2664  NKVRVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQ---ENS  2500
             NKVRVLF+FNN ++GS  + G+A      E+DPS+LW+ +  SS+   V  SV      S
Sbjct  253   NKVRVLFDFNNLEVGSWPMGGAADQG---ESDPSSLWINDNPSSTIEVVKESVNIAPATS  309

Query  2499  IPSSSVKEIVFRN----ENSIPSSTGNNHHDS------------------QPSQYFTREL  2386
              PS+S   I  +N    +N+ PSS+G + + S                  Q   +FTREL
Sbjct  310   GPSTSNHHIS-KNPIPFDNNHPSSSGLSDNPSAVLQVSHHQQQQPQQQVTQTQSFFTREL  368

Query  2385  NFSEF-GFDGAnnnhnndlrngNSSHSCKPEAGEILNFGE----SVTKRNGNGNSCQFLG  2221
             NFS++ G+DG+     +   + ++SHS KPE+GEILNFGE    S +  NG   S Q   
Sbjct  369   NFSDYNGYDGS-----SVKNSNSNSHSMKPESGEILNFGESKRTSYSANNGKLFSAQSQI  423

Query  2220  GDEskskkktatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEAD  2056
               E  +KKK +     +EEG+LSF SG++                SDHSDLEASV KEAD
Sbjct  424   AAEDTNKKKRSPSSRGSEEGILSFTSGVILPSSSGVVKSSAGPADSDHSDLEASVAKEAD  483

Query  2055  SRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  1876
             S  V      EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD
Sbjct  484   SSRV---VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  540

Query  1875  KASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHK  1696
             KASLLGDAI+YI ELK+KL+T+ES  +D++ Q ++L KEL  +E R      ++     K
Sbjct  541   KASLLGDAISYITELKTKLQTTESDKEDMQKQVETLSKEL--QESRSCSGLDQELKGSTK  598

Query  1695  IPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAV  1516
             + D+D+DVK++GWDA I+IQC+KKNHPAARLM AL +LDL+V HASVSV+NDLMIQQA V
Sbjct  599   LIDLDIDVKILGWDARIQIQCSKKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATV  658

Query  1515  KMGTRLYNQDQLRLALISKLAE  1450
             +MG+R+Y Q+QLRLAL +K+ +
Sbjct  659   RMGSRIYTQEQLRLALSAKVGD  680



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/600 (59%), Positives = 421/600 (70%), Gaps = 59/600 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRL  LI+GARE+WTYAIFWQ+S  ++  P+ L WGDGYYKGE+DKG R + AS
Sbjct  73    NQETLQQRLLALIEGARESWTYAIFWQSSAAEYGAPAALTWGDGYYKGEDDKGNR-KSAS  131

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvd---eevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             SPAEQ HRKKVLRELNSLISG  ST  + +   EEVTDTEWFFL+SMT SF NGSG+PGQ
Sbjct  132   SPAEQEHRKKVLRELNSLISGTQSTTAADEPVDEEVTDTEWFFLISMTQSFANGSGIPGQ  191

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  SSSP+W                        T+VCIPSSNGVVELGST++I QS DLM
Sbjct  192   ALYSSSPVW------------------------TIVCIPSSNGVVELGSTEVIFQSSDLM  227

Query  2664  NKVRVLFNFNN-PDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNT-------SVQ  2509
              KVRVLFNFNN  + GS SGS SWA P   DP+ALWLT+P+SS+ +D ++       +  
Sbjct  228   KKVRVLFNFNNGAETGSGSGSGSWALPDNVDPAALWLTDPSSST-MDKDSFNNINNNNTT  286

Query  2508  ENSIPSS-SVKEIVFRNENSIPSS---TGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnnh  2344
              NS+P S + K++ F NEN  P S   T N H+ +  +  Y  RELNFSEFG  G++N  
Sbjct  287   TNSVPCSITSKQVAFGNENPNPCSSTLTDNPHNQTTNNPGYLNRELNFSEFGAHGSSNVR  346

Query  2343  nndlrngNSSHSCKPEAGEILNFGESVTKR----NGNGNSCQFLGGDEskskkktatlka  2176
                     ++  CK E+GEILNFGES+        G  N+      +    KK + T + 
Sbjct  347   --------NAGLCKRESGEILNFGESIKTSPFGAQGENNNNNNSNNNNKNKKKTSPTSRG  398

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
             SN+EGMLSF SGMVK+ GG G    SD SDLEASVVKE +S  V      EKRPRKRGRK
Sbjct  399   SNDEGMLSFTSGMVKNGGGGGGVVDSDQSDLEASVVKEVESSRV---VDPEKRPRKRGRK  455

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL+
Sbjct  456   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLQ  515

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
               E   D+L+ Q +S    +  K+ +  + +  K  +   I DM++DVK++GWDAMIR+Q
Sbjct  516   NVELDKDELRRQLESSSSSMQKKKDK--EYSSAKEESSKGIVDMEIDVKIIGWDAMIRVQ  573

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             C+KKNHPAA++MVAL++LDL+V HASVSV+NDLMIQQA VKM  R ++QDQLR ALISKL
Sbjct  574   CSKKNHPAAKMMVALRELDLDVHHASVSVVNDLMIQQATVKMEGRFFSQDQLRAALISKL  633



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/622 (54%), Positives = 428/622 (69%), Gaps = 67/622 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ+TLQQRLQ LID A E+WTYAIFWQ+SV++++GP +LGWGDGYYKGE +K K+   A+
Sbjct  56    NQDTLQQRLQGLIDTAHESWTYAIFWQSSVLEYSGPPILGWGDGYYKGEPNKPKQVMSAT  115

Query  3015  SPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             S AEQ +RKKVLRELNS+ISG  A  +++VDEEVTDTEWFFL+SMT SF+NG GLPGQA 
Sbjct  116   SLAEQQYRKKVLRELNSMISGTQAPENDAVDEEVTDTEWFFLISMTQSFVNGVGLPGQAM  175

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              ++ P+W++G+++L++S CERARQ + FGL+T+VCIPS++GV+ELGST+LI QS D+M K
Sbjct  176   VANQPVWVAGRERLMTSHCERARQGEGFGLQTIVCIPSADGVIELGSTELIYQSSDIMKK  235

Query  2658  VRVLFNFNNP----DMGSISGSASWAAPPENDPSALWLTEPTSSS---------------  2536
             VR  FNFN       +  ++  ++       DPS++WLT+P ++S               
Sbjct  236   VRGSFNFNQARDPMQVNDVNDDST-------DPSSIWLTDPVATSVSTVTTDVTVIKDTV  288

Query  2535  ---GVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGF  2365
                G ++ TSV   S+ S   K++ F N NS+  +  + H+      + +RELNFS  G 
Sbjct  289   GVIGSEMMTSVLP-SVKSHVPKQLPFENPNSLSQNPRSGHN------FGSRELNFSMEGG  341

Query  2364  DGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkkta-  2188
              G  N          +S   KPE G+ L+FGES  KR+   N   F+G D + +   T  
Sbjct  342   SGGKNL---------NSSYTKPEPGKFLSFGES--KRSITNNGALFVGTDNNNNNNNTNK  390

Query  2187  -----tlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADS-RAVETLAAA  2026
                  T   SNE+G+LSF SG  KS      G  SDHSDL+AS++KE +S R VE     
Sbjct  391   KKRSPTSCGSNEDGILSFVSGTAKSGAVAFTGADSDHSDLDASMIKEVESIRVVE----P  446

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI 
Sbjct  447   EKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIL  506

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH--------PDPNPKKTTTPHKIP  1690
             YINELKSK++ ++   ++L+ Q ++LKKEL TK+ R         PD     T     I 
Sbjct  507   YINELKSKVDNTQCDKEELRNQLEALKKELLTKDSRQSSSSAISLPDDMKMPTGVHSAIA  566

Query  1689  DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKM  1510
             D+D+DVKVMGWDAMIRIQC KKNHPAARLM   K+LD EV HASVS++NDLMIQQA VKM
Sbjct  567   DLDIDVKVMGWDAMIRIQCNKKNHPAARLMAVFKELDFEVNHASVSIVNDLMIQQATVKM  626

Query  1509  GTRLYNQDQLRLALISKLAETL  1444
             G+RLY+QDQLR+AL +   + L
Sbjct  627   GSRLYSQDQLRVALTNGFTDRL  648



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/625 (56%), Positives = 441/625 (71%), Gaps = 60/625 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP-SLLGWGDGYYKGEEDKGK-RNRP  3022
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D++G  ++LGWG+G+YK E DK K + + 
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSY-DYSGAGAVLGWGEGFYKDERDKVKAKAKT  136

Query  3021  ASSPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
              +S AEQ +RKKVLR+LNSLISG   ++ D  VD+EVTDTEWFFLVSMT SF+NG GLPG
Sbjct  137   TTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGLPG  196

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QAF  S+P+W++G D+L +S CERARQ   FGL+TMVC+P++NGVVELGST+LI Q+ DL
Sbjct  197   QAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTELIYQTSDL  256

Query  2667  MNKVRVLFNFNNPDMGS----ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENS  2500
             MNKVRVLFNFNN ++GS     + +A+ A   ENDPS LWL +P++++ ++V   V  ++
Sbjct  257   MNKVRVLFNFNNLEVGSWPMAGAAAAATADQGENDPS-LWLNDPSTTT-MEVKDPVNASA  314

Query  2499  IPSSS----VKEIVFRNENSIPSSTGNNHHDSQPS------------QYFTRELNFSEF-  2371
               S+S     K I F N  S  S + N      P              +FTRELNFS++ 
Sbjct  315   PTSTSNQPISKPIQFDNHPSSSSLSENPSPVQVPQLQQQVQQQQQTQSFFTRELNFSDYN  374

Query  2370  GFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG--------D  2215
             G+D      ++   + ++SHS KPE+GEILNFGES  KR+    + +   G        D
Sbjct  375   GYD-----RSSVKNSXSNSHSLKPESGEILNFGES--KRSSYSANGKLFSGHSQIAAAED  427

Query  2214  EskskkktatlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRAV  2044
              +  KK++     SNEEG+LSF SG++      G       SDHSDLEASVV+EADS  V
Sbjct  428   NNSKKKRSPPSLGSNEEGILSFSSGVILPSSGVGKSSGVADSDHSDLEASVVREADSSRV  487

Query  2043  ETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  1864
                   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL
Sbjct  488   ---VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  544

Query  1863  LGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH-----  1699
             LGDAI+YINELK KL+T E+  ++L+ Q +S+ K+L +K+ R    +   T   H     
Sbjct  545   LGDAISYINELKXKLQTVETDKEELQKQLESMNKDLPSKDSR----SSGSTVXEHEMKGS  600

Query  1698  --KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQ  1525
               K+ DMD+DVK++G DAMIRIQC KKNHPAARLM ALK+LDLEV HASVSV+NDLMIQQ
Sbjct  601   SSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVHHASVSVVNDLMIQQ  660

Query  1524  AAVKMGTRLYNQDQLRLALISKLAE  1450
             A VK G+R+Y QDQLRLAL SK+ +
Sbjct  661   ATVKAGSRIYTQDQLRLALHSKVGD  685



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/621 (56%), Positives = 440/621 (71%), Gaps = 61/621 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D++G ++LGWG            + +  +
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSY-DYSGGTVLGWGKA----------KAKTTT  126

Query  3015  SPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             S A+Q +RKKVLRELNSLISG   ++ D  VD+EVTDTEWFFLVSMT SF+ G GLPGQA
Sbjct  127   SAADQEYRKKVLRELNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVPGGGLPGQA  186

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F  S+P+W++G D+L +SPCERARQ Q FGL+TMVC+P++NGVVELGST+LI QS DL N
Sbjct  187   FFHSTPVWVAG-DRLAASPCERARQGQLFGLQTMVCVPTANGVVELGSTELIYQSSDLTN  245

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQE---NSIPS  2491
             KVRVLFNFNN ++GS       A   ENDPS+LW+ +P+S++ ++V   V      S P+
Sbjct  246   KVRVLFNFNNLEVGSWPMGGGGADQGENDPSSLWINDPSSTT-IEVKDPVNMAPVTSAPT  304

Query  2490  SSVKEIV---FRNENSIPSSTGNNHHDS---------------QPSQYFTRELNFSEFGF  2365
             S+  + V    + E+  PSS+  + + S               Q   +FTRELNFS++G+
Sbjct  305   STSTQPVSKPIQFESHQPSSSSLSENPSAIQLQQSQQQQQVQQQTQSFFTRELNFSDYGY  364

Query  2364  DGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG--------DEs  2209
             DG++  ++N      +SHS KPE+GEIL+FGES  KR+    + +   G        D +
Sbjct  365   DGSSGKNSNS-----NSHSLKPESGEILSFGES--KRSSYSANGKLFSGHSQIAAAEDNN  417

Query  2208  kskkktatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEADSRAV  2044
               KK++ T + SN+EG+LSF SG++         G G    SDHSDLEASVV+E DS  V
Sbjct  418   SKKKRSPTSRGSNDEGILSFSSGVILPSSGVVKSGGGGAADSDHSDLEASVVRETDSSRV  477

Query  2043  ETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  1864
                   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL
Sbjct  478   ---VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  534

Query  1863  LGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPR--HPDPNPKKTTTPHKIP  1690
             LGDAI+YINELK+KL+T+ES  +DL+ Q +S+ ++L  K+      D    K     K+ 
Sbjct  535   LGDAISYINELKAKLQTTESDKEDLQKQLESMNQDLGCKDSSSLSDDLKMSKHQASSKLI  594

Query  1689  DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKM  1510
             D+D+DVK++GWDAMIRIQC KKNHPAARLM +LK+LDL+V HAS+SV+NDLMIQQA VKM
Sbjct  595   DLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDLDVHHASISVVNDLMIQQATVKM  654

Query  1509  GTRLYNQDQLRLALISKLAET  1447
             G+R+Y QDQLRLAL+SK+ ++
Sbjct  655   GSRIYTQDQLRLALLSKIGDS  675



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/627 (56%), Positives = 443/627 (71%), Gaps = 62/627 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP-SLLGWGDGYYKGEEDKGK-RNRP  3022
             NQETL QRLQ LI+GARE+WTYAIFWQ+S  D++G  ++LGWG+G+YK E DK K + + 
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSY-DYSGAGAVLGWGEGFYKDERDKVKAKAKT  136

Query  3021  ASSPAEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
              +S AEQ +RKKVLR+LNSLISG   ++ D  VD+EVTDTEWFFLVSMT SF+NG GLPG
Sbjct  137   TTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGLPG  196

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QAF  S+P+W++G D+L +S CERARQ   FGL+TMVC+P++NGVVELGST+LI Q+ DL
Sbjct  197   QAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTELIYQTSDL  256

Query  2667  MNKVRVLFNFNNPDMGS-------ISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQ  2509
             MNKVRVLFNFNN ++GS        + +A+ A   ENDPS LWL +P++++ ++V   V 
Sbjct  257   MNKVRVLFNFNNLEVGSWPMAGGAAAAAAAAADQGENDPS-LWLNDPSTTT-MEVKDPVN  314

Query  2508  ENSIPSSS----VKEIVFRNENSIPSSTGNNHHDSQPSQ-----------YFTRELNFSE  2374
              ++  S+S     K I F N  S  S + N      P             +FTRELNFS+
Sbjct  315   ASAPTSTSNQPISKPIQFDNHPSSSSLSENPSPVQVPQLQQQVQQQQTQSFFTRELNFSD  374

Query  2373  F-GFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG-------  2218
             + G+D      ++   + ++SHS KPE+GEILNFGES  KR+    + +   G       
Sbjct  375   YNGYD-----RSSVKNSNSNSHSLKPESGEILNFGES--KRSSYSANGKLFSGHSQIAAA  427

Query  2217  -DEskskkktatlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSR  2050
              D +  KK++     SNEEG+LSF SG++      G    G  SDHSDLEASVV+EADS 
Sbjct  428   EDNNSKKKRSPPSLGSNEEGILSFSSGVILPSSGVGKSSGGADSDHSDLEASVVREADSS  487

Query  2049  AVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA  1870
              V      EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA
Sbjct  488   RV---VDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA  544

Query  1869  SLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH---  1699
             SLLGDAI+YINELK KL+T E+  ++L+ Q +S+ K+L +K+ R    +   T + H   
Sbjct  545   SLLGDAISYINELKLKLQTVETDKEELQKQLESMNKDLPSKDSR----SSGSTMSEHEMK  600

Query  1698  ----KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMI  1531
                 K+ DMD+DVK++G DAMIRIQC KKNHPAARLM ALK+LDLEV HASVSV+NDLMI
Sbjct  601   GSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVHHASVSVVNDLMI  660

Query  1530  QQAAVKMGTRLYNQDQLRLALISKLAE  1450
             QQA VK G+R+Y QDQLRLAL SK+ +
Sbjct  661   QQATVKAGSRIYTQDQLRLALHSKVGD  687



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/621 (56%), Positives = 429/621 (69%), Gaps = 65/621 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDK--GKRNRP  3022
             NQETLQ RLQ+LI+G+RE+WTYAIFWQ S    +G  LLGWGDGYYKGE++K  GK+   
Sbjct  61    NQETLQHRLQSLIEGSRESWTYAIFWQPSHDYSSGAPLLGWGDGYYKGEDEKEKGKKVIK  120

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAst-desvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              +SP EQAHRKKVLRELNSLISG + + D++V+E+VTDTEWFFL SMT SF+N SG   Q
Sbjct  121   TTSPEEQAHRKKVLRELNSLISGSSGSPDDAVEEDVTDTEWFFLTSMTQSFVNSSGSLSQ  180

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIP--SSNGVVELGSTDLILQSFD  2671
             A+ +S+P+WISG D+L  S CERARQAQ  GL+T+VCIP  SSNGVVEL ST++I  S D
Sbjct  181   AYFNSTPVWISGPDRLSISACERARQAQFLGLQTLVCIPTPSSNGVVELASTEIIPYSSD  240

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVD-------VNTSV  2512
             LM KVR LFNFNNP+ GS   ++      ENDPS+LWL +P+ S+G++       VNT+V
Sbjct  241   LMEKVRALFNFNNPEAGSWPLNSVTTDQSENDPSSLWLNDPSGSAGIEIKDSVNAVNTTV  300

Query  2511  QENSIPSSSVK-EIVFRNENSIPSSTGNNHH-------DSQPSQYFTRELNFSEFGFDGA  2356
               N+    S++ E      +S  + T N  H        +Q   +F +ELNFS       
Sbjct  301   SANAAIGKSLQFETQTHGSSSTLTETPNVIHVHNAQRNQNQNQSFFPKELNFSS------  354

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGES----VTKRNGNGNSCQFLG-----GDEsks  2203
                            S KPE+GEILNFGES     +  NGNGN   F G       E   
Sbjct  355   ---------------SMKPESGEILNFGESKKSSYSAVNGNGNGNFFSGQSPFAAGEENR  399

Query  2202  kkktatlkaSNEEGMLSFGSGMV------KssggigigdssDHSDLEASVVKEADS-RAV  2044
             K+++   ++S ++G+LSF SG++      KSSGGIG G  SD SDLE SVVKEADS R +
Sbjct  400   KRRSPVSRSSVDDGILSFTSGVLLPASNMKSSGGIGTGGDSDQSDLEVSVVKEADSSRVI  459

Query  2043  ETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  1864
             E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASL
Sbjct  460   E----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASL  515

Query  1863  LGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL---STKEPRHPDPNPKKTTTPHKI  1693
             LGDAI+YINELK KL+  ES   +L+ Q  + KKEL   S K P  P  + +K  T  K+
Sbjct  516   LGDAISYINELKEKLQGLESSKGELEKQLDTTKKELELASNKNPLLP-LDKEKLKTNCKL  574

Query  1692  PDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVK  1513
              D+D++VKV+GWDAMIR+QC+KKNHPAA+LMVALK+LD+EV HASVSV+NDLMIQQA V 
Sbjct  575   IDLDIEVKVIGWDAMIRVQCSKKNHPAAKLMVALKELDVEVNHASVSVVNDLMIQQATVN  634

Query  1512  MGTRLYNQDQLRLALISKLAE  1450
             MG + Y ++QL   L SK+ +
Sbjct  635   MGNQFYTKEQLLSVLSSKIGD  655



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/636 (55%), Positives = 437/636 (69%), Gaps = 69/636 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR-PA  3019
             NQETLQQRLQ LI+G+RE WTYAIFWQ+S  D++G S+LGWGDGYYKGE +KGK ++   
Sbjct  65    NQETLQQRLQQLIEGSREGWTYAIFWQSSC-DYSGSSMLGWGDGYYKGEGEKGKSSKIKT  123

Query  3018  SSPAEQAHRKKVLRELNSLISGPAs--tdesvdeevtdtEWFFLVSMTHSFI-----NGS  2860
             SS AEQ HRKKVLRELNSLISG  S  TD++VDEEVTDTEWFFL+SMT SF       G 
Sbjct  124   SSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGGGG  183

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPGQA+  +SP+W+SG ++L +S C+RARQ Q FGL+T+VCIPS+NGVVELGST++I+Q
Sbjct  184   GLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVIIQ  243

Query  2679  SFDLMNKVRVLFNFNNP-DMGSISGSASWAAPPENDPSALWLTEPT-----SSSGVDVNT  2518
             + DLMNKVR LFNFN   ++G+   +       ENDPS+ W+ +P+     ++  +++  
Sbjct  244   NSDLMNKVRFLFNFNGSMEIGTWPSAMQNPDQGENDPSS-WINDPSPTPAPTAGFIEIKD  302

Query  2517  SVQENS-------------IPSSSVKEIVFRNENSIPSSTG-------NNHHDSQPSQYF  2398
             S    +             I S S   +       +PSS          +    Q   +F
Sbjct  303   STAAAATTTTTTTTTTTPVIGSGSASNLSKGIHFELPSSVSLTESVDLQHQQIPQTQSFF  362

Query  2397  TRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN---GNGNSC--  2233
             TRELNFSE+ +D       ++     SS   KPE+GEILNF ES  KR+   GNGN+   
Sbjct  363   TRELNFSEYAYD-------HNSVKNGSSRLFKPESGEILNFAES--KRSSCTGNGNNSLL  413

Query  2232  ----QFLGGDEskskkktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEA  2077
                 QF+  +ES  KK++ T + S EEGMLSF SG++          G    SDHSDLEA
Sbjct  414   SNHSQFVA-EESNKKKRSPTSRGSTEEGMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEA  472

Query  2076  SVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  1897
             SVVK+ DS  VE     EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV
Sbjct  473   SVVKDPDSSRVE----PEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  528

Query  1896  PNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL------STKEPRH  1735
             PNVSKMDKASLLGDAI+YINEL++KL+++ES  +DL+ +  S+KKEL      S   P  
Sbjct  529   PNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKELASVKKELAGGGKDSHSGPST  588

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
              D + K +    K+ D+D++VK++GWDAMIRIQ +KKNHPAA+LM ALK+LDLEV HAS+
Sbjct  589   SDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMEALKELDLEVNHASM  648

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             SV+NDLMIQQA VKMG+R Y Q+QL+  L +K+ +T
Sbjct  649   SVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVGDT  684



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/636 (55%), Positives = 436/636 (69%), Gaps = 69/636 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR-PA  3019
             NQETLQQRLQ LI+G+RE WTYAIFWQ+S  D++G S+LGWGDGYYKGE +KGK ++   
Sbjct  65    NQETLQQRLQQLIEGSREGWTYAIFWQSSC-DYSGSSMLGWGDGYYKGEGEKGKSSKIKT  123

Query  3018  SSPAEQAHRKKVLRELNSLISGPAs--tdesvdeevtdtEWFFLVSMTHSFI-----NGS  2860
             SS AEQ HRKKVLRELNSLISG  S  TD++VDEEVTDTEWFFL+SMT SF       G 
Sbjct  124   SSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGGGG  183

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPGQA+  +SP+W+SG ++L +S C+RARQ Q FGL+T+VCIPS+NGVVELGST++I+Q
Sbjct  184   GLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVIIQ  243

Query  2679  SFDLMNKVRVLFNFNNP-DMGSISGSASWAAPPENDPSALWLTEPT-----SSSGVDVNT  2518
             + DLMNKVR LFNFN   ++G+   +       ENDPS+ W+ +P+     ++  +++  
Sbjct  244   NSDLMNKVRFLFNFNGSMEIGTWPSAMQNPDQGENDPSS-WINDPSPTPAPTAGFIEIKD  302

Query  2517  SVQEN-------------SIPSSSVKEIVFRNENSIPSSTG-------NNHHDSQPSQYF  2398
             S                 +I S S   +       +PSS          +    Q   +F
Sbjct  303   STAAATTTTTTTTTTTTPAIGSGSASNLSKGIHFELPSSVSLTESVDLQHQQIPQTQSFF  362

Query  2397  TRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN---GNGNSC--  2233
             TRELNFSE+ +D       ++     SS   KPE+GEILNF ES  KR+   GNGN+   
Sbjct  363   TRELNFSEYAYD-------HNSVKNGSSRLFKPESGEILNFAES--KRSSCTGNGNNSLL  413

Query  2232  ----QFLGGDEskskkktatlkaSNEEGMLSFGSGMV----KssggigigdssDHSDLEA  2077
                 QF+  D S  KK++ T + S EEGMLSF SG++          G    SDHSDLEA
Sbjct  414   SNHSQFVAED-SNKKKRSPTSRGSTEEGMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEA  472

Query  2076  SVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  1897
             SVVK+ DS  VE     EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV
Sbjct  473   SVVKDPDSSRVE----PEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  528

Query  1896  PNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL------STKEPRH  1735
             PNVSKMDKASLLGDAI+YINEL++KL+++ES  +DL+ +  S+KKEL      S   P  
Sbjct  529   PNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKELASVKKELAGGGKDSHSGPST  588

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
              D + K +    K+ D+D++VK++GWDAMIRIQ +KKNHPAA+LM ALK+LDLEV HAS+
Sbjct  589   SDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLEVNHASM  648

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             SV+NDLMIQQA VKMG+R Y Q+QL+  L +K+ +T
Sbjct  649   SVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVGDT  684



>ref|XP_010058170.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
Length=699

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/643 (56%), Positives = 423/643 (66%), Gaps = 78/643 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDG-ARETWTYAIFWQASVVDFAGPSL--------------LGWGDGY  3061
             NQ+TLQ RLQTLID  +R  WTYAIFWQ+S   + GP+               LGWGDGY
Sbjct  73    NQDTLQHRLQTLIDSTSRYPWTYAIFWQSSFDGYPGPAAAPPAASSASPPVPVLGWGDGY  132

Query  3060  YKGEEDK--GKRNRPASSPAEQAHRKKVLRELNSLISGPAstdesvd-----eevtdtEW  2902
             YKGEEDK  GK    ASS AEQ HRK+VLRELNSLI+GP+S   +       EEVTDTEW
Sbjct  133   YKGEEDKSKGKAKISASSAAEQEHRKRVLRELNSLIAGPSSAAAAAPDDAVDEEVTDTEW  192

Query  2901  FFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSS  2722
             FFLVSMT SF N   LPGQA   S+P+W+SG D+L    CERA+QA+ FGL TMVC+P  
Sbjct  193   FFLVSMTQSFGNDGSLPGQALYGSTPLWVSGGDRLADCGCERAKQARIFGLNTMVCVPVI  252

Query  2721  NGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTS  2542
              GVVELGST+ I QS DL+NKVR LFNF         G+ +     E+DPS+LWL +P  
Sbjct  253   GGVVELGSTEPIYQSPDLLNKVRNLFNFTGGMELGFGGNGNDQG--ESDPSSLWLNDPAG  310

Query  2541  SSGVDVNTSVQENSIPSSS--------VKEIVFRNENSIPSSTGNN----HHDS------  2416
             +  V  +      ++  SS         K I   N N + SS G      H D+      
Sbjct  311   TVEVKDSAVAGAAAVTGSSNYNGSNHGSKSIQLEN-NHVLSSMGEKPTAIHRDNPRHNYP  369

Query  2415  ------QPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKR  2254
                   Q   +FTRELNFSEFGFDG++  +        +SH  KPE+GEIL+FGES  KR
Sbjct  370   QSNQQMQGQSFFTRELNFSEFGFDGSSARNG-------NSHPMKPESGEILSFGES--KR  420

Query  2253  ---NGNGN--SCQF-LGGDEskskkktatlkaSNEEGMLSFGSGMV----Kssggigigd  2104
                NGNGN  S Q  L   E   K+++ T + SNEEGMLSF SG+V          G   
Sbjct  421   VSCNGNGNLYSGQSQLTAVEESKKRRSPTSRGSNEEGMLSFTSGVVLPSSGMVKSSGGAG  480

Query  2103  ssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  1927
              SDHSDLEASVVKEADS R +E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  481   DSDHSDLEASVVKEADSSRVIE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  536

Query  1926  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTK  1747
             QRFYALRAVVPNVSKMDKASLLGDAIAYI EL SKL+T+ES  ++L+ Q +SLKKEL+ K
Sbjct  537   QRFYALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNK  596

Query  1746  EPRHPDPNPKK---TTTPH--KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDL  1582
             + R   P   K    ++ H  K+ ++DVDVK++GWD MIRIQ +KKNHPAA+LM AL +L
Sbjct  597   DSRSALPQSDKDLSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMEL  656

Query  1581  DLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             DL+V HASVSV+NDLMIQQA VKM  R Y Q+QLRLAL SK+ 
Sbjct  657   DLDVHHASVSVVNDLMIQQATVKMSGRFYTQEQLRLALSSKIG  699



>gb|KCW71784.1| hypothetical protein EUGRSUZ_E00277 [Eucalyptus grandis]
Length=713

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/643 (56%), Positives = 423/643 (66%), Gaps = 78/643 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDG-ARETWTYAIFWQASVVDFAGPSL--------------LGWGDGY  3061
             NQ+TLQ RLQTLID  +R  WTYAIFWQ+S   + GP+               LGWGDGY
Sbjct  87    NQDTLQHRLQTLIDSTSRYPWTYAIFWQSSFDGYPGPAAAPPAASSASPPVPVLGWGDGY  146

Query  3060  YKGEEDK--GKRNRPASSPAEQAHRKKVLRELNSLISGPAstdesvd-----eevtdtEW  2902
             YKGEEDK  GK    ASS AEQ HRK+VLRELNSLI+GP+S   +       EEVTDTEW
Sbjct  147   YKGEEDKSKGKAKISASSAAEQEHRKRVLRELNSLIAGPSSAAAAAPDDAVDEEVTDTEW  206

Query  2901  FFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSS  2722
             FFLVSMT SF N   LPGQA   S+P+W+SG D+L    CERA+QA+ FGL TMVC+P  
Sbjct  207   FFLVSMTQSFGNDGSLPGQALYGSTPLWVSGGDRLADCGCERAKQARIFGLNTMVCVPVI  266

Query  2721  NGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTS  2542
              GVVELGST+ I QS DL+NKVR LFNF         G+ +     E+DPS+LWL +P  
Sbjct  267   GGVVELGSTEPIYQSPDLLNKVRNLFNFTGGMELGFGGNGNDQG--ESDPSSLWLNDPAG  324

Query  2541  SSGVDVNTSVQENSIPSSS--------VKEIVFRNENSIPSSTGNN----HHDS------  2416
             +  V  +      ++  SS         K I   N N + SS G      H D+      
Sbjct  325   TVEVKDSAVAGAAAVTGSSNYNGSNHGSKSIQLEN-NHVLSSMGEKPTAIHRDNPRHNYP  383

Query  2415  ------QPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKR  2254
                   Q   +FTRELNFSEFGFDG++  +        +SH  KPE+GEIL+FGES  KR
Sbjct  384   QSNQQMQGQSFFTRELNFSEFGFDGSSARNG-------NSHPMKPESGEILSFGES--KR  434

Query  2253  ---NGNGN--SCQF-LGGDEskskkktatlkaSNEEGMLSFGSGMV----Kssggigigd  2104
                NGNGN  S Q  L   E   K+++ T + SNEEGMLSF SG+V          G   
Sbjct  435   VSCNGNGNLYSGQSQLTAVEESKKRRSPTSRGSNEEGMLSFTSGVVLPSSGMVKSSGGAG  494

Query  2103  ssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  1927
              SDHSDLEASVVKEADS R +E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  495   DSDHSDLEASVVKEADSSRVIE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  550

Query  1926  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTK  1747
             QRFYALRAVVPNVSKMDKASLLGDAIAYI EL SKL+T+ES  ++L+ Q +SLKKEL+ K
Sbjct  551   QRFYALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNK  610

Query  1746  EPRHPDPNPKK---TTTPH--KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDL  1582
             + R   P   K    ++ H  K+ ++DVDVK++GWD MIRIQ +KKNHPAA+LM AL +L
Sbjct  611   DSRSALPQSDKDLSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMEL  670

Query  1581  DLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             DL+V HASVSV+NDLMIQQA VKM  R Y Q+QLRLAL SK+ 
Sbjct  671   DLDVHHASVSVVNDLMIQQATVKMSGRFYTQEQLRLALSSKIG  713



>ref|XP_004512525.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=664

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/631 (55%), Positives = 430/631 (68%), Gaps = 62/631 (10%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASS  3013
             Q+TLQQRLQ LI+GA ETWTYAIFWQ S  D++G SL GWGDGYYKGEEDK K      +
Sbjct  42    QDTLQQRLQALIEGATETWTYAIFWQPSY-DYSGTSL-GWGDGYYKGEEDKTKAKSKTKA  99

Query  3012  --PAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
               PAEQ HR+KVLRELNSLISG P   D +VDEEVTDTEWFFLVSMT SF+NGSGLPGQ 
Sbjct  100   TSPAEQEHRRKVLRELNSLISGNPTPDDSAVDEEVTDTEWFFLVSMTQSFVNGSGLPGQT  159

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             + +S+P+W++G + L  SP ERAR+ Q  GL+T+ CIPS+NGV+ELGST+LI Q+ DLMN
Sbjct  160   YFNSTPVWLTGGENLAVSPFERAREGQELGLQTLACIPSANGVLELGSTELIYQNNDLMN  219

Query  2661  KVRVLFNFNNP-DMGSI----SGSASWAAPPENDPSALWLTEPTSSSGVDVNT-------  2518
             KV++LFNFNN  ++GS      GS++ A   ENDPS++WL +P +   VD N+       
Sbjct  220   KVKMLFNFNNSFELGSAWQLGLGSSTIAHQGENDPSSIWLNDPETRDSVDNNSLAVTTTT  279

Query  2517  -SVQENSIPSSS--VKEIVFRNENS--IPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGA  2356
              +    SIPS +   K + F    S  +    G  H   + +Q +F++E+N  E+G    
Sbjct  280   TTNTSISIPSHNNVTKTLQFETHGSSTLTEVPGAVHVSQKQNQSFFSKEMNVLEYG----  335

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGES----------VTKRNGNGNSCQFLG-----  2221
               ++NN+  N       KPE+GEIL+FG+S           +  N      Q +      
Sbjct  336   -ASNNNNNNNQQHQRLLKPESGEILSFGDSKKSSYVANNGNSNSNFFSGQSQLVSVAEEN  394

Query  2220  -GDEskskkktatlkaSNEEGMLSFGSGMV--------KssggigigdssDHSDLEASVV  2068
               + +  K+   +  ++N++GMLSF SG++        K SGG G G  SDHSDLEASVV
Sbjct  395   NNNGNGKKRSPNSRGSNNDDGMLSFTSGVIVPPAGSNLKFSGGTGGGGDSDHSDLEASVV  454

Query  2067  KEADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  1891
             KE DS R VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN
Sbjct  455   KEVDSSRMVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  510

Query  1890  VSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL-----STKEPRHPDP  1726
             VSKMDKASLLGDAI+YI ELK+KL+ +ES  D L+ +   +KKEL     ++  P  P P
Sbjct  511   VSKMDKASLLGDAISYITELKTKLQKTESDKDVLEKEIDEVKKELQKINENSSNPSQPQP  570

Query  1725  NPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVM  1546
                K ++   + ++D+DVK++GWDAMIRIQC+KKNHPAARLM AL +LDLEV HASVSV+
Sbjct  571   LHNKPSSNKALINLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLEVHHASVSVV  630

Query  1545  NDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             NDLMIQQA VKMG R Y Q+QLR AL SK+ 
Sbjct  631   NDLMIQQATVKMGGRFYTQEQLRAALSSKVG  661



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   550 bits (1417),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 332/616 (54%), Positives = 413/616 (67%), Gaps = 84/616 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             +QE+LQQRLQ LI+GA E+WTYA+FWQ S  DF+G ++LGWGDGYYKGEEDK + + RP 
Sbjct  48    SQESLQQRLQALIEGAHESWTYAMFWQLSC-DFSGAAVLGWGDGYYKGEEDKARAKQRPR  106

Query  3018  SS----PAEQAHRKKVLRELNSLISGPAstdesv-deevtdtEWFFLVSMTHSFINGSGL  2854
             SS    PAEQ HRKKVLRELNSLISG A T E   DEEVTD EWFFLVSMT SF +GSGL
Sbjct  107   SSMFSSPAEQEHRKKVLRELNSLISGGAVTTEDAIDEEVTDMEWFFLVSMTQSFPSGSGL  166

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF +S+P+W+ G D+L  S CERARQ   FGL+T+ CIP +NGVVELGST++I QS 
Sbjct  167   TGKAFSTSNPVWVVGSDQLSGSGCERARQGGVFGLQTIACIPLANGVVELGSTEMIRQSS  226

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSG----------  2533
             DLMNKVR+LF+F+    G +SG   W   P   ENDPS +W+++PT  +           
Sbjct  227   DLMNKVRILFSFDGAAAGDLSGH-HWNRDPDQGENDPS-MWISDPTGGAAGPSERGHGAP  284

Query  2532  ----VDVNTSVQENSIPSSSVKEIVFRNENS------IPSSTGNNHHDSQPSQYFTRELN  2383
                    + S+Q  +  SS++ E    N N       + S T N  +++     F+RE+N
Sbjct  285   SSSSQLFSKSMQFENGSSSTITENQNANPNPNPNPSPVQSQTQNTKYNN-----FSREIN  339

Query  2382  FSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGN------SCQFLG  2221
             FS                  ++S+  KP +GEIL+FGE   + + N N        QFL 
Sbjct  340   FS-----------------TSNSNLAKPRSGEILSFGEDAKRSSSNLNPAPFSGQTQFLP  382

Query  2220  GDEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVE  2041
             GD     K+        E+G+LSFG            G+SSDHSDLEASVVKEA      
Sbjct  383   GD----TKRKTKSVGVTEDGVLSFG----------VPGESSDHSDLEASVVKEA------  422

Query  2040  TLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  1861
                A EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL
Sbjct  423   ---APEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  479

Query  1860  GDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP-DM  1684
             GDAI+YINELKSKL+ +ES    ++ Q ++LK EL+ +     + +   +++    P  M
Sbjct  480   GDAISYINELKSKLQRTESEKTQIECQLENLKSELAGRNANAGNRDCGDSSSAVSKPIGM  539

Query  1683  DVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGT  1504
             +++VK++GWDAMIRI+ +K+NHPAARLM ALKDL+LEV HAS+SV+NDLMIQQA VKMG 
Sbjct  540   EIEVKIIGWDAMIRIESSKRNHPAARLMSALKDLELEVNHASMSVVNDLMIQQATVKMGF  599

Query  1503  RLYNQDQLRLALISKL  1456
             R+Y Q+QLR ALISK+
Sbjct  600   RIYTQEQLRAALISKI  615



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score =   549 bits (1414),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 333/610 (55%), Positives = 401/610 (66%), Gaps = 52/610 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAG------PSLLGWGDGYYKGEEDKGK  3034
             N++TLQQRLQ LI+GARETWTYAI+WQ S    AG       + LGWGDGYYKGEEDKGK
Sbjct  68    NEDTLQQRLQALIEGARETWTYAIYWQLSYDSIAGGGDGEGTAFLGWGDGYYKGEEDKGK  127

Query  3033  RNRPASS--PAEQAHRKKVLRELNSLISGPAstdesvd---eevtdtEWFFLVSMTHSFI  2869
               +  SS    EQ HRK+V+RELN+LISG A    + D   EEVTDTEWFFLVSMT SF+
Sbjct  128   SKKRCSSVNAVEQEHRKRVIRELNALISGGAVAGAADDAGDEEVTDTEWFFLVSMTQSFL  187

Query  2868  NGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDL  2689
             NG+GLPGQAF     IW+SG   L  S CERA+Q Q +GLRT+VCIPS NGVVELGSTD+
Sbjct  188   NGTGLPGQAFLHCRTIWLSGSGALAGSGCERAQQGQIYGLRTLVCIPSDNGVVELGSTDV  247

Query  2688  ILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNT  2518
             I QS DLM KV  LFNFNN   G  +GS ++   P   ENDP+ LW+TEPT+   +D   
Sbjct  248   IQQSSDLMEKVNTLFNFNNG--GGEAGSWTFNLNPDEGENDPT-LWITEPTTR--IDSGH  302

Query  2517  SVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQ-----YFTRELNFSEFGFDGAn  2353
              +   +I + +       ++   P    N      P Q        R LN S  G +   
Sbjct  303   VIPTAAINNGNSNSNSNSHQFPKPGHFENGSSVENPGQNPQSSSLDRNLNLSSSGLN---  359

Query  2352  nnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLG-----GDEskskkkta  2188
                    +NGN S   +P++GEILNF       N NGN   F G       E+  K+   
Sbjct  360   -------QNGNFSDGSRPKSGEILNFC-----GNKNGNGTGFSGQTSFAAAENNKKRSPV  407

Query  2187  tlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKRPR  2011
             +  ++N+EGMLSF  G+V           SDHSD+EASV KEADS R VE     EK+PR
Sbjct  408   SKGSNNDEGMLSFTCGVV-LPSSAAKSGDSDHSDVEASVAKEADSSRIVE----PEKKPR  462

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINEL
Sbjct  463   KRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINEL  522

Query  1830  KSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--DMDVDVKVMGW  1657
             KSKL+ +ES  +DL+ Q   L KE S K+ R      +K       P  +M++DVK++GW
Sbjct  523   KSKLQEAESDKEDLQKQLNELNKEGSGKDSRPQSSKDRKGLNQDSGPAMEMEIDVKIIGW  582

Query  1656  DAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLR  1477
             D MIRIQC+KKNHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG R   QDQL+
Sbjct  583   DVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNRFLTQDQLK  642

Query  1476  LALISKLAET  1447
             +AL++K+ E+
Sbjct  643   VALMAKVGES  652



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score =   548 bits (1413),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 351/630 (56%), Positives = 420/630 (67%), Gaps = 89/630 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA-  3019
             NQETLQQRLQTLI+GA E+WTYAIFWQ+S    +G SLLGWGDGYYKGEEDK K    A 
Sbjct  67    NQETLQQRLQTLIEGACESWTYAIFWQSSYDYSSGTSLLGWGDGYYKGEEDKDKVKTKAP  126

Query  3018  --SSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
                S AEQ HRKKVLRELNSLISGP+++ + +DEEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  127   KTRSSAEQDHRKKVLRELNSLISGPSASADDIDEEVTDTEWFFLVSMTQSFVNGSGLPGQ  186

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +SSP+W++G ++L  S CERARQ Q FGL+T+VCIPS+NGVVEL S ++I Q+ DLM
Sbjct  187   AFFNSSPVWVAGPERLSESACERARQGQLFGLQTLVCIPSANGVVELASAEVIFQNPDLM  246

Query  2664  NKVRVLFNFNNPDMGSISGSASWAA-------PPENDPSALWLT-EPTSSSGVD-----V  2524
             NKVR LFNFNN +  +   + SWA          ENDPS+LWL  E   SS V      V
Sbjct  247   NKVRDLFNFNNNNNNNNPETCSWALNCVATTDQGENDPSSLWLNPEIKDSSTVSPPNSTV  306

Query  2523  NTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQ-YFTRELNFSEFGFDGAnnn  2347
             N ++   +  SS++ E         PS+    H  +  SQ +F RELNF           
Sbjct  307   NKTMHFETPGSSTLTE--------TPSAAAAVHVPNSKSQGFFPRELNF-----------  347

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG----------DEskskk  2197
                       S+S KPE+GEIL+FGES  K + NG    F  G          +++K K+
Sbjct  348   ----------SNSLKPESGEILSFGES-KKSSYNG---AFFPGVVAVEENNNNNKNKKKR  393

Query  2196  ktatlkaSNEEGMLSFGS----GMVKssggigigdssDHSDLEASVVKEADSRAVETLAA  2029
                  ++S ++GMLSF S     +   +G       SDHSDLEASV K+        +  
Sbjct  394   SPVVSRSSIDDGMLSFTSLPAANIKSVNGACVGAGDSDHSDLEASVAKQ--------VVE  445

Query  2028  AEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
              EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI
Sbjct  446   PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  505

Query  1848  AYINELKSKLETSESYIDDLKIQAQSLKK--ELSTKEPRHPDP-------------NPKK  1714
              YINELKSKL   +S   +L+ Q  S KK  EL+TK P  P P              PKK
Sbjct  506   LYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPPPPPPPPPPGPPPSNSVEPKK  565

Query  1713  TTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLM  1534
             TT+  K+ D++++VK++GWDAM+RIQC+KKNHPAARLM ALKDLDLEV HASVSV+NDLM
Sbjct  566   TTS--KLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLM  623

Query  1533  IQQAAVKMGTRLYNQDQLRLALISKLAETL  1444
             IQQA V MG + Y Q+QL  AL SK+ + L
Sbjct  624   IQQATVNMGNKFYTQEQLLSALSSKVGDEL  653



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   547 bits (1410),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 342/634 (54%), Positives = 422/634 (67%), Gaps = 71/634 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA-  3019
             NQ+TLQ RLQ LI+GARE+WTYAIFWQ S  D++G +LLGWGDGYYKG++DK K    A 
Sbjct  114   NQDTLQHRLQALIEGARESWTYAIFWQHSY-DYSGSALLGWGDGYYKGDDDKAKAKAKAK  172

Query  3018  -SSPAEQAHRKKVLRELNSLISGPAstdesvdeevtd-tEWFFLVSMTHSFINGSGLPGQ  2845
              +S AEQ HRKKVLRELNSLISG ++      +E    TEWFFLVSMT SF+NG+GLPGQ
Sbjct  173   ATSAAEQDHRKKVLRELNSLISGSSAASSDDVDEEVTDTEWFFLVSMTQSFVNGAGLPGQ  232

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +S+P+W+ G D+L +SPCERARQ Q FGL+T+VCIPS+NGVVELGST+LI Q+ DLM
Sbjct  233   AFFNSNPVWVIGGDRLSTSPCERARQGQVFGLQTLVCIPSANGVVELGSTELIYQNPDLM  292

Query  2664  NKVRVLFNF--NNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI--  2497
             NKV+VLFNF  NN DMGS S  A+ A   ENDPS LWL +P     ++   +    S+  
Sbjct  293   NKVKVLFNFSNNNFDMGS-SWPATSADQGENDPSTLWLNDPEVRDSINTAAATPSVSVSV  351

Query  2496  -PSSSVKEI--VFRNENSI-----------PSSTGNNHHDSQPSQYFTRELNFSEFGFDG  2359
              P +S   I    + E+SI           PSS    H   Q    F+RELNFSE+GFD 
Sbjct  352   PPHNSTHGISKTMQLESSIQTPGSSTLTETPSSI---HAVPQNQSVFSRELNFSEYGFD-  407

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGES----------------VTKRNGNGNSCQF  2227
                       N ++ HS KPE+ EI +F +S                 +  N       F
Sbjct  408   ------PKSGNTHNQHSLKPESCEIFSFSDSKRTSYGGGGGGVNGNSNSNSNFFSGQSPF  461

Query  2226  LG-GDEsks----kkktatlkaSNEEGMLSFGSGMV--KssggigigdssDHSDLEASVV  2068
             +   DE+ +    K+++   + SN++GMLSF S  +   ++     G  SDHSDLEASVV
Sbjct  462   VAVADENNNNNNGKRRSPNSRGSNDDGMLSFTSRAILPATNLKSAGGGDSDHSDLEASVV  521

Query  2067  KEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1888
             K+        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV
Sbjct  522   KDP-------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  574

Query  1887  SKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL-------STKEPRHPD  1729
             SKMDKASLLGDAI+YI ELKSKL+  ES  D L+ Q + +KKEL       S+   +H  
Sbjct  575   SKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKKELEKSSDNVSSNHTKH-G  633

Query  1728  PNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSV  1549
              N    ++   + D+D+DVK++GWDAMIRIQC+KKNHPAARLM AL +LDL+V HASVSV
Sbjct  634   GNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDVHHASVSV  693

Query  1548  MNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             +NDLMIQQA VKMG+R Y Q+QLR AL +K+ + 
Sbjct  694   VNDLMIQQATVKMGSRFYTQEQLRSALSAKVGDV  727



>gb|AAY90122.1| basic helix-loop-helix transcription factor protein [Rheum australe]
Length=720

 Score =   544 bits (1401),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 344/659 (52%), Positives = 425/659 (64%), Gaps = 105/659 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRN----  3028
             NQ++LQQRLQ LID ARE+WTYAIFWQ +V +  G SLLGWGDGYYKG++   K      
Sbjct  87    NQDSLQQRLQALIDDARESWTYAIFWQCNV-EPTGQSLLGWGDGYYKGDDSANKNASSAA  145

Query  3027  -----RPASSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFIN  2866
                  RP  +PAEQ HR++VLRELNSLISG +S  +++VD++VTDTEWFFL+SMT +F  
Sbjct  146   PAAGSRPPKNPAEQEHRRRVLRELNSLISGSSSPQNDAVDDDVTDTEWFFLISMTQAFPF  205

Query  2865  GSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLI  2686
             G  LPGQA   S+PIW  G D+L  SP +RARQ   FGL+T+VCIPS  GV+ELGST+L+
Sbjct  206   GVDLPGQAILGSNPIWAYGSDRLAGSPWDRARQGAAFGLQTIVCIPSGTGVLELGSTELV  265

Query  2685  LQSFDLMNKVRVLFNFNNPDMGSISGSASWAAP---------------PENDPSALWLTE  2551
               S  LMNKVRVLFNF + D   ++ +AS +AP                ENDP+ALW+++
Sbjct  266   FNSSVLMNKVRVLFNFGSGDASLLTAAASSSAPAAAPPPPISTATTDEAENDPAALWISD  325

Query  2550  PTSSSG-----VDVNTSVQENSIPSSS---------------VKEIVFRNENSIPSSTGN  2431
             P+SS+      ++   +V+E+SIP  S               V+  +   ENSI   +  
Sbjct  326   PSSSAAEVKEALNPRITVRESSIPIGSNSIPVHQPAKPPQLDVQSSIGLTENSIGIHSQK  385

Query  2430  NHHDSQPSQ---YFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVT  2260
             +H+  QP Q   +FT+ELNFSEF                      KPE+GEILNFGES  
Sbjct  386   SHN--QPLQHQGFFTKELNFSEFAM--------------------KPESGEILNFGES--  421

Query  2259  KRN----GNGNSCQFL---GGDEskskkktatlkaSNEEGMLSFGSGMV-----Kssggi  2116
             KRN    GNG + QFL         SKK++ T + S EEGMLSF S +V           
Sbjct  422   KRNSLGNGNGLNSQFLVEESNKNIISKKRSPTSRGSAEEGMLSFTSSVVLPSSMAVKSSA  481

Query  2115  gigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRRE  1936
                  SDHSDLEASVVKEADS  V      EKRPRKRGRKPANGREEPLNHVEAERQRRE
Sbjct  482   TGAGDSDHSDLEASVVKEADSSRV---VDPEKRPRKRGRKPANGREEPLNHVEAERQRRE  538

Query  1935  KLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKE-  1759
             KLNQRFYALRAVVPNVSKMDKASLLGDAI++INELKSKL+  ES  + L  Q + LK E 
Sbjct  539   KLNQRFYALRAVVPNVSKMDKASLLGDAISFINELKSKLQNVESEKETLLSQVECLKTEV  598

Query  1758  LSTKEPRHPDPNPKKTTTPHKIP----------------DMDVDVKVMGWDAMIRIQCTK  1627
             L++++ +    N       H  P                D+DVDVK++G DAM+R+ C+K
Sbjct  599   LASRDHQSRSSNGGGGVQNHHHPSLEQDMNMLNGSCKQSDLDVDVKIIGRDAMVRVNCSK  658

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
              NHPAARLMVALK+LDLEVTHASVSV+NDLMIQQA V+MG+R Y+ D LR+ L +K+++
Sbjct  659   SNHPAARLMVALKELDLEVTHASVSVVNDLMIQQATVRMGSRYYSPDHLRMVLEAKVSD  717



>ref|XP_010538501.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=646

 Score =   540 bits (1392),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 336/609 (55%), Positives = 411/609 (67%), Gaps = 58/609 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAG---PSLLGWGDGYYKGEEDKGKRNR  3025
             N++TLQQRLQ+LI+GARE WTYAIFWQ S  DF G    +LLGWGDGYYKGEEDKGK  +
Sbjct  67    NEDTLQQRLQSLIEGAREPWTYAIFWQLSY-DFPGGDGTALLGWGDGYYKGEEDKGKSRK  125

Query  3024  PASSP--AEQAHRKKVLRELNSLISGP---AstdesvdeevtdtEWFFLVSMTHSFINGS  2860
               SS   AEQ HRK+V+RELN+LISG     + D++ DEEVTDTE FFLVSMT SF+NG+
Sbjct  126   KCSSASAAEQEHRKRVIRELNALISGGEAVGAADDAGDEEVTDTEGFFLVSMTQSFLNGT  185

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPGQA  +S  IW++G   L  S CERARQ Q +GL+T+VCIPS NGVVELGST++I Q
Sbjct  186   GLPGQASLNSRTIWLAGSGVLAGSGCERARQGQIYGLQTLVCIPSENGVVELGSTEVIQQ  245

Query  2679  SFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQ  2509
             S DLM KV  LF+FN  D G  +GS +++  P   ENDP ALW++EPT+  G++      
Sbjct  246   SSDLMEKVNTLFHFN--DGGGEAGSWAFSLNPDEGENDP-ALWISEPTT--GIESGHVAP  300

Query  2508  ENSIPSSSVKEIVFRNENSIPSSTGNNHHDS------QPSQYFTRELNFSEFGFDGAnnn  2347
               +I + +       N +  P      H D+       P Q    +LN S  G +     
Sbjct  301   TEAINNGNSNSNSNSNSHLFPKP---GHFDNGGSSVENPGQNPQSDLNLSSSGLN-----  352

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNS----CQFLGGDEskskkktatlk  2179
                  +NGN     +P++GEIL   E   KRNGNG        F+ GD S  K+   +  
Sbjct  353   -----QNGNYPDGSRPKSGEILTSSE---KRNGNGTGYSGQTSFMAGD-SNKKRSPVSKG  403

Query  2178  aSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRG  2002
             ++NEEGMLSF  G+V           SDHSD+EASV KEADS R VE     EKRPRKRG
Sbjct  404   SNNEEGMLSFTCGVV-IPSAAAKSGDSDHSDVEASVAKEADSGRTVE----PEKRPRKRG  458

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL+GDAI+YI+ELKSK
Sbjct  459   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLIGDAISYISELKSK  518

Query  1821  LETSESYIDDLKIQAQSLKKELSTKE--PRHPDPNPKKTTTPHK---IPDMDVDVKVMGW  1657
             L+T+ES  ++L+   Q L KE S K+  P+    + K   T        +M++DVK++GW
Sbjct  519   LQTAESDKEELR---QQLNKEESGKDSRPQQRSKDRKGVITNQDSGLAIEMEIDVKIIGW  575

Query  1656  DAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLR  1477
             D MIRIQC KKNHP A+ M ALKDLDLEV HAS+SV+NDLMIQQA VKMG R ++QDQL+
Sbjct  576   DVMIRIQCGKKNHPGAKFMEALKDLDLEVNHASLSVVNDLMIQQATVKMGNRFFSQDQLK  635

Query  1476  LALISKLAE  1450
              AL++K+ E
Sbjct  636   RALMAKVGE  644



>ref|XP_010933462.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=677

 Score =   540 bits (1391),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 337/633 (53%), Positives = 409/633 (65%), Gaps = 73/633 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQ+RL T+I+GARETWTYAIFWQ+SV   +G SLLGWGDGYYKG E+  ++ +  +
Sbjct  61    NQETLQRRLLTVIEGARETWTYAIFWQSSVDVASGASLLGWGDGYYKGCEEDKRKQKANA  120

Query  3015  SPAEQAHRKKVLRELNSLISGPAstde---svdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S  EQ HRK+VLRELNSLISG A+      +V+EEVTDTEWFFLVSMT SF++G+GLPGQ
Sbjct  121   SAEEQEHRKRVLRELNSLISGGAAGSSPDEAVEEEVTDTEWFFLVSMTQSFVDGAGLPGQ  180

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  S SP WI+G + L  +PCERARQAQ FGL+TMVC+P  +GV+ELGSTDLI Q+F+LM
Sbjct  181   ALFSESPTWITGANLLAMAPCERARQAQVFGLQTMVCVPVGSGVLELGSTDLIYQNFELM  240

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPP----------ENDPSALWLTEPTSSSGVDVNTS  2515
             NK+RVLFNFN  D+ S     SW  PP          E DPS LWL +P+     D  + 
Sbjct  241   NKIRVLFNFNGLDVPS----GSWLLPPAATPAVADHGETDPSVLWLADPSMVEIKDSVSP  296

Query  2514  VQENSIPSSSVKEIVFRNENSI-----PSST---------------GNNHHDSQPSQYFT  2395
             V   +  S +   I F N +S      PSS                 N + + Q   +  
Sbjct  297   VSATAEISVTKPPIQFDNPSSSTITESPSSVPMQQRHNQQQQQNQNSNGNSNFQTQSFGN  356

Query  2394  RELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN-----GNG--NS  2236
             +  NFSEF  +G+            +  S KPE GEILNFG S  KRN     G+G    
Sbjct  357   KGFNFSEFVMNGSA-----------APSSFKPETGEILNFGNS--KRNSSPTPGSGLFPH  403

Query  2235  CQFLGGDEskskkktatlkaSNEEGMLSFGS--------GMVKssggigigdssDHSDLE  2080
              Q    D+   +   AT + S +EGMLSF S        G VKS GGI  G  SDHSDLE
Sbjct  404   HQTAPDDKKNKRSTGATSRGSIDEGMLSFSSAPARPSSAGPVKSGGGILGGGDSDHSDLE  463

Query  2079  ASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  1900
             ASV +    R VE     EKRPRKRGRKPANGR EPLNHVEAERQRREKLNQRFYALRAV
Sbjct  464   ASVREVESGRVVE----PEKRPRKRGRKPANGRSEPLNHVEAERQRREKLNQRFYALRAV  519

Query  1899  VPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPR---HPD  1729
             VPNVSKMDKASLLGDAI+YI EL SKLET ES  + L+ Q ++LK E  +   R    PD
Sbjct  520   VPNVSKMDKASLLGDAISYIKELTSKLETLESDKEGLQAQIETLKTERDSAPARPSQPPD  579

Query  1728  PNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSV  1549
             P+  +     +   ++++VK +G +AMIR+QC K NHPAARLM ALKDLDL+V +ASVSV
Sbjct  580   PD-TRLMNGGRCHGVEIEVKTLGLEAMIRVQCHKTNHPAARLMAALKDLDLDVHYASVSV  638

Query  1548  MNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             + DLMIQQA VKM  R+Y Q+QL   L +++A+
Sbjct  639   VKDLMIQQATVKMSGRVYTQEQLSAGLFARVAD  671



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score =   542 bits (1396),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 343/634 (54%), Positives = 423/634 (67%), Gaps = 67/634 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ+TLQ RLQ LI+GARETWTYAIFWQ+S  D++G +LLGWGDGYYKG++DK K    + 
Sbjct  113   NQDTLQHRLQALIEGARETWTYAIFWQSSY-DYSGSTLLGWGDGYYKGDDDKAKAKAKSK  171

Query  3015  SPA--EQAHRKKVLRELNSLISGPAstdes--vdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             + +  EQ HRKKVLRELNSLISG +S   S  VDEEVTDTEWFFLVSMT SF+NG GLPG
Sbjct  172   ATSAAEQDHRKKVLRELNSLISGSSSASASDDVDEEVTDTEWFFLVSMTQSFVNGGGLPG  231

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QAF +S+P+W++G D+L +SPCERARQ   FGL+T+VCIPS+NGVVELGST+LI Q+ DL
Sbjct  232   QAFFNSTPVWVTGSDRLSASPCERARQGHMFGLQTLVCIPSANGVVELGSTELIFQNSDL  291

Query  2667  MNKVRVLFNF--NNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIP  2494
             MNKV+VLFNF  NN DMGS S  A+ A   ENDPS+LWL++P     V+   +     +P
Sbjct  292   MNKVKVLFNFSNNNFDMGS-SWPATSADQGENDPSSLWLSDPEVRDSVNTAAATPSVMVP  350

Query  2493  S-----SSVKEIVFRNENSIPSST------GNNHHDSQPSQYFTRELNFSEFGFDGAnnn  2347
             +     S  K +   +    P S+       + H   Q    F+RELNFSE+GFD     
Sbjct  351   AQTQGISISKTMQLESSIQTPGSSTLTETPSSIHAIPQNQSVFSRELNFSEYGFD-----  405

Query  2346  hnndlrngNSSHSCKPEAGEILNFGES---------VTKRNGNGNSCQFLGG--------  2218
                   N  + HS KPE+GEIL+FGES                 ++  F  G        
Sbjct  406   --PKSGNNQNHHSLKPESGEILSFGESRRTSYGGVNGNTNTNTNSNSHFFSGQSPFVAAV  463

Query  2217  DEskskkktatlka-------SNEEGMLSFGSGMV--KssggigigdssDHSDLEASVVK  2065
             DE+K    +   K        SN++GMLSF SG++   ++   G G  SDHSDLEASVVK
Sbjct  464   DENKKNNMSNNGKKRSPNSRGSNDDGMLSFTSGVIIPATNLKSGGGGDSDHSDLEASVVK  523

Query  2064  EADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1885
             +        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS
Sbjct  524   DP-------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  576

Query  1884  KMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL--------STKEPRHPD  1729
             KMDKASLLGDAI+YI ELKSKL+T ES  D L  Q + +KKEL        S     + +
Sbjct  577   KMDKASLLGDAISYITELKSKLQTLESDKDVLHKQLEGVKKELEKTTDNVSSNHACNNNN  636

Query  1728  PNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSV  1549
              N   +  P  I  +++DVK++GWDAMI I C+KKNHPAA LM AL +LDL+V +A+V++
Sbjct  637   NNKLSSNQPALIDLVEMDVKIIGWDAMITITCSKKNHPAATLMTALMELDLDVHYATVTL  696

Query  1548  MNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             +NDLMIQQA VKMG+R Y Q+QLR AL +K+ + 
Sbjct  697   VNDLMIQQATVKMGSRFYTQEQLRAALSAKVGDV  730



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   537 bits (1383),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 318/601 (53%), Positives = 400/601 (67%), Gaps = 61/601 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKANPRRRSS  122

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  123   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  182

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG+ T+ CIPS+NGVVE+GST+ I QS 
Sbjct  183   AGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSS  242

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVR+LFNF+  D G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  243   DLINKVRILFNFDGGD-GDLSG-LNWNLDPDQGENDPS-MWINDPIGTPGSNEPGNGAPS  299

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + +  F+RELNFS+  F   
Sbjct  300   SSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSDVKF---  356

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                           +  +P +GEILNFG+   + +GN +   + G  +++ + K      
Sbjct  357   --------------YFSEPRSGEILNFGDEGKRSSGNPDPSSYSG--QTQFENKRKRSMV  400

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  401   LNEDKVLSFGD---------KTAGESDHSDLEASVVKEV---------AVEKRPKKRGRK  442

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+ 
Sbjct  443   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVV  502

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
              +ES    +K Q + +K EL+ ++      +   + +  K   M+++VK++GWDAMIR++
Sbjct  503   KTESEKLQIKNQLEEVKLELAGRKASPSGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVE  562

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
              +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y QDQLR +LISK+
Sbjct  563   SSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQDQLRASLISKI  622

Query  1455  A  1453
              
Sbjct  623   G  623



>gb|AET03296.2| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=648

 Score =   538 bits (1386),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 325/624 (52%), Positives = 418/624 (67%), Gaps = 71/624 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQ RLQ LI+GA+E+WTYAIFWQ+S        LLGWGDGYYKGE+DK K  R  +
Sbjct  50    NQETLQHRLQALIEGAKESWTYAIFWQSSYDYTMATPLLGWGDGYYKGEDDKVKLKR-VT  108

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
              P EQAHR+K+LRELN+LISG  + +D++V+E+VTDTEWFFL SMT SF+NG+G   QA+
Sbjct  109   PPEEQAHRRKILRELNTLISGGSSVSDDAVEEDVTDTEWFFLTSMTQSFVNGTGSLSQAY  168

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIP-SSNGVVELGSTDLILQSFDLMN  2662
              +S+P+WI+G ++L  SPCERAR+A+  G +T+VCIP SS+GVVEL ST++I  + DLM 
Sbjct  169   FNSTPVWITGAERLSGSPCERAREARVHGFQTLVCIPTSSSGVVELASTEMIPYNADLME  228

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVD-----VNTSV---QE  2506
             K+RVLFNFNNP+ GS   ++      ENDPS++WL + ++S+ ++     VNT+      
Sbjct  229   KIRVLFNFNNPETGSWPLNS--ITTSENDPSSVWLNDLSASAAIEIRESTVNTAAVPAMN  286

Query  2505  NSIPSSSV--KEIVFRNENS---IPSSTGNNHHDSQPS-----QYFTRELNFSEFGFDGA  2356
              +IP+++   K + F    S   +  +T  N    Q        +F +ELNFS       
Sbjct  287   ATIPANATVGKTLPFETNGSTSTLTETTAVNFAQRQNQNNQNHSFFLKELNFS-------  339

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSC------QFLGGDEskskkk  2194
                            S KPE+GEIL+FGES       GN        QF+ G+E++ +K 
Sbjct  340   --------------GSMKPESGEILSFGESKKSSYITGNGTFFSGQSQFVAGEENRKRKS  385

Query  2193  tatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEADS-RAVETLA  2032
               +  +  ++GMLSF SG+V       S   G G  SDHSDL+ S VKE +S R VE   
Sbjct  386   PISRSSI-DDGMLSFTSGVVLPSSNMKSSSRGGGGDSDHSDLDVSAVKEGESSRVVE---  441

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
                KRP+KRGRKPANGREEPLNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDA
Sbjct  442   -PGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDA  500

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP----------KKTTTP  1702
             I+YINELKSKL+  ES   +L+ Q  + KKEL     ++   NP            +T+ 
Sbjct  501   ISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQNPIPLDKEKEKTTSSTSS  560

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
              K+ D+D+DVK+MGWDAMIRIQC+KKNHPAA+LM ALK+LDL+V HASVSV+NDLMIQQA
Sbjct  561   SKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDLDVNHASVSVVNDLMIQQA  620

Query  1521  AVKMGTRLYNQDQLRLALISKLAE  1450
             +V MG+R Y Q+QL   L SK+ +
Sbjct  621   SVNMGSRFYTQEQLLSLLSSKIGD  644



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score =   539 bits (1388),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 328/659 (50%), Positives = 410/659 (62%), Gaps = 99/659 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNRPA  3019
             NQ+TLQQRLQ LI+GA+E WTYAIFWQ S  D++G SLLGWGDGYYKGEEDK K +    
Sbjct  41    NQDTLQQRLQALIEGAKEIWTYAIFWQPSY-DYSGSSLLGWGDGYYKGEEDKTKAKKSKV  99

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             +SPAEQ HR+KVLRELNSLISG P + +  VDEEVTDTEWFFLVSMT SF+NG+GLPGQA
Sbjct  100   TSPAEQEHRRKVLRELNSLISGNPVTDESPVDEEVTDTEWFFLVSMTQSFVNGTGLPGQA  159

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             + +S+P+W++G + L  S CERARQ Q  G++T+ CI S++GV+ELGST+LI Q+ DLMN
Sbjct  160   YYNSAPVWLTGAENLALSACERARQGQEHGIQTLACIRSADGVLELGSTELIYQNNDLMN  219

Query  2661  KVRVL------------FNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNT  2518
             KV++L            +   N    +I G+       ENDPS  W+ +P +   VD N+
Sbjct  220   KVKMLFNFNNNFDFGSSWQLGNNSAATIGGNQG-----ENDPSLNWINDPEARDSVDNNS  274

Query  2517  SVQEN--------SIPS------------SSVKEIVFRNENS-----IPSSTGNNHHDSQ  2413
              V           S+PS            S  K + F    S     +PS    +   + 
Sbjct  275   LVTTTTAATNASISVPSHQHHNNNQNLSVSVTKTMQFETHGSSTLTEVPSVVHVSSKQNN  334

Query  2412  PSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGES----------V  2263
              S +F++E+N S++G             + N     KPE+G+IL FGES           
Sbjct  335   QS-FFSKEMNLSDYG------------GSNNQQRLLKPESGDILCFGESKKSSYVANNGN  381

Query  2262  TKRNGNGNSCQFLGGDEskskkktatlk---------aSNEEGMLSFGSGMVK-------  2131
             +  N      Q +   E  +                 ++N++GMLSF SG++        
Sbjct  382   SNSNFFSGQSQLVSVAEENNNGNGNGNGKRRSPNSRGSNNDDGMLSFTSGVIVPPATSNL  441

Query  2130  ssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEA  1954
                G   G  SDHSDLEASVVKE DS R VE     EK+PRKRGRKPANGREEPLNHVEA
Sbjct  442   KFSGGTGGGDSDHSDLEASVVKEVDSSRVVE----PEKKPRKRGRKPANGREEPLNHVEA  497

Query  1953  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQ  1774
             ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI ELK+KL+ +ES  D L+ Q  
Sbjct  498   ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDGLEKQLD  557

Query  1773  SLKKELSTKEPRHPDPN----------PKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKK  1624
              +K E+                     P K ++   + D+D+DVK++GWDAMIR+QC+KK
Sbjct  558   GMKNEIQKINENQSHQPPQQQQQQQPIPNKPSSNQALIDLDIDVKIIGWDAMIRVQCSKK  617

Query  1623  NHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             NHPAARLM AL +LDLEV HASVSV+NDLMIQQA VKMG+R Y Q+QLR AL SK+ + 
Sbjct  618   NHPAARLMAALMELDLEVHHASVSVVNDLMIQQATVKMGSRFYTQEQLRAALSSKVGDV  676



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   535 bits (1379),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 327/610 (54%), Positives = 406/610 (67%), Gaps = 76/610 (12%)
 Frame = -3

Query  3189  ETLQQRLQTLIDGARETWTYAIFWQASVVDF---AGPSLLGWGDGYYKGEEDKGKRNRPA  3019
             ETLQQRLQ LI+GA ETWTYAIFWQ S  DF    G +LLGWGDGYYKGEEDKGK N   
Sbjct  71    ETLQQRLQALIEGAPETWTYAIFWQLSY-DFDAAGGTALLGWGDGYYKGEEDKGKSNIRC  129

Query  3018  S--SPAEQAHRKKVLRELNSLISGPAstdesvde---evtdtEWFFLVSMTHSFINGSGL  2854
             S  S AEQ HRK+V+RELN+LISG A    S D    EVTDTEWFFLVSMT SF+NG+G 
Sbjct  130   SPESAAEQEHRKRVIRELNALISGGAVAGASEDAGDEEVTDTEWFFLVSMTQSFLNGTGF  189

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PGQAF +S  IW+SG D L  S CERARQ Q +GL T+VCIPS NGVVELGST++I QS 
Sbjct  190   PGQAFLNSRTIWLSGSDVLAGSGCERARQGQIYGLHTLVCIPSENGVVELGSTEVIQQSS  249

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DLM KV  LFNFN+   GS +GS ++   P   ENDP A W++EPT+  G++       N
Sbjct  250   DLMEKVNTLFNFNSG--GSEAGSWAFNLNPDQGENDP-AFWISEPTT--GIESG-----N  299

Query  2502  SIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY-----------------FTRELNFSE  2374
               P++++      N NS      N+H  ++P Q+                   R+LN S 
Sbjct  300   MAPTAAIN-----NGNS------NSHQLTKPGQFENGSSVENPRQNPQGSSVDRDLNVSS  348

Query  2373  FGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkk  2194
              G D          +NGN S   +P++GEIL+F  +     G  +    +   E+K K+ 
Sbjct  349   SGLD----------QNGNYSDGSRPKSGEILSFCGNKNGNGGGLSGKTRIVAGENKKKRS  398

Query  2193  tatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADS-RAVETLAAAEKR  2017
               + +++NEEG+LSF SG             SDHSD+EASV KEADS R VE     EK+
Sbjct  399   PVSKRSNNEEGILSFTSGAA-LPSSAAKSGDSDHSDVEASVYKEADSGRVVE----PEKK  453

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRA+VPNVSKMDKASLLGDAI+YIN
Sbjct  454   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRALVPNVSKMDKASLLGDAISYIN  513

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPR--HPDPNPKKTTTPHKIPDMDVDVKVM  1663
             ELKSK++ +E    +L+ Q + L+K +S K+ +  + D  P   T        ++DVK++
Sbjct  514   ELKSKVQKAEFDKGELQKQLRELRKGVSGKDQKGLNQDSGPSVET--------EIDVKII  565

Query  1662  GWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQ  1483
             GWD MIRIQC+KKNHP A+ M ALK+LDLEV HAS+SV+ND MI+QA VKMG+R + QDQ
Sbjct  566   GWDVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVVNDFMIEQATVKMGSRFFTQDQ  625

Query  1482  LRLALISKLA  1453
             L+ AL++K++
Sbjct  626   LKTALMAKVS  635



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   534 bits (1376),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 318/601 (53%), Positives = 399/601 (66%), Gaps = 61/601 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKANPRRRSS  122

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  123   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  182

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG+ T+ CIPS+NGVVE+GST+ I QS 
Sbjct  183   AGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSS  242

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVR+LFNF+    G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  243   DLINKVRILFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGTPGSNEPGNGAPS  299

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + +  F+RELNFS       
Sbjct  300   SSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFS-------  352

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                        +SS   KP +GEILNFG+   + +GN +   + G  +++ + K      
Sbjct  353   ----------TSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSG--QTQFENKRKRSMV  400

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  401   LNEDKVLSFGD---------KTAGESDHSDLEASVVKEV---------AVEKRPKKRGRK  442

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+ 
Sbjct  443   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVV  502

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
              +ES    +K Q + +K EL+ ++      +   + +  K   M+++VK++GWDAMIR++
Sbjct  503   KTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVE  562

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
              +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK+
Sbjct  563   SSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKI  622

Query  1455  A  1453
              
Sbjct  623   G  623



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   533 bits (1374),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 318/601 (53%), Positives = 398/601 (66%), Gaps = 61/601 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKANPRRRSS  122

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  123   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  182

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG+ T+ CIPS+NGVVE+GST+ I QS 
Sbjct  183   AGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSS  242

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVR+LFNF+    G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  243   DLINKVRILFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGTPGSNEPGNGAPS  299

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + +  F+RELNFS       
Sbjct  300   SSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFS-------  352

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                        +SS   KP +GEILNFG+   + +GN +   + G  +++ + K      
Sbjct  353   ----------TSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSG--QTQFENKRKRSMV  400

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  401   LNEDKVLSFGD---------KTAGESDHSDLEASVVKEV---------AVEKRPKKRGRK  442

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+ 
Sbjct  443   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVV  502

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
              +ES    +K Q + +K EL+ +       +   + +  K   M+++VK++GWDAMIR++
Sbjct  503   KTESEKLQIKNQLEEVKLELAGRRASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVE  562

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
              +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK+
Sbjct  563   SSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKI  622

Query  1455  A  1453
              
Sbjct  623   G  623



>ref|XP_003628820.1| Transcription factor MYC2 [Medicago truncatula]
Length=648

 Score =   534 bits (1376),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 324/624 (52%), Positives = 417/624 (67%), Gaps = 71/624 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQ RLQ LI+GA+E+WTYAIFWQ+S        LLGWGDGYYKGE+DK K  R  +
Sbjct  50    NQETLQHRLQALIEGAKESWTYAIFWQSSYDYTMATPLLGWGDGYYKGEDDKVKLKR-VT  108

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
              P EQAHR+K+LRELN+LISG  + +D++V+E+VTDTEWFFL SMT SF+NG+G   QA+
Sbjct  109   PPEEQAHRRKILRELNTLISGGSSVSDDAVEEDVTDTEWFFLTSMTQSFVNGTGSLSQAY  168

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIP-SSNGVVELGSTDLILQSFDLMN  2662
              +S+P+WI+G ++L  SPCERAR+A+  G +T+VCIP SS+GVVEL ST++I  + DLM 
Sbjct  169   FNSTPVWITGAERLSGSPCERAREARVHGFQTLVCIPTSSSGVVELASTEMIPYNADLME  228

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVD-----VNTSV---QE  2506
             K+RVLFNFNNP+ GS   ++      ENDPS++WL + ++S+ ++     VNT+      
Sbjct  229   KIRVLFNFNNPETGSWPLNS--ITTSENDPSSVWLNDLSASAAIEIRESTVNTAAVPAMN  286

Query  2505  NSIPSSSV--KEIVFRNENS---IPSSTGNNHHDSQPS-----QYFTRELNFSEFGFDGA  2356
              +IP+++   K + F    S   +  +T  N    Q        +F +ELNFS       
Sbjct  287   ATIPANATVGKTLPFETNGSTSTLTETTAVNFAQRQNQNNQNHSFFLKELNFS-------  339

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSC------QFLGGDEskskkk  2194
                            S KPE+GEIL+FGES       GN        QF+ G+E++ +K 
Sbjct  340   --------------GSMKPESGEILSFGESKKSSYITGNGTFFSGQSQFVAGEENRKRKS  385

Query  2193  tatlkaSNEEGMLSFGSGMV-----KssggigigdssDHSDLEASVVKEADS-RAVETLA  2032
               +  +  ++GMLSF SG+V       S   G G  SDHSDL+ S VKE +S R VE   
Sbjct  386   PISRSSI-DDGMLSFTSGVVLPSSNMKSSSRGGGGDSDHSDLDVSAVKEGESSRVVE---  441

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
                KRP+KRGRKPANGREEPLNHVEAERQRREKLNQ+FYALRAVVPN SKMDKASLLGDA
Sbjct  442   -PGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNGSKMDKASLLGDA  500

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP----------KKTTTP  1702
             I+YINELKSKL+  ES   +L+ Q  + KKEL     ++   NP            +T+ 
Sbjct  501   ISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQNPIPLDKEKEKTTSSTSS  560

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
              K+ D+D+DVK+MGWDAMIRIQC+KKNHPAA+LM ALK+LDL+V HASVSV+NDLMIQQA
Sbjct  561   SKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDLDVNHASVSVVNDLMIQQA  620

Query  1521  AVKMGTRLYNQDQLRLALISKLAE  1450
             +V MG+R Y Q+QL   L SK+ +
Sbjct  621   SVNMGSRFYTQEQLLSLLSSKIGD  644



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   533 bits (1372),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 327/607 (54%), Positives = 402/607 (66%), Gaps = 79/607 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             N+ETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRTS  110

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG    TD++VDEEVTDTEWFFLVSMT SF  GSGL
Sbjct  111   PPPFSTPADQEYRKKVLRELNSLISGGCGPTDDAVDEEVTDTEWFFLVSMTQSFACGSGL  170

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+ G D+L  S CERA+Q   FG++T+ CIPS+NGVVELGST+ I QS 
Sbjct  171   AGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQSS  230

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DLMNKVRVLFNFN    G +SG  +W   P   ENDP+ +W+ +P       +  + Q N
Sbjct  231   DLMNKVRVLFNFNG-GAGDLSG-LNWNLDPDQGENDPT-MWINDP-------IGVAEQGN  280

Query  2502  SIPSSS----VKEIVFRNENSIPSSTGNNHHDSQPS------------QYFTRELNFSEF  2371
               PSSS     K I F N  S  +   N + D  PS              F+RELNFS  
Sbjct  281   GAPSSSSQLFAKSIQFENGGSSSTIIENPNPDPAPSPVHSQTQNPKFSNNFSRELNFS--  338

Query  2370  GFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkkt  2191
                             +S+   KP  GEIL+FG+   + + N +   + G  + ++K+K 
Sbjct  339   ---------------TSSTTLVKPRPGEILSFGDEGKRSSVNPDPSSYSGQTQFENKRKK  383

Query  2190  atlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPR  2011
             +      ++ +L+FG+G          G  SDHSDLEASVVKE            EKRP+
Sbjct  384   SI-----DDKVLTFGTG----------GGESDHSDLEASVVKEI----------PEKRPK  418

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL
Sbjct  419   KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  478

Query  1830  KSKLETSESYIDDLKIQAQSLKKELS-TKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWD  1654
             KSK+  +ES    +K Q + +K EL+  K     D +   + T  K   M+++VK++GWD
Sbjct  479   KSKVTKTESEKTQIKTQLEEVKMELAGRKASAGGDLSSSCSMTAIKPVGMEIEVKIIGWD  538

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIR++ +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR 
Sbjct  539   AMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRA  598

Query  1473  ALISKLA  1453
             +LISK+ 
Sbjct  599   SLISKIG  605



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   531 bits (1367),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 322/602 (53%), Positives = 403/602 (67%), Gaps = 64/602 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  68    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRSS  126

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  127   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  186

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVE+GST+ I QS 
Sbjct  187   AGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEQIRQSS  246

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVRVLFNF+    G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  247   DLINKVRVLFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGAPGSNEPGNGAPS  303

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + S  F+RELNFS       
Sbjct  304   SSSQLFSKSIQFENGSSSTITENPNPDPTPSPVHSQTQNPKFSNNFSRELNFS-------  356

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                        +SS   KP +GEIL+FG+   + +GN +   + G    +++ +    K+
Sbjct  357   ----------TSSSTLVKPRSGEILSFGDDGKRGSGNPDPSSYSG----QTQFENKRKKS  402

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  403   PNEDKVLSFGD---------KTTGESDHSDLEASVVKEV---------AVEKRPKKRGRK  444

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+ 
Sbjct  445   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVV  504

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP-DMDVDVKVMGWDAMIRI  1639
              +ES    +K Q + +K EL+ ++      +   +T     P  M+++VK++GWDAMIR+
Sbjct  505   KTESEKLQIKNQLEEVKLELAGRKASAGCGDMSSSTCSSIKPVGMEIEVKIIGWDAMIRV  564

Query  1638  QCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISK  1459
             + +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK
Sbjct  565   ESSKRNHPAARLMAALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISK  624

Query  1458  LA  1453
             + 
Sbjct  625   IG  626



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   530 bits (1366),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 322/602 (53%), Positives = 402/602 (67%), Gaps = 64/602 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  65    NQETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRSS  123

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  124   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  183

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVE+GST+ I QS 
Sbjct  184   AGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEQIRQSS  243

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVRVLFNF+    G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  244   DLINKVRVLFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGAPGSNEPGNGAPS  300

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + S  F+RELNFS       
Sbjct  301   SSSQLFSKSIQFENGSSSTITENPNPDPTPSPVHSQTQNPKFSNNFSRELNFS-------  353

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                        +SS   KP +GEIL+FG+   + +GN +   + G    +++ +    K+
Sbjct  354   ----------TSSSTLVKPRSGEILSFGDDGKRGSGNPDPSSYSG----QTQLENKRKKS  399

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE  +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  400   PNENKVLSFGD---------KTTGESDHSDLEASVVKEV---------AMEKRPKKRGRK  441

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+ 
Sbjct  442   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVV  501

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP-DMDVDVKVMGWDAMIRI  1639
              +ES    +K Q + +K EL+ ++      +   +T     P  M+++VK++GWDAMIR+
Sbjct  502   KTESEKLQIKNQLEEVKLELAGRKASAGCGDVSSSTCSSIKPVGMEIEVKIIGWDAMIRV  561

Query  1638  QCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISK  1459
             + +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK
Sbjct  562   ESSKRNHPAARLMAALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISK  621

Query  1458  LA  1453
             + 
Sbjct  622   IG  623



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score =   530 bits (1366),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 343/656 (52%), Positives = 425/656 (65%), Gaps = 107/656 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGKR--NR  3025
             NQETLQQRL TLI+GARETWTYAIFWQ+SV   +G SLLGWGDGYYKG EEDK K+    
Sbjct  64    NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGVSLLGWGDGYYKGCEEDKRKQKTTN  123

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstde---svdeevtdtEWFFLVSMTHSFINGSGL  2854
             PA++ AEQ HRK+VLRELNSLISG A       +V+EEVTDTEWFFLVSMT SF+NG+GL
Sbjct  124   PATA-AEQEHRKRVLRELNSLISGGAGGSSPDETVEEEVTDTEWFFLVSMTQSFVNGAGL  182

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PGQAF + +P WI+G D+L  +PC+RARQA+  GL+TMVC+P   GV+ELGSTD+I QS 
Sbjct  183   PGQAFFADAPNWIAGADRLALAPCDRARQARELGLQTMVCVPVGTGVLELGSTDVIYQSL  242

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP------ENDPSALWLTEPT----------S  2542
             +LMNK+RVLFNFN+ ++ S S   + AA P      E DPS LWL +PT          +
Sbjct  243   ELMNKIRVLFNFNSFEIPSGSWLPTPAATPAVADQGETDPSMLWLADPTMVEIKDSVSPA  302

Query  2541  SSGVDVNTS---VQENSIPSSSVKEIVFRNENSI-----------------PSSTGNNHH  2422
             S+  D++ +   +Q ++  SS+V E    N +SI                      N++ 
Sbjct  303   SATADISITKPPIQFDNPSSSTVTE----NPSSIQMQQHHNHHQQQQQQQQQHQNQNSNS  358

Query  2421  DSQPSQYFT-RELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN  2245
             + Q    FT RE NF+E   +G+               + KPE+GEIL FG +  KRN +
Sbjct  359   NVQTQSLFTSREFNFAEVVLNGSA-----------PPQAFKPESGEILTFGNN--KRNSS  405

Query  2244  GNSCQFL----------GGDEskskkktatlkaSNEEGMLSFGS--------GMVKssgg  2119
                                D+   +   AT + SN+EGMLSF S        G VKS GG
Sbjct  406   PAPSSLFSHHQIATVTAADDKKNKRSTGATSRGSNDEGMLSFSSAAARPSSAGQVKSGGG  465

Query  2118  igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRR  1939
             I  G  SDHSDLEASV +   S  VE     EKRPRKRGRKPANGREEPLNHVEAERQRR
Sbjct  466   ILGGADSDHSDLEASVREVESSPVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRR  521

Query  1938  EKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKE  1759
             EKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+SKL++ ES  + L+ Q ++LK+E
Sbjct  522   EKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESDKEGLQTQIEALKRE  581

Query  1758  LSTKEPRHPDPNPKKTTTPHKIPDMD-------------VDVKVMGWDAMIRIQCTKKNH  1618
                      D NP +   P ++PD D             ++VK++G +AMIR+QC K+NH
Sbjct  582   R--------DSNPAR---PLQLPDQDMKMMNGGRCHGVEIEVKILGVEAMIRVQCHKRNH  630

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             PAARLM ALK+LDL+V +ASVSV+ DLMIQQA VKM +R+Y Q+QL  AL S++ E
Sbjct  631   PAARLMAALKELDLDVYYASVSVVKDLMIQQATVKMSSRVYTQEQLSAALFSRVGE  686



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   528 bits (1359),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 318/603 (53%), Positives = 404/603 (67%), Gaps = 65/603 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  66    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKLRQRSS  124

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  125   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  184

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVE+GST+ I QS 
Sbjct  185   AGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEPIRQSS  244

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSS--SGVDVNTS--  2515
             DL+NKVR+LFNF+    G +SG  +W   P   ENDPS +W+ +P  +  S   VN +  
Sbjct  245   DLINKVRILFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGAPESNEPVNGAPS  301

Query  2514  ---------VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFD  2362
                      +Q  +  SS++ E    N +  PS   +   + + +  F+R+LNFS     
Sbjct  302   SSSQLFSKSIQFENGSSSTITE--NPNPDPTPSPVHSQTQNPKFNNTFSRKLNFS-----  354

Query  2361  GAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatl  2182
                          +SS   KP +GEILNFG+   + + N +   + G  +++ + K    
Sbjct  355   ------------TSSSTLVKPRSGEILNFGDDGKRSSVNPDPSSYSG--QTQFENKRKKS  400

Query  2181  kaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
                NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRG
Sbjct  401   MVLNEDKVLSFGD---------KTAGESDHSDLEASVVKEV---------AVEKRPKKRG  442

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK
Sbjct  443   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSK  502

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             +  +ES    +K Q + +K EL+ ++      +   + +  K   M+++VK++GWDAMIR
Sbjct  503   VVKTESEKIQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIR  562

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             ++ +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LIS
Sbjct  563   VESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLIS  622

Query  1461  KLA  1453
             K+ 
Sbjct  623   KIG  625



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   527 bits (1357),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 321/606 (53%), Positives = 394/606 (65%), Gaps = 77/606 (13%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKG----KRNR  3025
             QETLQQRL  LI+GA E WTYAIFWQ S  DF+G ++LGWGDGYYKGEEDK     +   
Sbjct  59    QETLQQRLHALIEGAHEGWTYAIFWQLSY-DFSGAAVLGWGDGYYKGEEDKACPRPRATT  117

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
               SS A+Q HRKKVLRELNSLISG A  +D++VDEEVTDTEWFFLVSMT SF +GSGL G
Sbjct  118   SFSSSADQEHRKKVLRELNSLISGGALPSDDAVDEEVTDTEWFFLVSMTQSFASGSGLAG  177

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             +AF +S+P+W++G D+L  S CERA Q   FGL+T+ CIPS+NGVVELGST++I QS DL
Sbjct  178   KAFSTSNPVWVAGSDQLSGSDCERAGQGGVFGLQTIACIPSANGVVELGSTEIIRQSSDL  237

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             MNKVR+LFN +            W+  P   EN PS +W+++P      +  T+   +  
Sbjct  238   MNKVRILFNLDG---------GQWSGDPDQGENHPS-MWISDPICG---EPGTNEPGHGA  284

Query  2496  PSSSV----KEIVFRNENSIPSSTGNN----HHDSQPSQY--FTRELNFSEFGFDGAnnn  2347
             PSS+     K ++  N +S P +   N    H  +Q  +Y  F+RE+NFS          
Sbjct  285   PSSNSQLFSKSLLMENGSSSPITENPNPTLVHSLTQNLKYNDFSREINFSTL--------  336

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGN------SCQFLGGDEskskkktat  2185
                      +S+  +P +GEILNFGE   +  GN N        QFL  D     K+   
Sbjct  337   ---------NSNLARPRSGEILNFGEDAKRCPGNPNPGLYSGQSQFLTSD----IKRKTK  383

Query  2184  lkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKR  2005
                  E+ +LSFG    KS           HSDLEASVVKEA           EKRPRKR
Sbjct  384   SIGITEDTVLSFGVAGDKSGDSD-------HSDLEASVVKEA---------VPEKRPRKR  427

Query  2004  GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKS  1825
             GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKS
Sbjct  428   GRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKS  487

Query  1824  KLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP--KKTTTPHKIPDMDVDVKVMGWDA  1651
             KL+  ES    ++ Q +SLK EL+ +              ++  K   ++++VK++GWDA
Sbjct  488   KLQKVESEKTQVECQVESLKGELAGQNANAGVVGDVGDSYSSVSKRTGVEIEVKIIGWDA  547

Query  1650  MIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLA  1471
             MIRI+ +K+N+PAARLM AL+DL+LEV HAS+SV+NDLM+QQA VKMG R+Y QDQLR  
Sbjct  548   MIRIESSKRNYPAARLMSALRDLELEVNHASMSVVNDLMVQQATVKMGFRIYTQDQLRAG  607

Query  1470  LISKLA  1453
             LISK  
Sbjct  608   LISKFG  613



>ref|XP_010677236.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=649

 Score =   528 bits (1360),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 328/626 (52%), Positives = 413/626 (66%), Gaps = 62/626 (10%)
 Frame = -3

Query  3192  QETLQQRLQTLIDG-----ARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRN  3028
             Q+TL  RLQ+LID      A + WTYAIFWQ SV D++G SLLGWGDGYYKGEE K +  
Sbjct  39    QDTLHSRLQSLIDNPATSHAAQAWTYAIFWQNSV-DYSGQSLLGWGDGYYKGEEKKTQTQ  97

Query  3027  RPASSP--AEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSG  2857
                 +   AEQ HRK+VLRELNSLISG     D +V+EEV+DTEWFFL+SMTHSF +G  
Sbjct  98    TQTQTQDVAEQEHRKRVLRELNSLISGAEPPEDSAVEEEVSDTEWFFLISMTHSFSSGED  157

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             LPG+A  SS PIW +G D+L SSPC RA+Q   FGL+TMV IP  NGVVELGST++I QS
Sbjct  158   LPGEAHLSSKPIWAAGPDRLSSSPCNRAKQGACFGLQTMVSIPVLNGVVELGSTEVIFQS  217

Query  2676  FDLMNKVRVLFNFN--NPDMGSISGSASWAAP---PENDPSALWLTEPTSSSGVDVNTSV  2512
              DLMNKVRVLF F   + D G +SGS S + P   PE+DP+ +W+ +P     V+V    
Sbjct  218   PDLMNKVRVLFCFGPGSGDPGLLSGSVSGSVPVSAPESDPTTMWINDPNP---VEVKELR  274

Query  2511  QENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQ-------YFTRELNFSEF-GFDGA  2356
             +  + P     +++   ++ I S+    H    P+        +F+RELNFS++ G++G 
Sbjct  275   KTPTPPPPPPMKLI-NLDSPIKSNLSEFHSTPNPAPKQQQQQGFFSRELNFSDYAGYNG-  332

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKR-----NGN----GNSCQFLGGDEsks  2203
                         S+ S KPE+GEIL+FG   +KR     NGN    G +  FL  D +  
Sbjct  333   --------NGNKSNGSLKPESGEILSFGGGDSKRSTNNSNGNVGIFGGNSSFLIDDSNNK  384

Query  2202  kkktatlkaSNEEGMLSFGSGM------VKssggigigdssDHSDLEASVVKEADSRAVE  2041
             KK++   + SNE+GMLSF SG+      V        G  S+HSDLEASV +E DS  V 
Sbjct  385   KKRSPNSRGSNEDGMLSFTSGVILASSGVVGKSSNNNGADSEHSDLEASV-REVDSSRV-  442

Query  2040  TLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  1861
              +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL
Sbjct  443   -VPEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  501

Query  1860  GDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKE--------PRHPDPNPKKTT-  1708
             GDAI+YINELK+KL+  E   + L  Q + LKKEL   +        P + +   K    
Sbjct  502   GDAISYINELKAKLQDFEVEKEGLVSQVEGLKKELGGSQPQSQQQLAPSYLEKETKAVLG  561

Query  1707  TPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQ  1528
                ++ D+++DVK++GW+AMIR+   KKNHPAARLM AL +L+L+VTHASVSV+NDLMIQ
Sbjct  562   VKQQLVDLEIDVKIIGWEAMIRVNSNKKNHPAARLMAALMELELDVTHASVSVVNDLMIQ  621

Query  1527  QAAVKMGTRLYNQDQLRLALISKLAE  1450
             QA VKM  R Y+Q+QLR+ L SK+++
Sbjct  622   QATVKMCNRYYSQEQLRMLLASKVSD  647



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   527 bits (1357),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 320/604 (53%), Positives = 400/604 (66%), Gaps = 62/604 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             +QETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDKGK  +   
Sbjct  60    SQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKGKPRQKSS  118

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG A   D++VDEEVTDTEWFFLVSMT SF  GSGL
Sbjct  119   SPPFSTPADQEYRKKVLRELNSLISGGAGPADDAVDEEVTDTEWFFLVSMTQSFACGSGL  178

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF +++ +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVELGST+ I QS 
Sbjct  179   AGKAFSTANAVWVSGSDQLSGSGCERAKQGGIFGMQTIACIPSANGVVELGSTEQIRQSS  238

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DLMNKVRVLFNF+    G +SG  +W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  239   DLMNKVRVLFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPIGAPGSNEPGNGAPS  295

Query  2502  SIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY------------FTRELNFSEFGFDG  2359
             S      K I F N  S  + T N + D  PS              F+RELNFS      
Sbjct  296   SSSQLFSKSIQFENGGSSSTITENPNPDPTPSPVHSQTQNPKFNNGFSRELNFS------  349

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlk  2179
                         +S+   KP +G+IL+FG+   + +GN +   + G  +++   K     
Sbjct  350   -----------TSSTTLVKPRSGDILSFGDEGKRGSGNPDPSSYSG--QTQFDNKRKKSV  396

Query  2178  aSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGR  1999
                ++ +LSF        G    G  SDHSDLEASVVKE            EKRP+KRGR
Sbjct  397   GLCDDKVLSF------GGGDKTGGGESDHSDLEASVVKEV----------PEKRPKKRGR  440

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+
Sbjct  441   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKV  500

Query  1818  ETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--DMDVDVKVMGWDAMI  1645
               +ES    +K Q + +K EL+ ++      +   ++    I    M+++VK++GWDAMI
Sbjct  501   TKTESEKTQIKTQLEEVKHELAGRKASAGGGDLASSSPMMGIKPVGMEIEVKIIGWDAMI  560

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             R++ +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LI
Sbjct  561   RVESSKRNHPAARLMTALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLI  620

Query  1464  SKLA  1453
             SK+ 
Sbjct  621   SKIG  624



>gb|ABD59338.1| G-box element binding protein [Pisum sativum]
Length=646

 Score =   527 bits (1357),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 330/615 (54%), Positives = 405/615 (66%), Gaps = 67/615 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQ RLQ LI+ A+E WTYAIFWQ S        LLGWGDGYYKGE+DK K  +   
Sbjct  66    NQETLQHRLQALIEDAKENWTYAIFWQTSYDYSTSRQLLGWGDGYYKGEDDKEKAKK-VI  124

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFC  2836
              P +QAHR KVLRELN+LISG +S+D+ VDE+VTDTEWFFL SMTHSF+NGSGL  QA+ 
Sbjct  125   LPEQQAHRNKVLRELNALISGSSSSDDVVDEDVTDTEWFFLTSMTHSFVNGSGLLSQAYF  184

Query  2835  SSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIP--SSNGVVELGSTDLILQSFDLMN  2662
             +SSP+WI+  D+L  S CER R A   GL+T+V IP  SSNGVVEL ST++I  S  +M 
Sbjct  185   NSSPVWIN--DRLSMSTCERTRAAHVHGLQTLVYIPAPSSNGVVELASTEIIPHSAGIME  242

Query  2661  KVRVLFNFNNPDMGSISGSASWAA-PPENDPSALWLTEPTSSSGVDVNTSVQENS-----  2500
             KVR LF+FNNP+      + SW     +NDPS++WL  P  S G+++  S+   S     
Sbjct  243   KVRFLFDFNNPE------ARSWPLNSADNDPSSMWLDIP-GSGGIEIRDSINTVSAVSVT  295

Query  2499  ------IPSSSVKEIVFRNENSIPSSTGNN--------HHDSQPSQYFTRELNFSEFGFD  2362
                   IP  S  EI   +     SST  N         + +Q   +F RELNFS     
Sbjct  296   ASANATIPKKSPFEIHGASTTLPESSTTVNISTAQRQIQNQNQNQSFFPRELNFS-----  350

Query  2361  GAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLG-----GDEskskk  2197
                              S KPE+GEILNFGES      + N   F G      +E   K+
Sbjct  351   ----------------GSFKPESGEILNFGESKKSSYSSANGNFFSGPSPFAANEENRKR  394

Query  2196  ktatlkaSNEEGMLSFGSG-MVKssggigigdssDHSDLEASVVKE-ADSRAVETLAAAE  2023
             ++   ++S E+G+LSF SG ++  S     G  SDHSDLE SVVK+   SR +E     E
Sbjct  395   RSPVSRSSIEDGILSFSSGKLLHGSTIKSGGGDSDHSDLEVSVVKKTVSSRVIE----PE  450

Query  2022  KRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAY  1843
             KRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+Y
Sbjct  451   KRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISY  510

Query  1842  INELKSKLETSESYIDDLKIQAQSLKKEL--STKEP-RHPDPNPKKTTTPHKIPDMDVDV  1672
             INELK KL+  ES  D+L+ +  + +KEL  +TK+P R  +   +K     K+ D+D+DV
Sbjct  511   INELKLKLQGLESSKDELEKELDTTRKELEIATKKPVRLNEEEKEKPENNSKLIDLDIDV  570

Query  1671  KVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYN  1492
             K+MGWDAMIRIQC+KKNHPAA+LM ALK+LDL+V HASVSV+NDLMIQQA++ MG+R Y 
Sbjct  571   KIMGWDAMIRIQCSKKNHPAAKLMAALKELDLDVNHASVSVVNDLMIQQASINMGSRFYT  630

Query  1491  QDQLRLALISKLAET  1447
             Q+QL   L SK+ +T
Sbjct  631   QEQLLSVLSSKIGDT  645



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   523 bits (1346),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 317/604 (52%), Positives = 406/604 (67%), Gaps = 66/604 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKG+EDK K R R  
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGDEDKAKPRQRSS  122

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +DE+VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  123   SPPYSTPADQEYRKKVLRELNSLISGGVAPSDEAVDEEVTDTEWFFLVSMTQSFACGAGL  182

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVE+GST+ I Q+ 
Sbjct  183   AGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTERIRQTS  242

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVD--------  2527
             DL+NKVRVLFNF+    G +SG  +W   P   ENDPS +W+ +P ++ G +        
Sbjct  243   DLVNKVRVLFNFDG-GAGDLSG-LNWNLDPDQGENDPS-MWINDPITAPGSNEPGNGAPS  299

Query  2526  -----VNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFD  2362
                   + S+Q  +  SS++ E    N +  PS   +   + + +  F+RELNFS     
Sbjct  300   SSSQLFSKSIQFENGSSSTITET--PNPDPTPSPVHSQTQNLKFNNNFSRELNFS-----  352

Query  2361  GAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatl  2182
                          +SS   KP +GEILNFG+   + + N +   + G  +++ + K    
Sbjct  353   ------------TSSSTLVKPRSGEILNFGDEGKRSSINPDPSSYSG--QTQFENKRKKS  398

Query  2181  kaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
                NE+ +LSFG               SDHSD+EASVVKE          A EKRP+KRG
Sbjct  399   TLLNEDKVLSFGD---------KTAGESDHSDVEASVVKEV---------AVEKRPKKRG  440

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK+K
Sbjct  441   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKAK  500

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP-DMDVDVKVMGWDAMI  1645
             +  +ES    +K Q + +K EL+ ++      +   ++     P  M+++VK++GWDAMI
Sbjct  501   VVKTESEKVMIKNQLEEVKMELAGRKASAGCGDMSSSSCSSIKPVGMEIEVKIIGWDAMI  560

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALI  1465
             R++ +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LI
Sbjct  561   RVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLI  620

Query  1464  SKLA  1453
             SK++
Sbjct  621   SKIS  624



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   522 bits (1345),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 325/611 (53%), Positives = 399/611 (65%), Gaps = 82/611 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             N+ETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRTS  110

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG    TD++VDEEVTDTEWFFLVSMT SF  GSGL
Sbjct  111   PPPFSTPADQEYRKKVLRELNSLISGGGGPTDDAVDEEVTDTEWFFLVSMTQSFACGSGL  170

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+ G D+L  S CERA+Q   FG++T+ CIPS+NGVVELG T+ I QS 
Sbjct  171   AGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGPTEQIRQSS  230

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DLMNKVRVLFNFN    G +S   +W   P   ENDPS +W+ +P       +    Q N
Sbjct  231   DLMNKVRVLFNFNG-GAGDLS-CLNWNLDPDQGENDPS-MWINDP-------IGVPEQGN  280

Query  2502  SIPSSS----VKEIVFRNENSIPSST-------------GNNHHDSQPSQY---FTRELN  2383
               PSSS     K I F N  S  SST                H  +Q  ++   F+RELN
Sbjct  281   GAPSSSSQLFAKSIQFENGGS--SSTIIENPNPDPAPAPSPVHSQTQNPKFSNNFSRELN  338

Query  2382  FSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEsks  2203
             FS                  +S+   KP   EIL+FG+   + + N +   + G  +++ 
Sbjct  339   FS-----------------TSSTTLVKPRPAEILSFGDEGKRSSVNPDPSSYSG--QTQF  379

Query  2202  kkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAE  2023
             + K       +++ +L+FG+G          G  SDHSDLEASVVKE            E
Sbjct  380   ENKRKKSIGMSDDKVLTFGTG----------GGESDHSDLEASVVKEI----------PE  419

Query  2022  KRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAY  1843
             KRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAY
Sbjct  420   KRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAY  479

Query  1842  INELKSKLETSESYIDDLKIQAQSLKKELS-TKEPRHPDPNPKKTTTPHKIPDMDVDVKV  1666
             INELKSK+  +ES    +K Q + +K EL+  K     D +   + T  K   M+++VK+
Sbjct  480   INELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGGDLSSSCSLTAIKPVGMEIEVKI  539

Query  1665  MGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQD  1486
             +GWDAMIR++ +K+NHPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+
Sbjct  540   IGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQE  599

Query  1485  QLRLALISKLA  1453
             QLR +LISK+ 
Sbjct  600   QLRASLISKIG  610



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   521 bits (1341),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 326/606 (54%), Positives = 406/606 (67%), Gaps = 78/606 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA-  3019
             NQETLQQRLQ LI+GA ++WTYAIFWQ S  DF+G ++LGWGDGYYKGEEDK + +R + 
Sbjct  51    NQETLQQRLQALIEGAPKSWTYAIFWQLSY-DFSGAAVLGWGDGYYKGEEDKAQPSRRSP  109

Query  3018  ----SSPAEQAHRKKVLRELNSLISGPAs-tdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 SSPAEQ HRK++L ELNSLISG A  +D++V+EEVTDTEWFFLVSMT SF +GSGL
Sbjct  110   RTFFSSPAEQEHRKRILSELNSLISGGAVPSDDAVNEEVTDTEWFFLVSMTQSFPSGSGL  169

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+A+ +S+P+W+ G D+L SS CERARQ   FGL+T+ CIPS+NGVVELGST++I QS 
Sbjct  170   AGKAYSTSNPVWVIGSDQLSSSGCERARQGGVFGLQTIACIPSANGVVELGSTEIIRQSS  229

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTS----  2515
              L+NKVR LF F+  D+        W+  P   ENDPS  W+++PT   G   N S    
Sbjct  230   GLVNKVRTLFKFDGGDLSE----HHWSHDPDQGENDPST-WISDPTDL-GPGTNESGHGA  283

Query  2514  -VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnn  2338
                 + + SS++ E +  N N + S T N  +++     F+RE+N               
Sbjct  284   PSSSSQLFSSTITENL--NPNPVYSQTQNPKYNN-----FSREIN---------------  321

Query  2337  dlrngNSSHSCKPEAGEILNFGESVTKRNG---NGNSCQ--FLGGDEskskkktatlkaS  2173
                   +S    P +GEIL+FGE   + +G      SCQ  FL  D   SK+KT      
Sbjct  322   --CWTTNSILAMPRSGEILSFGEDAKRGSGPKPGPYSCQTQFLSSD---SKRKTTKSIRI  376

Query  2172  NEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKP  1993
             NE+G+LSFG    K            HSDLEASVVKEA         A EKRPRKRGRKP
Sbjct  377   NEDGVLSFGFTGEKFGDSD-------HSDLEASVVKEA---------APEKRPRKRGRKP  420

Query  1992  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLET  1813
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSKL+ 
Sbjct  421   ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQR  480

Query  1812  SESYIDDLKIQAQSLKKELSTKEPRHPDPNP------KKTTTPHKIPDMDVDVKVMGWDA  1651
             +ES     + Q ++LK+EL+    RH + N         ++   K   M+++VK++ WDA
Sbjct  481   AESDKTQFQCQLENLKRELAG---RHANANAGILDASDSSSAVSKPIGMEIEVKIIEWDA  537

Query  1650  MIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLA  1471
             MIRI+ +K+NHPAARLM ALK+L+LEV HASVSV+NDLMIQQA VK+G R Y Q+QL+ A
Sbjct  538   MIRIESSKRNHPAARLMTALKELELEVNHASVSVVNDLMIQQATVKLGFRPYTQEQLKAA  597

Query  1470  LISKLA  1453
             LISK+ 
Sbjct  598   LISKIG  603



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score =   521 bits (1343),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 326/644 (51%), Positives = 412/644 (64%), Gaps = 78/644 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGK-RNRP  3022
             NQETLQQRLQTLIDGA E WTY IFWQ+SV   +G S LGWGDGYYKG EEDK K R   
Sbjct  59    NQETLQQRLQTLIDGAGENWTYGIFWQSSVDAASGASFLGWGDGYYKGCEEDKRKQRAAS  118

Query  3021  ASSPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             A+S AEQ HRK+VLRELNSLISG   ++ DE+V+EEVTDTEWFFLVSMT SF+NG GLPG
Sbjct  119   AASAAEQEHRKRVLRELNSLISGGGSSAQDETVEEEVTDTEWFFLVSMTQSFVNGDGLPG  178

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  + +P W++G D+L ++PCERARQAQ FG++TMVC P  +GV+ELGSTD+IL S ++
Sbjct  179   QALYAGAPSWVAGCDRLAAAPCERARQAQLFGIQTMVCYPVGSGVLELGSTDVILHSPEI  238

Query  2667  MNKVRVLFNFNNPDMGSISGSA-----SWAAPP-----ENDPSALWLTEPT---------  2545
             M K+ VLFNF +PD  S +G++     S AA P     E DPS LWLTEP+         
Sbjct  239   MGKISVLFNFGSPDSPSTAGASLIAPQSAAATPAADQGETDPSVLWLTEPSMVEIKDSVS  298

Query  2544  -SSSGVDVNTS---VQENSIPSSSV------------KEIVFRNENSIPSSTGNNHHDSQ  2413
              + +  D++ +   +   S PSS+V            K +    +        ++    Q
Sbjct  299   PAPAAADISVTKLPILLESNPSSTVHIENPASSMEIQKALYGHQQQIHHPQHQSSGSKPQ  358

Query  2412  PSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN------  2251
                +F++ELNFS F  +G+              HS KPE+G+ILNF     KRN      
Sbjct  359   SQPFFSKELNFSGFASNGSVAL-----------HSVKPESGDILNFAGG--KRNSSPVPV  405

Query  2250  -----GNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigds-----  2101
                   +  +       ++     T ++ ++N+EGMLSF S   +      +  S     
Sbjct  406   TGSVFSHHQAAAVADDKKNSKSTGTTSMVSNNDEGMLSFSSAPTRPPSNSQLKSSCGGGV  465

Query  2100  -----sDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRRE  1936
                  SD SDLEASV +    R VE     EKRPRKRGRKPANGREEPLNHVEAERQRRE
Sbjct  466   LDGADSDQSDLEASVREVESIRVVEP----EKRPRKRGRKPANGREEPLNHVEAERQRRE  521

Query  1935  KLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL  1756
             KLNQRFYALRAVVPNVSKMDKASLLGDA++YINEL+SKL+ SE+  ++L+ Q + +KKE 
Sbjct  522   KLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQASEADKEELQSQMEIIKKER  581

Query  1755  STKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDL  1576
              +   R   P             +++DVK++G +AMIR+Q  K+NHPAARLM AL+DLDL
Sbjct  582   ESAPARPAPPPRYDVKMMKGCHGVEIDVKLLGSEAMIRLQSQKRNHPAARLMAALQDLDL  641

Query  1575  EVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL-AET  1447
             EV +ASVSV+ DLMIQQA V+M +R+Y Q+QL  AL S+L AET
Sbjct  642   EVHYASVSVVKDLMIQQATVQMSSRVYTQEQLNAALYSRLVAET  685



>ref|XP_008786336.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=680

 Score =   516 bits (1329),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 323/625 (52%), Positives = 401/625 (64%), Gaps = 76/625 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRL TLI+GARETWTYAIFWQ+SV   +G SLLGWGDG+YKG E+  ++ + A+
Sbjct  61    NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGASLLGWGDGFYKGCEEDKRKQKAAA  120

Query  3015  SPAEQAHRKKVLRELNSLISGPAstde---svdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             S  EQ HRK+VLRELNSLISG A       +V+EEVTDTEWFFLVSM  SF  G GLPGQ
Sbjct  121   SREEQEHRKRVLRELNSLISGGAGVSSPDEAVEEEVTDTEWFFLVSMAQSFGVGDGLPGQ  180

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  + +P WI+G D+L  +PCERARQAQ FGL+TMVC+P  +GV+ELGSTDLI QS +LM
Sbjct  181   ALFAEAPTWIAGADRLAMAPCERARQAQLFGLQTMVCVPVGSGVLELGSTDLIYQSSELM  240

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPP----------ENDPSALWLTEPT----------  2545
             NK+RVLFNF++ ++ S     SW  PP          E DPS LWL +P+          
Sbjct  241   NKIRVLFNFHSLEIPS----GSWLPPPVATPAVADQDETDPSVLWLADPSMVEIKDSVSP  296

Query  2544  --SSSGVDVNTS-VQENSIPSSSVKE----IVFR---NENSIPSSTGNNHHDSQPSQYFT  2395
               +++ + V  S +Q ++  SS++ E    I  +   N+    +   N   + Q     T
Sbjct  297   GPATAEISVTKSPIQLDNRSSSTITESPSSIQMQQRHNQQKHQNQNSNGTSNFQTQSLCT  356

Query  2394  RELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN-----GNG---N  2239
             R   FSEF  +G+               S KPE+GEILNFG S  KRN     G+G   +
Sbjct  357   RGFTFSEFAMNGSAPPP-----------SLKPESGEILNFGNS--KRNSSPAPGSGLLSH  403

Query  2238  SCQFLGGDEskskkktatlkaSNEEGMLSFGS--------GMVKssggigigdssDHSDL  2083
                   GD++  +   AT + S++EGMLSF S        G  KS GGI  G  SDHSDL
Sbjct  404   QQTAATGDKNNKRSTGATSRGSSDEGMLSFSSAPARPSSAGQAKSVGGIAGGGDSDHSDL  463

Query  2082  EASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  1903
             EASV +      VE     EKRPRKRGRKPANGR EPLNHVEAERQRREKLNQRFYALRA
Sbjct  464   EASVREVESGLVVE----PEKRPRKRGRKPANGRLEPLNHVEAERQRREKLNQRFYALRA  519

Query  1902  VVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELST-----KEPR  1738
             VVPNVSKMDKASLLGDAI+YI EL +K ET ES  + L+ Q + LK    +     +  +
Sbjct  520   VVPNVSKMDKASLLGDAISYIKELATKQETLESEKEGLQAQIEILKTARDSDSAPARPSQ  579

Query  1737  HPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHAS  1558
              PDP+  +     +   ++++VK +G +AMIR+QC K NHPAARLM ALK+LDL+V +A 
Sbjct  580   QPDPD-TRLMNGGRCHGVEIEVKTLGLEAMIRVQCHKTNHPAARLMAALKELDLDVYYAM  638

Query  1557  VSVMNDLMIQQAAVKMGTRLYNQDQ  1483
             VSV+ DLMIQQA VKM  R+Y Q+Q
Sbjct  639   VSVVKDLMIQQATVKMSGRVYTQEQ  663



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   512 bits (1318),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 307/609 (50%), Positives = 401/609 (66%), Gaps = 81/609 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAG----------PSLLGWGDGYYKGEE  3046
             N++TLQQRLQ LI+GA E+WTYA+FWQ+S  DFAG           ++LGWGDGYYKGEE
Sbjct  62    NEDTLQQRLQALIEGANESWTYAVFWQSSY-DFAGEDDGGGESRNTAVLGWGDGYYKGEE  120

Query  3045  D--KGKRNRPASSPAEQAHRKKVLRELNSLISGPAs-------tdesvdeevtdtEWFFL  2893
             +  + K++ PAS+ AEQ HR++V+RELN+LISG          +DE+ DEEVTDTEWFFL
Sbjct  121   ENSRKKKSNPASA-AEQEHRRRVIRELNALISGGGGVVNNGGGSDEAGDEEVTDTEWFFL  179

Query  2892  VSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGV  2713
             VSMT SF++G+GLPGQAF +S+ IW+SG + L  S CERARQ Q +GL+TMVC+P  NGV
Sbjct  180   VSMTQSFVSGTGLPGQAFSNSNTIWLSGSNALAGSSCERARQGQIYGLQTMVCVPCENGV  239

Query  2712  VELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTS  2542
             VELGS+++I QS DL++KV   FNFNN   G  SGS ++   P   ENDP  LW+ EP  
Sbjct  240   VELGSSEIIHQSSDLVDKVDTFFNFNNG--GGESGSWAFNLNPDQGENDP-GLWIGEP-D  295

Query  2541  SSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFD  2362
             S GV++                        + ++TGNN   +  SQ  ++  N S     
Sbjct  296   SVGVELGLVA-------------------PVMNNTGNNSASNSDSQPISKLCNGS-----  331

Query  2361  GAnnnhnndlrngNSSHSCKPE---AGEILNFGESVTKRNGNGNSCQFLGGDEskskkkt  2191
                           S    KP+   + E+++F ++ T  NG     +F+  D      K 
Sbjct  332   --------------SVEDPKPQVTKSSEMVSF-KNGTDENGFSGQSRFMEED----SNKK  372

Query  2190  atlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPR  2011
              +  ++N+EGMLSF S + + +          HSDLEASVVKEA+S    T+   EK+PR
Sbjct  373   RSPVSNNDEGMLSFTSVLPRPAKSGDSN----HSDLEASVVKEAESN--RTVVEPEKKPR  426

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPN+SKMDKASLLGDAI+YINEL
Sbjct  427   KRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNISKMDKASLLGDAISYINEL  486

Query  1830  KSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDA  1651
             KSKL+  ES  ++L+ Q + + KE + ++    +       +   I +M+VDVK++GWDA
Sbjct  487   KSKLQKVESDKEELQKQIEGMSKEAANEKSYVKERKCANQESGVTI-EMEVDVKIIGWDA  545

Query  1650  MIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLA  1471
             MIR+QC+K+NHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG   + QDQL++A
Sbjct  546   MIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGKEFFTQDQLKVA  605

Query  1470  LISKLAETL  1444
             L+ K+ E L
Sbjct  606   LMEKVGECL  614



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score =   512 bits (1318),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 315/639 (49%), Positives = 404/639 (63%), Gaps = 72/639 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQETLQQRLQ LI+GARE+WTY IFWQ+SV    G S LGWGDGYYKG E+  ++ R AS
Sbjct  65    NQETLQQRLQALIEGARESWTYGIFWQSSVDAATGTSFLGWGDGYYKGCEEDKRKQRAAS  124

Query  3015  --SPAEQAHRKKVLRELNSLISGPAstd--esvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
               S A+Q HRK+VLRELNSLISG  S    E V+EEVTDTEWFFLVSMT SF+NG+GLPG
Sbjct  125   TASAADQDHRKRVLRELNSLISGGVSLAPDEIVEEEVTDTEWFFLVSMTQSFVNGAGLPG  184

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA C+ +P WI+G  +L ++ CERAR AQ FG++TMVC P  +GV+ELGSTD IL + DL
Sbjct  185   QALCAGAPYWIAGAGRLSAASCERARHAQLFGIQTMVCAPVGSGVLELGSTDTILYNLDL  244

Query  2667  MNKVRVLFNFNNPDMGSISGSASW------AAPP-----ENDPSALWLTEPTS-------  2542
             M K+RVLFNF++ D    + + SW      AA P     E++P  LWLT+P++       
Sbjct  245   MGKIRVLFNFSSRDAPDTAAAPSWLAQQSVAATPAAGHGESNPPVLWLTDPSTVEIKDSV  304

Query  2541  -----SSGVDVNTS-VQENSIPSSSVKEIVFRNENSIPSSTGNNH-------HDS-----  2416
                  S G+ V    +Q +S PSSS+      +   IP    ++        H S     
Sbjct  305   SRVSTSVGISVTKPPIQSDSNPSSSILTENPTSAMQIPKVHDDHQRQIHQLQHQSSCSKP  364

Query  2415  QPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG--------ESVT  2260
             Q   + ++E +FS F  +GA             + S KPE+ +I +F           V 
Sbjct  365   QAQSFMSKEFDFSGFASNGAVA----------PARSFKPESRDIPSFAGGKRDSSPAPVA  414

Query  2259  KRNGNGNSCQFLGGDEskskkktatlkaSNE-EGMLSFGSGMVKssggigigdss-----  2098
                 +      +  D+  ++   AT +ASN+ EGMLSF S   ++     +  SS     
Sbjct  415   SSLFSRQQATAVADDKKTNRSTGATSRASNDGEGMLSFSSAPARAPSSGQLRSSSGGVPD  474

Query  2097  ----DHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKL  1930
                 D S+LE SV +   SRAVE     EKRPRKRGRKPANGREEPLNHVEAERQRREKL
Sbjct  475   GPDSDQSELEPSVREVESSRAVEP----EKRPRKRGRKPANGREEPLNHVEAERQRREKL  530

Query  1929  NQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELST  1750
             NQRFYALRAVVPNVSKMDKASLLGDA++YINEL+SKL+  E+  +DL+ Q Q LKKE  +
Sbjct  531   NQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQALEANKEDLQAQIQGLKKERES  590

Query  1749  KEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEV  1570
                + P+ N K      +   ++++VK++G +A+IR+Q  K+NHPAA LM AL+DLDLEV
Sbjct  591   APTQRPESNLKTMNGGGRCHGVEIEVKLLGSEALIRLQSQKRNHPAAVLMAALQDLDLEV  650

Query  1569  THASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
              +ASVSV+ DLMIQQA VKM  R++ Q+QL   L ++LA
Sbjct  651   HYASVSVVKDLMIQQATVKMSRRVFTQEQLSSVLYARLA  689



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   509 bits (1311),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 321/649 (49%), Positives = 408/649 (63%), Gaps = 91/649 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGK-RNRP  3022
             +QETLQQRLQ LI+GARE+WTY IFWQ+SV    G S LGWGDGYYKG EEDK K R   
Sbjct  73    SQETLQQRLQALIEGARESWTYGIFWQSSVDAATGASFLGWGDGYYKGYEEDKRKQRVAG  132

Query  3021  ASSPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             A+S AEQ HRK VLREL+SLISG   ++ DE+VDEEVTDTEWFFLVSMT SF+NG GLPG
Sbjct  133   AASAAEQEHRKCVLRELHSLISGGGSSAPDEAVDEEVTDTEWFFLVSMTQSFVNGGGLPG  192

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QAF + +P W++G D+L ++PC+RARQAQ FGL+TMVC+P  +GV+ELGSTD++  S ++
Sbjct  193   QAFYTGAPAWVTGADRLAAAPCDRARQAQLFGLQTMVCVPVGSGVLELGSTDVVFHSPEI  252

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPP-----------ENDPSALWLTEPTSSSGVDVN  2521
             M K+RVLFNF++PD  S+   ASW  P            E DPS LWLT+P   S VD+ 
Sbjct  253   MGKIRVLFNFSSPDAPSV---ASWLTPQSAAPTPATDQGETDPSMLWLTDP---SAVDIK  306

Query  2520  TSV----------------QENSIPSSSV------KEIVFRNENSIPSSTGNNHHDSQPS  2407
              SV                Q  + PSSS+        + F+  ++ P    +    S P 
Sbjct  307   DSVSPVSATADLSVTKPPIQLENNPSSSILTESPSSSMQFQRTHNQPQQQLHQSSASDPH  366

Query  2406  Q--YFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN------  2251
                + +++ N SEF  +G+               S KPE  +IL+F  S   RN      
Sbjct  367   THLFVSKKFNLSEFASNGSVV-----------PRSAKPEPSDILDFAGS--NRNPTPAPV  413

Query  2250  -----GNGNSCQFLGGDEskskkktatlkaSN-EEGMLSFGSGMVKssggigigds----  2101
                   +  +      D+   +   AT + SN +EGM+SF S   +    +    S    
Sbjct  414   TGSLFSHHQTITAAADDKRNKRSTGATSRVSNSDEGMISFSSASARPPSDVLFKSSGGGG  473

Query  2100  ------sDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRR  1939
                   SD SDLEAS  +    R VE     EKRP+KRGRKPANGREEPLNHVEAERQRR
Sbjct  474   ILDGPDSDQSDLEASAREVESIRPVE----PEKRPKKRGRKPANGREEPLNHVEAERQRR  529

Query  1938  EKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKE  1759
             EKLNQRFYALRAVVPNVSKMDKASLLGDA++YINEL+SKLET E   ++L+ Q ++L+KE
Sbjct  530   EKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLETLEIDKEELRAQVEALEKE  589

Query  1758  LSTKEPRHPDPNPKKT------TTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMV  1597
               +   R   P P         +   +   ++++VK++G +AMIR+QC K+NHPAA+LM 
Sbjct  590   RESNPTRPVQPPPDHDLRMMNGSGGDRCHGVELEVKILGSEAMIRLQCLKRNHPAAKLMA  649

Query  1596  ALKDLDLEVTHASVSVMNDLMIQQAAVKMG-TRLYNQDQLRLALISKLA  1453
             A++DLDL+V +ASVSV+ DLMIQQA VKM  +R Y  +QLR AL SKLA
Sbjct  650   AIRDLDLDVHYASVSVVEDLMIQQATVKMSPSRTYTPEQLRAALYSKLA  698



>ref|XP_008796257.1| PREDICTED: transcription factor MYC4 [Phoenix dactylifera]
Length=687

 Score =   507 bits (1306),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 336/650 (52%), Positives = 410/650 (63%), Gaps = 95/650 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGKR--NR  3025
             NQETLQ RL TLI+GARE+WTYAIFWQ+SV   +G SLLGWGDGYYKG EEDK K+    
Sbjct  60    NQETLQHRLLTLIEGARESWTYAIFWQSSVDMASGVSLLGWGDGYYKGCEEDKRKQRVTN  119

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstde---svdeevtdtEWFFLVSMTHSFINGSGL  2854
             PAS+  EQ HRK+VLRELNSLISG A       +V+EEVTDTEWFFLVSM  SF NGSGL
Sbjct  120   PASA-EEQEHRKRVLRELNSLISGGAGVSSPDETVEEEVTDTEWFFLVSMMQSFENGSGL  178

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PGQA  + +P WI G D+L  +PCERARQAQ  GL+TM C+P  +GV+ELGSTD+I QS 
Sbjct  179   PGQALFADAPTWIPGADRLALAPCERARQAQALGLQTMACVPVGSGVLELGSTDVIYQSS  238

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP----------ENDPSALWLTEPT-------  2545
             +LMN +RVLFNF + ++ S      W              E DPS LWL +PT       
Sbjct  239   ELMNTIRVLFNFTSLEIPS----GCWLPTAAATPAVADHGETDPSVLWLADPTMVEIKDS  294

Query  2544  ---SSSGVDVNTS---VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQP---------  2410
                +S+  D++ +   +Q ++  SS+V E    N +SI     +N H  Q          
Sbjct  295   ISPASATADISVTKPPIQFDNPSSSTVTE----NPSSIQMQRHHNQHQQQRQQHENQNSN  350

Query  2409  --------SQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKR  2254
                     S +  RE NFSE   +G                S KPE+G+IL FG+S  KR
Sbjct  351   SNSNLQTQSLFAAREFNFSEVVLNGPA-----------PPQSFKPESGDILTFGDS--KR  397

Query  2253  NGNGNSCQFL-----------GGDEskskkktatlkaSNEEGMLSFGS--------GMVK  2131
             N +      L             D+   +   AT + SN+EGMLSF S        G  K
Sbjct  398   NSSPAPGSSLFSHHQIATVPAADDKKNKRSTGATSRGSNDEGMLSFSSAAARPSSAGQAK  457

Query  2130  ssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAE  1951
             S GGI  G  SDHSDLEASV +   S  VE     EKRPRKRGRKPANGREEPLNHVEAE
Sbjct  458   SGGGILGGADSDHSDLEASVREVESSPVVE----PEKRPRKRGRKPANGREEPLNHVEAE  513

Query  1950  RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQS  1771
             RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+SKL++ ES  + L+ Q  S
Sbjct  514   RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESDKEGLQAQIDS  573

Query  1770  LKKELSTKEPRH---PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLM  1600
             LK++  +   R    PD +  K     +   ++++VK++G +AMIR+QC KKNHPAARLM
Sbjct  574   LKRDRDSSPARPLQLPDQD-AKMMNGGRCHGVEIEVKILGLEAMIRVQCHKKNHPAARLM  632

Query  1599  VALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
              ALKDLDL+V +ASVSV+ DLMIQQ  VKM +R+Y+Q+QL  AL S++ E
Sbjct  633   AALKDLDLDVYYASVSVVKDLMIQQTTVKMPSRVYSQEQLSAALFSRVGE  682



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score =   500 bits (1288),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 308/595 (52%), Positives = 381/595 (64%), Gaps = 79/595 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-------LLGWGDGYYKGEEDKG  3037
             N++ LQQRLQ LI+GA E WTYA+FWQ+S   FAG         LLGWGDGYYKGEE+K 
Sbjct  59    NEDNLQQRLQALIEGANENWTYAVFWQSSH-GFAGEDNNNNNTVLLGWGDGYYKGEEEKS  117

Query  3036  --KRNRPASSPAEQAHRKKVLRELNSLISGPAstdesv-deevtdtEWFFLVSMTHSFIN  2866
               K++ PAS+ AEQ HRK+V+RELNSLISG     +   DEEVTDTEWFFLVSMT SF+ 
Sbjct  118   RKKKSNPASA-AEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMTQSFVK  176

Query  2865  GSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLI  2686
             G+GLPGQAF +S  IW+SG + L  S CERARQ Q +GL+TMVC+ + NGVVELGS+++I
Sbjct  177   GTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELGSSEII  236

Query  2685  LQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTS  2515
              QS DL++KV   FNFNN   G   GS ++   P   ENDP  LW++EP           
Sbjct  237   HQSSDLVDKVDTFFNFNNG--GGEFGSWAFNLNPDQGENDP-GLWISEP-----------  282

Query  2514  VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnnd  2335
                N + S  V   V  N        GN+   +  SQ  ++  N S              
Sbjct  283   ---NGVDSGLVAAPVMNN-------GGNDSTSNSDSQPISKLCNGS--------------  318

Query  2334  lrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
                  S  +  P+   +L   E V  +NG  N      G E  S  K  +  ++NEEGML
Sbjct  319   -----SVENPNPK---VLKSCEMVNFKNGIEN------GQEEDSSNKKRSPVSNNEEGML  364

Query  2154  SFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREE  1975
             SF S +            S+HSDLEASV KEA+S  V  +   EK+PRKRGRKPANGREE
Sbjct  365   SFTSVL---------PCDSNHSDLEASVAKEAESNRV--VVEPEKKPRKRGRKPANGREE  413

Query  1974  PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYID  1795
             PLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YI+ELKSKL+ +ES  +
Sbjct  414   PLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKE  473

Query  1794  DLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHP  1615
             +L+ Q   + KE    +    D       +   I +M+VDVK++GWDAMIRIQC+K+NHP
Sbjct  474   ELQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLI-EMEVDVKIIGWDAMIRIQCSKRNHP  532

Query  1614  AARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
              A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG + + QDQL++AL  K+ E
Sbjct  533   GAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALTEKVGE  587



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score =   500 bits (1288),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 308/595 (52%), Positives = 381/595 (64%), Gaps = 79/595 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-------LLGWGDGYYKGEEDKG  3037
             N++ LQQRLQ LI+GA E WTYA+FWQ+S   FAG         LLGWGDGYYKGEE+K 
Sbjct  59    NEDNLQQRLQALIEGANENWTYAVFWQSSH-GFAGEDNNNNNTVLLGWGDGYYKGEEEKS  117

Query  3036  --KRNRPASSPAEQAHRKKVLRELNSLISGPAstdesv-deevtdtEWFFLVSMTHSFIN  2866
               K++ PAS+ AEQ HRK+V+RELNSLISG     +   DEEVTDTEWFFLVSMT SF+ 
Sbjct  118   RKKKSNPASA-AEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMTQSFVK  176

Query  2865  GSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLI  2686
             G+GLPGQAF +S  IW+SG + L  S CERARQ Q +GL+TMVC+ + NGVVELGS+++I
Sbjct  177   GTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELGSSEII  236

Query  2685  LQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTS  2515
              QS DL++KV   FNFNN   G   GS ++   P   ENDP  LW++EP           
Sbjct  237   HQSSDLVDKVDTFFNFNNG--GGEFGSWAFNLNPDQGENDP-GLWISEP-----------  282

Query  2514  VQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnnd  2335
                N + S  V   V  N        GN+   +  SQ  ++  N S              
Sbjct  283   ---NGVDSGLVAAPVMNN-------GGNDSTSNSDSQPISKLCNGS--------------  318

Query  2334  lrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
                  S  +  P+   +L   E V  +NG  N      G E  S  K  +  ++NEEGML
Sbjct  319   -----SVENPNPK---VLKSCEMVNFKNGIEN------GQEEDSSNKKRSPVSNNEEGML  364

Query  2154  SFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREE  1975
             SF S +            S+HSDLEASV KEA+S  V  +   EK+PRKRGRKPANGREE
Sbjct  365   SFTSVL---------PCDSNHSDLEASVAKEAESNRV--VVEPEKKPRKRGRKPANGREE  413

Query  1974  PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYID  1795
             PLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YI+ELKSKL+ +ES  +
Sbjct  414   PLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKE  473

Query  1794  DLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHP  1615
             +L+ Q   + KE    +    D       +   I +M+VDVK++GWDAMIRIQC+K+NHP
Sbjct  474   ELQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLI-EMEVDVKIIGWDAMIRIQCSKRNHP  532

Query  1614  AARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
              A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG + + QDQL++AL  K+ E
Sbjct  533   GAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALTEKVGE  587



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score =   504 bits (1297),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 316/656 (48%), Positives = 393/656 (60%), Gaps = 100/656 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ++I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  ++ R   
Sbjct  53    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  112

Query  3024  PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             PA++ AEQ HRK+VLRELNSLI+G  A+ DE+V+EEVTDTEWFFLVSMT SF NG GLPG
Sbjct  113   PAAA-AEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFPNGLGLPG  171

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  ++ P WI+    L S+PC+RARQA TFGLRTMVC+P + GV+ELGSTD+I Q+ D 
Sbjct  172   QALFAAQPTWIA--TGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQTGDS  229

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPEN---DPSALWLTEPTSSSGVDVNTSVQENSI  2497
             + ++R LFN       S + ++SW   P+    DPS LWL +   +  +D+  S+    I
Sbjct  230   IPRIRALFNL------SAAAASSWPPHPDAASADPSVLWLAD---APPMDMKDSISAADI  280

Query  2496  PSSSVKEIVFRN----ENSIPSSTGNNH----HDSQPSQY--------------------  2401
               S             EN   S+   N     H   PSQ                     
Sbjct  281   SVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPTPSQPAAPPQRQQQQQQSSQAQQGP  340

Query  2400  FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG--ESVTKRNG-------  2248
             F RELNFS+F  +G                  KPE GEILNFG   S  +RN        
Sbjct  341   FRRELNFSDFASNGGAAAPPF----------FKPETGEILNFGNDSSSGRRNPSPAPPAA  390

Query  2247  ---------------------------NGNSCQFLGGDEskskkktatlkaSNEEGMLSF  2149
                                        + N  + +      S         +NE GMLSF
Sbjct  391   TASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSRASNTNNHPAATANE-GMLSF  449

Query  2148  GSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGRE  1978
              S                 SDHSDLEASV +   SR V     AEKRPRKRGRKPANGRE
Sbjct  450   SSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVAPPPEAEKRPRKRGRKPANGRE  509

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ KL   E+  
Sbjct  510   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDK  569

Query  1797  DDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
             + L+ Q +SLKKE   ++ R P P+        +   ++++ K++G +AMIR+QC K+NH
Sbjct  570   ETLQSQMESLKKE---RDARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNH  626

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             PAARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QDQL  AL +++AE
Sbjct  627   PAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYSQDQLNAALYTRIAE  682



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score =   503 bits (1295),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 316/656 (48%), Positives = 393/656 (60%), Gaps = 100/656 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ++I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  ++ R   
Sbjct  64    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  123

Query  3024  PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             PA++ AEQ HRK+VLRELNSLI+G  A+ DE+V+EEVTDTEWFFLVSMT SF NG GLPG
Sbjct  124   PAAA-AEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFPNGLGLPG  182

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  ++ P WI+    L S+PC+RARQA TFGLRTMVC+P + GV+ELGSTD+I Q+ D 
Sbjct  183   QALFAAQPTWIA--TGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQTGDS  240

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPEN---DPSALWLTEPTSSSGVDVNTSVQENSI  2497
             + ++R LFN       S + ++SW   P+    DPS LWL +   +  +D+  S+    I
Sbjct  241   IPRIRALFNL------SAAAASSWPPHPDAASADPSVLWLAD---APPMDMKDSISAADI  291

Query  2496  PSSSVKEIVFRN----ENSIPSSTGNNH----HDSQPSQY--------------------  2401
               S             EN   S+   N     H   PSQ                     
Sbjct  292   SVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPTPSQPAAPPQRQQQQQQSSQAQQGP  351

Query  2400  FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG--ESVTKRNG-------  2248
             F RELNFS+F  +G                  KPE GEILNFG   S  +RN        
Sbjct  352   FRRELNFSDFASNGGAAAPPF----------FKPETGEILNFGNDSSSGRRNPSPAPPAA  401

Query  2247  ---------------------------NGNSCQFLGGDEskskkktatlkaSNEEGMLSF  2149
                                        + N  + +      S         +NE GMLSF
Sbjct  402   TASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSRASNTNNHPAATANE-GMLSF  460

Query  2148  GSGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGRE  1978
              S                 SDHSDLEASV +   SR V     AEKRPRKRGRKPANGRE
Sbjct  461   SSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVAPPPEAEKRPRKRGRKPANGRE  520

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ KL   E+  
Sbjct  521   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDK  580

Query  1797  DDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
             + L+ Q +SLKKE   ++ R P P+        +   ++++ K++G +AMIR+QC K+NH
Sbjct  581   ETLQSQMESLKKE---RDARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNH  637

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             PAARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QDQL  AL +++AE
Sbjct  638   PAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYSQDQLNAALYTRIAE  693



>ref|XP_010053608.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=614

 Score =   499 bits (1286),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 303/597 (51%), Positives = 400/597 (67%), Gaps = 34/597 (6%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGAR------------ETWTYAIFWQASVVDFAGPSLLGWGDGYYKG  3052
             +QE+LQ+RLQ LI+GAR              WTY IFWQ+S  D++GP +LGWGDGYYKG
Sbjct  35    SQESLQRRLQALIEGARGRDGEEGAGGPAAAWTYTIFWQSSG-DYSGP-VLGWGDGYYKG  92

Query  3051  EEDKGKRNRPASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSF  2872
             +  + +    A S AEQ HRKKVLRELNSLISG    D++V+EEVTDTEWFFLVSMT SF
Sbjct  93    D-GRARSRGSACSQAEQEHRKKVLRELNSLISGAPPADDAVEEEVTDTEWFFLVSMTQSF  151

Query  2871  INGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTD  2692
               G GLPG+A+ SS+P W++G ++L +  C+RARQAQ FGL+T+ C+P  NGVVELGST+
Sbjct  152   AGGVGLPGRAYFSSNPAWVTGAERLGNCGCDRARQAQIFGLQTIACVPVLNGVVELGSTE  211

Query  2691  LILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSV  2512
              I QS DL++ +R LFNF+  +MG            E+DP++LW+ +P  +  ++     
Sbjct  212   PIYQSSDLISGIRGLFNFHESEMGC----GGRVLNSEHDPASLWICDPPVTMEINDRPMT  267

Query  2511  QENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndl  2332
              +   PSSS          +I       +       +F +ELNF+E+  + ++ ++N   
Sbjct  268   FQIENPSSSSLTESPSAICAINDQQSGQNQQQNEG-FFAKELNFAEYAINSSSRSNNG--  324

Query  2331  rngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLS  2152
                  SH  KPE+ E+LNFG+S + R  + +S   + G+ +K KK++AT   SNEE M+S
Sbjct  325   ----DSHPMKPESVEVLNFGDSGSGRLLSSHSQVAVAGETAKKKKRSATSIGSNEEEMMS  380

Query  2151  FGSGMV----KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             F SG++         +     SDHSD+EASVVKEA+S  V      EKRPRKRGRKPANG
Sbjct  381   FTSGVIVPSSGMLKSVSGAGDSDHSDVEASVVKEAESSKV---VEPEKRPRKRGRKPANG  437

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL DA +YI EL   L+ +ES
Sbjct  438   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLQDAESYIRELNMNLQAAES  497

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTT-TPHKIPDMDVDVKVMGWDAMIRIQCTK  1627
               +DLK Q   LKK  S KE    D + K    T  +   + +DVK+MGWDA++R++  +
Sbjct  498   DKEDLKKQLDELKKRSSDKECIPVDQDRKMAKPTGSRSTGVAIDVKIMGWDAVVRVESGR  557

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             K+HPAARLMVAL++L+LE+ HASVSV+N+LMIQQA VKMG++LY Q+QL+ AL++ +
Sbjct  558   KDHPAARLMVALQELNLELQHASVSVVNELMIQQATVKMGSQLYTQEQLKAALLAVI  614



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   499 bits (1284),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 303/600 (51%), Positives = 379/600 (63%), Gaps = 79/600 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAG-----------PSLLGWGDGYYKGE  3049
             N++ LQQRLQ LI+GA E+WTYA+FWQ+S  DFAG            +LLGWGDGYYKGE
Sbjct  58    NEDNLQQRLQALIEGANESWTYAVFWQSSH-DFAGEDDGVRTNNNNTTLLGWGDGYYKGE  116

Query  3048  EDKG--KRNRPASSPAEQAHRKKVLRELNSLISGPAstdesvdeev--tdtEWFFLVSMT  2881
             E+K   K++ PAS+ AEQ HRK+V+RELNSLISG          +   TDTEWFFLVSMT
Sbjct  117   EEKSRKKKSNPASA-AEQEHRKRVIRELNSLISGGGGGGGDEAGDEEVTDTEWFFLVSMT  175

Query  2880  HSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELG  2701
              SF+NG GLPGQAF +S+ IW+SG + L  S CERARQ Q +GL+TMVC+ + NGVVELG
Sbjct  176   QSFVNGIGLPGQAFSNSNTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATGNGVVELG  235

Query  2700  STDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGV  2530
             S+++I QS DL++KV   FN      G  SGS ++   P   ENDP  LW++EP +    
Sbjct  236   SSEIIHQSSDLVDKVDTFFN-----GGGESGSWAFNLNPDQGENDP-GLWISEPNN----  285

Query  2529  DVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnn  2350
                     N   S  V   V  N N    ST N+  DSQP    ++  N S         
Sbjct  286   --------NGDESGLVAAPVMMN-NGGNDSTSNS--DSQP---ISKLCNGSSV-------  324

Query  2349  nhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSN  2170
                                 ++L  GE V  +NG  N      G     ++   +  ++N
Sbjct  325   ------------------ENQVLKSGEMVRVKNGMENG---FSGQSRFMEEDKRSPVSNN  363

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             EEGMLSF S + + +          HSDLEASV KEA+S     +   EK+PRKRGRKPA
Sbjct  364   EEGMLSFTSVLPRPAKSGDSN----HSDLEASVAKEAESNRF--VVEPEKKPRKRGRKPA  417

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +
Sbjct  418   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQKA  477

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCT  1630
             ES  ++L+ Q   + KE    +    D       +   I +M+VDVK++GWDAMIRIQC+
Sbjct  478   ESDKEELQKQFDGMIKEAGNSKSSVKDRRCLNQESSVLI-EMEVDVKIIGWDAMIRIQCS  536

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             K+NHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG + + QDQL++AL+ K+ E
Sbjct  537   KRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALMEKVGE  596



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score =   498 bits (1281),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 328/636 (52%), Positives = 406/636 (64%), Gaps = 78/636 (12%)
 Frame = -3

Query  3189  ETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPA--S  3016
             +TLQ RLQ LI+GARE+WTYAIFWQ S  D++G +LLGWGDGYYKG++DK K    A  +
Sbjct  1     DTLQHRLQALIEGARESWTYAIFWQHSY-DYSGSALLGWGDGYYKGDDDKAKAKAKAKAT  59

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvdeevtd-tEWFFLVSMTHSFINGSGLPGQAF  2839
             S AEQ HRKKVLRELNSLISG ++      +E    TEWFFLVSMT SF+NG+GLP +  
Sbjct  60    SAAEQDHRKKVLRELNSLISGSSAASSDDVDEEVTDTEWFFLVSMTQSFVNGAGLPRRPS  119

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              + +P   S +   L  P   +   Q FGL+T+VCIPS+NGVVELGST+LI Q+ DLMNK
Sbjct  120   STPTPSG-SPERPPLHLPLRESPPGQVFGLQTLVCIPSANGVVELGSTELIYQNPDLMNK  178

Query  2658  VRVLFNF--NNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSI---P  2494
             V+VLFNF  NN DMGS S  A+ A   ENDPS LWL +P     ++   +    S+   P
Sbjct  179   VKVLFNFSNNNFDMGS-SWPATSADQGENDPSTLWLNDPEVRDSINTAAATPSVSVSVPP  237

Query  2493  SSSVKEI--VFRNENSI-----------PSSTGNNHHDSQPSQYFTRELNFSEFGFDGAn  2353
              +S   I    + E+SI           PSS    H   Q    F+RELNFSE+GFD   
Sbjct  238   HNSTHGISKTMQLESSIQTPGSSTLTETPSSI---HAVPQNQSVFSRELNFSEYGFD---  291

Query  2352  nnhnndlrngNSSHSCKPEAGEILNFGESVTKRNG--------------------NGNSC  2233
                     N ++ HS KPE+ EIL+F +S  KR                           
Sbjct  292   ----PKSGNTHNQHSLKPESCEILSFSDS--KRTSYGGGGGGGGVNGNSNSNSNFFSGQS  345

Query  2232  QFLG-GDEsks----kkktatlkaSNEEGMLSFGSGMV--KssggigigdssDHSDLEAS  2074
              F+   DE+ +    K+++   + SN++GMLSF S  +   ++     G  SDHSDLEAS
Sbjct  346   PFVAVADENNNNNNGKRRSPNSRGSNDDGMLSFTSRAILPATNLKSAGGGDSDHSDLEAS  405

Query  2073  VVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1894
             VVK+        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP
Sbjct  406   VVKDP-------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  458

Query  1893  NVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL-------STKEPRH  1735
             NVSKMDKASLLGDAI+YI ELKSKL+  ES  D L+ Q + +KKEL       S+   +H
Sbjct  459   NVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKKELEKSSDNVSSNHTKH  518

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
                N    ++   + D+D+DVK++GWDAMIRIQC+KKNHPAARLM AL +LDL+V HASV
Sbjct  519   -GGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDVHHASV  577

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             SV+NDLMIQQA VKMG+R Y Q+QLR AL +K+ + 
Sbjct  578   SVVNDLMIQQATVKMGSRFYTQEQLRSALSAKVGDV  613



>ref|XP_010434608.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=623

 Score =   496 bits (1277),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 320/618 (52%), Positives = 399/618 (65%), Gaps = 95/618 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFA-----------------GPSLLGWGD  3067
             N++TLQQRLQ LI+GA E+WTYA+FWQ S  DFA                   +LLGWGD
Sbjct  63    NEDTLQQRLQALIEGANESWTYAVFWQLSY-DFAGEDVEEGGVGGGGLTNNNTALLGWGD  121

Query  3066  GYYKGEEDKG--KRNRPASSPAEQAHRKKVLRELNSLISGPAs-------tdesvdeevt  2914
             GYYKGEE+K   K+ +PAS+ AEQ HRK+V+RELN+LISG          +DE+ DEEVT
Sbjct  122   GYYKGEEEKSRKKKTKPASA-AEQEHRKRVVRELNALISGGGGEVVNNGGSDEAGDEEVT  180

Query  2913  dtEWFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVC  2734
             DTEWFFLVSMT SFING+GLPGQAF SS+ IW+SG + L  S CERARQ Q +GL+TMVC
Sbjct  181   DTEWFFLVSMTQSFINGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIYGLQTMVC  240

Query  2733  IPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWA-----APPENDPS  2569
             +P  NGVVELGS+++I QS DL++KV   FNFNN   G    S SWA        ENDP 
Sbjct  241   VPCENGVVELGSSEIIHQSSDLVDKVDTFFNFNNGGGGGCE-SGSWAFNLNPDQGENDPR  299

Query  2568  ALWLTEPTSSSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRE  2389
              LW++EP    GV++             V  ++         +TGNN   +  SQ  ++ 
Sbjct  300   -LWISEP----GVELGL-----------VAPVII--------NTGNNSTSNSDSQPISKL  335

Query  2388  LNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNG--NGNSC---QFL  2224
              N                   G+S  + KP+   +    E V+ +NG  NG S    +F+
Sbjct  336   CN------------------GGSSVENPKPQ---VTKSCEMVSVKNGVENGFSSGQSRFM  374

Query  2223  GGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAV  2044
             G D   S  K  +  ++NEEGMLSF S  V           S+HSDLEASVVKEA+S   
Sbjct  375   GED---SSNKKRSPVSNNEEGMLSFTS--VSVLPRPAKSGDSNHSDLEASVVKEAESN--  427

Query  2043  ETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASL  1864
              T+   EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASL
Sbjct  428   RTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASL  487

Query  1863  LGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDM  1684
             LGDAI+YINELKSKL  +ES  ++L+ Q   + KE +  +    + N +    P    +M
Sbjct  488   LGDAISYINELKSKLLKAESDKEELQKQIDGMSKEAANGKSSVKERNQE----PGVSVEM  543

Query  1683  DVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGT  1504
             +VDVK++GWDAMIR+QC+K+NHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG 
Sbjct  544   EVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGN  603

Query  1503  RLYNQDQLRLALISKLAE  1450
               + QDQL++AL+ K+ E
Sbjct  604   EFFTQDQLKVALMEKVGE  621



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score =   494 bits (1271),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 310/604 (51%), Positives = 403/604 (67%), Gaps = 68/604 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYY+GEEDK K+
Sbjct  47    NEDTLQQRLQALIESAEENWTYAIFWQISH-DFDSPTGDNTLILGWGDGYYRGEEDKDKK  105

Query  3030  NRPAS-SPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSG  2857
              + +S +PAEQ HRK+V+RELNSLISG    +DE+ DEEVTDTEWFFLVSMT SF NG G
Sbjct  106   KKSSSSNPAEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFANGVG  165

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             LPG++  +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS
Sbjct  166   LPGESLLNSRVIWLSGSGALTGSGCERAHQGQIYGLQTMVCIAAENGVVELGSSEVISQS  225

Query  2676  FDLMNKVRVLFNFNNPDMGSISGSASWAAP-----PENDPSALWLTEPTSSSGVD---VN  2521
              DLM+KV  LFNFNN + G    + SW         ENDP ALW++EPT++ GV+   V 
Sbjct  226   SDLMDKVNSLFNFNNGNGGE---ACSWGLDLNPDQGENDP-ALWISEPTTT-GVESGQVT  280

Query  2520  TSVQENSIPSSSVKEI-----VFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
              ++  ++  S+S  +      + +NE+SI     N   + Q      ++LNFS  G +  
Sbjct  281   PAIHNSNSNSNSKSDSHQISKLEKNESSIE----NPRQNPQNPSLVEQDLNFSSSGLN--  334

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                                   +  NF +  ++   +  +  F+  +ES  ++   +  +
Sbjct  335   ----------------------QNGNFPDGSSRMMKSSETLSFMA-EESNKRRSPVSKGS  371

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
             +N+EGMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRK
Sbjct  372   NNDEGMLSF-STVVRSAAKSGDSD---HSDLEASVVKEA------IVVEPEKKPRKRGRK  421

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVS+MDKASLLGDAI+YINELKSKL+
Sbjct  422   PANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSEMDKASLLGDAISYINELKSKLQ  481

Query  1815  TSESYIDDLKIQAQSLKKELSTKE--PRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
              +ES  ++++ Q   + KE + K    R  +       +   I +M++DVK++GWD MIR
Sbjct  482   QAESDKEEIQKQLDGMSKEGNGKSGGSRVKERKCSNQDSASSI-EMEIDVKIIGWDVMIR  540

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             +QC+KKNHP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL+LAL+S
Sbjct  541   VQCSKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKLALMS  600

Query  1461  KLAE  1450
             K+ E
Sbjct  601   KVGE  604



>ref|XP_010449546.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=622

 Score =   492 bits (1266),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 314/616 (51%), Positives = 393/616 (64%), Gaps = 92/616 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP-----------------SLLGWGD  3067
             N++TLQQRLQ LI+GA E+WTYA+FWQ S  +FAG                  +LLGWGD
Sbjct  63    NEDTLQQRLQALIEGANESWTYAVFWQLSY-EFAGEDVEEGRVGGGLTNNNNMALLGWGD  121

Query  3066  GYYKGEEDKG--KRNRPASSPAEQAHRKKVLRELNSLISGPAstdesvd----------e  2923
             GYYKGEE+K   K+  PAS+ AEQ HRK+V+RELN+LI+G      +            E
Sbjct  122   GYYKGEEEKSRKKKTNPASA-AEQEHRKRVVRELNALITGVGGEVVNSGGGGGSDEAGDE  180

Query  2922  evtdtEWFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRT  2743
             EVTDTEWFFLVSMT SFING+GLPGQAF SS+ IW+SG + L  S CERARQ Q +GL+T
Sbjct  181   EVTDTEWFFLVSMTQSFINGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIYGLQT  240

Query  2742  MVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWA-----APPEN  2578
             MVC+P  NGVVELGS+++I QS DL++KV   FNFNN   G    S SWA        EN
Sbjct  241   MVCVPCENGVVELGSSEVIHQSSDLVDKVDTFFNFNNGGGGGCE-SGSWAFNLNPDQGEN  299

Query  2577  DPSALWLTEPTSSSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYF  2398
             DP  LW++EP    GV++        +P   +             +TGNN   +  SQ  
Sbjct  300   DP-GLWISEP----GVELGL------VPPVII-------------NTGNNSTSNSDSQPV  335

Query  2397  TRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGG  2218
             ++  N                   G+S  + KP+  E+++F   V     +G S +F+G 
Sbjct  336   SKLCN------------------GGSSVENPKPQV-EMVSFKNGVENGFSSGQS-RFMGE  375

Query  2217  DEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVET  2038
             D   S  K  +  ++NEEGMLSF S  V           S+HS LEASVVKEA+S    T
Sbjct  376   D---SSNKKRSPVSNNEEGMLSFTS--VSVLPRPAKSGDSNHSVLEASVVKEAESN--RT  428

Query  2037  LAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1858
             +   EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLG
Sbjct  429   VVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLG  488

Query  1857  DAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDV  1678
             DAI+YINELKSKL  +ES  ++L+ Q   + KE +  +    + N +    P    DM+V
Sbjct  489   DAISYINELKSKLLKAESDKEELQKQIDGMSKEAANGKSLVKERNQE----PGVSVDMEV  544

Query  1677  DVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRL  1498
             DVK++GWDAMIR+QC+K+NHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG   
Sbjct  545   DVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNEF  604

Query  1497  YNQDQLRLALISKLAE  1450
             + QDQL++AL+ K+ E
Sbjct  605   FTQDQLKVALMEKVGE  620



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score =   493 bits (1270),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 404/604 (67%), Gaps = 68/604 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYY+GEEDK K+
Sbjct  106   NEDTLQQRLQALIESAEENWTYAIFWQISH-DFDSPTGDNTLILGWGDGYYRGEEDKDKK  164

Query  3030  NRPAS-SPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSG  2857
              + +S +PAEQ HRK+V+RELNSLISG    +DE+ DEEVTDTEWFFLVSMT SF NG G
Sbjct  165   KKSSSSNPAEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFANGVG  224

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             LPG++  +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS
Sbjct  225   LPGESLLNSRVIWLSGSGALTGSGCERAHQGQIYGLQTMVCIAAENGVVELGSSEVISQS  284

Query  2676  FDLMNKVRVLFNFNNPDMGSISGSASWAA-----PPENDPSALWLTEPTSSSGVD---VN  2521
              DLM+KV  LFNFNN + G    + SW         ENDP ALW++EPT++ GV+   V 
Sbjct  285   SDLMDKVNSLFNFNNGNGGE---ACSWGLDLNPDQGENDP-ALWISEPTTT-GVESGQVT  339

Query  2520  TSVQENSIPSSSVKEI-----VFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
              ++  ++  S+S  +      + +NE+SI     N   + Q      ++LNFS  G +  
Sbjct  340   PAIHNSNSNSNSKSDSHQISKLEKNESSIE----NPRQNPQNPSLVEQDLNFSSSGLN--  393

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                                + G   NF +  ++   +  +  F+  +ES  ++   +  +
Sbjct  394   -------------------QNG---NFPDGSSRMMKSSETLSFMA-EESNKRRSPVSKGS  430

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
             +N+EGMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRK
Sbjct  431   NNDEGMLSF-STVVRSAAKSGDSD---HSDLEASVVKEA------IVVEPEKKPRKRGRK  480

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+
Sbjct  481   PANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQ  540

Query  1815  TSESYIDDLKIQAQSLKKELSTKE--PRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
              +ES  ++++ Q   + KE + K    R  +       +   I +M++DVK++GWD MIR
Sbjct  541   QAESDKEEIQKQLDGMSKEGNGKSGGSRVKERKCSNQDSASSI-EMEIDVKIIGWDVMIR  599

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             +QC+KKNHP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL+LAL+S
Sbjct  600   VQCSKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKLALMS  659

Query  1461  KLAE  1450
             K+ E
Sbjct  660   KVGE  663



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   488 bits (1257),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 313/613 (51%), Positives = 395/613 (64%), Gaps = 96/613 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP-------------------SLLGW  3073
             N++TLQQRLQ LI+GA E+W YA+FWQ S  DFAG                    +LLGW
Sbjct  63    NEDTLQQRLQALIEGANESWAYAVFWQLSY-DFAGEDVEGGGVGGVGLTNNNNNTALLGW  121

Query  3072  GDGYYKGEEDKGKRNR--PASSPAEQAHRKKVLRELNSLISGPAs-------tdesvdee  2920
             GDGYYKGEE+K ++ +  PAS+ AEQ HRK+V+RELN+LISG          +DE+ DEE
Sbjct  122   GDGYYKGEEEKSRKKKTNPASA-AEQEHRKRVVRELNALISGGGGEVVNNGGSDEAGDEE  180

Query  2919  vtdtEWFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTM  2740
             VTDTEWFFLVSMT SF+ G+GLPGQAF SS+ IW+SG + L  S CERARQ Q +GL+TM
Sbjct  181   VTDTEWFFLVSMTQSFVYGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIYGLQTM  240

Query  2739  VCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPS  2569
             VC+P  NGVVELGS+++I QS DL++KV   FNFNN   G  SGS ++   P   ENDP 
Sbjct  241   VCVPCENGVVELGSSEVIHQSSDLVDKVDTFFNFNNGGGGCESGSWAFNLNPDQGENDP-  299

Query  2568  ALWLTEPTSSSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRE  2389
              +W++EP    GV++             V  ++         +TGNN   +  SQ  ++ 
Sbjct  300   GMWISEP----GVELGL-----------VAPVII--------NTGNNSTSNSDSQQISKL  336

Query  2388  LNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEs  2209
              N       G ++  N  L+   S        GE+++F   V     +G S +F+G D  
Sbjct  337   CN-------GGSSVENPKLQVTKS--------GEMVSFKNGVENGFSSGQS-RFMGED--  378

Query  2208  kskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAA  2029
              S  K  +  ++NEEGMLSF S  V           S+HSDLEASVVKEA+S    T+  
Sbjct  379   -SSNKKRSPVSNNEEGMLSFTS--VSVLPRPAKSGDSNHSDLEASVVKEAESN--RTVVE  433

Query  2028  AEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
              EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI
Sbjct  434   PEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAI  493

Query  1848  AYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVK  1669
             +YINELKSKL  +ES  ++L+ Q   +                K+   P    +M+VDVK
Sbjct  494   SYINELKSKLLKAESDKEELQKQIDGM----------------KRNQEPGVSVEMEVDVK  537

Query  1668  VMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQ  1489
             ++GWDAMIR+QC+K+NHP A+ M ALK+LDLEV HAS+SV+NDLMIQQA VKMG   + Q
Sbjct  538   IIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNEFFTQ  597

Query  1488  DQLRLALISKLAE  1450
             DQL++AL+ K+ E
Sbjct  598   DQLKVALMEKVGE  610



>gb|KFK45000.1| hypothetical protein AALP_AA1G331100 [Arabis alpina]
Length=610

 Score =   488 bits (1256),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 296/595 (50%), Positives = 385/595 (65%), Gaps = 52/595 (9%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             +QETLQQRLQ LI+G  E WTYAIFWQ S  D++G S+LGW DGYYKGEEDK  R     
Sbjct  54    SQETLQQRLQALIEGTHEGWTYAIFWQPSY-DYSGASVLGWADGYYKGEEDKSNRRSSSP  112

Query  3024  PA-SSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             PA ++P +QA+RKKVLRELNSLISG  A  D++V+EEVTDTEWFFLVSMT SF  G GL 
Sbjct  113   PAFTTPVDQAYRKKVLRELNSLISGSLAPADDAVEEEVTDTEWFFLVSMTQSFGPGFGLA  172

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G+AF S++P+W +G D+L  S CERA+Q   FG++T+ C+P+ NGVVELGST+ I QS D
Sbjct  173   GKAFSSANPVWCTGFDQLSGSGCERAKQGGVFGMKTIACVPTVNGVVELGSTEQIRQSSD  232

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAA---------PPENDPSALWLTEPTSSSGVDVNT  2518
             L+NKVR+LFNF+  D  + +G    +            ENDP  LW+ EP   S    ++
Sbjct  233   LLNKVRILFNFDGGDDDATAGGGDLSGLNWNLDEPDQGENDP-GLWINEPVGVSEPGHSS  291

Query  2517  SVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnn  2338
              +   S+P  +        EN  PS   +   + + +  F RELNFS             
Sbjct  292   QLFSKSVPFENGGSSSTITENPNPSPVHSQTQNPKFNNGFGRELNFSN------------  339

Query  2337  dlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGM  2158
                  +S+   KP +GEIL+FG+   + +GN +   + G  +  + K+  T   ++++ +
Sbjct  340   -----SSTTLVKPRSGEILSFGDD-KRSSGNPDPSSYSGQTQFDNNKRKKTTGLTDDK-V  392

Query  2157  LSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGRE  1978
             LSFG            G  SDHSDLEASVVKE   +  +                ANGR+
Sbjct  393   LSFGG-------KDKTGVESDHSDLEASVVKEIPEKKPKKRGRKP----------ANGRD  435

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+  +ES  
Sbjct  436   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKVTKTESEK  495

Query  1797  DDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
               ++ Q + +K EL+ ++      +   TTT  K   M+++VK++GWDAMIR++ +K+NH
Sbjct  496   TQIRNQLEEVKSELAERKASANGGDLTATTTAIKAVGMEIEVKIIGWDAMIRVESSKRNH  555

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             PAARLM AL +L+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK+ 
Sbjct  556   PAARLMSALMELELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  610



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score =   491 bits (1263),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 313/670 (47%), Positives = 389/670 (58%), Gaps = 115/670 (17%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP--  3022
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG ++  ++ +P  
Sbjct  53    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKGCDEDKRKQKPLT  112

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstd-esvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              S+ AEQ HRK+VLRELNSLISG A+   E+V+EEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  113   PSAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLPGQ  172

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +  P WI+    L S+PCERARQA  FGLRTMVC P   GV+ELGSTD++ ++ + M
Sbjct  173   ALFAGQPTWIA--SGLSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFKTAESM  230

Query  2664  NKVRVLFNFN---------NPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSV  2512
              K+R LF             P   S    A+ A   E DPS LWL +   +  +D+  S+
Sbjct  231   AKIRSLFGGGAGGGSWPPVQPQAPSSQQPAAGADHAETDPSMLWLAD---APVMDIKDSL  287

Query  2511  QENSI------PSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY-----------------  2401
                S       P     +I F N      ST     +  PS +                 
Sbjct  288   SHPSAEISVSKPPPHPPQIHFEN-----GSTSTLTENPSPSVHAPPPPPAPAAPQQRQHQ  342

Query  2400  ---------FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN  2251
                      F RELNFS+F          +      +    KPE+GEIL+FG +S  +RN
Sbjct  343   HQNQAHQGPFRRELNFSDFA---------STPSLAATPPFFKPESGEILSFGADSNARRN  393

Query  2250  GN----------------------------------GNSCQFLGGDEskskkktatlkaS  2173
              +                                   N+ + +      S         +
Sbjct  394   PSPVPPAATASLTTAPGSLFSQHTATMTAAAANDAKNNNKRSMEATSRASNTNHHPAATA  453

Query  2172  NEEGMLSFGSGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             NE GMLSF S                 SDHSDL+ASV +   SR V     AEKRPRKRG
Sbjct  454   NE-GMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASVREVESSRVVAPPPEAEKRPRKRG  512

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ K
Sbjct  513   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGK  572

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHP------DPNPKKTTTPHKIPDMDVDVKVMG  1660
             L + E+  + L+ Q ++LKKE   + P H       D  P+     H +   ++D K++G
Sbjct  573   LTSLETDKETLQTQVEALKKERDARPPSHSAGLGGHDGGPRC----HAV---EIDAKILG  625

Query  1659  WDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQL  1480
              +AMIR+QC K+NHP+ARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y QDQL
Sbjct  626   LEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYTQDQL  685

Query  1479  RLALISKLAE  1450
               AL S+LAE
Sbjct  686   SAALYSRLAE  695



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score =   490 bits (1262),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 313/670 (47%), Positives = 389/670 (58%), Gaps = 115/670 (17%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP--  3022
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG ++  ++ +P  
Sbjct  56    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKGCDEDKRKQKPLT  115

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstd-esvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              S+ AEQ HRK+VLRELNSLISG A+   E+V+EEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  116   PSAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLPGQ  175

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +  P WI+    L S+PCERARQA  FGLRTMVC P   GV+ELGSTD++ ++ + M
Sbjct  176   ALFAGQPTWIA--SGLSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFKTAESM  233

Query  2664  NKVRVLFNFN---------NPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSV  2512
              K+R LF             P   S    A+ A   E DPS LWL +   +  +D+  S+
Sbjct  234   AKIRSLFGGGAGGGSWPPVQPQAPSSQQPAAGADHAETDPSMLWLAD---APVMDIKDSL  290

Query  2511  QENSI------PSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY-----------------  2401
                S       P     +I F N      ST     +  PS +                 
Sbjct  291   SHPSAEISVSKPPPHPPQIHFEN-----GSTSTLTENPSPSVHAPPPPPAPAAPQQRQHQ  345

Query  2400  ---------FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN  2251
                      F RELNFS+F          +      +    KPE+GEIL+FG +S  +RN
Sbjct  346   HQNQAHQGPFRRELNFSDFA---------STPSLAATPPFFKPESGEILSFGADSNARRN  396

Query  2250  GN----------------------------------GNSCQFLGGDEskskkktatlkaS  2173
              +                                   N+ + +      S         +
Sbjct  397   PSPVPPAATASLTTAPGSLFSQHTATMTAAAANDAKNNNKRSMEATSRASNTNHHPAATA  456

Query  2172  NEEGMLSFGSGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRG  2002
             NE GMLSF S                 SDHSDL+ASV +   SR V     AEKRPRKRG
Sbjct  457   NE-GMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASVREVESSRVVAPPPEAEKRPRKRG  515

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ K
Sbjct  516   RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGK  575

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHP------DPNPKKTTTPHKIPDMDVDVKVMG  1660
             L + E+  + L+ Q ++LKKE   + P H       D  P+     H +   ++D K++G
Sbjct  576   LTSLETDKETLQTQVEALKKERDARPPSHSAGLGGHDGGPRC----HAV---EIDAKILG  628

Query  1659  WDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQL  1480
              +AMIR+QC K+NHP+ARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y QDQL
Sbjct  629   LEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYTQDQL  688

Query  1479  RLALISKLAE  1450
               AL S+LAE
Sbjct  689   SAALYSRLAE  698



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score =   486 bits (1252),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 319/679 (47%), Positives = 390/679 (57%), Gaps = 125/679 (18%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S    AG SLLGWGDGYYKG +D  KR R   
Sbjct  48    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTDAGAGASLLGWGDGYYKGCDDADKRARQQP  107

Query  3015  SPA---EQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             +PA   EQ HRK+VLRELNSLI+G   A+ DE+V+EEVTDTEWFFLVSMT SF NG GLP
Sbjct  108   TPASAAEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGLP  167

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQA  +  P WI+    L S+PCERARQA TFGLRTMVCIP   GV+ELG+T++I Q+ D
Sbjct  168   GQALYTRQPTWIAS--GLASAPCERARQAYTFGLRTMVCIPVGTGVLELGATEVIFQTAD  225

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPP------------ENDPSALWLTEP-----TS  2542
              + ++R LFN N    G  +GS SW  PP            E DPS LWLT+        
Sbjct  226   SLGRIRSLFNLNGGGGGGGAGS-SW--PPVAPHQQHGGDQAETDPSVLWLTDAPVGDMKE  282

Query  2541  SSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY-------------  2401
             S  V+++ S      P   +      + +++  + G + H  Q                 
Sbjct  283   SPSVEISVS---KPPPPPQIHHFENGSTSTLTENAGPSLHAHQQPATLAPAAPPRQNQHP  339

Query  2400  --------------------FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEIL  2281
                                 F RELNFS+F  + +                 KPE+GEIL
Sbjct  340   HQLQLQHQQSQQQQQQQQGPFRRELNFSDFATNASVTVTPPF---------FKPESGEIL  390

Query  2280  NFG-ESVTKRN---------------------------------GNGNSCQFLGGDEsks  2203
             NFG +S ++RN                                    N  + +      S
Sbjct  391   NFGADSTSRRNPSPAPPAAAASLTTAPGSLFSQHTATVTAPTNEAKNNPKRSMEATSRAS  450

Query  2202  kkktatlkaSNEEGMLSFGSGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLA  2032
                      +NE GMLSF S                 SDHSDLEASV +   SR V    
Sbjct  451   NTNHHPSATANE-GMLSFSSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVP--P  507

Query  2031  AAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1852
               EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  508   PEEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  567

Query  1851  IAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHP-----DPNPKKTTTPHKIPD  1687
             I+YINEL+ K+   ES  D L  Q ++LKKE   + P  P     D  P+     H +  
Sbjct  568   ISYINELRGKMTALESDKDTLHSQIEALKKERDAR-PVAPLSGVHDSGPRC----HAV--  620

Query  1686  MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMG  1507
              +++ K++G +AMIR+QC K+NHPAA+LM AL++LDL+V HASVSV+ D+MIQQ AVKM 
Sbjct  621   -EIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLDVYHASVSVVKDIMIQQVAVKMP  679

Query  1506  TRLYNQDQLRLALISKLAE  1450
              R+Y+QDQL  AL S+LAE
Sbjct  680   NRVYSQDQLNAALYSRLAE  698



>ref|XP_010941241.1| PREDICTED: transcription factor MYC2-like [Elaeis guineensis]
Length=665

 Score =   484 bits (1246),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 313/636 (49%), Positives = 399/636 (63%), Gaps = 89/636 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGKRNRPA  3019
             +QE LQ RLQTLI+GARE WTYAIFWQ+S     G ++LGWGDGYYKG EEDK KR    
Sbjct  60    SQENLQHRLQTLIEGARENWTYAIFWQSS-----GDAVLGWGDGYYKGCEEDKRKRRASG  114

Query  3018  SSP---AEQAHRKKVLRELNSLISGPAstde---svdeevtdtEWFFLVSMTHSFINGSG  2857
              S    AEQ HRK+VLRELNSLISG A        V++EVTDTEWFFLVSMT SF+ G+G
Sbjct  115   GSAVPAAEQEHRKRVLRELNSLISGGAGGAVPDDMVEDEVTDTEWFFLVSMTQSFVAGAG  174

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             LPGQA  S +P W++G +++++SPCERAR A  FGL+TM C+P  +GVVELGSTD I QS
Sbjct  175   LPGQALLSGAPTWVAGGERMVNSPCERARHAHVFGLQTMACVPVVSGVVELGSTDRIFQS  234

Query  2676  FDLMNKVRVLFNFNNPDMGSISGSASWA-APP-----ENDPSALWLTEPTSSSGVDVNTS  2515
              +++ KVR +F F   +  +   + SW  APP     E DPS LW++ P           
Sbjct  235   SEIVAKVRTIFRFGGREAAA---TGSWPPAPPRQSDGETDPSVLWISGPI----------  281

Query  2514  VQENSIPSSSVKEIVFRNENSIPSSTGNN-----------------HHDSQPSQYFTREL  2386
             V  ++ P  SV +  F  EN I SS   N                   + Q   + TR+ 
Sbjct  282   VPTSTAPEISVSKPSFPFENPISSSLAENPSSIPAPHRSPPPPQSSSTNPQTQSFLTRDF  341

Query  2385  NFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN---GNSCQF----  2227
             +FSEFG +              SS  CKPE+G++ N+ +S  KRN +    N   F    
Sbjct  342   SFSEFGLNA-----------YPSSPICKPESGDLSNYDDS--KRNPSTSAANGGLFFHHE  388

Query  2226  LGGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigds-------------sDHSD  2086
             +  +    K   AT + SN++G++SF S  + ++       S             SDHSD
Sbjct  389   ISAEAKNKKSAVATSRGSNDDGLISFSSAALAAAASARPSSSGGGGGATGLLTGDSDHSD  448

Query  2085  LEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  1906
             LEASV +   SR VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR
Sbjct  449   LEASVREVESSRVVEP----EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  504

Query  1905  AVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTK--EPRHP  1732
             AVVPNVSKMDKASLL DA++YINEL+SKL++ E   + L+ Q  +LK+E  +    PR P
Sbjct  505   AVVPNVSKMDKASLLADAVSYINELRSKLQSLELDKERLQGQVDTLKEERDSTLARPRPP  564

Query  1731  -DPNPKKTTT-PHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHAS  1558
              D +PK       +   ++V+VK++G +AMIR+QC KK HPAARLM+A K+LDLEV +AS
Sbjct  565   LDRDPKAMMNGSGRCHGVEVEVKILGLEAMIRVQCNKKFHPAARLMMAFKELDLEVNYAS  624

Query  1557  VSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             VSV+ DLM+QQA VKM +R Y Q++L  AL++++AE
Sbjct  625   VSVVKDLMMQQATVKMLSRSYTQEKLAAALLARVAE  660



>ref|XP_008799392.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=665

 Score =   482 bits (1240),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 311/644 (48%), Positives = 398/644 (62%), Gaps = 106/644 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGKRNRPA  3019
             +QE+LQ RLQTLI+G RE WTYAIFWQ+S    +  ++LGWGDGYYKG EEDK KR R  
Sbjct  61    SQESLQHRLQTLIEGPRENWTYAIFWQSSGDAASSATVLGWGDGYYKGCEEDKRKRRRGG  120

Query  3018  SSPAEQAHRKKVLRELNSLISGP---AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
              + A+Q HRK+VLRELNSLISG    A+ D++V+EEVTDTEWFFLVSMT SF+ G+ LPG
Sbjct  121   PA-ADQEHRKRVLRELNSLISGGSGVAAPDDTVEEEVTDTEWFFLVSMTESFVGGTRLPG  179

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  + +P W++G++++ +SPCERARQAQ FGL+TM C P  +GVVELGST+ ILQS ++
Sbjct  180   QALLTGAPAWLAGREQMAASPCERARQAQAFGLQTMACFPVGSGVVELGSTERILQSSEI  239

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPP------ENDPSALWLTEPTSSSGVDVNTSVQE  2506
             + KVR LF F   +  +   + SW  PP      E DPS LW+  P           V  
Sbjct  240   LTKVRALFRFGGREAAA---TGSWPPPPPCQSEGETDPSVLWVPGPI----------VHA  286

Query  2505  NSIPSSSVKEIVFRNENSIPSSTGNNHHDS--------------------QPSQYFTREL  2386
             ++ P SSV +  F  EN  P S G N + S                    Q   + TR+ 
Sbjct  287   SAAPGSSVSKPSFPFEN--PISIGLNENPSSIPAPHRSPPPPPQSSSTNPQTQSFLTRDF  344

Query  2385  NFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN---GNSCQF----  2227
             +FSEFG +              S   CKPE+G+  N+G+S  KRN +    N   F    
Sbjct  345   SFSEFGLNA-----------YPSPPICKPESGDFSNYGDS--KRNPSTPAANGGLFFHHE  391

Query  2226  LGGDEskskkktatlkaSNEEGML------------------SFGSGMVKssggigigds  2101
             +  +    K   AT + SNEEG+L                  S G+G+            
Sbjct  392   ISAEGKNKKSAVATSRGSNEEGILSFSSAAIATAASARPSPSSGGAGLF--------TGD  443

Query  2100  sDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQR  1921
             SDHSDLEASV +   SR  E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQR
Sbjct  444   SDHSDLEASVREVESSRVAEP----EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQR  499

Query  1920  FYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEP  1741
             FYALRAVVPNVSKMDKASLL DA++YI+EL+SKL++ E   + L+ Q  +LK+E  +   
Sbjct  500   FYALRAVVPNVSKMDKASLLADAVSYISELRSKLQSLELDKERLQCQVDALKEERDSASA  559

Query  1740  RHPDPNPKKTTTPHKIPD-------MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDL  1582
             R   P P     P  + +       ++V+ K++G +AMIR+Q  K+ HPAARLM+AL++L
Sbjct  560   R---PRPLLDLDPKAMMNGCGRCHGVEVEAKILGSEAMIRVQSDKRFHPAARLMMALREL  616

Query  1581  DLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             DLEV +ASVSV+ DLMIQQA VKM +R Y Q+QL  AL++++AE
Sbjct  617   DLEVNYASVSVVKDLMIQQATVKMLSRSYTQEQLAAALLARVAE  660



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score =   483 bits (1242),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 319/672 (47%), Positives = 388/672 (58%), Gaps = 116/672 (17%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  +R+RP  
Sbjct  51    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRRHRPPL  110

Query  3015  SP---AEQAHRKKVLRELNSLISGPAstd------esvdeevtdtEWFFLVSMTHSFING  2863
             +P   AEQ HRK+VLRELNSLISG AS        E+V+EEVTDTEWFFLVSMT SF+NG
Sbjct  111   TPAAQAEQEHRKRVLRELNSLISGGASAAPAPAPDEAVEEEVTDTEWFFLVSMTQSFLNG  170

Query  2862  SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLIL  2683
             SGLPGQA  +    WI+    L S+PC+RARQA  FGLRTMVC P   GV+ELGSTD++ 
Sbjct  171   SGLPGQALFAGHHTWIAA--GLSSAPCDRARQAYNFGLRTMVCFPVGTGVLELGSTDVVF  228

Query  2682  QSFDLMNKVRVLFNFNNPDMGSISGSASWAA-----------------PPENDPSALWLT  2554
             Q+ + M K+R LF           G  SW                     E DPS LWL 
Sbjct  229   QTAETMAKIRSLFG-------GGPGGGSWPPVQPQAAPQQQHAAEADQAAETDPSVLWLA  281

Query  2553  EPTSSSGVDVNTSVQENSIPSSSVK---------EIVFRN-------ENSIPS------S  2440
             +   +  VD+  S    S    SV          +I F N       EN  PS       
Sbjct  282   D---APVVDIKDSYSHPSAAEISVSKPPPPPPPPQIHFENGSTSTLTENPSPSVHAPPAP  338

Query  2439  TGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESV  2263
                     Q    F RELNFS+F  + +                 KPE+GEIL+FG +S 
Sbjct  339   PAPPQRQQQNQGPFRRELNFSDFASNPSLAAAPPF---------FKPESGEILSFGVDSN  389

Query  2262  TKRNGN---------------------------------GNSCQFLGGDEskskkktatl  2182
              +RN +                                  N+ + +      S       
Sbjct  390   AQRNPSPAPPASLTTAPGSLFSQSQHTATAAANDAKNNNNNNKRSMEATSLASNTNHHPA  449

Query  2181  kaSNEEGMLSFGSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPR  2011
              A+NE GMLSF S                 SDHSDL+ASV +   SR V     AEKRPR
Sbjct  450   AAANE-GMLSFSSAPTARPSAGTGAPAKSESDHSDLDASVREVESSRVVAPPPEAEKRPR  508

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL
Sbjct  509   KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL  568

Query  1830  KSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH-----KIPDMDVDVKV  1666
             + KL + ES  + L+ Q ++LKKE   +    P P+P      H     +   +++D K+
Sbjct  569   RGKLTSLESDRETLQAQVEALKKERDAR----PHPHPAAGLGGHDAGGPRCHAVEIDAKI  624

Query  1665  MGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQD  1486
             +G +AMIR+QC K+NHP+ARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QD
Sbjct  625   LGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRMYSQD  684

Query  1485  QLRLALISKLAE  1450
             QL  AL S+LAE
Sbjct  685   QLSAALYSRLAE  696



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   480 bits (1236),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 319/662 (48%), Positives = 391/662 (59%), Gaps = 107/662 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S    AG SLLGWGDGYYKG +D  KR +   
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTD--AGASLLGWGDGYYKGCDDADKRRQQPT  99

Query  3024  PASSPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             PAS+ AEQ HRK+VLRELNSLI+G   A+ DE+V+EEVTDTEWFFLVSMT SF NG GLP
Sbjct  100   PASA-AEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGLP  158

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQA  +  PIWI+    L S+PCERARQA TFGLRTMVCIP   GV+ELG+T++I Q+ D
Sbjct  159   GQALFAGQPIWIA--TGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTTD  216

Query  2670  LMNKVRVLFNFNNPDMGSISGSASW--AAPP----ENDPSALWLTEPTSSSGVDVNTSVQ  2509
              + ++R LF+ N        GS SW   APP    E DPS LWL +  +    +   SV+
Sbjct  217   SLGRIRSLFSLNG----GGGGSGSWPPVAPPPQEAETDPSVLWLADAPAGDMKESPPSVE  272

Query  2508  EN-SIPSSSVKEIVFRNENSIPSSTGNNH----HDSQP----------------------  2410
              + S P  S    +   EN   S+   N     H  QP                      
Sbjct  273   ISVSKPPPSQPPQIHHFENGSTSTLTENPSLSVHAQQPLPRQQAAAAAQRQNQLQLQHQH  332

Query  2409  -SQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN-----  2251
                 F RELNFS+F  + +            +    KPE+GEILNFG +S ++RN     
Sbjct  333   NQGPFRRELNFSDFASNPSVTV---------TPPFFKPESGEILNFGADSTSRRNPSPAP  383

Query  2250  ----------------------------GNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
                                            N  + +      S         +NE GML
Sbjct  384   PAATASLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANE-GML  442

Query  2154  SFGSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             SF S                 SDHSDLEASV +   SR V      EKRPRKRGRKPANG
Sbjct  443   SFSSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVP--PPEEKRPRKRGRKPANG  500

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFY LRAVVPNVSKMDKASLLGDAI+YINEL+ K+   ES
Sbjct  501   REEPLNHVEAERQRREKLNQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALES  560

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH----KIPDMDVDVKVMGWDAMIRIQ  1636
               + L  Q ++LKKE      R   P    ++  H    +   ++++ K++G +AMIR+Q
Sbjct  561   DKETLHSQIEALKKE------RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQ  614

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             C K+NHPAA+LM AL++LDL+V HASVSV+ D+MIQQ AVKM TR+Y+Q+QL  AL  +L
Sbjct  615   CHKRNHPAAKLMTALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRL  674

Query  1455  AE  1450
             AE
Sbjct  675   AE  676



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   478 bits (1230),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 319/662 (48%), Positives = 391/662 (59%), Gaps = 107/662 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S    AG SLLGWGDGYYKG +D  KR +   
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTD--AGASLLGWGDGYYKGCDDADKRRQQPT  99

Query  3024  PASSPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             PAS+ AEQ HRK+VLRELNSLI+G   A+ DE+V+EEVTDTEWFFLVSMT SF NG GLP
Sbjct  100   PASA-AEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGLP  158

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQA  +  PIWI+    L S+PCERARQA TFGLRTMVCIP   GV+ELG+T++I Q+ D
Sbjct  159   GQALFAGKPIWIA--TGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTTD  216

Query  2670  LMNKVRVLFNFNNPDMGSISGSASW--AAPP----ENDPSALWLTEPTSSSGVDVNTSVQ  2509
              + ++R LF+ N        GS SW   APP    E DPS LWL +  +    +   SV+
Sbjct  217   SLGRIRSLFSLNG----GGGGSGSWPPVAPPPQEAETDPSVLWLADAPAGDMKESPPSVE  272

Query  2508  EN-SIPSSSVKEIVFRNENSIPSSTGNN-----HHDSQPSQY------------------  2401
              + S P  S    +   EN   S+   N     H      Q                   
Sbjct  273   ISVSKPPPSQPPQIHHFENGSTSTLTENPSLSVHAQQPLPQQQAAAAAQRQNQLQLQHQH  332

Query  2400  ----FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN-----  2251
                 F RELNFS+F  + +            +    KPE+GEILNFG +S ++RN     
Sbjct  333   NQGPFRRELNFSDFASNPSVTV---------TPPFFKPESGEILNFGADSTSRRNPSPAP  383

Query  2250  ----------------------------GNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
                                            N  + +      S         +NE GML
Sbjct  384   PAATASLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANE-GML  442

Query  2154  SFGSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             SF S                 SDHSDLEASV +   SR V      EKRPRKRGRKPANG
Sbjct  443   SFSSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVP--PPEEKRPRKRGRKPANG  500

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ K+   ES
Sbjct  501   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALES  560

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH----KIPDMDVDVKVMGWDAMIRIQ  1636
               + L  Q ++LKKE      R   P    ++  H    +   ++++ K++G +AMIR+Q
Sbjct  561   DKETLHSQIEALKKE------RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQ  614

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             C K+NHPAA+LM AL++LDL+V HASVSV+ D+MIQQ AVKM TR+Y+Q+QL  AL  +L
Sbjct  615   CHKRNHPAAKLMTALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRL  674

Query  1455  AE  1450
             AE
Sbjct  675   AE  676



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   478 bits (1230),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 319/662 (48%), Positives = 391/662 (59%), Gaps = 107/662 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ +I+G+RETWTYAIFWQ+S    AG SLLGWGDGYYKG +D  KR +   
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTD--AGASLLGWGDGYYKGCDDADKRRQQPT  99

Query  3024  PASSPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
             PAS+ AEQ HRK+VLRELNSLI+G   A+ DE+V+EEVTDTEWFFLVSMT SF NG GLP
Sbjct  100   PASA-AEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGLP  158

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             GQA  +  PIWI+    L S+PCERARQA TFGLRTMVCIP   GV+ELG+T++I Q+ D
Sbjct  159   GQALFAGQPIWIA--TGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTTD  216

Query  2670  LMNKVRVLFNFNNPDMGSISGSASW--AAPP----ENDPSALWLTEPTSSSGVDVNTSVQ  2509
              + ++R LF+ N        GS SW   APP    E DPS LWL +  +    +   SV+
Sbjct  217   SLGRIRSLFSLNG----GGGGSGSWPPVAPPPQEAETDPSVLWLADAPAGDMKESPPSVE  272

Query  2508  EN-SIPSSSVKEIVFRNENSIPSSTGNN-----HHDSQPSQY------------------  2401
              + S P  S    +   EN   S+   N     H      Q                   
Sbjct  273   ISVSKPPPSQPPQIHHFENGSTSTLTENPSLSVHAQQPLPQQQAAAAAQRQNQLQLQHQH  332

Query  2400  ----FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN-----  2251
                 F RELNFS+F  + +            +    KPE+GEILNFG +S ++RN     
Sbjct  333   NQGPFRRELNFSDFASNPSVTV---------TPPFFKPESGEILNFGADSTSRRNPSPAP  383

Query  2250  ----------------------------GNGNSCQFLGGDEskskkktatlkaSNEEGML  2155
                                            N  + +      S         +NE GML
Sbjct  384   PAATASLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANE-GML  442

Query  2154  SFGSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             SF S                 SDHSDLEASV +   SR V      EKRPRKRGRKPANG
Sbjct  443   SFSSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVP--PPEEKRPRKRGRKPANG  500

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ K+   ES
Sbjct  501   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALES  560

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH----KIPDMDVDVKVMGWDAMIRIQ  1636
               + L  Q ++LKKE      R   P    ++  H    +   ++++ K++G +AMIR+Q
Sbjct  561   DKETLHSQIEALKKE------RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQ  614

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             C K+NHPAA+LM AL++LDL+V HASVSV+ D+MIQQ AVKM TR+Y+Q+QL  AL  +L
Sbjct  615   CHKRNHPAAKLMTALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRL  674

Query  1455  AE  1450
             AE
Sbjct  675   AE  676



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   474 bits (1220),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 307/612 (50%), Positives = 388/612 (63%), Gaps = 92/612 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  56    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  114

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF NG GL
Sbjct  115   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFPNGVGL  173

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S C+RA Q Q +GL+TMVCI + NGVVELGS++ I QS 
Sbjct  174   PGESFLNSRVIWLSGSGALTGSGCKRAGQGQIYGLKTMVCIAAQNGVVELGSSEAISQSS  233

Query  2673  DLMNKVRVLFN---------------FN-NPDMGSISGSASWAAPPENDPSALWLTEPTS  2542
             DLM+KV  LFN               FN NPD G            ENDP ALW++EP +
Sbjct  234   DLMDKVNSLFNSNNGGNNGGEACSWGFNLNPDQG------------ENDP-ALWISEPAT  280

Query  2541  SSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFD  2362
             ++G++    V  ++  S S    + + E +  SS  N  H+ Q S    RELNFS  G +
Sbjct  281   NTGIESPARVNHSNSNSKSDSHRISKLEKNDISSVEN--HNRQSSCLGERELNFSSSGLN  338

Query  2361  GAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN-------GNSCQFLGGDEsks  2203
                                                +NGN         +  F G +ES  
Sbjct  339   -----------------------------------QNGNFQGGLKSNETFSFCGNNESNK  363

Query  2202  kkkt-atlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAA  2026
             KK++  +   +N++GMLSF S +V+S+   G  D   HSDLEASVVKEA       +   
Sbjct  364   KKRSPVSKGGNNDQGMLSF-STVVRSAAKSGDSD---HSDLEASVVKEAI-----VVEPP  414

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+
Sbjct  415   EKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAIS  474

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKV  1666
             YINELKSKL+ +E   ++++ +   + KE             +K +      +M++DVK+
Sbjct  475   YINELKSKLQQAEVDKEEIQKRLDGVNKE-GKGGGGGSRARERKCSNQDTSIEMEIDVKI  533

Query  1665  MGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQD  1486
             +GWD MIR+QC+KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N D
Sbjct  534   IGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHD  593

Query  1485  QLRLALISKLAE  1450
             QL++AL++K+ E
Sbjct  594   QLKVALMTKVGE  605



>ref|XP_009413229.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=707

 Score =   478 bits (1229),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 293/647 (45%), Positives = 398/647 (62%), Gaps = 80/647 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP--  3022
             +QETLQQRLQTLI+GARE+WTY IFWQ+SV    G S LGWGDGYYKG E+  ++ RP  
Sbjct  68    SQETLQQRLQTLIEGARESWTYGIFWQSSVDAATGASYLGWGDGYYKGREEDKRKQRPTA  127

Query  3021  ASSPAEQAHRKKVLRELNSLIS--GPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             A+SP EQ +RK+VLREL+SLIS  G +  DE+V++EVTDTEWFFLVSMT SF+NG GL G
Sbjct  128   AASPEEQEYRKRVLRELHSLISCGGSSGMDEAVEDEVTDTEWFFLVSMTQSFVNGVGLAG  187

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  + +P W++G  +L ++PC+RA QAQ  G++TMVC+P  +GV+ELGSTD+I ++ ++
Sbjct  188   QALYAGAPSWVAGDSRLAAAPCQRAHQAQLLGIQTMVCVPVGSGVLELGSTDVIFENPEI  247

Query  2667  MNKVRVLFNFNNPDMGSISGSA----------SWAAPP-----ENDPSALWLTEPTSSSG  2533
             M K+RVLFNF++PD  + S +A          S    P     E DPS L LT+P++   
Sbjct  248   MGKIRVLFNFDSPDAPTSSSAAAAAPSSLALQSAVGTPAADRGETDPSVLSLTDPSAVEI  307

Query  2532  VDVNTSVQENSIPSSSVKEIVFRNE-----------NSIPSSTGNNHHDSQPS-------  2407
              D  + +   +  S +   I F N+           +S  +    NH     S       
Sbjct  308   KDSVSFLSTTADMSVTKPPIQFGNKATSSNLIENPSSSFQTQKSQNHQQQHRSGGSKPRN  367

Query  2406  -QYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN-----  2245
               +F+++LN SEF  + +              HS + E+G ILNF     KRN +     
Sbjct  368   QSFFSKDLNSSEFASNDS-----------VGPHSFERESGNILNFAGG--KRNSSPAPAA  414

Query  2244  --------GNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHS  2089
                       +        ++S   T+    +N+EGMLSF S  V+         S    
Sbjct  415   GSLFSHPAAAAATVDDKKNTRSTGATSRASNNNDEGMLSFSSTPVRPLPNGQRNSSGGGR  474

Query  2088  DLEASVVKEADS---------RAVET--LAAAEKRPRKRGRKPANGREEPLNHVEAERQR  1942
                  ++  ADS         R VE+  +   EKRPRKRGRKPANGREEPLNHVEAERQR
Sbjct  475   GGGGGILDAADSDQSDLVASVREVESSQVVEPEKRPRKRGRKPANGREEPLNHVEAERQR  534

Query  1941  REKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK  1762
             REKLNQRFYALRAVVPNVSKMDKASLL DA++YI EL+SKL+  E+  ++L+ Q ++L+K
Sbjct  535   REKLNQRFYALRAVVPNVSKMDKASLLADAVSYIEELRSKLQAVEADREELQAQVEALEK  594

Query  1761  ELSTKEPRHPDPNPKKTTTPH---KIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVAL  1591
             +  +   R P P  +     +   +   ++++VK++G +AM+R+QC ++NHPAARLM AL
Sbjct  595   QRDSGRAR-PSPTAQHEQMVNGGSRCHGVEMEVKILGMEAMVRLQCERRNHPAARLMTAL  653

Query  1590  KDLDLEVTHASVSVMNDLMIQQAAVKMG-TRLYNQDQLRLALISKLA  1453
             ++L +EV +ASVSV+ DLMIQQA VKM  +R+Y Q+QL  AL S+LA
Sbjct  654   QELGVEVHYASVSVVKDLMIQQATVKMSPSRVYTQEQLNAALYSRLA  700



>ref|XP_010935028.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=641

 Score =   475 bits (1222),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 300/624 (48%), Positives = 383/624 (61%), Gaps = 67/624 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             + E+LQ RLQTLI+GAR++WTYAIFWQ+S    +G +LLGWGDGYYKG ++  +  R A+
Sbjct  38    SHESLQHRLQTLIEGARDSWTYAIFWQSSADAASGAALLGWGDGYYKGFQEDKRTRRAAA  97

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFC  2836
             S +EQ HRK+VLRELN LIS  A+ D++V+EEVTD EWFFLVSMT SFI G GLPGQA  
Sbjct  98    SGSEQEHRKRVLRELNCLISSGAAPDDAVEEEVTDMEWFFLVSMTQSFIAGVGLPGQALL  157

Query  2835  SSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKV  2656
             S +P+WI+G D++ ++ C+RARQA  FGL+TM CIP  +GV+ELGST+ I QSF+++ KV
Sbjct  158   SGAPVWIAGGDRMAAAQCDRARQAHAFGLQTMACIPVGSGVLELGSTERIFQSFEMVAKV  217

Query  2655  RVLFNFNNPDMGSISGSASWAAPP------ENDPSALWLTE---------------PTSS  2539
             R  F+F   +  +I    SW+ PP      E DPS LW+++               P S 
Sbjct  218   RAFFSFGGRETAAI---GSWSLPPPIQTAAETDPSVLWISDPIAPAPPAPEIPVSKPPSQ  274

Query  2538  SGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDG  2359
                  ++S+ EN  PS              P S+  N H    +Q F  +++ SE G   
Sbjct  275   FENPNSSSLTEN--PSPFPIPQRSSPPPPPPQSSSTNPH----TQSFL-DVSLSESGLKA  327

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGE-----SVTKRNGNGNSCQFLGGDEskskkk  2194
                          S+ +CKPE  +  N+GE     S    NG       +  +    K  
Sbjct  328   -----------FPSAPTCKPETCDFSNYGESKRNPSTVAANGGFFFHHSISTENKNKKST  376

Query  2193  tatlkaSNEEGMLSFGSGMVKss------------ggigigdssDHSDLEASVVKEADSR  2050
              AT K SN EGMLSF S     +                +   SDHSDLEASV +   SR
Sbjct  377   GATSKGSNNEGMLSFSSAATAVAAADWSRPASGGCTTGLLAGDSDHSDLEASVREVESSR  436

Query  2049  AVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA  1870
               E     EKRPRKRGRKPANGREEPL+HVEAERQRREKLNQRFYALRA VPNVSKMDKA
Sbjct  437   VAE----PEKRPRKRGRKPANGREEPLDHVEAERQRREKLNQRFYALRAEVPNVSKMDKA  492

Query  1869  SLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKE--LSTKEPRHPDPNPKKTTT--P  1702
             SLL DAI+YI EL+SKL++ E   + L  Q   LKKE  L+   P  P  N  K      
Sbjct  493   SLLADAISYIRELRSKLQSLELDREGLHSQIDVLKKERDLTLARPSPPLDNDLKAVVNGG  552

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
              +   ++V+VK++G +AMIR+ C K+ HPAARLM+ALK+LDLEV++ASVSV+NDLMIQQA
Sbjct  553   SRCHGVEVEVKILGREAMIRVHCNKRYHPAARLMMALKELDLEVSYASVSVVNDLMIQQA  612

Query  1521  AVKMGTRLYNQDQLRLALISKLAE  1450
              V M +R Y Q+QL  AL +++ E
Sbjct  613   TVNMLSRSYTQEQLTAALFARITE  636



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   471 bits (1212),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 308/608 (51%), Positives = 388/608 (64%), Gaps = 83/608 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  55    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  113

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DE+ DEEVTDTEWFFLVSMT SF NG GL
Sbjct  114   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFPNGVGL  172

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS++ I QS 
Sbjct  173   PGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIAAQNGVVELGSSEAISQSS  232

Query  2673  DLMNKVRVLFN---------------FN-NPDMGSISGSASWAAPPENDPSALWLTEPTS  2542
             DLM+KV  LFN               FN NPD G            ENDP ALW++EP +
Sbjct  233   DLMDKVNSLFNSNNGGNNGGEACSWGFNLNPDQG------------ENDP-ALWISEPAT  279

Query  2541  SSGVD----VNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSE  2374
             ++G++    VN     NS   S   +I    +N I S    N       +   RELNFS 
Sbjct  280   NTGIESPARVNNGNHSNSNSKSDSHQISKLEKNDISSVENQN-------RLGERELNFSS  332

Query  2373  FGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkk  2194
              G +             N +     ++ E L+F        GN N       + +K K+ 
Sbjct  333   SGLN------------QNGNFQGGLKSNETLSFC-------GNNN-------ESNKKKRS  366

Query  2193  tatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRP  2014
               +  ++N+EGMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+P
Sbjct  367   PVSKGSNNDEGMLSF-STVVRSAAKSGDSD---HSDLEASVVKEAI-----VVEPPEKKP  417

Query  2013  RKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINE  1834
             RKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINE
Sbjct  418   RKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINE  477

Query  1833  LKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWD  1654
             LKSKL+ +E   ++++ +   + KE             +K +      +M++DVK++GWD
Sbjct  478   LKSKLQQAEIDKEEIQKRLDGVNKEGKGGGGGGSRARERKCSNQDTSIEMEIDVKIIGWD  537

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
              MIR+QC+KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL++
Sbjct  538   VMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKV  597

Query  1473  ALISKLAE  1450
             AL++K+ E
Sbjct  598   ALMTKVGE  605



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score =   469 bits (1207),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 308/598 (52%), Positives = 378/598 (63%), Gaps = 83/598 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYYKGEEDK K+
Sbjct  46    NEDTLQQRLQALIESAGEKWTYAIFWQISH-DFESPAGDNAVVLGWGDGYYKGEEDKEKK  104

Query  3030  NRPASS-PAEQAHRKKVLRELNSLISGPAs-------tdesvdeevtdtEWFFLVSMTHS  2875
              + ++S PAEQ HRK+V+RELNSLISG          +DES DEEVTDTEWFFLVSMT S
Sbjct  105   KKSSNSNPAEQEHRKRVIRELNSLISGGGGGGGGVGVSDESNDEEVTDTEWFFLVSMTQS  164

Query  2874  FINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGST  2695
             F NG GLPG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+
Sbjct  165   FANGVGLPGESFLNSRVIWLSGSGALTGSGCERANQGQIYGLQTMVCIAAENGVVELGSS  224

Query  2694  DLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP--ENDPSALWLTEPTSSSGVDVN  2521
             + I QS DLM+KV  LFN +N + G  S       P   ENDP ALW+TEP         
Sbjct  225   EAISQSSDLMDKVNSLFNSSNGNGGEASSWGFGLNPDQGENDP-ALWITEPAIE------  277

Query  2520  TSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhn  2341
                     P  S    + +NE+S+ +   N+ +     Q F    NF             
Sbjct  278   --------PVQSGSHKLEKNESSVENPRKNHQNPFLVEQDF----NF-------------  312

Query  2340  ndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEG  2161
                    SS   KP   E L+F    T   GN        G             ++NEEG
Sbjct  313   ----QAGSSKMMKP--SETLSF----TAEEGNKRRSPVSKG-------------SNNEEG  349

Query  2160  MLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGR  1981
             MLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRKPANGR
Sbjct  350   MLSF-STVVRSTAKSGESD---HSDLEASVVKEA------IVVEPEKKPRKRGRKPANGR  399

Query  1980  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESY  1801
             EEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +ES 
Sbjct  400   EEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESE  459

Query  1800  IDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--DMDVDVKVMGWDAMIRIQCTK  1627
              ++++ Q   + KE + K         ++++        +M++DVK++GWD MIR+QC+K
Sbjct  460   KEEIQKQLDGMSKEGNGKSGASRAVKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSK  519

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             KNHP +R M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQLR AL+ K+ 
Sbjct  520   KNHPGSRFMDALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLRAALMLKVG  577



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   465 bits (1196),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 307/608 (50%), Positives = 391/608 (64%), Gaps = 81/608 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  50    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGENTVILGWGDGYYKGEEDKEKK  108

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF+NG GL
Sbjct  109   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGL  167

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS 
Sbjct  168   PGESFLNSRVIWLSGPGALTGSGCERAGQGQIYGLKTMVCIAAQNGVVELGSSEVISQSS  227

Query  2673  DLMNKVRVL--------------FNFN-NPDMGSISGSASWAAPPENDPSALWLTEPTSS  2539
             DLM+KV  L              + FN NPD G            ENDP ALW++EP ++
Sbjct  228   DLMDKVNNLFNSNNGGNNGEACSWGFNLNPDQG------------ENDP-ALWISEPATN  274

Query  2538  SGVDVNTSVQENSIPSSSVK---EIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFG  2368
             +G++    V  N+  S+S     +I    +N I S    N    Q      R+LNFS  G
Sbjct  275   TGIESPARVNGNNSNSNSKSDSHQISKLEKNDISSVENLNR---QSPCLGERDLNFSSSG  331

Query  2367  FDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkkta  2188
              +             N +     ++ E L+F             C    G+E   K+   
Sbjct  332   LN------------KNGNFQGGLKSNETLSF-------------C----GNERNKKRSVV  362

Query  2187  tlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRK  2008
             +  ++N+EGMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRK
Sbjct  363   SKGSNNDEGMLSF-STVVRSTAKSGDSD---HSDLEASVVKEAI-----VVEPPEKKPRK  413

Query  2007  RGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK  1828
             RGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK
Sbjct  414   RGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELK  473

Query  1827  SKLETSESYIDDLKIQAQSLKKELSTK-EPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDA  1651
             SKL+ +E   ++++ +   + KE + K   R  +       +     +M++DVK++GWD 
Sbjct  474   SKLQQAEIDKEEIQKRLDGVNKEGNGKGGSRAKERKSSNQDSSGSSIEMEIDVKIIGWDV  533

Query  1650  MIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLA  1471
             MIR+QC+KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL++A
Sbjct  534   MIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVA  593

Query  1470  LISKLAET  1447
             L++K+ ET
Sbjct  594   LMTKVGET  601



>ref|XP_006414178.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
 gb|ESQ55631.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
Length=621

 Score =   464 bits (1195),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 305/622 (49%), Positives = 390/622 (63%), Gaps = 105/622 (17%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS------------LLGWGDGYYKGE  3049
             ++TLQQRLQ LI+GARE+WTYA+FWQ S  DFAG              LLGW DGYYKGE
Sbjct  62    EDTLQQRLQALIEGARESWTYAVFWQLSY-DFAGEDDGGGGGGSINTPLLGWSDGYYKGE  120

Query  3048  EDKGKRN---RPASSPAEQAHRKKVLRELNSLISGPAs---------tdesvdeevtdtE  2905
             E+K  R     PAS+ A+Q HRK+V++ELNSLISG            +DE+ DEEVTDTE
Sbjct  121   EEKKSRKKKPNPASA-ADQEHRKRVIQELNSLISGGGGGGTVNGGGNSDEAGDEEVTDTE  179

Query  2904  WFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPS  2725
             WFFLVSMT SFINGSGLPGQAF  S  IW+SG + L  S CERARQ Q +GL TMVCIP+
Sbjct  180   WFFLVSMTQSFINGSGLPGQAFSDSQTIWLSGSNALAGSSCERARQGQIYGLETMVCIPA  239

Query  2724  SNGVVELGSTDLILQSFDLMNKVRVL-------------FNFN-NPDMGSISGSASWAAP  2587
              NGVVELGS+++I QS DL+ KVR               + FN  PD G           
Sbjct  240   ENGVVELGSSEIIHQSSDLIGKVRSFFNFNNGGGGESGSWAFNLTPDQG-----------  288

Query  2586  PENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPS  2407
              ENDP A+W++EP        N +  E+ + + ++             +TGNN   +  S
Sbjct  289   -ENDP-AMWISEP--------NVAGIESGLVAPAM-------------NTGNNSTSNSDS  325

Query  2406  QYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQF  2227
                ++  N       G++  +     +G ++H   P++ EI++F   +   NG     +F
Sbjct  326   HPISKLCN-------GSSVENPKISSSGFNNH---PKSSEIVSFKNGI--ENGFSGQSRF  373

Query  2226  LGGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRA  2047
             +  D      K   L + NEEGMLSF S + + +          HSDL+ASVVKEA+S  
Sbjct  374   VEED----SNKKRCLVSDNEEGMLSFTSVLPRPTKSGDSN----HSDLDASVVKEAESN-  424

Query  2046  VETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKAS  1867
               T+   EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKAS
Sbjct  425   -RTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKAS  483

Query  1866  LLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKE---LSTKEPRHPDPNPKKTTTPHK  1696
             LLGDAI+YINELKSKL+  ES  ++L+ Q   +  E    S  + ++ + +   +     
Sbjct  484   LLGDAISYINELKSKLQKVESDKEELQKQIDVMSNENGKCSGGDRKYLNQDSGVSI----  539

Query  1695  IPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAV  1516
               +M++DVK++GWDAMIRIQC+K+NHP A+ M ALKDLDLEV HAS+SV+ND MIQQA V
Sbjct  540   --EMEIDVKIIGWDAMIRIQCSKRNHPGAKFMEALKDLDLEVNHASLSVVNDFMIQQATV  597

Query  1515  KMGTRLYNQDQLRLALISKLAE  1450
             KMG + + QDQL+ +L+ K+ E
Sbjct  598   KMGNQFFTQDQLKASLMEKVGE  619



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score =   462 bits (1188),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 310/616 (50%), Positives = 387/616 (63%), Gaps = 97/616 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  56    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  114

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF NG GL
Sbjct  115   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFPNGVGL  173

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S C+RA Q Q +GL+TMVCI + NGVVELGS++ I QS 
Sbjct  174   PGESFLNSRVIWLSGSGALTGSGCKRAGQGQIYGLKTMVCIAAQNGVVELGSSEAISQSS  233

Query  2673  DLMNKVRVLFN---------------FN-NPDMGSISGSASWAAPPENDPSALWLTEPTS  2542
             DLM+KV  LFN               FN NPD G            ENDP ALW++EP +
Sbjct  234   DLMDKVNSLFNSNNGGNNGGEACSWGFNLNPDQG------------ENDP-ALWISEPAT  280

Query  2541  SSGVD----VNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSE  2374
             ++GV+    VN     NS   S   +I    +N I S     +H+ Q S    RELNFS 
Sbjct  281   NTGVESPARVNNGNHSNSNSKSDSHQISKLEKNDISSVE---NHNRQSSCLGERELNFSS  337

Query  2373  FGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGN-------GNSCQFLGGD  2215
              G +                                   +NGN         +  F G +
Sbjct  338   SGLN-----------------------------------QNGNFQGGLKSNETLSFCGNN  362

Query  2214  Eskskkkt-atlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVET  2038
             ES  KK++  +  ++N+EGMLSF S +V+S+   G  D   HSDLEASVVKEA       
Sbjct  363   ESNKKKRSPVSKGSNNDEGMLSF-STVVRSAAKSGDSD---HSDLEASVVKEAI-----V  413

Query  2037  LAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1858
             +   EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLL 
Sbjct  414   VEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLA  473

Query  1857  DAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDV  1678
             DAI+YINELKSKL+ +E   ++++ +   + KE               +     I +M++
Sbjct  474   DAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGKGGGGGSRGRERNCSNQDASI-EMEI  532

Query  1677  DVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRL  1498
             DVK++GWD MIR+QC+KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ 
Sbjct  533   DVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQF  592

Query  1497  YNQDQLRLALISKLAE  1450
             +N DQL++AL++K+ E
Sbjct  593   FNHDQLKVALMTKVGE  608



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   461 bits (1186),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 303/600 (51%), Positives = 388/600 (65%), Gaps = 75/600 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  48    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  106

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF+NG GL
Sbjct  107   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGL  165

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS 
Sbjct  166   PGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSS  225

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWA-----APPENDPSALWLTEPTSSSGVD----VN  2521
             DLM+KV  LFNFNN    +   ++SW         ENDP ALW++EPT++ G++    VN
Sbjct  226   DLMHKVNNLFNFNNGGGNNGVEASSWGFNLNPDQGENDP-ALWISEPTNT-GIESPARVN  283

Query  2520  TSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhn  2341
                  NS   S   +I    +N I S    N    Q S    ++L F             
Sbjct  284   NGNNSNSNSKSDSHQISKLEKNDISSVENQNR---QSSCLVEKDLTFQ------------  328

Query  2340  ndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEG  2161
                             G +L   E+++             G+ES  K+ + +  ++N+EG
Sbjct  329   ----------------GGLLKSNETLS-----------FCGNESSKKRTSVSKGSNNDEG  361

Query  2160  MLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGR  1981
             MLSF S +V+S+          HSDLEASVVKEA       +   EK+PRKRGRKPANGR
Sbjct  362   MLSF-STVVRSAANDSD-----HSDLEASVVKEAI-----VVEPPEKKPRKRGRKPANGR  410

Query  1980  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESY  1801
             EEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +ES 
Sbjct  411   EEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESD  470

Query  1800  IDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP---DMDVDVKVMGWDAMIRIQCT  1630
              ++++ +   + KE +  +        +K++         +M++DVK++GWD MIR+QC 
Sbjct  471   KEEIQKKLDGMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCG  530

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL++AL++K+ E
Sbjct  531   KKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGE  590



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   461 bits (1185),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 303/600 (51%), Positives = 388/600 (65%), Gaps = 75/600 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  48    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  106

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF+NG GL
Sbjct  107   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGL  165

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS 
Sbjct  166   PGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSS  225

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWA-----APPENDPSALWLTEPTSSSGVD----VN  2521
             DLM+KV  LFNFNN    +   ++SW         ENDP ALW++EPT++ G++    VN
Sbjct  226   DLMHKVNNLFNFNNGGGNNGVEASSWGFNLNPDQGENDP-ALWISEPTNT-GIESPARVN  283

Query  2520  TSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhn  2341
                  NS   S   +I    +N I S    N    Q S    ++L F             
Sbjct  284   NGNNSNSNSKSDSHQISKLEKNDISSVENQNR---QSSCLVEKDLTFQ------------  328

Query  2340  ndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEG  2161
                             G +L   E+++             G+ES  K+ + +  ++N+EG
Sbjct  329   ----------------GGLLKSNETLS-----------FCGNESSKKRTSVSKGSNNDEG  361

Query  2160  MLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGR  1981
             MLSF S +V+S+          HSDLEASVVKEA       +   EK+PRKRGRKPANGR
Sbjct  362   MLSF-STVVRSAANDSD-----HSDLEASVVKEAI-----VVEPPEKKPRKRGRKPANGR  410

Query  1980  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESY  1801
             EEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +ES 
Sbjct  411   EEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESD  470

Query  1800  IDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP---DMDVDVKVMGWDAMIRIQCT  1630
              ++++ +   + KE +  +        +K++         +M++DVK++GWD MIR+QC 
Sbjct  471   KEEIQKKLDGMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCG  530

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL++AL++K+ E
Sbjct  531   KKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGE  590



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   460 bits (1183),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 310/613 (51%), Positives = 393/613 (64%), Gaps = 87/613 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  52    NEDTLQQRLQALIESAGENWTYAIFWQISH-DFDSSTGDNTVILGWGDGYYKGEEDKEKK  110

Query  3030  NRPASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
                 ++ AEQ HRK+V+RELNSLISG    +DES DEEVTDTEWFFLVSMT SF+NG GL
Sbjct  111   KNNTNT-AEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGL  169

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+++I QS 
Sbjct  170   PGESFLNSRVIWLSGSGSLTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSS  229

Query  2673  DLMNKVRVL-----------------FNFN-NPDMGSISGSASWAAPPENDPSALWLTEP  2548
             DLM+KV  L                 + FN NPD G            ENDP ALW++EP
Sbjct  230   DLMDKVNNLFNFNNGGSGNNGGEASSWGFNLNPDQG------------ENDP-ALWISEP  276

Query  2547  TSSSGVD----VNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNF  2380
             T++ G++    VN     NS   S   +I   ++N I S    N    Q S    R+LNF
Sbjct  277   TNT-GIESPARVNNGNNSNSNSKSDSHQISKLDKNDISSVENQNR---QSSCLVERDLNF  332

Query  2379  SEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEsksk  2200
             S  G +                     + G   NF   + K N   + C    G+ES  K
Sbjct  333   SSSGLN---------------------QNG---NFQGGLLKSNETLSFC----GNESSKK  364

Query  2199  kktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEK  2020
             +   +  ++N+EGMLSF S +V+S+      D   HSDLEASVVKEA       +   EK
Sbjct  365   RSPVSKGSNNDEGMLSF-STVVRSAAKSVDSD---HSDLEASVVKEAI-----VVEPPEK  415

Query  2019  RPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYI  1840
             +PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YI
Sbjct  416   KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYI  475

Query  1839  NELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP---DMDVDVK  1669
             NELKSKL+ +ES  ++++ +   + KE +  +        +K++         +M++DVK
Sbjct  476   NELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGGGSRAKERKSSNQDSTASSIEMEIDVK  535

Query  1668  VMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQ  1489
             ++GWD MIR+QC+KK+HP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N 
Sbjct  536   IIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNH  595

Query  1488  DQLRLALISKLAE  1450
             DQL++AL++K+ E
Sbjct  596   DQLKVALMTKVGE  608



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score =   460 bits (1183),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 288/655 (44%), Positives = 366/655 (56%), Gaps = 123/655 (19%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ++I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  ++ R   
Sbjct  54    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  113

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             PA++ AEQ HRK+VLRELNSLI+G  +  +                          +  +
Sbjct  114   PAAA-AEQEHRKRVLRELNSLIAGAGAAPD------------------------EAVEEE  148

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  ++ P WI+    L S+PC+RARQA TFGLRTMVC+P + GV+ELGSTD+I Q+ D +
Sbjct  149   ALFAAQPTWIA--TGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQTGDSI  206

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPEN---DPSALWLTEPTSSSGVDVNTSVQENSIP  2494
              ++R LFN       S + ++SW   P+    DPS LWL +   +  +D+  S+    I 
Sbjct  207   PRIRALFNL------SAAAASSWPPHPDAASADPSVLWLAD---APPMDMKDSISAADIS  257

Query  2493  SSSVKEIVFRN----ENSIPSSTGNNH----HDSQPSQY--------------------F  2398
              S             EN   S+   N     H   PSQ                     F
Sbjct  258   VSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPTPSQPAAPPQRQQQQQQSSQAQQGPF  317

Query  2397  TRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG--ESVTKRNG--------  2248
              RELNFS+F  +G                  KPE GEILNFG   S  +RN         
Sbjct  318   RRELNFSDFASNGGAAAPPF----------FKPETGEILNFGNDSSTGRRNPSPAPPAAT  367

Query  2247  --------------------------NGNSCQFLGGDEskskkktatlkaSNEEGMLSFG  2146
                                       + N  + +      S         +NE GMLSF 
Sbjct  368   ASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSRASNTNNHPAATANE-GMLSFS  426

Query  2145  SGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREE  1975
             S                 SDHSDLEASV +   SR V     AEKRPRKRGRKPANGREE
Sbjct  427   SAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVAPPPEAEKRPRKRGRKPANGREE  486

Query  1974  PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYID  1795
             PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ KL   E+  +
Sbjct  487   PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKE  546

Query  1794  DLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHP  1615
              L+ Q +SLKKE   ++ R P P+        +   ++++ K++G +AMIR+QC K+NHP
Sbjct  547   TLQSQMESLKKE---RDARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHP  603

Query  1614  AARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             AARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QDQL  AL +++AE
Sbjct  604   AARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYSQDQLNAALYTRIAE  658



>gb|KFK31432.1| hypothetical protein AALP_AA6G111200 [Arabis alpina]
Length=585

 Score =   444 bits (1143),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 299/598 (50%), Positives = 381/598 (64%), Gaps = 77/598 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E W YAIFWQ S  DF   +     +LGWGDGYYKGEEDK K+
Sbjct  48    NEDTLQQRLQALIESASENWLYAIFWQISH-DFNSSTGDNTVILGWGDGYYKGEEDKEKK  106

Query  3030  NRPA--SSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGS  2860
              +    S+P EQ HRK+V+RELNSLISG    +DE+ DEEVTDTEWFFLVSMT SF+NG 
Sbjct  107   KKTKSESNPLEQEHRKRVIRELNSLISGGVGVSDEANDEEVTDTEWFFLVSMTQSFVNGV  166

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPG+++ +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS+D+I Q
Sbjct  167   GLPGESYQNSRVIWLSGSGSLTGSGCERAGQGQVYGLQTMVCIATENGVVELGSSDVIDQ  226

Query  2679  SFDLMNKVRVLFNFNNPDMGSISG--SASWAA-----PPENDPSALWLTEPTSSSGVDVN  2521
             S DLM+KV  LFN  + D        + SW         ENDP ALW++EP  S  V   
Sbjct  227   SSDLMDKVNHLFNGGDGDGDGDGVGEACSWGYNLNPDQGENDP-ALWISEPIESGHVTPA  285

Query  2520  TSVQENSIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGF--DGAnnn  2347
                  NS   S +     +NE+S+ +    N     P        NFS  G   DG    
Sbjct  286   NHSNSNSNQISKLD----KNESSVENPRLQN-----P--------NFSTSGLNKDG----  324

Query  2346  hnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNE  2167
                                   NF + + K N    +  F+G +ES  ++   +  ++N+
Sbjct  325   ----------------------NFRDGLMKSN---ETLSFMG-EESNKRRSPVSKGSNND  358

Query  2166  EGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPAN  1987
             EGMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRKPAN
Sbjct  359   EGMLSF-STVVRSTAKSGDSD---HSDLEASVVKEAI-----VVEPPEKKPRKRGRKPAN  409

Query  1986  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSE  1807
             GREEPLNHVEAERQRREKLNQ+FY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +E
Sbjct  410   GREEPLNHVEAERQRREKLNQKFYSLRAVVPNVSKMDKASLLGDAISYINELKTKLQQAE  469

Query  1806  SYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTK  1627
             +  ++++     + KE +    R       + +      +M++DVK++GWD MIR+QC+K
Sbjct  470   NDKEEIQKLLDGMGKEGNGTRGRERKRGSNQDSASS--IEMEIDVKIIGWDVMIRVQCSK  527

Query  1626  KNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             KNHP AR M ALK+LDLEV HAS+SV+N+LMIQQA VKMG++ +N DQL+ AL++K+ 
Sbjct  528   KNHPGARFMDALKELDLEVNHASLSVVNELMIQQATVKMGSQFFNHDQLKAALMAKVG  585



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score =   441 bits (1133),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 273/593 (46%), Positives = 349/593 (59%), Gaps = 120/593 (20%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+  S+LGWGDGYYKGEEDKGK  +   
Sbjct  45    NQETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSSASVLGWGDGYYKGEEDKGKPKQRSI  103

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
               P S+PA+Q +RKK                                    SF +G+GL 
Sbjct  104   PLPFSTPADQEYRKK------------------------------------SFASGAGLA  127

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G+A  +++ +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVELGST+ I  S D
Sbjct  128   GKALSTANVVWVSGSDQLSGSSCERAKQGGVFGMQTIACIPSANGVVELGSTEQIPPSSD  187

Query  2670  LMNKVRVLFNFNNPDMGSIS-GSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             LM+KVR+LFNF   D+G       +W   P   ENDPS +W+ +P  +            
Sbjct  188   LMSKVRILFNF---DVGVADLPGPNWNLDPTQGENDPS-IWINDPIGA------------  231

Query  2502  SIPSSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrng  2323
               P     ++     N + S T N   ++     F+ E+NFS+                 
Sbjct  232   --PEPGKGQLF---SNPVHSQTQNQKINNN----FSPEMNFSK-----------------  265

Query  2322  NSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGS  2143
             +S+   KP   EIL+FG    + + N +  QF        + K        ++ +LSFG 
Sbjct  266   SSTTLVKPRPREILSFGNDGRRSSMNPDPIQF--------ENKRKNSLGLIDDKVLSFGG  317

Query  2142  GMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNH  1963
             G             SDHSDLEA +VKE            EKRP+KRGRKPANGREEPLNH
Sbjct  318   G-----------GESDHSDLEAFIVKEI----------PEKRPKKRGRKPANGREEPLNH  356

Query  1962  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKI  1783
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK K+  +ES    +K 
Sbjct  357   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKLKVNKTESEKIHIKN  416

Query  1782  QAQSLKKELSTKEPR---HPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPA  1612
             Q + +K EL+ ++         +    T   K   M+++VKV+GWDAMIR++ +K+NHPA
Sbjct  417   QLEEVKIELAGRKSSTCGDLSSSSSSATAMIKPVGMEIEVKVIGWDAMIRVESSKRNHPA  476

Query  1611  ARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             ARLM AL DL+LEV+HAS+SV+NDLMIQQA VKMG R+Y QDQL+ +L+SK+ 
Sbjct  477   ARLMSALMDLELEVSHASMSVVNDLMIQQATVKMGFRIYTQDQLQASLVSKIG  529



>gb|EEE51454.1| hypothetical protein OsJ_32566 [Oryza sativa Japonica Group]
Length=732

 Score =   447 bits (1149),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 295/656 (45%), Positives = 371/656 (57%), Gaps = 122/656 (19%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             NQ+TLQQRLQ++I+G+RETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  ++ R   
Sbjct  119   NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  178

Query  3024  PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             PA++ AEQ HRK+VLRELNSLI+G  A+ DE+V+EEVTDTEWFFLVSMT SF NG GLPG
Sbjct  179   PAAA-AEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFPNGLGLPG  237

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  ++ P WI+    L S+PC+RARQA TFGLRTMVC+P + GV+ELGSTD+I Q+ D 
Sbjct  238   QALFAAQPTWIA--TGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQTGDS  295

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPE---NDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             + ++R LFN       S + ++SW   P+    DPS LWL +   +  +D+  S+    I
Sbjct  296   IPRIRALFNL------SAAAASSWPPHPDAASADPSVLWLAD---APPMDMKDSISAADI  346

Query  2496  PSSSVKEIVFRN----ENSIPSSTGNNH----HDSQPSQY--------------------  2401
               S             EN   S+   N     H   PSQ                     
Sbjct  347   SVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPTPSQPAAPPQRQQQQQQSSQAQQGP  406

Query  2400  FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG--ESVTKRNG-------  2248
             F RELNFS+F  +G                  KPE GEILNFG   S  +RN        
Sbjct  407   FRRELNFSDFASNGGAAAPPF----------FKPETGEILNFGNDSSSGRRNPSPAPPAA  456

Query  2247  ---------------------------NGNSCQFLGGDEskskkktatlkaSNEEGMLSF  2149
                                        + N  + +      S         +N EGMLSF
Sbjct  457   TASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSRASNTNNHPAATAN-EGMLSF  515

Query  2148  GSGMVKssgg---igigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGRE  1978
              S                 SDHSDLEASV +   SR V     AEKRPRKRGRKPANGRE
Sbjct  516   SSAPTTRPSTGTGAPAKSESDHSDLEASVREVESSRVVAPPPEAEKRPRKRGRKPANGRE  575

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAV                      L+ KL   E+  
Sbjct  576   EPLNHVEAERQRREKLNQRFYALRAV----------------------LRGKLTALETDK  613

Query  1797  DDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNH  1618
             + L+ Q +SLKKE   ++ R P P+        +   ++++ K++G +AMIR+QC K+NH
Sbjct  614   ETLQSQMESLKKE---RDARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNH  670

Query  1617  PAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             PAARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QDQL  AL +++AE
Sbjct  671   PAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYSQDQLNAALYTRIAE  726



>ref|XP_006838603.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
 gb|ERN01172.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
Length=655

 Score =   431 bits (1108),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 298/615 (48%), Positives = 375/615 (61%), Gaps = 62/615 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             +Q++LQ RLQ+LI+ A E WTYAIFWQ S+   A    L W DGYYKGE  K  R  PA 
Sbjct  65    SQDSLQHRLQSLIETAHEPWTYAIFWQPSLPSQA----LAWADGYYKGEPLKLAR-PPAP  119

Query  3015  SPAEQAHRKKVLRELNSLIS--GPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
               AEQ +RK VLR+L+SLIS    A+ DESVDEEVTDTEWF+LVSM  SF   + LP  +
Sbjct  120   PSAEQINRKLVLRQLHSLISQTSSATNDESVDEEVTDTEWFYLVSMMQSFAGPTALPSHS  179

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             F S +P+W++G  +L + PCERARQA  FGL+++VCIP+S+GVVELGST+ +  + +L+ 
Sbjct  180   FFSGAPVWLAGGGRLATCPCERARQAVAFGLQSLVCIPTSSGVVELGSTEAVPHNPELVR  239

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
               + LF + +P               ++D  +LWLT+P         T+ Q   +     
Sbjct  240   GAQALFTWPDPHA-------------QHDDPSLWLTDPAPEPPEPAKTTTQTPPVTKPVP  286

Query  2481  KEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDG-AnnnhnndlrngNSSHS-  2308
                             N  + +     F+  LNFS+FGF+G A NN    L     SH  
Sbjct  287   PPPPPPPVVE------NTSNSTVTQTAFS--LNFSDFGFEGLATNNQRGALNTYEDSHRD  338

Query  2307  --------CKPEAGEILNFGESVTKRNGNGNSCQFLG---------GDEskskkktatlk  2179
                     CKPE+GEIL+FG      N         G         G             
Sbjct  339   GKVGNLQPCKPESGEILSFGGGNGGGNSMSRGGSSSGLMGRVDEKRGGRLGPTMGPTRQN  398

Query  2178  aSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGR  1999
                +EG+LSF SG+V     +  G  SDHSDLEASV +   SR V+T  AAE+RPRKRGR
Sbjct  399   GGVDEGILSFSSGVV-LQSELKSGADSDHSDLEASVREVESSRIVDT--AAERRPRKRGR  455

Query  1998  KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKL  1819
             +PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL+ KL
Sbjct  456   RPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELRGKL  515

Query  1818  ETSESYIDDLKIQAQSLKKELS-------TKEPRHPDPNPKKTTT-----PHKIPDMDVD  1675
             +  ES  D+L+ Q ++LKK+ S         +    D + K  +T       K P ++++
Sbjct  516   QGLESENDELQTQVEALKKKESQLFNGSLKSQALSGDSDLKAHSTHSSANSGKYPGLEIE  575

Query  1674  VKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLY  1495
             VK++GW+AMIRIQ  K+NHPAAR MVALKDLDLEV +ASVSV+ DLMIQQA VKM +R+Y
Sbjct  576   VKILGWEAMIRIQSNKQNHPAARFMVALKDLDLEVHYASVSVVKDLMIQQATVKMTSRIY  635

Query  1494  NQDQLRLALISKLAE  1450
              QDQL  AL SK+A+
Sbjct  636   TQDQLSAALYSKVAD  650



>ref|XP_009396848.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=712

 Score =   431 bits (1108),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 291/652 (45%), Positives = 379/652 (58%), Gaps = 91/652 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             ++E L +RLQ LI+G R++WTY I WQ+SV    G SLL W DG YKG E+  ++ +PA+
Sbjct  73    DKEMLHERLQALIEGVRDSWTYVILWQSSVDTDTGESLLVWADGCYKGCEEDKRKQQPAA  132

Query  3015  SPA----EQAHRKKVLRELNSLISG---PAstdesvdeevtdtEWFFLVSMTHSFINGSG  2857
             + A    EQ  RK+VLRELNSLI G    +S +E+ ++EVTD+EWFFLVSMT SF+NGSG
Sbjct  133   ASAASAAEQVRRKRVLRELNSLIDGDERSSSANEAAEDEVTDSEWFFLVSMTQSFVNGSG  192

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             LPGQA  S  P W++G D+L  +PC+RARQA  FG++TMV +P S GV+ELGST LI  S
Sbjct  193   LPGQALFSGDPSWLAGADRLAVAPCDRARQATVFGIQTMVYVPVSPGVLELGSTQLISHS  252

Query  2676  FDLMNKVRVLFNFNNPDM-------GSISGSASWAAPP-----ENDPSALWLTEPTSSSG  2533
              ++ +K+R+LF+ N+  M       GS+    S AA       E DPS LW  +P   S 
Sbjct  253   SEITSKIRILFDLNSLQMPLANAAAGSVLSPLSLAASTPVNQGEIDPSELWFADP---SL  309

Query  2532  VDVNTSVQENS--IPSSSVKEIVFRNEN-------------SIPSSTGNNH---------  2425
             V++   V  NS  +  S+ K ++  + N              I  S G  H         
Sbjct  310   VEIRDFVLPNSASVEISASKPLIHFDSNHSSRTLRENPSPFQIQQSNGQRHQQRQQHQSS  369

Query  2424  --HDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRN  2251
               +DSQ   +F RELNFSE    G                S KPE+ E  NF  S  KRN
Sbjct  370   SGNDSQTQPFFARELNFSELLHTGPAAPL----------QSVKPESDENGNFIGS--KRN  417

Query  2250  GNG--------NSCQFLGG----DEskskkktatlkaSNEEGMLSFGSGMVKssggigig  2107
              +         +S Q        + + S     ++  SN+E  L F S   + S    + 
Sbjct  418   SSAAIVASNLFSSHQIAAAVPDDNMNNSSTGAMSMPRSNDEAKLVFSSAPARPSSIALMK  477

Query  2106  --------------dssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPL  1969
                             SDHSD E S+ K   S     L   EKRPRKRGRKPANGREEPL
Sbjct  478   CSPGGGSIGDFLEGADSDHSDTERSMRKMGSS----LLTDPEKRPRKRGRKPANGREEPL  533

Query  1968  NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDL  1789
             NHVEAERQRREKLNQRFYALR+VVPNVSKMDKASLLGDA  YINEL+ KL++ ES  + L
Sbjct  534   NHVEAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDATTYINELRVKLQSLESEKEGL  593

Query  1788  KIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAA  1609
             + Q ++L+K+  +   R P    + T    +   ++++VK++  +AMIR+QC   NHP A
Sbjct  594   EAQVEALRKDRQSPPARSPHLG-ETTNGNGRCYGVEMEVKMLDSEAMIRLQCQNTNHPTA  652

Query  1608  RLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
              LM ALKDL+L+V +ASVSV+ DLMIQQA VKM +R Y Q+QL  AL  ++A
Sbjct  653   MLMSALKDLNLDVYYASVSVVKDLMIQQATVKMSSREYTQEQLSSALYYRVA  704



>gb|KHN04880.1| Transcription factor MYC2, partial [Glycine soja]
Length=487

 Score =   422 bits (1086),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 255/515 (50%), Positives = 324/515 (63%), Gaps = 75/515 (15%)
 Frame = -3

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPGQAF +S+P+W++G D+L +S CERARQ   FGL+T+VCIPS+NGVVELGST+LI Q
Sbjct  1     GLPGQAFFNSTPVWVTGSDRLSASACERARQGHMFGLQTLVCIPSANGVVELGSTELIFQ  60

Query  2679  SFDLMNKVRVLFNF--NNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQE  2506
             + DLMNKV+VLFNF  NN DMGS S  A+ A   ENDPS+LWL++P     ++   +   
Sbjct  61    NPDLMNKVKVLFNFSNNNFDMGS-SWPATSADQGENDPSSLWLSDPEVRDSINTVAATPS  119

Query  2505  NSIPS-----SSVKEIVFRNENSIPSST------GNNHHDSQPSQYFTRELNFSEFGFDG  2359
              S+P+     S  K +   +    P S+       + H   Q    F+RELNFSE+GFD 
Sbjct  120   VSVPAQTQGISISKTMQLESSIQTPGSSTLTETPSSIHAIPQNQSVFSRELNFSEYGFD-  178

Query  2358  AnnnhnndlrngNSSHSCKPEAGEILNFGESVTKR------NGNGNS-CQFLGG------  2218
                       N  + HS KPE+GEIL+FGES  KR      NGN NS   F  G      
Sbjct  179   ------PKTGNNQNHHSLKPESGEILSFGES--KRTSYGGVNGNSNSNSHFFSGQSPFVA  230

Query  2217  --DEskskkkta--------tlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVV  2068
               DE+ +K              + SN++GMLSF SG++  +               ASVV
Sbjct  231   AADENTNKNNINNNGKTKSPNSRGSNDDGMLSFTSGVILPAS-------------NASVV  277

Query  2067  KEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1888
             K+        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV
Sbjct  278   KDP-------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  330

Query  1887  SKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL--------STKEPRHP  1732
             SKMDKASLLGDAI+YI ELKSKL+T ES  D ++ Q + +KKEL        S       
Sbjct  331   SKMDKASLLGDAISYITELKSKLQTLESDKDGMQKQLEGVKKELEKTTENVSSNHAGNSS  390

Query  1731  DPNPKKTTTPHKIPD-MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
               N     +  K+ D +++DVK++GWDAMIRI C+KKNHP ARL+ AL +LDL+V HA+V
Sbjct  391   SCNNNNKLSNQKLIDVLEMDVKILGWDAMIRIHCSKKNHPGARLLTALMELDLDVHHANV  450

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             +++ND+ + QA VKMG+R Y Q+QLR AL +K+ +
Sbjct  451   NLVNDMTMLQATVKMGSRFYTQEQLRAALAAKVGD  485



>gb|AEJ88337.1| putative MYC protein, partial [Tamarix hispida]
Length=521

 Score =   414 bits (1064),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 280/528 (53%), Positives = 339/528 (64%), Gaps = 61/528 (12%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             NQ++LQQRLQ LIDGARE+WTYAIFWQ++  D    S+L WGDGYYKGEE+K K    + 
Sbjct  5     NQDSLQQRLQALIDGARESWTYAIFWQSNP-DPDADSMLVWGDGYYKGEENKDKSRNRSL  63

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
              P EQ  RKKVLRELNSLISG  AS D++VDE+VTDTEWFFLVSMT SF  G  LP QAF
Sbjct  64    DPIEQDLRKKVLRELNSLISGSTASPDDAVDEDVTDTEWFFLVSMTESFAKGVDLPVQAF  123

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
                + IWI+G + L  SP +RAR+   FGL+T+VCIP   GVVE+GSTD+I +S DLMNK
Sbjct  124   TGLNLIWIAGSETLRISPFDRARRGLDFGLQTLVCIPIQGGVVEMGSTDMIPRSSDLMNK  183

Query  2658  VRVLFNFNNPDMGSISGSASWAAPP--------------ENDPSALWLTEPTSSS-----  2536
              R+LFN+   D+G+ S SA+  A                 NDPSALW++EP+SS+     
Sbjct  184   FRILFNYGGGDLGNCSNSAAAVAAAPVADQPGPAVVDQGNNDPSALWISEPSSSAAEFRT  243

Query  2535  ------GVDVN-TSVQENSIPSSS---------------VKEIVFRNENSIPSSTGNNHH  2422
                   G   N T +  N + + S               V+      EN I  +T     
Sbjct  244   VMTAGGGSSSNLTCLSSNPVANGSHHHQQQQQKGVIHLDVQSTSCVGENPIGINTHKVQQ  303

Query  2421  DSQPSQYFTRELNFSEFGF-DGAnnnhnndlrngNSSHSCKPEAGEILNFGES--VTKRN  2251
             + QP  + +RELNFSE+G+ DG  + +             KPEAGEIL+FG+S  V    
Sbjct  304   NQQPG-FVSRELNFSEYGYVDGIGSRNGTLT-------PAKPEAGEILSFGDSKRVPSCT  355

Query  2250  GNGN---SCQFLGGDEskskkktatlkaSNEEGMLSFGSGMV--KssggigigdssDHSD  2086
             G+G    S   L  +E K KK + T + SNEEGM+SF SG++   S G       SDHSD
Sbjct  356   GSGTIFGSNSHLMAEEYKKKKSSPTSRGSNEEGMMSFTSGVLLPSSGGVKSSTVDSDHSD  415

Query  2085  LEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  1906
             LEASV KEADS A   +  AEK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR
Sbjct  416   LEASV-KEADS-ASRVVDPAEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  473

Query  1905  AVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK  1762
             AVVPNVSKMDKASLLGDAI+YI ELKSKL+  ES  + L+ Q  +LK+
Sbjct  474   AVVPNVSKMDKASLLGDAISYIKELKSKLQNVESDKEILQKQIGTLKR  521



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score =   410 bits (1055),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 256/468 (55%), Positives = 316/468 (68%), Gaps = 43/468 (9%)
 Frame = -3

Query  2757  FGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNNPDMGS--ISGSASWAAPP  2584
             FGL+TMVC+P++NGVVELGSTDLI QS DLMNKVRVLF+FNN ++GS  +SG A+ A   
Sbjct  1     FGLQTMVCVPTANGVVELGSTDLIYQSSDLMNKVRVLFDFNNLEVGSCPMSGGAT-ADQG  59

Query  2583  ENDPSALWLTEPTSS---SGVDVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHH---  2422
             ENDPS+ WL +P+++   +   VNTS   N+      K   F N  S  S + N      
Sbjct  60    ENDPSSFWLNDPSTTIMEAKDPVNTSATTNTSNQLISKLAQFDNHPSSSSLSENPSPIQV  119

Query  2421  ---------DSQPSQYFTRELNFSEF-GFDGAnnnhnndlrngNSSHSCKPEAGEILNFG  2272
                        Q   +FT ELNFS++ G+DG++  ++N      +SHS KPE+GEILNFG
Sbjct  120   PQLQQQVQQQQQTQSFFTMELNFSDYDGYDGSSVKNSNS-----NSHSLKPESGEILNFG  174

Query  2271  ESVTKRNGNGNSCQFLGG--------DEskskkktatlkaSNEEGMLSFGSGMV---Kss  2125
             ES  KR+    + +   G        D +  KK++   + SN+EG+LSF SG++      
Sbjct  175   ES--KRSSYSANGKLFSGHSQITAAEDNNSKKKRSPPSRGSNDEGILSFSSGVILPSSCV  232

Query  2124  ggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQ  1945
                  G  SDHSDLEASVV+EADS  V      EKRPRKRGRKPANGREEPLNHVEAERQ
Sbjct  233   VKSSGGADSDHSDLEASVVREADSSRV---VDPEKRPRKRGRKPANGREEPLNHVEAERQ  289

Query  1944  RREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLK  1765
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KL+T E+  ++L+ Q +S+ 
Sbjct  290   RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMN  349

Query  1764  KELSTKEPRHPD---PNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVA  1594
               L  K+ R         +      K+ DMD+DVK++G DAMIRIQC KKNHPAARLM A
Sbjct  350   NHLPCKDSRSSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAA  409

Query  1593  LKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             LK+LD++V HASVSV+NDLMIQQA VKMG+R+Y QD LRLAL SK+ E
Sbjct  410   LKELDMDVHHASVSVVNDLMIQQATVKMGSRIYTQDHLRLALHSKVGE  457



>ref|XP_006398377.1| hypothetical protein EUTSA_v10000853mg [Eutrema salsugineum]
 gb|ESQ39830.1| hypothetical protein EUTSA_v10000853mg [Eutrema salsugineum]
Length=534

 Score =   408 bits (1048),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 260/587 (44%), Positives = 332/587 (57%), Gaps = 103/587 (18%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPA  3007
             TLQ+RLQ +++G  E WTY IFW+ S  +F+G S+L WGDG +K ++ K +R +   + A
Sbjct  40    TLQKRLQAVLNGTHEAWTYVIFWKPSYYEFSGESVLIWGDGIHKDDDVKSRRRK--KTMA  97

Query  3006  EQAHRKKVLRELNSLISGPA-------stdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             E+ HR KVLRELNS+ISG A         D+  D EVTDTEW+FLVSMT SF  GSGL G
Sbjct  98    EKEHRSKVLRELNSMISGEAFPVVGGDDDDDDGDVEVTDTEWYFLVSMTCSFCIGSGLAG  157

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             +AF + +P+W++G D +  S C+RA+Q    GL T+VCIP  NGV+ELGST  I Q  DL
Sbjct  158   KAFATYNPVWVTGSDDINGSGCDRAKQGGGLGLETIVCIPLDNGVLELGSTVEIRQHSDL  217

Query  2667  MNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIPSS  2488
             +NK+R LFNF         GS  +   P N  S L+                      S+
Sbjct  218   LNKIRFLFNF--------KGSDDFPGAP-NSKSKLF----------------------ST  246

Query  2487  SVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHS  2308
              V ++  R     P+ T      S     F+ ELNFS                    + S
Sbjct  247   QVAKVSLRTVTDNPNPTYPKIQKS-----FSPELNFS----------------MVTPNSS  285

Query  2307  CKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMVKs  2128
                 +GEILNFG+ V +  G  N   + G             +  N++G           
Sbjct  286   TGALSGEILNFGDDVKRNPGILNCTSYPG-------------QIQNDDG-----------  321

Query  2127  sggigigdssDHSDLEASVVKEADSRAVE---TLAAAEKRPRKRGRKPANGREEPLNHVE  1957
                          DL A+V K  DS       T+    KR  KRGRKPANGR+EP+NHVE
Sbjct  322   -------------DLLAAVKKIDDSDQSNINATVVCENKRQSKRGRKPANGRKEPMNHVE  368

Query  1956  AERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQA  1777
             AER RR+KLNQRFYALRAVVPNVSKMDKASLLGDA+ YINELKS+ E +E     ++IQ 
Sbjct  369   AERLRRDKLNQRFYALRAVVPNVSKMDKASLLGDAVCYINELKSRAENAEMEKIAIEIQL  428

Query  1776  QSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMV  1597
             Q LK+E+S            K  +  KI    +DVKVMG DAMIR++ +K+NHP ARLM 
Sbjct  429   QKLKEEISGCNAISSVCADGKNAS--KIGTAKIDVKVMGCDAMIRVESSKRNHPGARLMN  486

Query  1596  ALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             A  DL+LEV HASVSV+NDLM+QQA VKM  + Y ++QLR+ LISK+
Sbjct  487   AFMDLELEVNHASVSVINDLMVQQATVKMVLKFYTEEQLRVMLISKI  533



>gb|KFK31426.1| hypothetical protein AALP_AA6G110400 [Arabis alpina]
Length=506

 Score =   380 bits (977),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 242/586 (41%), Positives = 322/586 (55%), Gaps = 109/586 (19%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASS  3013
             + TLQ+RL  +++   E WTYA+FW+ S  DF+G S+L WGDG YKGE+    R R  ++
Sbjct  22    ETTLQKRLHAVLNCTHEAWTYAVFWKPSYYDFSGDSVLKWGDGIYKGEDGDTPRRRRKTT  81

Query  3012  PAEQAHRKKVLRELNSLISGPAstdesv-------deevtdtEWFFLVSMTHSFINGSGL  2854
              AE+ HR KVL+EL S+ISG A    +        D EV+DTEWF+LVSMT SF  GSGL
Sbjct  82    -AEKEHRNKVLKELTSMISGEAFQVMNEGDDDDDDDVEVSDTEWFYLVSMTWSFGRGSGL  140

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + +P+W++G D++  S C RA+Q    GL+T+VCIPS NGV+ELGS + I Q+ 
Sbjct  141   AGKAFATYNPVWVTGSDQIYGSGCNRAKQGGDLGLQTIVCIPSDNGVLELGSMEQIQQNS  200

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQENSIP  2494
             DL NK+R LFNF         GS  +   P                      SVQ     
Sbjct  201   DLFNKIRFLFNF--------EGSKDFTGAPNL-------------------MSVQLEKGN  233

Query  2493  SSSVKEIVFRNENSIPSSTGNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSS  2314
              S+V      + + +     N          FT++LNFS                   +S
Sbjct  234   FSTVPNSPNPDPSPVYMQMQNG---------FTQDLNFS-----------------TATS  267

Query  2313  HSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSGMV  2134
              S +  +GEIL+FG++V K + N +   + G             +   EEG +S      
Sbjct  268   TSARDLSGEILSFGDNV-KHSLNPDRNSYSG-------------QIQKEEGKMS------  307

Query  2133  KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEA  1954
                                S  K  DS     L    KR ++RGRKPA  RE PL+HV+A
Sbjct  308   ------------------TSGEKMDDS----ILVPENKREKRRGRKPAKDREVPLSHVQA  345

Query  1953  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQ  1774
             ER RREKLNQRFYALRAVVPNV+KMDK SLLGDAI YINELK K E +E+  + ++IQ  
Sbjct  346   ERLRREKLNQRFYALRAVVPNVTKMDKTSLLGDAICYINELKLKSENAETEKNAVQIQLN  405

Query  1773  SLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVA  1594
              LK++++ +         +K          ++DVK++G DAMIR++  K NHP AR M A
Sbjct  406   KLKEQITGRRRNAISSGGEKNAFS------EIDVKIIGCDAMIRVESNKSNHPGARFMNA  459

Query  1593  LKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             L DL++EV HAS+SV+N LMIQQA VKMG R Y ++QLR  L SK+
Sbjct  460   LMDLEVEVNHASISVINHLMIQQATVKMGLRNYTEEQLRAMLSSKV  505



>gb|KHN38923.1| Transcription factor MYC2 [Glycine soja]
Length=471

 Score =   379 bits (973),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 242/484 (50%), Positives = 302/484 (62%), Gaps = 62/484 (13%)
 Frame = -3

Query  2757  FGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNF--NNPDMGSISGSASWAAPP  2584
             FGL+T+VCIPS+NGVVELGST+LI Q+ DLMNKV+VLFNF  NN DMGS S  A+ A   
Sbjct  2     FGLQTLVCIPSANGVVELGSTELIFQNSDLMNKVKVLFNFSNNNFDMGS-SWPATSADQG  60

Query  2583  ENDPSALWLTEPTSSSGVDVNTSVQENSIPS-----SSVKEIVFRNENSIPSST------  2437
             ENDPS+LWL++P     V+   +     +P+     S  K +   +    P S+      
Sbjct  61    ENDPSSLWLSDPEVRDSVNTAAATPSVMVPAQTQGISISKTMQLESSIQTPGSSTLTETP  120

Query  2436  GNNHHDSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGES---  2266
              + H   Q    F+RELNFSE+GFD           N  + HS KPE+GEIL+FGES   
Sbjct  121   SSIHAIPQNQSVFSRELNFSEYGFD-------PKSGNNQNHHSLKPESGEILSFGESRRT  173

Query  2265  ------VTKRNGNGNSCQFLGG--------DEskskkktatlka-------SNEEGMLSF  2149
                           ++  F  G        DE+K    +   K        SN++GMLSF
Sbjct  174   SYGGVNGNTNTNTNSNSHFFSGQSPFVAAVDENKKNNMSNNGKKRSPNSRGSNDDGMLSF  233

Query  2148  GSGMV--KssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREE  1975
              SG++   ++   G G  SDHSDLEASVVK+        +   EKRPRKRGRKPANGREE
Sbjct  234   TSGVIIPATNLKSGGGGDSDHSDLEASVVKDP-------VVEPEKRPRKRGRKPANGREE  286

Query  1974  PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYID  1795
             PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI ELKSKL+T ES  D
Sbjct  287   PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKD  346

Query  1794  DLKIQAQSLKKEL--------STKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRI  1639
              L  Q + +KKEL        S     + + N   +  P  I  +++DVK++GWDAMI I
Sbjct  347   VLHKQLEGVKKELEKTTDNVSSNHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITI  406

Query  1638  QCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISK  1459
              C+KKNHPAA LM AL +LDL+V +A+V+++NDLMIQQA VKMG+R Y Q+QLR AL +K
Sbjct  407   TCSKKNHPAATLMTALMELDLDVHYATVTLVNDLMIQQATVKMGSRFYTQEQLRAALSAK  466

Query  1458  LAET  1447
             + + 
Sbjct  467   VGDV  470



>gb|KHM99168.1| Transcription factor MYC2 [Glycine soja]
Length=426

 Score =   369 bits (948),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 296/462 (64%), Gaps = 66/462 (14%)
 Frame = -3

Query  2757  FGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNN-PDMGSIS-GSASWAAPP  2584
             FGL+T+VCIPS+NGVVEL ST++I Q+ DLMNKVR LFNFNN P+ GS +    +     
Sbjct  2     FGLQTLVCIPSANGVVELASTEVIFQNPDLMNKVRDLFNFNNNPETGSWALNCVATTDQG  61

Query  2583  ENDPSALWLT-EPTSSSGV-----DVNTSVQENSIPSSSVKEIVFRNENSIPSSTGNNHH  2422
             ENDPS+LWL  E   SS V      VN ++Q  +  SS++ +        +P S G    
Sbjct  62    ENDPSSLWLNPEIRDSSTVAPPNSTVNKTLQFETPGSSTLTDTPSAAAVHVPKSNGQG--  119

Query  2421  DSQPSQYFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNG  2242
                   +F+RELNFS                     +S KPE+GEIL+FGES  K + NG
Sbjct  120   ------FFSRELNFS---------------------NSLKPESGEILSFGES-KKSSYNG  151

Query  2241  NSCQFLGGDEskskkktatlkaSNEEGMLSFGS---GMVKssggigigdssD--HSDLEA  2077
             +    +   E  +KK++   ++S ++GMLSF S     +KS  G       D  HSDLEA
Sbjct  152   SFFPGVVAIEENNKKRSPVSRSSIDDGMLSFTSLPAANIKSGSGGAGAGGGDSDHSDLEA  211

Query  2076  SVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  1897
             SV K+        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV
Sbjct  212   SVAKQ--------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVV  263

Query  1896  PNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK--ELSTKEPRHP---  1732
             PNVSKMDKASLLGDAI+YINELK KL   +S   +L+ Q  S KK  EL+TK P  P   
Sbjct  264   PNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPPP  323

Query  1731  --------DPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDL  1576
                     +   KKTTT  K+ D++++VK++GWDAMIRIQC+KKNHPAARLM ALKDLDL
Sbjct  324   PPGLPPSNNEEAKKTTT--KLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDL  381

Query  1575  EVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             EV HASVSV+NDLMIQQA V MG + Y Q+QL  AL SK+ +
Sbjct  382   EVHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKVGD  423



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score =   312 bits (799),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 197/249 (79%), Gaps = 11/249 (4%)
 Frame = -3

Query  2172  NEEGMLSFGSGMVKssggigigd-----ssDHSDLEASVVKEADS-RAVETLAAAEKRPR  2011
             NEEGMLSF SG++  S  +          SDHSDLEASVV+E +S R VE     EK+PR
Sbjct  28    NEEGMLSFTSGVILPSSCVMKSSGGTGGDSDHSDLEASVVRETESSRIVE----PEKKPR  83

Query  2010  KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINEL  1831
             KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI EL
Sbjct  84    KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKEL  143

Query  1830  KSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNP-KKTTTPHKIPDMDVDVKVMGWD  1654
             KSKL+ +ES  ++L+ Q +S+KKE S K+ R   P P ++    +K  +MD+DVK++GWD
Sbjct  144   KSKLQNTESDKEELEKQVESMKKEFSKKDTRSGTPPPDQELKMSNKSIEMDIDVKIIGWD  203

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
              MIRIQC+KKNHPAARLM ALK+LDL+V HASVSV+NDLMIQQA VKMG+R Y  +QLR+
Sbjct  204   VMIRIQCSKKNHPAARLMAALKELDLDVHHASVSVVNDLMIQQATVKMGSRFYTHEQLRV  263

Query  1473  ALISKLAET  1447
             AL +K+ +T
Sbjct  264   ALSNKVCDT  272



>ref|XP_010463090.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=462

 Score =   312 bits (799),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 211/432 (49%), Positives = 266/432 (62%), Gaps = 63/432 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             NQETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  65    NQETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRSS  123

Query  3024  --PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
               P S+PA+Q +RKKVLRELNSLISG  A +D++VDEEVTDTEWFFLVSMT SF  G+GL
Sbjct  124   SPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGL  183

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
              G+AF + + +W+SG D+L  S CERA+Q   FG++T+ CIPS+NGVVE+GST+ I QS 
Sbjct  184   AGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEQIRQSS  243

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQEN  2503
             DL+NKVRVLFN +    G +SG   W   P   ENDPS +W+ +P  + G +   +   +
Sbjct  244   DLINKVRVLFNLDG-GAGDLSG-LDWNLDPDQGENDPS-MWINDPIGAPGSNEPGNGAPS  300

Query  2502  SIPSSSVKEIVFRNENS-----------IPSSTGNNHHDSQPSQYFTRELNFSEFGFDGA  2356
             S      K I F N +S            PS   +   + + S  F+RELNFS       
Sbjct  301   SSSQLFSKSIQFENGSSSTITENPNPDPTPSPVHSQTQNPKFSNNFSRELNFS-------  353

Query  2355  nnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlka  2176
                        +SS   KP +GEIL+FG+   + +GN +   + G    +++ +    K+
Sbjct  354   ----------TSSSTLVKPRSGEILSFGDDGKRGSGNPDPSSYSG----QTQFENKRKKS  399

Query  2175  SNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
              NE+ +LSFG               SDHSDLEASVVKE          A EKRP+KRGRK
Sbjct  400   PNEDKVLSFGD---------KTTGESDHSDLEASVVKE---------VAVEKRPKKRGRK  441

Query  1995  PANGREEPLNHV  1960
             PANGREEPLN +
Sbjct  442   PANGREEPLNXM  453



>gb|AAF04917.1|AF011557_1 jasmonic acid 3 [Solanum lycopersicum]
Length=326

 Score =   281 bits (718),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 173/280 (62%), Positives = 199/280 (71%), Gaps = 27/280 (10%)
 Frame = -3

Query  2403  YFTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGN-----  2239
             +FTRELNFSEFGFDG++N + N      SS SCKPE+GEILNFG+S  K   + N     
Sbjct  24    FFTRELNFSEFGFDGSSNRNGN------SSVSCKPESGEILNFGDSTKKSASSANVNLFT  77

Query  2238  -SCQFLG-GDEskskkktatl--kaSNEEGMLSFGSGMV---KssggigigdssDHSDLE  2080
                QF G G+E+ +K +      + SNEEGMLSF SG V              S+HSDLE
Sbjct  78    GQSQFWGLGEENNNKNQEKISYFRGSNEEGMLSFVSGTVCFFGHEVRWRRRQDSEHSDLE  137

Query  2079  ASVVKEADS-RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  1903
             ASVVKEADS R VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRF++LRA
Sbjct  138   ASVVKEADSSRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFFSLRA  193

Query  1902  VVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPN  1723
             VVPNVSKMDKASLLGDAI+YINELKSKL+ +ES  +DLK Q + LKKE S +    P PN
Sbjct  194   VVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKE-SRRPGPPPPPN  252

Query  1722  PKKTTTPH---KIPDMDVDVKVMGWDAMIRIQCTKKNHPA  1612
                  + H   KI D+D+DVK++GWDAMIRIQC KKNHPA
Sbjct  253   QDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPA  292



>gb|KHN18804.1| Transcription factor MYC4 [Glycine soja]
Length=280

 Score =   277 bits (708),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 174/232 (75%), Gaps = 25/232 (11%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSDLEASV K+        +   EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  58    HSDLEASVAKQ--------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  109

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK--ELSTKEP  1741
             ALRAVVPNVSKMDKASLLGDAI YINELKSKL   +S   +L+ Q  S KK  EL+TK P
Sbjct  110   ALRAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNP  169

Query  1740  RHPDP-------------NPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLM  1600
               P P              PKKTT+  K+ D++++VK++GWDAM+RIQC+KKNHPAARLM
Sbjct  170   PPPPPPPPPPGPPPSNSVEPKKTTS--KLADLELEVKIIGWDAMVRIQCSKKNHPAARLM  227

Query  1599  VALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAETL  1444
              ALKDLDLEV HASVSV+NDLMIQQA V MG + Y Q+QL  AL SK+ + L
Sbjct  228   AALKDLDLEVHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKVGDEL  279



>gb|KHM99167.1| Transcription factor MYC4 [Glycine soja]
Length=218

 Score =   273 bits (698),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 171/221 (77%), Gaps = 19/221 (9%)
 Frame = -3

Query  2073  VVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1894
             +VK+ADSR +E     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP
Sbjct  1     MVKQADSRVMEP----EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  56

Query  1893  NVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKK--ELSTKEPRHP----  1732
             NVSKMDKASLLGDAI+YINELK KL   +S   +L+ Q  S KK  EL+TK P  P    
Sbjct  57    NVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPPPP  116

Query  1731  -------DPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLE  1573
                    +   KKTTT  K+ D++++VK++GWDAMIRIQC+KKNHPAARLM ALKDLDLE
Sbjct  117   PGLPPSNNEEAKKTTT--KLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLE  174

Query  1572  VTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             V HASVSV+NDLMIQQA V MG + Y Q+QL  AL SK+ +
Sbjct  175   VHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKVGD  215



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score =   276 bits (706),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 181/239 (76%), Gaps = 12/239 (5%)
 Frame = -3

Query  2163  GMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             GMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRKPANG
Sbjct  218   GMLSF-STVVRSTAKSGESD---HSDLEASVVKEA------IVVEPEKKPRKRGRKPANG  267

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +ES
Sbjct  268   REEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAES  327

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--DMDVDVKVMGWDAMIRIQCT  1630
               ++++ Q   + KE + K         ++++        +M++DVK++GWD MIR+QC+
Sbjct  328   EKEEIQKQLDGMSKEGNGKSGASRAVKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCS  387

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             KKNHP +R M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQLR AL+ K+ 
Sbjct  388   KKNHPGSRFMDALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLRAALMLKVG  446


 Score =   182 bits (463),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 138/217 (64%), Gaps = 28/217 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYYKGEEDK K+
Sbjct  46    NEDTLQQRLQALIESAGEKWTYAIFWQISH-DFESPAGDNAVVLGWGDGYYKGEEDKEKK  104

Query  3030  NRPASS-PAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
              + ++S PAEQ HRK+ + +                     TEWFFLVSMT SF NG GL
Sbjct  105   KKSSNSNPAEQEHRKREVTD---------------------TEWFFLVSMTQSFANGVGL  143

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS++ I QS 
Sbjct  144   PGESFLNSRVIWLSGSGALTGSGCERANQGQIYGLQTMVCIAAENGVVELGSSEAISQSS  203

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSAL  2563
             DLM+KV  LFN +N  +   +   S A   E+D S L
Sbjct  204   DLMDKVNSLFNSSNGMLSFSTVVRSTAKSGESDHSDL  240



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score =   266 bits (681),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 167/221 (76%), Gaps = 17/221 (8%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
              SDLEASVVKEA+S  +   A  EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  19    RSDLEASVVKEAESGRI--AAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  76

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             +LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +E+  ++L+ Q   + KE+       
Sbjct  77    SLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVG------  130

Query  1734  PDPNPKKTTTPHKIPDMD--------VDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLD  1579
              D N K +    K  + D        +DVK++GWDAMIRIQC KKNHP A+ M ALK+L+
Sbjct  131   -DGNVKSSVKDQKCLEQDSGVSIEVEIDVKIIGWDAMIRIQCGKKNHPGAKFMEALKELE  189

Query  1578  LEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             LEV HAS+SV+N+ MIQQA VKMG + + QDQL+ AL+ ++
Sbjct  190   LEVNHASLSVVNEFMIQQATVKMGNQFFTQDQLKAALMERV  230



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score =   275 bits (702),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 181/239 (76%), Gaps = 12/239 (5%)
 Frame = -3

Query  2163  GMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANG  1984
             GMLSF S +V+S+   G  D   HSDLEASVVKEA       +   EK+PRKRGRKPANG
Sbjct  221   GMLSF-STVVRSTAKSGESD---HSDLEASVVKEA------IVVEPEKKPRKRGRKPANG  270

Query  1983  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSES  1804
             REEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELKSKL+ +ES
Sbjct  271   REEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAES  330

Query  1803  YIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--DMDVDVKVMGWDAMIRIQCT  1630
               ++++ Q   + KE + K         +K++        +M++DVK++GWD MIR+QC+
Sbjct  331   DKEEIQKQLDGMSKEGNGKSGASRAVRERKSSYQDSASSVEMEIDVKIIGWDVMIRVQCS  390

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             KKNHP +R M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL+ AL+ K+ 
Sbjct  391   KKNHPGSRFMDALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKAALMLKVG  449


 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 138/217 (64%), Gaps = 28/217 (13%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQ LI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYYKGEEDK K+
Sbjct  49    NEDTLQQRLQALIESAGEKWTYAIFWQISH-DFESPTGDNAVVLGWGDGYYKGEEDKEKK  107

Query  3030  NRPASS-PAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGL  2854
              + ++S PAEQ HRK+ + +                     TEWFFLVSMT SF NG GL
Sbjct  108   KKSSNSNPAEQEHRKREVTD---------------------TEWFFLVSMTQSFANGVGL  146

Query  2853  PGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSF  2674
             PG++F +S  IW+SG   L  S CERA Q Q +GL+TMVCI + NGVVELGS++ I QS 
Sbjct  147   PGESFLNSRVIWLSGSGALTGSGCERASQGQIYGLQTMVCIAAENGVVELGSSEAISQSS  206

Query  2673  DLMNKVRVLFNFNNPDMGSISGSASWAAPPENDPSAL  2563
             DLM+KV  LFN NN  +   +   S A   E+D S L
Sbjct  207   DLMDKVNSLFNSNNGMLSFSTVVRSTAKSGESDHSDL  243



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score =   280 bits (715),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 176/242 (73%), Gaps = 4/242 (2%)
 Frame = -3

Query  2166  EGMLSFGSGMVKssggig---igdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRK  1996
             EGMLSF S                 SDHSDL+ASV +   SR V     AEKRPRKRGRK
Sbjct  462   EGMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASVREVESSRVVAPPPEAEKRPRKRGRK  521

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL+ KL 
Sbjct  522   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLT  581

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
             + ES  D L+ Q ++LKKE   + P H          P +   +++D K++G +AMIR+Q
Sbjct  582   SLESDKDTLQAQIEALKKERDARPPAHAAGLGGHDGGP-RCHAVEIDAKILGLEAMIRVQ  640

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             C K+NHP+ARLM AL++LDL+V HASVSV+ DLMIQQ AVKM +R+Y+QDQL  AL S+L
Sbjct  641   CHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRIYSQDQLNAALYSRL  700

Query  1455  AE  1450
             AE
Sbjct  701   AE  702


 Score =   236 bits (602),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 203/359 (57%), Gaps = 61/359 (17%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP--  3022
             NQ+TLQQRLQ +I+G+ ETWTYAIFWQ+S+    G SLLGWGDGYYKG +D  ++ RP  
Sbjct  58    NQDTLQQRLQAMIEGSSETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRKQRPLT  117

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAst-desvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              ++ AEQ HRK+VLRELNSLISG A+  DE+V+EEVTDTEWFFLVSMT SF+NGSGLPGQ
Sbjct  118   PAAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLPGQ  177

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +  P WI+    L S+PCERARQA  FGLRTMVC P   GV+ELGSTD++ Q+ + M
Sbjct  178   ALFAGQPTWIA--SGLSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFQTAESM  235

Query  2664  NKVRVLFNFNN------PDMGSISGSASWAAPPENDPSALWLTEPTSSSGVDVNTSVQEN  2503
              K+R LF          P           AA P+   + LWL +   +  +D+  S+   
Sbjct  236   AKIRSLFGGGAGGGSWPPVQPQAPSHQQPAAGPDQAETDLWLAD---APVMDIKDSMSHP  292

Query  2502  SIPSSSVK--------EIVFRNENSIPSSTGNNHHDSQPSQY------------------  2401
             S   S  K        +I F N     +ST     +  PS +                  
Sbjct  293   SAEISVSKPPPPPPPPQIHFEN-----ASTSTLTENPSPSVHAAPPQPAPAAAPQRQHQH  347

Query  2400  --------FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN  2251
                     F RELNFS+F          N      +    KPE+GEIL+FG +S  +RN
Sbjct  348   QNQAHQGPFRRELNFSDFA-------STNPSSLAATPPFFKPESGEILSFGADSNARRN  399



>gb|EPS60924.1| hypothetical protein M569_13876, partial [Genlisea aurea]
Length=539

 Score =   273 bits (698),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 229/331 (69%), Gaps = 26/331 (8%)
 Frame = -3

Query  2394  RELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGD  2215
             R+LNFS+F F+ +NN+    +     +  CK ++GEILNFG++  + +   +S      D
Sbjct  219   RDLNFSDFRFNSSNNSSTMTMMRNIGNSPCKHQSGEILNFGDNTAQMDNYFSSVVQADSD  278

Query  2214  Eskskkkt-atlkaSNEEGMLSFGSGMV---KssggigigdssDHSDLEASVVKEADSRA  2047
               ++KK+   +  +SNE G LSF S ++    S+        SDHSD+EASVVKEA+S  
Sbjct  279   AIRAKKRYPTSKGSSNEGGGLSFTSVVIAPSSSATLKADKVESDHSDMEASVVKEAESSR  338

Query  2046  VETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKAS  1867
                 A  E+RPRKRGRKPANGREEPLNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKAS
Sbjct  339   A---ALPERRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKAS  395

Query  1866  LLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD  1687
             LLGDAI+YINEL+++L+ SE  + DLK Q +SL          H  P P ++  P K  +
Sbjct  396   LLGDAISYINELRTQLQNSEMDMQDLKSQIESLNNH-------HHLPLPHESKRPRKCEE  448

Query  1686  -----------MDVDVKVMGW-DAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMN  1543
                        +D++VK++G  DAMIRIQC+KKNHPAA+LM A ++LDL++ HAS+SV N
Sbjct  449   GESFTATGEDAVDIEVKIIGRDDAMIRIQCSKKNHPAAKLMTAFRELDLDLHHASLSVAN  508

Query  1542  DLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             + MIQQA VKMG+R ++QDQLRLAL+SK+AE
Sbjct  509   EFMIQQATVKMGSRYFSQDQLRLALMSKIAE  539


 Score =   200 bits (509),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 140/194 (72%), Gaps = 10/194 (5%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAG---PSLLGWGDGYYKGEED-KGKRN  3028
             +QE LQ+RL +LIDGARE+WTYAIFWQ S  D      P +L WGDGYY+GE+    +R 
Sbjct  3     SQENLQKRLISLIDGARESWTYAIFWQNSAADGGCNFFPGVLSWGDGYYRGEDGGDNRRR  62

Query  3027  RPASSPAEQAHRKKVLRELNSLISG---PAstdesvdeevtdtEWFFLVSMTHSFINGSG  2857
             +  SSPAEQ  RK+VLREL+SL+SG    +S  ++V+E+VTD EWFFL+SMT +F  G G
Sbjct  63    KTTSSPAEQEQRKEVLRELSSLVSGGYPSSSAGDAVNEDVTDAEWFFLISMTQTFHGGIG  122

Query  2856  LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQS  2677
             +PGQA   S  +WI+G ++L  + C+RARQA + G+RTM  IP  NGVVE GST +I Q+
Sbjct  123   IPGQA---SGTVWITGPERLAEAGCDRARQALSHGIRTMAYIPVFNGVVEFGSTAVIFQN  179

Query  2676  FDLMNKVRVLFNFN  2635
              DL+ KV+ LFNF+
Sbjct  180   LDLVKKVKSLFNFD  193



>gb|KFK28472.1| hypothetical protein AALP_AA7G000700 [Arabis alpina]
Length=543

 Score =   273 bits (697),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 190/299 (64%), Gaps = 38/299 (13%)
 Frame = -3

Query  2319  SSHSCKPEAGEILNFGESVTKRNGNGNSCQFLGGDEskskkktatlkaSNEEGMLSFGSG  2140
             S +S   +  ++ N G SV     N N    +  DE    KK   L   NEEGMLSF   
Sbjct  274   SCNSDSDQVSKLCNGGSSVE----NPNRFVVVDDDEESKNKKKRCLVLDNEEGMLSF---  326

Query  2139  MVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHV  1960
                                  SVVKEA S     +   EK+PRKRGRKPANGREEPLNHV
Sbjct  327   --------------------TSVVKEAGSNR-NVVEPGEKKPRKRGRKPANGREEPLNHV  365

Query  1959  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQ  1780
             EAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDAI+YINELKS LE +ES  ++L+ Q
Sbjct  366   EAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAISYINELKSNLEKAESDKEELEKQ  425

Query  1779  AQSLKKELSTKEPRHPDPNPKKTTTPHKI--------PDMDVDVKVMGWDAMIRIQCTKK  1624
                ++KE+  K       N K +    K          +M++DVK++GWD M+RIQC+KK
Sbjct  426   IDEMRKEVKAK--AMASENGKCSVKDRKCLNQDSSVAIEMEIDVKIIGWDVMVRIQCSKK  483

Query  1623  NHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAET  1447
             NHP AR M ALK+LD+EV HAS+SVMNDLMIQQA VKMG + + QDQL++AL+ K+ E 
Sbjct  484   NHPGARFMEALKELDMEVNHASLSVMNDLMIQQATVKMGNQFFTQDQLKVALMEKVGEC  542


 Score =   207 bits (526),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 148/219 (68%), Gaps = 18/219 (8%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFA-------GPSLLGWGDGYYKGEEDKGKRNR  3025
             LQQ+LQ LI+GA + WTYA+FW +S  D           ++L WGDGYYKG E+   ++R
Sbjct  53    LQQKLQALIEGANQNWTYAVFWLSSHEDNNNNNNNNNASAMLCWGDGYYKGGEEY--KSR  110

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
               S+P EQ HRK+V+RELNSL+S         DEEVTDTEWFFLVSMT SFINGSGLP Q
Sbjct  111   KKSNPLEQEHRKRVIRELNSLLSSGFVVSSDEDEEVTDTEWFFLVSMTQSFINGSGLPSQ  170

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             AF +S+ IW+SG + L SS C RA Q Q +GL TMVC+P  NGVVELGS ++I  + DL+
Sbjct  171   AFSNSNTIWLSGSNALASSCCVRACQGQVYGLETMVCVPVMNGVVELGSWEIIEPNSDLV  230

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPPENDPSALWLTEP  2548
             +KV ++F       G  SGS ++    ENDPS LW+ EP
Sbjct  231   DKVNMVF-------GDESGSWTFDQ-GENDPS-LWINEP  260



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   271 bits (694),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 178/246 (72%), Gaps = 21/246 (9%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             EE MLSF S +          + S+ SDLEASVVKEA+S  +  +A  EK+PRKRGRKPA
Sbjct  354   EEEMLSFTSVL----PLPTKSNDSNRSDLEASVVKEAESGRI--VAETEKKPRKRGRKPA  407

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  408   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKA  467

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMD--------VDVKVMGWD  1654
             E+  ++L+ Q   + KE+        D N K      K  D D        +DVK++GWD
Sbjct  468   EADKEELQKQIDGMSKEVG-------DGNVKSLVKDQKCLDQDSGVSIEVEIDVKIIGWD  520

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC KKNHP A+ M ALK+L+LEV HAS+SV+N+ MIQQA VKMG + + QDQL+ 
Sbjct  521   AMIRIQCAKKNHPGAKFMEALKELELEVNHASLSVVNEFMIQQATVKMGNQFFTQDQLKA  580

Query  1473  ALISKL  1456
             AL+ ++
Sbjct  581   ALMERV  586


 Score =   223 bits (567),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 160/246 (65%), Gaps = 45/246 (18%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAG------PSLLGWGDGYYKGEEDKGKR  3031
             ++TLQQRLQ LI+GARE+WTYA+FWQ S  DFAG       +LL WGDGYYKGEE++  R
Sbjct  59    EDTLQQRLQALIEGARESWTYAVFWQLSH-DFAGEDISNTAALLTWGDGYYKGEEERKSR  117

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISGPAstd--------esvdeevtdtEWFFLVSMT  2881
              R  +  S AEQ HRK+V+RELNSLISG   T         E+ DE+V+DTEWFFLVSMT
Sbjct  118   KRKPNPVSAAEQEHRKRVIRELNSLISGGGGTVSSSGGSSDEAGDEDVSDTEWFFLVSMT  177

Query  2880  HSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELG  2701
              SF+NGSGLPG+AF SS  IW+SG + L  S CERARQ Q +GL TMVCIP+ NGVVELG
Sbjct  178   QSFVNGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVELG  237

Query  2700  STDLILQSFDLMNKV--------------RVLFNFN-NPDMGSISGSASWAAPPENDPSA  2566
             S ++I QS DL+ KV                 + FN NPD G            END SA
Sbjct  238   SLEIIHQSSDLVEKVNSFFSFNGGGGGGESGSWEFNLNPDQG------------END-SA  284

Query  2565  LWLTEP  2548
              W+ EP
Sbjct  285   TWINEP  290



>ref|XP_009776798.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=270

 Score =   259 bits (663),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 175/223 (78%), Gaps = 10/223 (4%)
 Frame = -3

Query  3189  ETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSP  3010
             E+LQQRLQTLI+GARE WTY IFWQ+ VVDFA P +L WG+GYY GEEDK K    + SP
Sbjct  49    ESLQQRLQTLIEGAREAWTYGIFWQSDVVDFASPLVLRWGNGYYIGEEDKNKCKTMSFSP  108

Query  3009  ---AEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
                AEQ HRKKV RE+NSLISG   +S ++ VDEEVTDTEWFFL+SM+ SF+NGSGLPG 
Sbjct  109   YFIAEQEHRKKVFREVNSLISGIQTSSENDVVDEEVTDTEWFFLISMSQSFVNGSGLPGL  168

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  SSSPIW++  ++L +S CERARQAQ +GL+TMVCIPS++GVVELGST+LI QS DLM
Sbjct  169   AMHSSSPIWVTESERLAASHCERARQAQGYGLQTMVCIPSTDGVVELGSTELISQSSDLM  228

Query  2664  NKVRVLFNFNNPDMGS----ISGSASWAAPPENDPSALWLTEP  2548
             +KV+VLFNFN  DMGS    +SGS    + PE D +AL LT+P
Sbjct  229   DKVKVLFNFNT-DMGSPMSLVSGSWGVQSEPEPDLTALRLTDP  270



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   270 bits (689),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 181/241 (75%), Gaps = 15/241 (6%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             +E MLSF S +V+S+      D   HSD+EASVVKEA       +   EK+PRKRGRKPA
Sbjct  334   DEEMLSF-STVVRSAAKSVDSD---HSDIEASVVKEA------IIVEPEKKPRKRGRKPA  383

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  384   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKTKLQQA  443

Query  1809  ESYIDDLKIQAQSLKKE-LSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQC  1633
             E+  ++++ Q   + KE   ++  +    N    ++     +M++DVK++GWD MIR+QC
Sbjct  444   ETDKEEVQKQLDRMSKEGGGSRRAKERKSNLDSASS----VEMEIDVKIIGWDVMIRVQC  499

Query  1632  TKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
              KKNHP AR M ALK+LDLEV HAS+S++NDLMIQQA VKMG++ +N DQL+ AL+ K+ 
Sbjct  500   GKKNHPGARFMEALKELDLEVNHASLSMVNDLMIQQATVKMGSQFFNHDQLKAALMLKVG  559

Query  1452  E  1450
             E
Sbjct  560   E  560


 Score =   214 bits (545),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 166/237 (70%), Gaps = 35/237 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQTLI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYY+GEEDK K+
Sbjct  63    NEDTLQQRLQTLIESAGERWTYAIFWQISH-DFDSPAGENTVILGWGDGYYRGEEDKEKK  121

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFING  2863
              + +S  +PAEQ HRK+V+RELNSLI+G     +DE+ DEEVTDTEWFFLVSMT SF+NG
Sbjct  122   KKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVNG  181

Query  2862  SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLIL  2683
              GLPG++F +S  IW+SG   L  S CERARQ + +GL+T+VCI + NGVVELGS+++I 
Sbjct  182   VGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVIS  241

Query  2682  QSFDLMNKVRVL-----------FNFN-NPDMGSISGSASWAAPPENDPSALWLTEP  2548
             QS DLM+KV  L           + FN NPD G            ENDP ALWL+EP
Sbjct  242   QSSDLMDKVNGLFNGNGGGEASSWGFNLNPDQG------------ENDP-ALWLSEP  285



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   269 bits (688),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 181/241 (75%), Gaps = 15/241 (6%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             +E MLSF S +V+S+      D   HSD+EASVVKEA       +   EK+PRKRGRKPA
Sbjct  335   DEEMLSF-STVVRSAAKSVDSD---HSDIEASVVKEA------IIVEPEKKPRKRGRKPA  384

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  385   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKTKLQQA  444

Query  1809  ESYIDDLKIQAQSLKKE-LSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQC  1633
             E+  ++++ Q   + KE   ++  +    N    ++     +M++DVK++GWD MIR+QC
Sbjct  445   ETDKEEVQKQLDRMSKEGGGSRRAKERKSNLDSASS----VEMEIDVKIIGWDVMIRVQC  500

Query  1632  TKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
              KKNHP AR M ALK+LDLEV HAS+S++NDLMIQQA VKMG++ +N DQL+ AL+ K+ 
Sbjct  501   GKKNHPGARFMEALKELDLEVNHASLSMVNDLMIQQATVKMGSQFFNHDQLKAALMLKVG  560

Query  1452  E  1450
             E
Sbjct  561   E  561


 Score =   214 bits (545),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 166/237 (70%), Gaps = 35/237 (15%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQTLI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYY+GEEDK K+
Sbjct  64    NEDTLQQRLQTLIESAGERWTYAIFWQISH-DFDSPAGENTVILGWGDGYYRGEEDKEKK  122

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISG--PAstdesvdeevtdtEWFFLVSMTHSFING  2863
              + +S  +PAEQ HRK+V+RELNSLI+G     +DE+ DEEVTDTEWFFLVSMT SF+NG
Sbjct  123   KKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVNG  182

Query  2862  SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLIL  2683
              GLPG++F +S  IW+SG   L  S CERARQ + +GL+T+VCI + NGVVELGS+++I 
Sbjct  183   VGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVIS  242

Query  2682  QSFDLMNKVRVL-----------FNFN-NPDMGSISGSASWAAPPENDPSALWLTEP  2548
             QS DLM+KV  L           + FN NPD G            ENDP ALWL+EP
Sbjct  243   QSSDLMDKVNGLFNGNGGGEASSWGFNLNPDQG------------ENDP-ALWLSEP  286



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   268 bits (684),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 175/240 (73%), Gaps = 28/240 (12%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             +E MLSF S +V+S+      D   HSD+EASVVKEA       +   EK+PRKRGRKPA
Sbjct  332   DEEMLSF-STVVRSAAKSVDSD---HSDIEASVVKEA------IIVEPEKKPRKRGRKPA  381

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  382   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKTKLQQA  441

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCT  1630
             E+  ++++ Q   + KE                       +M++DVK++GWD MIR+QC 
Sbjct  442   ETDKEEVQKQLDGMSKEGGGS------------------VEMEIDVKIIGWDVMIRVQCG  483

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             KKNHP AR M ALK+LDLEV HAS+SV+NDLMIQQA VKMG++ +N DQL+ AL+ K+ E
Sbjct  484   KKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKAALMLKVGE  543


 Score =   214 bits (546),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 167/236 (71%), Gaps = 34/236 (14%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPS-----LLGWGDGYYKGEEDKGKR  3031
             N++TLQQRLQTLI+ A E WTYAIFWQ S  DF  P+     +LGWGDGYY+GEEDK K+
Sbjct  62    NEDTLQQRLQTLIESAGERWTYAIFWQISH-DFDSPAGESTVILGWGDGYYRGEEDKEKK  120

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISGPA-stdesvdeevtdtEWFFLVSMTHSFINGS  2860
              + +S  +PAEQ HRK+V+RELNSLI+G A  +DE+ DEEVTDTEWFFLVSMT SF+NG 
Sbjct  121   KKQSSSSNPAEQEHRKRVIRELNSLIAGGAGVSDEANDEEVTDTEWFFLVSMTQSFVNGV  180

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPG++F +S  IW+SG   L  S CERARQ + +GL+T+VCI + NGVVELGS+++I Q
Sbjct  181   GLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVISQ  240

Query  2679  SFDLMNKVRVL-----------FNFN-NPDMGSISGSASWAAPPENDPSALWLTEP  2548
             S DLM+KV  L           + FN NPD G            ENDPS LWL+EP
Sbjct  241   SSDLMDKVNGLFNGNGGGEASSWGFNLNPDQG------------ENDPS-LWLSEP  283



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score =   268 bits (684),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 178/246 (72%), Gaps = 21/246 (9%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             EE MLSF S +          + S+ SDLEASVVKEA+S  +  +A  EK+PRKRGRKPA
Sbjct  354   EEEMLSFTSVL----PLPTKSNDSNRSDLEASVVKEAESGRI--VAEPEKKPRKRGRKPA  407

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  408   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKA  467

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMD--------VDVKVMGWD  1654
             E+  ++L+ Q   + KE+        D N K +    K  D D        +DVK++GWD
Sbjct  468   EADKEELQKQIGGMSKEVG-------DGNVKSSVKDQKCLDQDSGVSIEVEIDVKIIGWD  520

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC K NHP A+ M ALK+L+LEV HAS+SV+N+ MIQQA VKMG + + QDQL+ 
Sbjct  521   AMIRIQCGKNNHPGAKFMEALKELELEVNHASLSVVNEFMIQQATVKMGNQFFTQDQLKA  580

Query  1473  ALISKL  1456
             AL+ ++
Sbjct  581   ALMERV  586


 Score =   223 bits (568),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 160/246 (65%), Gaps = 45/246 (18%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAG------PSLLGWGDGYYKGEEDKGKR  3031
             ++TLQQRLQ LI+GARE+WTYA+FWQ S  DFAG       +LL WGDGYYKGEE++  R
Sbjct  59    EDTLQQRLQALIEGARESWTYAVFWQLSH-DFAGEDISNTAALLSWGDGYYKGEEERKSR  117

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISGPAstd--------esvdeevtdtEWFFLVSMT  2881
              R  +  S AEQ HRK+V+RELNSLISG   T         E+ DE+V+DTEWFFLVSMT
Sbjct  118   KRKPNPVSAAEQEHRKRVIRELNSLISGGGGTVSSSGGSSDEAGDEDVSDTEWFFLVSMT  177

Query  2880  HSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELG  2701
              SF+NGSGLPG+AF SS  IW+SG + L  S CERARQ Q +GL TMVCIP+ NGVVELG
Sbjct  178   QSFVNGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVELG  237

Query  2700  STDLILQSFDLMNKV--------------RVLFNFN-NPDMGSISGSASWAAPPENDPSA  2566
             S ++I QS DL+ KV                 + FN NPD G            ENDP A
Sbjct  238   SLEIIHQSSDLVEKVNSFFSFNGGGGGGESGSWEFNLNPDQG------------ENDP-A  284

Query  2565  LWLTEP  2548
              W+ EP
Sbjct  285   TWINEP  290



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score =   266 bits (681),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 178/246 (72%), Gaps = 21/246 (9%)
 Frame = -3

Query  2169  EEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPA  1990
             EE MLSF S +          + S+ SDLEASVVKEA+S  +   A  EK+PRKRGRKPA
Sbjct  347   EEEMLSFTSVL----PLPTKSNDSNRSDLEASVVKEAESGRI--AAEPEKKPRKRGRKPA  400

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             NGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAI+YINELK+KL+ +
Sbjct  401   NGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKA  460

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMD--------VDVKVMGWD  1654
             E+  ++L+ Q   + KE+        D N K +    K  + D        +DVK++GWD
Sbjct  461   EADKEELQKQIDGMSKEVG-------DGNVKSSVKDQKCLEQDSGVSVEVEIDVKIIGWD  513

Query  1653  AMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRL  1474
             AMIRIQC KK+HP A+ M ALK+L+LEV HAS+SV+N+ MIQQA VKMG + + QDQL+ 
Sbjct  514   AMIRIQCGKKDHPGAKFMEALKELELEVNHASLSVVNEFMIQQATVKMGNQFFTQDQLKA  573

Query  1473  ALISKL  1456
             AL+ ++
Sbjct  574   ALMERV  579


 Score =   225 bits (574),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 158/239 (66%), Gaps = 38/239 (16%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAG------PSLLGWGDGYYKGEEDKGKR  3031
             ++TLQQRLQ LI+GARE+WTYA+FWQ S  DFAG       +LL WGDGYYKGEE++  R
Sbjct  59    EDTLQQRLQALIEGARESWTYAVFWQLSH-DFAGEDISNTAALLSWGDGYYKGEEERKSR  117

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISGPAstdesv-deevtdtEWFFLVSMTHSFINGS  2860
              R  +  S AEQ HRK+V+RELNSLISG      +  DE+V+DTEWFFLVSMT SF NGS
Sbjct  118   KRKPNPVSAAEQEHRKRVIRELNSLISGGGGGGGTAGDEDVSDTEWFFLVSMTQSFANGS  177

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             GLPG+AF SS  IW+SG + L  S CERARQ Q +GL TMVCIP+ NGVVELGS ++I Q
Sbjct  178   GLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVELGSLEIIHQ  237

Query  2679  SFDLMNKV--------------RVLFNFN-NPDMGSISGSASWAAPPENDPSALWLTEP  2548
             S +L++KV                 + FN NPD G            ENDP A W+ EP
Sbjct  238   SSELVDKVNSFFSFNGGGGGGESGSWAFNLNPDQG------------ENDP-ATWINEP  283



>emb|CCQ71910.1| transcription factor MYC2, partial [Brassica napus]
Length=320

 Score =   255 bits (651),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 212/372 (57%), Gaps = 71/372 (19%)
 Frame = -3

Query  2895  LVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNG  2716
             LVSMT SF  GSGL G+A  + + +W+ G D+L  S CERA+Q   FG++T+ CIPS+NG
Sbjct  1     LVSMTQSFACGSGLAGKALSTGNVVWVYGSDQLSGSGCERAKQGGVFGMQTIACIPSANG  60

Query  2715  VVELGSTDLILQSFDLMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPT  2545
             VVELGST+ I  S DLM+KVRVLFNF+    G + G  +W   P   ENDPS +W+ +P 
Sbjct  61    VVELGSTEQIPPSSDLMSKVRVLFNFDV-GAGDLPG-LNWNLDPTQGENDPS-IWINDP-  116

Query  2544  SSSGVDVNTSVQENSIPSSS----VKEIVFRNENSIPSSTGNNHHDSQPSQY--------  2401
                   +      N  PSS      K I F N  S  +  GN + DS PS          
Sbjct  117   ------IGAPEPGNGAPSSFSKLFAKSIQFENGGSSSTIIGNPNPDSAPSPVHSQTQNPK  170

Query  2400  ----FTRELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFGESVTKRNGNGNSC  2233
                 F+ ELNFS                  +S+   KP   EIL+FG    + + N +  
Sbjct  171   FSNNFSPELNFS-----------------TSSTTLVKPRPREILSFGNEDKRSSMNPDPS  213

Query  2232  QFLGGDEskskkktatlkaSNEEGMLSFGSGMVKssggigigdssDHSDLEASVVKEADS  2053
                G  + ++  K        ++ +LSFG+G          G  SDHSDLEA +VKE   
Sbjct  214   SNSGQTQLENNTKKFI-----DDKVLSFGTG----------GGESDHSDLEAFIVKEI--  256

Query  2052  RAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  1873
                      EKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK
Sbjct  257   --------PEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  308

Query  1872  ASLLGDAIAYIN  1837
             ASLLGDAIAYIN
Sbjct  309   ASLLGDAIAYIN  320



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score =   260 bits (665),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 177/245 (72%), Gaps = 20/245 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGK-RNRP  3022
             +QETLQQRLQ LI+GARE+WTY IFWQ SV    G   LGWGDGYYKG EEDK K R   
Sbjct  58    SQETLQQRLQALIEGARESWTYGIFWQTSVDGATGAYFLGWGDGYYKGCEEDKRKQRVAN  117

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstd--esvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
             A S  EQ HR++VLREL+SLISG  S+   E+VDEEVTDTEWFFLVSMT SF+NG G PG
Sbjct  118   AVSAVEQEHRRRVLRELHSLISGGGSSAPDETVDEEVTDTEWFFLVSMTQSFVNGGGFPG  177

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QA  + +P+W++G D+L S+PCERARQAQ FGL+TMVC+P  +GV+ELGSTD++  S ++
Sbjct  178   QALFAGAPVWVAGADRLASAPCERARQAQLFGLQTMVCVPVGSGVLELGSTDVVSHSHEI  237

Query  2667  MNKVRVLFNFNNPDMGSISGSA--SWAAPP-----------ENDPSALWLTEPTSSSGVD  2527
             M K+RVLF F++PD+ S S +A  SW  P            E DPS LWLT+P   S V+
Sbjct  238   MGKIRVLFLFSSPDLPSSSTAAAVSWITPQPAAATPATDQGETDPSVLWLTDP---SAVE  294

Query  2526  VNTSV  2512
             +  SV
Sbjct  295   IKDSV  299


 Score =   251 bits (641),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 168/215 (78%), Gaps = 8/215 (4%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
              SDLEAS  +   +R VE     EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  459   QSDLEASAREVESNRVVE----PEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  514

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRAVVPNVSKMDKASLLGDA++YINEL+S L+T E+  ++L+ + ++L+K+L  + P  
Sbjct  515   ALRAVVPNVSKMDKASLLGDAVSYINELRSNLQTLEADKEELRDRVEALEKKLPVQPP--  572

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
             PD N  +TTT  +   ++++VK++G +AMIR+QC K+NHPAA LM ALKDLDLE+ +ASV
Sbjct  573   PDHN-LRTTTNGRCHGVEMEVKILGSEAMIRLQCQKRNHPAASLMAALKDLDLELHYASV  631

Query  1554  SVMNDLMIQQAAVKMGT-RLYNQDQLRLALISKLA  1453
             SV+ DLMIQQ  VKM   R+  Q+QL  +L S++A
Sbjct  632   SVVKDLMIQQVTVKMSPGRVMTQEQLCASLYSRVA  666



>gb|EPS71023.1| hypothetical protein M569_03732, partial [Genlisea aurea]
Length=549

 Score =   255 bits (651),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 169/221 (76%), Gaps = 11/221 (5%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EASV K+A S  V      +KRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  332   HSDIEASVAKDAGSSKV---VDPQKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  388

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRAVVP VSKMDK+SLLGDAI+YINELKSKL+ SE  +++++ Q +SLKK+   KE   
Sbjct  389   ALRAVVPTVSKMDKSSLLGDAISYINELKSKLQNSELDMEEMRAQLESLKKKKKKKEEEE  448

Query  1734  ---PDPNPKKTTTPHKIP-----DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLD  1579
                P  N  K + P +         D++VK++G DAMIRIQC++KNHPAA+LM A K+LD
Sbjct  449   EGLPPHNETKYSAPSENKYGGGGATDIEVKIIGSDAMIRIQCSRKNHPAAKLMAAFKELD  508

Query  1578  LEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             L++ HAS+SVMN+ MIQ+A VKMG   ++QDQLR  L+SK+
Sbjct  509   LDLHHASISVMNESMIQRATVKMGATSFSQDQLRTTLMSKI  549


 Score =   218 bits (556),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 143/207 (69%), Gaps = 23/207 (11%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPAS  3016
             +QE LQQRL  LI+GA E++TYAIFWQ S   F  PS L WGDGYYKGEE++G R +  S
Sbjct  39    SQENLQQRLIALIEGAGESFTYAIFWQDSATGFGVPSFLSWGDGYYKGEENRGNR-KTTS  97

Query  3015  SPAEQAHRKKVLRELNSLISG-PAstdesv--deevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             SP+EQ HRKKVLRELNSL+SG PA +      +E+VTDTEWFFL+SMTH F +GSG+PGQ
Sbjct  98    SPSEQEHRKKVLRELNSLVSGTPAHSSLDEFVEEDVTDTEWFFLISMTHIFESGSGIPGQ  157

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  +S+P                   A  +GL+T+VCIPSSNGVVELGST +I QS DL+
Sbjct  158   ALYTSTP-------------------ALGYGLQTLVCIPSSNGVVELGSTAVIFQSLDLV  198

Query  2664  NKVRVLFNFNNPDMGSISGSASWAAPP  2584
              KV  LFNFN  D  S SG+ SW  PP
Sbjct  199   KKVVSLFNFNGLDAASFSGTGSWGTPP  225



>ref|XP_003612908.1| Transcription factor MYC2 [Medicago truncatula]
 gb|AES95866.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=236

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 3/190 (2%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP-A  3019
             NQ+TLQQRLQ LI+G +E WTYAIFWQ S  D++G SLLGWGDGYYKGEEDK K  +   
Sbjct  24    NQDTLQQRLQALIEGVKEIWTYAIFWQPSY-DYSGSSLLGWGDGYYKGEEDKTKVKKSIV  82

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             +SPAEQ HR+KVLREL SLISG P + +  VDEEVTD EWFFLVSMT SF+N  GLPGQA
Sbjct  83    TSPAEQEHRRKVLRELYSLISGNPVTEESPVDEEVTDMEWFFLVSMTQSFVNDGGLPGQA  142

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             + +S+P+W+ G + L+ S CERARQ Q  GL T+VC+PS+NGV+ELGST+LI Q+ D M+
Sbjct  143   YFNSTPVWLVGGENLVLSHCERARQGQEHGLETLVCVPSANGVLELGSTELIYQNNDFMD  202

Query  2661  KVRVLFNFNN  2632
             KV++L +FNN
Sbjct  203   KVKMLLDFNN  212



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score =   242 bits (617),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 161/228 (71%), Gaps = 20/228 (9%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+  KE +       A  EK+PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  78    HSDVEAASFKEMEE------AVVEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  131

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRAVVPNVSKMDKASLLGDA++YINEL+SK++  E+   +L+   ++ KKEL +     
Sbjct  132   ALRAVVPNVSKMDKASLLGDAVSYINELRSKVQELETERKELESHVEATKKELLSSHSGF  191

Query  1734  PDPN---PKKTTTPHKIPD-----------MDVDVKVMGWDAMIRIQCTKKNHPAARLMV  1597
                N    K  ++  ++PD           +D+DV+V+G +AM+RIQ  KKNHPAARLM 
Sbjct  192   SGANFGFAKDLSSSSRVPDSKGFGTKQCPGLDLDVRVLGAEAMVRIQSGKKNHPAARLMT  251

Query  1596  ALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             A ++L+LEV HASVS +N+LM+Q   V++   LY ++QL  AL  KL+
Sbjct  252   AFQELELEVHHASVSTVNELMLQNVIVRLPKSLYTEEQLSAALFKKLS  299



>gb|KEH27718.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=258

 Score =   239 bits (611),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 3/190 (2%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRP-A  3019
             NQ+TLQQRLQ LI+G +E WTYAIFWQ S  D++G SLLGWGDGYYKGEEDK K  +   
Sbjct  24    NQDTLQQRLQALIEGVKEIWTYAIFWQPSY-DYSGSSLLGWGDGYYKGEEDKTKVKKSIV  82

Query  3018  SSPAEQAHRKKVLRELNSLISG-PAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             +SPAEQ HR+KVLREL SLISG P + +  VDEEVTD EWFFLVSMT SF+N  GLPGQA
Sbjct  83    TSPAEQEHRRKVLRELYSLISGNPVTEESPVDEEVTDMEWFFLVSMTQSFVNDGGLPGQA  142

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
             + +S+P+W+ G + L+ S CERARQ Q  GL T+VC+PS+NGV+ELGST+LI Q+ D M+
Sbjct  143   YFNSTPVWLVGGENLVLSHCERARQGQEHGLETLVCVPSANGVLELGSTELIYQNNDFMD  202

Query  2661  KVRVLFNFNN  2632
             KV++L +FNN
Sbjct  203   KVKMLLDFNN  212



>ref|XP_009408104.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   249 bits (636),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 162/216 (75%), Gaps = 6/216 (3%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSDLEAS  +E  S AV  +   EKRP+KRGRKPANGREEPL+HVEAERQRREKLNQRFY
Sbjct  392   HSDLEASA-REVTSSAV--MEPPEKRPKKRGRKPANGREEPLDHVEAERQRREKLNQRFY  448

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALR+VVPNVSKMDKASLL DA+ YINEL+SK++  ES    L+ +   LK E  +   R 
Sbjct  449   ALRSVVPNVSKMDKASLLADAVTYINELRSKMQALESDKRKLQSELGVLKMERESGSGRQ  508

Query  1734  ---PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTH  1564
                  P P  +  P +  +++V+VK++GW+AMIR+QC ++ HP+ARLM+AL++LDLEV +
Sbjct  509   MPPAGPRPAASNWPGRCSEVEVEVKILGWEAMIRVQCDRRCHPSARLMIALRELDLEVYY  568

Query  1563  ASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             A+VSV+ DLMIQQ  VKM +R+Y Q+QL  AL S +
Sbjct  569   ANVSVVKDLMIQQVTVKMTSRIYTQEQLTAALFSSV  604


 Score =   224 bits (570),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 15/226 (7%)
 Frame = -3

Query  3189  ETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGKRNRP-AS  3016
             +TLQQRL +LI+GARE WTYAIFWQ+S    +G ++L WGDGYY+G EEDK K  R  AS
Sbjct  77    DTLQQRLHSLIEGAREKWTYAIFWQSSPP--SGAAVLTWGDGYYRGCEEDKRKPLRSGAS  134

Query  3015  SPAEQAHRKKVLRELNSLI-SGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             S AEQ HRK VLRELN+LI  G    D++ DEEVTDTEWFFLVSMT +F  G+G PGQAF
Sbjct  135   SAAEQEHRKHVLRELNALIYGGCGGGDDAADEEVTDTEWFFLVSMTQTFAPGAGHPGQAF  194

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              S SP WI+G D++ ++PCER RQAQ FGLRTM C+P  +GVVELGST  I QS ++++K
Sbjct  195   LSGSPAWIAGADRMAAAPCERVRQAQAFGLRTMACVPLESGVVELGSTHDIFQSSEILSK  254

Query  2658  VRVLFNFNNPDMGSISGSASWAAPPEN-------DPSALWLTEPTS  2542
             VR+LF   +   G    +ASW  P          DP  LW++EP++
Sbjct  255   VRLLFGQGS---GRRPAAASWPTPQPAVAEQGLLDPCMLWMSEPSA  297



>ref|XP_006662628.1| PREDICTED: transcription factor MYC2-like [Oryza brachyantha]
Length=481

 Score =   244 bits (623),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 217/349 (62%), Gaps = 57/349 (16%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASV-VDFAGPSLLGWGDGYYKG-EEDKGK-RNR  3025
             NQ+TLQQRLQ++I+G+R+TWTYAIFWQ+S+ V   G SLLGWGDGYYKG +EDK K R+ 
Sbjct  59    NQDTLQQRLQSIIEGSRDTWTYAIFWQSSLDVVPPGASLLGWGDGYYKGCDEDKRKQRSA  118

Query  3024  PASSPAEQAHRKKVLRELNSLISGP-AstdesvdeevtdtEWFFLVSMTHSFINGSGLPG  2848
               ++ AEQ HRK+VLRELNSLI+G  A+ DE+V+EEVTDTEWFFLVSMT SF NG GLPG
Sbjct  119   TPAAAAEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFHNGMGLPG  178

Query  2847  QAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDL  2668
             QAF +S P WI+    L ++PCERARQA TFGLRTMVC+P ++GV+ELGSTD+I Q+ D 
Sbjct  179   QAFFASQPTWIA--TGLSTAPCERARQAYTFGLRTMVCLPLASGVLELGSTDVIFQTGDS  236

Query  2667  MNKVRVLFNFNNPDMGSISGSASW---AAPPENDPSALWLTEPTSSSGVDVNTSVQENSI  2497
             + ++R LFN        +SG +SW      P+ DPS LWL + T +  +  + S  E S+
Sbjct  237   LPRIRALFN--------LSGGSSWPPQPPQPDADPSVLWLAD-TPAMDMKDSISAAEISV  287

Query  2496  PSSSVKEIVFRNENSIPSSTGNNHHDSQPSQY--------------------------FT  2395
                       ++  +  +ST     +  PS +                          F 
Sbjct  288   SKPPPPPQQIQHFENGSTSTLTVTENPSPSVHAPPPQQSVAQPQQRQQQQNSQAQQGPFR  347

Query  2394  RELNFSEFGFDGAnnnhnndlrngNSSHSCKPEAGEILNFG-ESVTKRN  2251
             RELNFS+F  +GA                 KPE+GEILNFG +S ++RN
Sbjct  348   RELNFSDFASNGAPPPFF------------KPESGEILNFGPDSASRRN  384


 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = -3

Query  1740  RHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHA  1561
             R+P P P   T  H +   +++ K++G +AMIR+QC K+NHPAARLM AL++LDL+V HA
Sbjct  383   RNPSPAPPAATC-HAV---EIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYHA  438

Query  1560  SVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             SVSV+ DLMIQQ AVKM +R+Y+Q+QL  AL S++AE
Sbjct  439   SVSVVKDLMIQQVAVKMASRVYSQEQLNAALYSRIAE  475



>ref|XP_006601141.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=293

 Score =   235 bits (599),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRP-ASSP  3010
             LQ+RLQTL++GARE+WTYAIFW++S  +F+G +LL WGDGYY+GEE DK K   P  ++ 
Sbjct  38    LQRRLQTLLEGARESWTYAIFWESSHDNFSGATLLRWGDGYYQGEEEDKAKGKAPKTTTS  97

Query  3009  AEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCSS  2830
             AEQA RKKVL ELNSLISGP+ + + VDEEVTDT WFFL+SMT SF NG+ LPGQAF +S
Sbjct  98    AEQARRKKVLLELNSLISGPSVSADDVDEEVTDTVWFFLLSMTQSFANGTTLPGQAFFNS  157

Query  2829  SPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRV  2650
             +P+W++G D+L    CERARQ + +GLRT+VCIPS+NGVVEL ST++I Q+ DLMNKV  
Sbjct  158   TPVWVAGSDRLSELACERARQGRMYGLRTLVCIPSANGVVELASTEVIFQNPDLMNKVLD  217

Query  2649  LFNFNNPD  2626
             LFNFN  D
Sbjct  218   LFNFNAVD  225



>gb|AEB35606.1| MYC2 [Helianthus annuus]
 gb|AEB35607.1| MYC2 [Helianthus annuus]
 gb|AEB35695.1| MYC2 [Helianthus annuus]
 gb|AEB35696.1| MYC2 [Helianthus annuus]
Length=155

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E+  D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEANKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35601.1| MYC2 [Helianthus argophyllus]
Length=155

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSXQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35568.1| MYC2 [Helianthus petiolaris]
 gb|AEB35569.1| MYC2 [Helianthus petiolaris]
Length=155

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     + N    T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENINLSSITARGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>ref|XP_009114324.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=507

 Score =   235 bits (600),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 157/213 (74%), Gaps = 17/213 (8%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+VV               K+ +KRGRK ANGR+EPLNHV+AER RREKLNQRFY
Sbjct  311   HSDIEATVV------------PGNKQKKKRGRKLANGRKEPLNHVQAERLRREKLNQRFY  358

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDKASLLGDAI+YI ELKS+ E +ES  + ++IQ   LK+E++ +    
Sbjct  359   ALRATVPNVSKMDKASLLGDAISYIKELKSRAENAESERNAIQIQLNKLKEEMAGR----  414

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
              +   +      +I   ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  415   -NVVCRGGENASEIETANIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  473

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R+Y QDQLR  L+SK+
Sbjct  474   SVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  506


 Score =   176 bits (447),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 155/260 (60%), Gaps = 14/260 (5%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRPASSPA  3007
             LQ+RLQ +++G  E WTYAIFW  S  D++G S+L WGDG YKGEE D  +R R   + A
Sbjct  39    LQKRLQAVLNGTHEAWTYAIFWTPSYYDYSGESVLKWGDGIYKGEEADNTRRRRRRMTVA  98

Query  3006  EQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCS  2833
             E+ H   +L EL+S+IS       D     EV+DTEWF++VSMT SF + +GLPG+AF +
Sbjct  99    EREHWSIILPELSSMISDEDVPVIDGEGGVEVSDTEWFYMVSMTVSFGSETGLPGKAFAT  158

Query  2832  SSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVR  2653
               P+W++G D +L+S C+RA++    GL+T+VCIP  NGV+ELGST  I Q+ DL NK+R
Sbjct  159   YKPVWVTGSDPILASGCDRAKKGGDSGLQTIVCIPLDNGVLELGSTVEIQQNPDLFNKIR  218

Query  2652  VLFNFNNPDMGSISGSASWAAPPEND---PSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
             V+F+F         GS  +   P ++   P +  L     S+ V VN ++  N +   +V
Sbjct  219   VVFSF--------EGSRDFLGDPNSNSFQPFSTHLENGGGSTTVTVNANLYPNPVYPQTV  270

Query  2481  KEIVFRNENSIPSSTGNNHH  2422
                    E ++ S   N  H
Sbjct  271   NYATSPLERALHSPNRNYPH  290



>gb|AEB35597.1| MYC2 [Helianthus argophyllus]
 gb|AEB35598.1| MYC2 [Helianthus argophyllus]
 gb|AEB35599.1| MYC2 [Helianthus argophyllus]
 gb|AEB35600.1| MYC2 [Helianthus argophyllus]
 gb|AEB35602.1| MYC2 [Helianthus argophyllus]
 gb|AEB35603.1| MYC2 [Helianthus argophyllus]
 gb|AEB35608.1| MYC2 [Helianthus annuus]
 gb|AEB35609.1| MYC2 [Helianthus annuus]
 gb|AEB35610.1| MYC2 [Helianthus annuus]
 gb|AEB35611.1| MYC2 [Helianthus annuus]
 gb|AEB35612.1| MYC2 [Helianthus annuus]
 gb|AEB35613.1| MYC2 [Helianthus annuus]
 gb|AEB35614.1| MYC2 [Helianthus annuus]
 gb|AEB35615.1| MYC2 [Helianthus annuus]
 gb|AEB35616.1| MYC2 [Helianthus annuus]
 gb|AEB35617.1| MYC2 [Helianthus annuus]
 gb|AEB35618.1| MYC2 [Helianthus annuus]
 gb|AEB35619.1| MYC2 [Helianthus annuus]
 gb|AEB35620.1| MYC2 [Helianthus annuus]
 gb|AEB35621.1| MYC2 [Helianthus annuus]
 gb|AEB35622.1| MYC2 [Helianthus annuus]
 gb|AEB35623.1| MYC2 [Helianthus annuus]
 gb|AEB35624.1| MYC2 [Helianthus annuus]
 gb|AEB35625.1| MYC2 [Helianthus annuus]
 gb|AEB35626.1| MYC2 [Helianthus annuus]
 gb|AEB35627.1| MYC2 [Helianthus annuus]
 gb|AEB35628.1| MYC2 [Helianthus annuus]
 gb|AEB35629.1| MYC2 [Helianthus annuus]
 gb|AEB35630.1| MYC2 [Helianthus annuus]
 gb|AEB35631.1| MYC2 [Helianthus annuus]
 gb|AEB35632.1| MYC2 [Helianthus annuus]
 gb|AEB35633.1| MYC2 [Helianthus annuus]
 gb|AEB35634.1| MYC2 [Helianthus annuus]
 gb|AEB35635.1| MYC2 [Helianthus annuus]
 gb|AEB35636.1| MYC2 [Helianthus annuus]
 gb|AEB35637.1| MYC2 [Helianthus annuus]
 gb|AEB35638.1| MYC2 [Helianthus annuus]
 gb|AEB35639.1| MYC2 [Helianthus annuus]
 gb|AEB35641.1| MYC2 [Helianthus annuus]
 gb|AEB35642.1| MYC2 [Helianthus annuus]
 gb|AEB35643.1| MYC2 [Helianthus annuus]
 gb|AEB35644.1| MYC2 [Helianthus annuus]
 gb|AEB35645.1| MYC2 [Helianthus annuus]
 gb|AEB35646.1| MYC2 [Helianthus annuus]
 gb|AEB35647.1| MYC2 [Helianthus annuus]
 gb|AEB35648.1| MYC2 [Helianthus annuus]
 gb|AEB35650.1| MYC2 [Helianthus annuus]
 gb|AEB35651.1| MYC2 [Helianthus annuus]
 gb|AEB35652.1| MYC2 [Helianthus annuus]
 gb|AEB35653.1| MYC2 [Helianthus annuus]
 gb|AEB35665.1| MYC2 [Helianthus annuus]
 gb|AEB35666.1| MYC2 [Helianthus annuus]
 gb|AEB35667.1| MYC2 [Helianthus annuus]
 gb|AEB35668.1| MYC2 [Helianthus annuus]
 gb|AEB35669.1| MYC2 [Helianthus annuus]
 gb|AEB35670.1| MYC2 [Helianthus annuus]
 gb|AEB35672.1| MYC2 [Helianthus annuus]
 gb|AEB35673.1| MYC2 [Helianthus annuus]
 gb|AEB35680.1| MYC2 [Helianthus annuus]
 gb|AEB35683.1| MYC2 [Helianthus annuus]
 gb|AEB35684.1| MYC2 [Helianthus annuus]
 gb|AEB35686.1| MYC2 [Helianthus annuus]
 gb|AEB35687.1| MYC2 [Helianthus annuus]
 gb|AEB35688.1| MYC2 [Helianthus annuus]
 gb|AEB35690.1| MYC2 [Helianthus annuus]
 gb|AEB35691.1| MYC2 [Helianthus annuus]
 gb|AEB35697.1| MYC2 [Helianthus annuus]
 gb|AEB35698.1| MYC2 [Helianthus annuus]
 gb|AEB35700.1| MYC2 [Helianthus annuus]
 gb|AEB35701.1| MYC2 [Helianthus annuus]
Length=155

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35671.1| MYC2 [Helianthus annuus]
Length=155

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEXNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>emb|CDY35183.1| BnaA09g18200D [Brassica napus]
Length=507

 Score =   235 bits (600),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 157/213 (74%), Gaps = 17/213 (8%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+VV               K+ +KRGRK ANGR+EPLNHV+AER RREKLNQRFY
Sbjct  311   HSDIEATVV------------PGNKQKKKRGRKLANGRKEPLNHVQAERLRREKLNQRFY  358

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDKASLLGDAI+YI ELKS+ E +ES  + ++IQ   LK+E++ +    
Sbjct  359   ALRATVPNVSKMDKASLLGDAISYIKELKSRAENAESERNAIQIQLNKLKEEMAGR----  414

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
              +   +      +I   ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  415   -NVVCRGGENASEIETANIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  473

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R+Y QDQLR  L+SK+
Sbjct  474   SVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  506


 Score =   187 bits (474),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 159/260 (61%), Gaps = 14/260 (5%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRPASSPA  3007
             LQ+RLQ +++G  E WTYAIFW  S  D++G S+L WGDG YKGEE D  +R R   + A
Sbjct  39    LQKRLQAVLNGTHEAWTYAIFWTPSYYDYSGESVLKWGDGIYKGEEADNTRRKRRRMTVA  98

Query  3006  EQAHRKKVLRELNSLIS--GPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCS  2833
             E+ H   +L EL+S+IS    +  +   D EV+DTEWF++VSMT SF + +GLPG+AF +
Sbjct  99    EREHWSIILPELSSMISDENVSVIEGEDDVEVSDTEWFYMVSMTVSFGSETGLPGKAFAT  158

Query  2832  SSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVR  2653
               P+W++G D +L+S C+RA++    GL+T+VCIP  NGV+ELGST  I Q+ DL NK+R
Sbjct  159   YKPVWVTGSDHILASGCDRAKKGGDSGLQTIVCIPLDNGVLELGSTVEIQQNPDLFNKIR  218

Query  2652  VLFNFNNPDMGSISGSASWAAPPEND---PSALWLTEPTSSSGVDVNTSVQENSIPSSSV  2482
             V+F+F         GS  ++  P ++   P +  L     SS V VN ++  N +   +V
Sbjct  219   VVFSF--------EGSRDFSGDPNSNSFQPFSTHLENGGGSSTVTVNANLYPNPVYPQTV  270

Query  2481  KEIVFRNENSIPSSTGNNHH  2422
                +   E ++ S   N  H
Sbjct  271   NYAISPLERALHSPNRNYPH  290



>gb|AEB35692.1| MYC2 [Helianthus annuus]
Length=155

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKXSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35565.1| MYC2 [Helianthus petiolaris]
 gb|AEB35584.1| MYC2 [Helianthus tuberosus]
 gb|AEB35585.1| MYC2 [Helianthus tuberosus]
 gb|AEB35586.1| MYC2 [Helianthus tuberosus]
 gb|AEB35588.1| MYC2 [Helianthus tuberosus]
 gb|AEB35589.1| MYC2 [Helianthus tuberosus]
 gb|AEB35590.1| MYC2 [Helianthus tuberosus]
 gb|AEB35591.1| MYC2 [Helianthus tuberosus]
 gb|AEB35593.1| MYC2 [Helianthus tuberosus]
 gb|AEB35594.1| MYC2 [Helianthus tuberosus]
 gb|AEB35679.1| MYC2 [Helianthus annuus]
 gb|AEB35685.1| MYC2 [Helianthus annuus]
Length=155

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35567.1| MYC2 [Helianthus petiolaris]
 gb|AEB35689.1| MYC2 [Helianthus annuus]
 gb|AEB35705.1| MYC2 [Helianthus annuus]
Length=155

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35595.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE  E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENXEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35580.1| MYC2 [Helianthus exilis]
 gb|AEB35581.1| MYC2 [Helianthus exilis]
 gb|AEB35582.1| MYC2 [Helianthus exilis]
 gb|AEB35583.1| MYC2 [Helianthus exilis]
Length=155

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSVQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35674.1| MYC2 [Helianthus annuus]
 gb|AEB35675.1| MYC2 [Helianthus annuus]
Length=155

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMSAMMELDLEVHHASVSVVNEL  155



>gb|AEB35658.1| MYC2 [Helianthus annuus]
 gb|AEB35659.1| MYC2 [Helianthus annuus]
 gb|AEB35663.1| MYC2 [Helianthus annuus]
 gb|AEB35664.1| MYC2 [Helianthus annuus]
Length=155

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM ++ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTSMMELDLEVHHASVSVVNEL  155



>gb|AEB35575.1| MYC2 [Helianthus exilis]
 gb|AEB35576.1| MYC2 [Helianthus exilis]
Length=155

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSVQENMKMSCITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35656.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (564),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E+  D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEANKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC K +HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKMSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35694.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEA+RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEADRQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35703.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC K +HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35706.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSXQENMKMSSVTXRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35571.1| MYC2 [Helianthus paradoxus]
 gb|AEB35572.1| MYC2 [Helianthus paradoxus]
Length=156

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTT-PHKIPDMDVDVKVMGWDAMI  1645
             LE +E   D+L+ Q  +LKKELS K     +     TT  P    D+DVDVKV+GWDAMI
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSTTRGPPADLDLDVDVKVIGWDAMI  120

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             R+QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   RVQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  156



>emb|CDY26910.1| BnaA05g18020D [Brassica napus]
Length=443

 Score =   231 bits (590),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -3

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+  +ES  
Sbjct  268   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEK  327

Query  1797  DDLKIQAQSLKKELS-TKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKN  1621
               +K Q + +K EL+  K     D +   + T  K   M+++VK++GWDAMIR++ +K+N
Sbjct  328   TQIKTQLEEVKMELAGRKASAGGDLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRN  387

Query  1620  HPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             HPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK+ 
Sbjct  388   HPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  443


 Score =   225 bits (573),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 157/258 (61%), Gaps = 53/258 (21%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             N+ETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRTS  110

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
               P S+PA+Q +RKKVLRELNS                              F  GSGL 
Sbjct  111   PPPFSTPADQEYRKKVLRELNS------------------------------FACGSGLA  140

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G+AF + + +W+ G D+L  S CERA+Q   FG++T+ CIPS+NGVVELGST+ I QS D
Sbjct  141   GKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQSSD  200

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQENS  2500
             LMNKVRVLFNFN    G +SG  +W   P   ENDP+ +W+ +P       +  + Q N 
Sbjct  201   LMNKVRVLFNFNG-GAGDLSG-LNWNLDPDQGENDPT-MWINDP-------IGVAEQGNG  250

Query  2499  IPSSS----VKEIVFRNE  2458
              PSSS     K I F NE
Sbjct  251   APSSSSQLFAKSIQFENE  268



>gb|AEB35676.1| MYC2 [Helianthus annuus]
 gb|AEB35677.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITARGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35587.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T+     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITSRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMXAMMELDLEVHHASVSVVNEL  155



>gb|AEB35578.1| MYC2 [Helianthus exilis]
 gb|AEB35579.1| MYC2 [Helianthus exilis]
Length=155

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D++VDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSVQENMKMSSITTRGPPADLEVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35640.1| MYC2 [Helianthus annuus]
 gb|AEB35654.1| MYC2 [Helianthus annuus]
 gb|AEB35662.1| MYC2 [Helianthus annuus]
Length=155

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC K +HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35604.1| MYC2 [Helianthus argophyllus]
 gb|AEB35605.1| MYC2 [Helianthus argophyllus]
Length=155

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC K +HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKMSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35577.1| MYC2 [Helianthus exilis]
Length=155

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+D DVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSVQENMKMSSXTTRGPPADLDXDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35592.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITXRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMXAMMELDLEVHHASVSVVNEL  155



>emb|CDX73261.1| BnaC05g28450D [Brassica napus]
Length=443

 Score =   230 bits (587),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -3

Query  1977  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYI  1798
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK+  +ES  
Sbjct  268   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEK  327

Query  1797  DDLKIQAQSLKKELS-TKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKN  1621
               +K Q + +K EL+  K     D +   + T  K   M+++VK++GWDAMIR++ +K+N
Sbjct  328   TQIKTQLEEVKMELAGRKASAGGDLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRN  387

Query  1620  HPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             HPAARLM AL DL+LEV HAS+SV+NDLMIQQA VKMG R+Y Q+QLR +LISK+ 
Sbjct  388   HPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  443


 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 155/258 (60%), Gaps = 53/258 (21%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK-RNR--  3025
             N+ETLQQRLQ LI+G  E WTYAIFWQ S  DF+G S+LGWGDGYYKGEEDK K R R  
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSY-DFSGASVLGWGDGYYKGEEDKAKPRQRTS  110

Query  3024  --PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLP  2851
               P S+PA+Q +RKKVLRELNS                              F  GSGL 
Sbjct  111   PPPFSTPADQEYRKKVLRELNS------------------------------FACGSGLA  140

Query  2850  GQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFD  2671
             G+AF + + +W+ G D+L  S CERA+Q   FG++T+ CIPS+NGVVELGST+ I QS D
Sbjct  141   GKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQSSD  200

Query  2670  LMNKVRVLFNFNNPDMGSISGSASWAAPP---ENDPSALWLTEPTSSSGVDVNTSVQENS  2500
             LMNKVRVLFNFN    G +S   +W   P   ENDPS +W+ +P       +    Q N 
Sbjct  201   LMNKVRVLFNFNG-GAGDLS-CLNWNLDPDQGENDPS-MWINDP-------IGVPEQGNG  250

Query  2499  IPSSS----VKEIVFRNE  2458
              PSSS     K I F NE
Sbjct  251   APSSSSQLFAKSIQFENE  268



>gb|AEB35660.1| MYC2 [Helianthus annuus]
 gb|AEB35661.1| MYC2 [Helianthus annuus]
Length=155

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAEQNMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAA LM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAAHLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35649.1| MYC2 [Helianthus annuus]
 gb|AEB35655.1| MYC2 [Helianthus annuus]
Length=155

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAZZNMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAA LM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAAXLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35596.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITXRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMSAMMELDLEVHHASVSVVNEL  155



>gb|AEB35678.1| MYC2 [Helianthus annuus]
Length=155

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARL  A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLRTAMMELDLEVHHASVSVVNEL  155



>emb|CDY03185.1| BnaC09g19710D [Brassica napus]
Length=473

 Score =   231 bits (588),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 156/213 (73%), Gaps = 17/213 (8%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+VV E             K+ +KRGRK ANGR+EPLNHV+AER RREKLNQRFY
Sbjct  277   HSDIEATVVPE------------NKQKKKRGRKLANGRKEPLNHVQAERLRREKLNQRFY  324

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDK SLLGDAI+YI ELKS+ E +ES  + ++I    LK+E++ +    
Sbjct  325   ALRATVPNVSKMDKTSLLGDAISYIKELKSRAENAESERNAIQILLNKLKEEMAGR----  380

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
              +   +      +I   ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  381   -NAVCRGGKNASEIETANIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  439

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R+Y QDQL+  L+SK+
Sbjct  440   SVIHDLMIQQATVKMGSRMYTQDQLQAMLVSKI  472


 Score =   179 bits (454),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRPASSPA  3007
             LQ+RLQ +++G  E WTYAI W  S  D++G S+L WGDG YKGEE D  +R R   + A
Sbjct  39    LQKRLQAVLNGTHEAWTYAILWTPSYYDYSGESVLKWGDGIYKGEEADNTRRKRRRMTVA  98

Query  3006  EQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCS  2833
             E+ H   +L EL+S+ S       D   D EV+DTEWF++VSMT SF + +GLPG+AF +
Sbjct  99    EREHWSIILPELSSMTSDEDLPVIDGEDDVEVSDTEWFYMVSMTVSFGSETGLPGKAFAT  158

Query  2832  SSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVR  2653
               P+W++G D +L+S CERA++    GL+T+VCIP  NGV+ELGST  I Q+ DL NK+R
Sbjct  159   YKPVWVTGSDHILASGCERAKKGGYSGLQTIVCIPLDNGVLELGSTVEIKQNPDLFNKIR  218

Query  2652  VLFNF  2638
             V+F+F
Sbjct  219   VVFSF  223



>gb|AEB35570.1| MYC2 [Helianthus petiolaris]
Length=155

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGRE PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREAPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      T      D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQXDALKKELSNKVSXQENMKMSSITARGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC KK+HPAARLM A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35657.1| MYC2 [Helianthus annuus]
Length=155

 Score =   218 bits (556),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E+  D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEANKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
             +QC K +HPAARL  A+ +LDLEV HASVSV+N+L
Sbjct  121   VQCNKMSHPAARLRTAMMELDLEVHHASVSVVNEL  155



>gb|AGO03814.1| JAMYC4 [Taxus cuspidata]
Length=361

 Score =   223 bits (569),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 152/222 (68%), Gaps = 15/222 (7%)
 Frame = -3

Query  2091  SDLEASV-VKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             SD+E S  +KE++S  VE      K+PRKRGRKPANGREEPLNHVEAERQRREKLNQ+FY
Sbjct  144   SDVEPSASIKESESVVVE------KKPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  197

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL-------  1756
              LRAVVPNVSKMDKASLL DA+ YIN+L S+ ++ E   D+L+ Q  + KKEL       
Sbjct  198   ELRAVVPNVSKMDKASLLADAVTYINDLSSRQQSLELERDELRTQIGAAKKELLVLPSKF  257

Query  1755  STKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDL  1576
               KEP        K ++  K P +D +V+++G +AMI+IQC K NHP ARLM AL++L++
Sbjct  258   GNKEPSGHTNMDLKGSSGGKFPGLDSEVRILGQEAMIKIQCAKHNHPVARLMTALQELEM  317

Query  1575  EVTHASVSVMND-LMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             EV HAS+S + D LMIQ    KM   LY + QL   L  K+A
Sbjct  318   EVLHASISTIKDALMIQTVIAKMTRVLYTEQQLHALLCKKVA  359



>gb|AEB35573.1| MYC2 [Helianthus paradoxus]
 gb|AEB35574.1| MYC2 [Helianthus paradoxus]
Length=151

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTT-PHKIPDMDVDVKVMGWDAMI  1645
             LE +E   D+L+ Q  +LKKELS K     +     TT  P    D+DVDVKV+GWDAMI
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSTTRGPPADLDLDVDVKVIGWDAMI  120

Query  1644  RIQCTKKNHPAARLMVALKDLDLEVTHASVS  1552
             R+QC KK+HPAARLM A+ +LDLEV HASVS
Sbjct  121   RVQCNKKSHPAARLMTAMMELDLEVHHASVS  151



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score =   230 bits (586),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 166/234 (71%), Gaps = 22/234 (9%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EAS+ +   S+A       E++PRKRGRKPANGREEPLNHVEAERQRREKLNQR Y
Sbjct  428   HSDIEASIKEPECSQAT----FVERKPRKRGRKPANGREEPLNHVEAERQRREKLNQRVY  483

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKEL-STKEPR  1738
             ALRAVVPNVSKMDKASLLGDAIAYINEL+SK+  +E++  +L++Q ++LKKEL   +E  
Sbjct  484   ALRAVVPNVSKMDKASLLGDAIAYINELRSKVVDAETHKKELQVQVEALKKELVVVRESG  543

Query  1737  HPDPN--------PKKTTTP--------HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAAR  1606
                PN        P   ++          K   ++++V+++G +AMIR+Q  K+NHP AR
Sbjct  544   ASGPNFGLIKDHYPTADSSDVKGHGLNNSKCHGIELEVRLLGREAMIRVQSPKQNHPVAR  603

Query  1605  LMVALKDLDLEVTHASVSVMNDLMIQQAAVKM-GTRLYNQDQLRLALISKLAET  1447
             LM ALK+LDLEV HASVS + +LMIQ   VKM G  +Y+Q+QL  AL   +A++
Sbjct  604   LMGALKELDLEVHHASVSAVKELMIQTVIVKMTGGIVYSQEQLNAALSKSVADS  657


 Score =   212 bits (540),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 155/233 (67%), Gaps = 19/233 (8%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG------EEDKGK  3034
             NQ+TLQQRLQ L++GA  +WTYAIFWQ S  D     +LGWGDGYYKG      EE   K
Sbjct  63    NQDTLQQRLQALVEGASASWTYAIFWQISS-DPENAMVLGWGDGYYKGPRDLTDEESASK  121

Query  3033  RNRPASSPAE-----QAHRKKVLRELNSLISGPAstdesvde---evtdtEWFFLVSMTH  2878
             R   +SS  E     Q  RKKVLR+L++LI+      +       EVTD EWF+LVSM  
Sbjct  122   RVSASSSAFEATASDQELRKKVLRDLHTLINPDIEMTDISSTVDGEVTDEEWFYLVSMMQ  181

Query  2877  SFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGS  2698
             SF+NG G+PGQAF +++PIWI+G + L +  C+RARQAQ FG+RT+VCIPS NGVVELGS
Sbjct  182   SFVNGCGVPGQAFFTATPIWITGPETLHAYNCDRARQAQQFGIRTLVCIPSPNGVVELGS  241

Query  2697  TDLILQSFDLMNKVRVLFNFN-NPDMGSISGSASW--AAPPENDPSALWLTEP  2548
             TDLI Q+++LM + R  F FN NP+     G+ S+      + DPS LWLTEP
Sbjct  242   TDLITQNWNLMQQARNSFTFNDNPNPLWEEGNPSYNNNNSVDADPS-LWLTEP  293



>ref|XP_009391048.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   227 bits (579),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSDLE S  +   S  +E     EKRP+KRGRKPANGRE P++HVEAERQRREKLNQRFY
Sbjct  343   HSDLEGSAREATSSATLER----EKRPKKRGRKPANGREVPIDHVEAERQRREKLNQRFY  398

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALR+VVPNVSKMDKASLL DAIAYINEL +K+ T ES    L+ +  +L KE  +K   +
Sbjct  399   ALRSVVPNVSKMDKASLLADAIAYINELHTKVGTMESEKRRLRSELSAL-KEAKSKATAN  457

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
                  +  T+     +++V+VK++G +AMIR+QC ++ HPAARLMVAL++L+LEV +A+V
Sbjct  458   EWTTSETGTSGEGEGEVEVEVKLLGREAMIRVQCERRAHPAARLMVALRELELEVYYANV  517

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             +V+ +LMIQQA VKMG+R+YNQ+QL  AL +++A
Sbjct  518   TVVKELMIQQATVKMGSRIYNQEQLTAALFARVA  551


 Score =   217 bits (553),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 155/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGK-RNRP  3022
             N ETLQQRL  LI+G  E WTYAIFWQ+S     G + L WGDGYY+  EEDK K     
Sbjct  46    NPETLQQRLNALIEGGPENWTYAIFWQSSPA--GGAAALSWGDGYYRSCEEDKRKPAGVG  103

Query  3021  ASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQA  2842
             ASS AEQ HRK+VLRELN+LISG A  +++ DEEV+DTEWFFLVSMT +F  G+GLPGQ 
Sbjct  104   ASSTAEQEHRKRVLRELNALISG-AGGEDAADEEVSDTEWFFLVSMTQTFAPGAGLPGQV  162

Query  2841  FCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMN  2662
               S   +W++G+D+L ++PCERA+QA  FGLRTM C+P  +GVVELGST  I  + ++++
Sbjct  163   LLSGETVWVAGEDRLAAAPCERAQQAWAFGLRTMACVPMGSGVVELGSTQDIFHNSEILS  222

Query  2661  KVRVLFNFNNPDMGSISGSASWAAPPEN---DPSALWLTEPTS  2542
             KVR+LF       G  +GS     PPE    DP  LW++EP++
Sbjct  223   KVRLLFGRGRGGGGHATGSLP--PPPEQGLVDPCMLWISEPSA  263



>gb|ABR16623.1| unknown [Picea sitchensis]
Length=582

 Score =   222 bits (565),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 146/205 (71%), Gaps = 8/205 (4%)
 Frame = -3

Query  2040  TLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL  1861
             T A  E++PRKRGRKPANGREEPLNHVEAERQRREKLNQ+FY LRAVVPNVSKMDKASLL
Sbjct  376   TSAVVERKPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYELRAVVPNVSKMDKASLL  435

Query  1860  GDAIAYINELKSKLETSESYIDDLKIQAQSLKKE-------LSTKEPRHPDPNPKKTTTP  1702
             GDA AYI +L SK +  ES   +L+ Q +S+KKE       L+ KE         K  + 
Sbjct  436   GDAAAYIKDLCSKQQDLESERVELQDQIESVKKELLMNSLKLAAKEATDLSSIDLKGFSQ  495

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMND-LMIQQ  1525
              K P ++ +V+++G +A+IRIQCTK NHP ARLM AL++LDLEV HAS+S + D L+IQ 
Sbjct  496   GKFPGLNSEVRILGREAIIRIQCTKHNHPVARLMTALQELDLEVLHASISTVKDSLIIQT  555

Query  1524  AAVKMGTRLYNQDQLRLALISKLAE  1450
               VKM   LY ++QL   L  K+A+
Sbjct  556   VIVKMTRGLYTEEQLHALLCKKVAD  580


 Score =   183 bits (465),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 136/199 (68%), Gaps = 13/199 (7%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG----EEDKG--K  3034
             +QETLQQRLQTL++ A   WTYAIFWQ S  + +G   L WGDGYYKG    EED+    
Sbjct  15    SQETLQQRLQTLVETASIVWTYAIFWQVSY-ESSGAIQLCWGDGYYKGSRNTEEDERLRM  73

Query  3033  RNRPASSPAEQAHRKKVLRELNSLISGPAs------tdesvdeevtdtEWFFLVSMTHSF  2872
             R+R   SPA+Q  RKKVLR+L+S+ISG         +  SVDEEVTD EWF+L+SM  SF
Sbjct  74    RSRLTVSPADQELRKKVLRDLHSMISGSDEGNQQDNSSVSVDEEVTDAEWFYLISMMQSF  133

Query  2871  INGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTD  2692
             ++G G+PG AF + +P+WI G ++L  S CERARQA   G++T+VC+P   GVVE GST+
Sbjct  134   LSGFGVPGTAFSTGAPVWIVGAERLRVSTCERARQAHDLGIQTLVCVPIQGGVVEFGSTE  193

Query  2691  LILQSFDLMNKVRVLFNFN  2635
              I++++  + +V   F +N
Sbjct  194   DIVENWLFLEQVNRSFKYN  212



>ref|XP_010481407.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=474

 Score =   218 bits (556),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = -3

Query  2067  KEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1888
             + +D R  E      K  +KRGRKP +GRE+PLNHVEAER RREKLN RFYALRAVVPNV
Sbjct  274   RSSDDRMDEMEIPEMKPGKKRGRKPMHGREKPLNHVEAERMRREKLNHRFYALRAVVPNV  333

Query  1887  SKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTT  1708
             SKMDK SLL DA+ YINELKS  E +ES  + ++ Q   LKK    +       N  K  
Sbjct  334   SKMDKTSLLEDAVRYINELKSTAENAESERNAVQNQLNELKKITGRQNATSSVCNDDK--  391

Query  1707  TPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQ  1528
                 + ++ ++VK MG D MIR++  K+NHP ARLM AL DL+LEV+HAS+SVMNDLMIQ
Sbjct  392   --ENLSELKIEVKAMGSDVMIRVESGKRNHPGARLMNALMDLELEVSHASISVMNDLMIQ  449

Query  1527  QAAVKMGTRLYNQDQLRLALISKL  1456
             QA VKMG R+Y Q+QL+  LISK+
Sbjct  450   QATVKMGLRIYEQEQLQDMLISKI  473


 Score =   175 bits (444),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 137/201 (68%), Gaps = 16/201 (8%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG--EEDKGKRNRPA  3019
             + TLQ+RL T++ G  E WTYAIFW+ S  D +G S+L W DG Y G  EE  G+R R  
Sbjct  32    ETTLQKRLHTVLSGTHEPWTYAIFWKPSYFDLSGESVLKWSDGVYNGDDEEKTGRRLRRT  91

Query  3018  ------SSPAEQAHRKKVLRELNSLISGPA--------stdesvdeevtdtEWFFLVSMT  2881
                   SSP E+  R++VLRELNS+ISG          + D+  D EVTDTEWFFLVSMT
Sbjct  92    IKKTIPSSPEEKERRRRVLRELNSMISGETFPVVEEDDAKDDVDDVEVTDTEWFFLVSMT  151

Query  2880  HSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELG  2701
              +F NGSGL G+AF + +P+W++G D++  S C+RA+Q    GL+T+VCIPS NGV+ELG
Sbjct  152   WTFGNGSGLAGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGGLGLQTIVCIPSDNGVLELG  211

Query  2700  STDLILQSFDLMNKVRVLFNF  2638
             ST+ I Q+ DL NK+R LF+F
Sbjct  212   STEQIRQNSDLFNKIRFLFSF  232



>ref|XP_009385748.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Musa acuminata subsp. malaccensis]
Length=564

 Score =   219 bits (557),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             +SD+EAS  + A S   E     E RP+KRGRKPAN R+ PL+HVEAERQRREKLNQRFY
Sbjct  347   NSDIEASAKEVASSGITEP---PENRPKKRGRKPANSRKXPLDHVEAERQRREKLNQRFY  403

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELST--KEP  1741
             +LR+VVPNVSKMDKASLL DA+ YINEL+SK +  ES    L+ +  +L+ E  +     
Sbjct  404   SLRSVVPNVSKMDKASLLADAVTYINELRSKTQALESNNRGLQSELSALRTESESAGSSA  463

Query  1740  RHPDPNPKKTTTPHKI-PDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTH  1564
              H DP   +T    +   ++DV+VK++G +A+IR+QC +++HP A LMVALK+LDLE+ +
Sbjct  464   AHRDPKTTETNGSGRCGGEVDVEVKIVGSEAIIRVQCDRRSHPPASLMVALKELDLELYY  523

Query  1563  ASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAETL  1444
             A++SV+ +LMIQQA  KM TR+Y+Q QL   L+ ++   L
Sbjct  524   ANISVVKELMIQQATTKMTTRVYSQQQLTAKLLGRMIAVL  563


 Score =   209 bits (532),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 175/268 (65%), Gaps = 29/268 (11%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG-EEDKGK-RNRPASSP  3010
             LQQRL +LI+GARE+WTYAI+W++S     G + L WGDGYY+G EEDKGK     ASS 
Sbjct  55    LQQRLNSLIEGARESWTYAIYWRSSX--HRGAAALTWGDGYYRGCEEDKGKPLGGGASSL  112

Query  3009  AEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCSS  2830
             AEQ HRK VLRELN+L+SG    D++ DE+VTDTEWFFLVSMT +F  G+GLPGQA  SS
Sbjct  113   AEQEHRKHVLRELNALVSG-GGGDDAADEDVTDTEWFFLVSMTQTFALGAGLPGQALLSS  171

Query  2829  SPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRV  2650
             SP WI+G D++ ++ CER RQA+  GLRTM C+P  +GVVELGST  I ++ +++ K R 
Sbjct  172   SPAWIAGADRMATALCERVRQARALGLRTMACVPLGSGVVELGSTHEIFRNSEILRKARA  231

Query  2649  LFNFNNPDMGSISG----SASWAAP----PEN---DPSALWLTEPTS---SSGVD--VNT  2518
             LF       G ++G    + SW  P     E    DPS LW + P++   SS  +  +  
Sbjct  232   LF-------GDVTGGRKAAGSWPPPLLAAAEQGVIDPSMLWFSVPSAPMPSSPFEKPIPG  284

Query  2517  SVQENSIPSSSVKEIVFRNE-NSIPSST  2437
              + EN +P     ++ F  + N+IP+++
Sbjct  285   CLTENPVPIHVPHDLNFTGDINTIPTTS  312



>emb|CDX77699.1| BnaC07g19530D [Brassica napus]
Length=271

 Score =   207 bits (527),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 148/212 (70%), Gaps = 3/212 (1%)
 Frame = -3

Query  2091  SDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  1912
             S++ AS VK  DS A   + A     +KRGR+P +GREEP+NHVEAER RREKLNQRFYA
Sbjct  62    SNISASAVKLEDS-AHFNIDAKTTPEKKRGRRPTHGREEPMNHVEAERLRREKLNQRFYA  120

Query  1911  LRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHP  1732
             LRA++PNV+K +KAS+L D + YINELK   E +ES  +  +IQ   LK++++ +     
Sbjct  121   LRALLPNVTKREKASILEDTVTYINELKVNAENAESEKNAFEIQLNELKEKIAGRRNGSS  180

Query  1731  DPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVS  1552
                     TP    ++ +DVKVM  DA+IR++ +K NHP ARLM A  DL++EV HAS+S
Sbjct  181   SVCGGGEKTPE--IEVKIDVKVMDRDALIRLESSKNNHPGARLMNAFMDLEVEVNHASIS  238

Query  1551  VMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             VMN+LMIQQ  VKMG+R+Y Q+QLR  L+SK+
Sbjct  239   VMNNLMIQQVTVKMGSRVYKQEQLRDLLLSKV  270



>emb|CDY59973.1| BnaA09g53560D [Brassica napus]
Length=509

 Score =   214 bits (546),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 149/213 (70%), Gaps = 14/213 (7%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+V  +   +       A            NGR+EPLNHV+AER RREKLN RFY
Sbjct  310   HSDIEATVAPDNKRKKKRGRKLA------------NGRKEPLNHVQAERLRREKLNMRFY  357

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDKASLLGDAI YINELKS+ E +ES  + ++++   L++EL+ +    
Sbjct  358   ALRATVPNVSKMDKASLLGDAICYINELKSRAENAESKKNAIQMELNKLREELAGRNAVS  417

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
                  +   + ++    ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  418   SVCRGEGNASENETA--NIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  475

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R+Y QDQLR  L+SK+
Sbjct  476   SVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  508


 Score =   197 bits (502),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 143/220 (65%), Gaps = 13/220 (6%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRPASSPA  3007
             LQ+RLQ ++DG +E WTYAIFW  S  DF+G S+L WGDG YKGEE DK +R R   + A
Sbjct  39    LQKRLQAVLDGTQEAWTYAIFWMPSYYDFSGDSVLKWGDGIYKGEEADKTRRRR--RTVA  96

Query  3006  EQAHRKKVLRELNSLISGPAstdesvdeevtdt--EWFFLVSMTHSFINGSGLPGQAFCS  2833
             E  HR  +LREL+S+IS  A      ++++  +   WF+L SMT SF +GSGLPG+AF +
Sbjct  97    ENEHRSTILRELSSMISDEALLVMGDEDDLEVSDPSWFYLTSMTVSFGSGSGLPGKAFAT  156

Query  2832  SSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVR  2653
               P+W++G D ++ S C+RA++    GL+T+VCIP  NGV+ELGST  I Q+ DL NK+R
Sbjct  157   YKPVWVTGSDHIMGSGCDRAKKGGDLGLQTIVCIPLDNGVLELGSTAEIQQTPDLFNKIR  216

Query  2652  VLFNFNNPDMGSISGSASWAAPPENDPSALWLTEPTSSSG  2533
             V+F+F         GS  ++  P ++   L+ T+  +  G
Sbjct  217   VVFSF--------EGSRDFSGDPNSNSFPLFSTQLDNGGG  248



>ref|XP_010441529.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=461

 Score =   213 bits (543),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -3

Query  2043  ETLAAAEKRP-RKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKAS  1867
             E +   E +P +KRGRKP +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK S
Sbjct  267   EEMVIPEMKPGKKRGRKPMHGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTS  326

Query  1866  LLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD  1687
             LL DA+ YINELKS  E +ES  + ++ Q   LKK    +   +   +         + +
Sbjct  327   LLEDAVRYINELKSTAENAESERNAVQNQLNELKKITGRQ---NATSSVVCNDDKENVSE  383

Query  1686  MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMG  1507
             + ++VK MG D MIR++  K+NHP ARLM AL DL+LEV+HAS+SVMNDLMIQQA VKMG
Sbjct  384   LKIEVKAMGSDVMIRVESGKRNHPGARLMNALMDLELEVSHASISVMNDLMIQQATVKMG  443

Query  1506  TRLYNQDQLRLALISKL  1456
              R+Y Q+QLR  L SK+
Sbjct  444   LRIYEQEQLRDMLKSKI  460


 Score =   191 bits (484),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 133/198 (67%), Gaps = 13/198 (7%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG--EEDKGKRNRPA  3019
             + TLQ+RL  ++ G  E WTYAIFW+ S  D +G S+L WGDG Y G  EE  G+R R  
Sbjct  32    ETTLQKRLHAVLSGTHEPWTYAIFWKPSDFDLSGESVLKWGDGVYNGDDEEKTGRRLRRT  91

Query  3018  ------SSPAEQAHRKKVLRELNSLISGP-----AstdesvdeevtdtEWFFLVSMTHSF  2872
                   SSP E+    KVLRELNS+ISG         D   D EVTDTEWFFLVSMT +F
Sbjct  92    IKKTIPSSPEEKERWSKVLRELNSMISGEPFPVVEEDDAKDDVEVTDTEWFFLVSMTWTF  151

Query  2871  INGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTD  2692
              NGSGL G+AF + +P+W++G D++  S C+RA+Q    GL+T+VCIPS NGV+ELGST+
Sbjct  152   GNGSGLAGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGVLGLQTIVCIPSDNGVLELGSTE  211

Query  2691  LILQSFDLMNKVRVLFNF  2638
              I Q+ +L NK+R LF+F
Sbjct  212   QISQNSNLFNKIRYLFSF  229



>ref|XP_009101672.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=271

 Score =   206 bits (524),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 152/214 (71%), Gaps = 7/214 (3%)
 Frame = -3

Query  2091  SDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  1912
             S++ AS VK  DS A   + A     +KRGR+P +GREEP+NHVEAER RREKLNQRFYA
Sbjct  62    SNISASAVKLEDS-AHFNIDAKTTPEKKRGRRPTHGREEPMNHVEAERLRREKLNQRFYA  120

Query  1911  LRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHP  1732
             LRA++PNV+K +KAS+L D + YINELK   E +E+  + ++ Q   LK++++ +     
Sbjct  121   LRALLPNVTKKEKASILEDTVTYINELKLNAENAETEKNAIENQLNELKEKIAGRR----  176

Query  1731  DPNPKKTTTPHKIPDMDV--DVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHAS  1558
             + +    +   K P+++V  DVKVM  DA+IR++ +K NHP ARLM A  DL++EV HAS
Sbjct  177   NGSSSVCSGGEKTPEIEVKIDVKVMDRDALIRLESSKNNHPGARLMNAFMDLEVEVNHAS  236

Query  1557  VSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             +SVMNDLMIQQ  VKMG+R+Y Q+QLR  L+SK+
Sbjct  237   ISVMNDLMIQQVTVKMGSRVYKQEQLRDLLLSKI  270



>ref|XP_009114323.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=509

 Score =   212 bits (539),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 149/213 (70%), Gaps = 14/213 (7%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+V  +   +       A            NGR+EPLNHV+AER RREKLN +FY
Sbjct  310   HSDIEATVAPDNKRKKKRGRKLA------------NGRKEPLNHVQAERLRREKLNMQFY  357

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDKASLLGDAI YINELKS+ E +ES  + ++++   L++E++ +    
Sbjct  358   ALRATVPNVSKMDKASLLGDAICYINELKSRAENAESKKNAIQMELNKLREEIAGRNAVS  417

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
                  +   + ++    ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  418   SVCRGEGNASENETA--NIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  475

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R+Y QDQLR  L+SK+
Sbjct  476   SVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  508


 Score =   192 bits (489),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEE-DKGKRNRPASSPA  3007
             LQ+RLQ +++G  E WTY IFW  S  DF+G S+L WGDG YKGEE DK +R R   + A
Sbjct  39    LQKRLQAVLNGTHEAWTYVIFWTPSYYDFSGDSVLKWGDGIYKGEEADKTRRRR--RTVA  96

Query  3006  EQAHRKKVLRELNSLISGPAstdesvdeevtdt--EWFFLVSMTHSFINGSGLPGQAFCS  2833
             E  HR  +LREL+S+IS  A      ++++  +   WF+L SMT SF +GSGLPG+AF +
Sbjct  97    ENEHRSTILRELSSMISDEALLVMGDEDDLEVSDPSWFYLTSMTVSFGSGSGLPGKAFAT  156

Query  2832  SSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVR  2653
               P+W++G D ++ S C+RA++    GL+T+VCIP  NGV+ELGST  I Q+ DL NK+R
Sbjct  157   YKPVWVTGSDHIMGSGCDRAKKGGDLGLQTIVCIPLDNGVLELGSTAEIQQTPDLFNKIR  216

Query  2652  VLFNF  2638
             V+F+F
Sbjct  217   VVFSF  221



>emb|CDY33482.1| BnaA06g35910D [Brassica napus]
Length=271

 Score =   204 bits (520),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 151/214 (71%), Gaps = 7/214 (3%)
 Frame = -3

Query  2091  SDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  1912
             S++ AS VK  DS A   + A     +KRGR+P +GREEP+NHVEAER RREKLNQRFYA
Sbjct  62    SNISASAVKLEDS-AHFNIDAKTTPEKKRGRRPTHGREEPMNHVEAERLRREKLNQRFYA  120

Query  1911  LRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHP  1732
             LRA++PN +K +KAS+L D + YINELK   E +E+  + ++ Q   LK++++ +     
Sbjct  121   LRALLPNATKKEKASILEDTVTYINELKLNAENAETEKNAIENQLNELKEKIAGRR----  176

Query  1731  DPNPKKTTTPHKIPDMDV--DVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHAS  1558
             + +    +   K P+++V  DVKVM  DA+IR++ +K NHP ARLM A  DL++EV HAS
Sbjct  177   NGSSSVCSGGEKTPEIEVKIDVKVMDRDALIRLESSKNNHPGARLMNAFMDLEVEVNHAS  236

Query  1557  VSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             +SVMNDLMIQQ  VKMG+R+Y Q+QLR  L+SK+
Sbjct  237   ISVMNDLMIQQVTVKMGSRVYKQEQLRDLLLSKI  270



>emb|CDY03183.1| BnaC09g19730D [Brassica napus]
Length=509

 Score =   211 bits (538),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 149/213 (70%), Gaps = 14/213 (7%)
 Frame = -3

Query  2094  HSDLEASVVKEADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  1915
             HSD+EA+VV++   +       A            NGR+EPLNHV+AER RREKLN RFY
Sbjct  310   HSDIEATVVRDNKRKKKRGRKLA------------NGRKEPLNHVQAERLRREKLNMRFY  357

Query  1914  ALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRH  1735
             ALRA VPNVSKMDKASLLGDAI YINELKS+ E +ES  + ++++   L++E++ +    
Sbjct  358   ALRATVPNVSKMDKASLLGDAICYINELKSRAEDAESKKNAIQMELIKLREEIAGRNADS  417

Query  1734  PDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASV  1555
                   +  + ++    ++DVK++G DAM+R++ +K+NHPAARLM A  DLD+E+ HAS+
Sbjct  418   SVCRGGENASENETA--NIDVKILGCDAMVRLESSKRNHPAARLMNAFMDLDVELNHASI  475

Query  1554  SVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             SV++DLMIQQA VKMG+R Y  DQLR  L+SK+
Sbjct  476   SVIHDLMIQQATVKMGSRTYTPDQLRAMLVSKI  508


 Score =   186 bits (472),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAE  3004
             LQ+RLQ +++G  E WTYAIFW  S  DF+G S+L WGDG YKGEE    R R     AE
Sbjct  39    LQKRLQAVLNGTHEAWTYAIFWTPSYYDFSGDSVLKWGDGIYKGEEADKTRWR-RRKVAE  97

Query  3003  QAHRKKVLRELNSLISGPAstdesvdeevtdt--EWFFLVSMTHSFINGSGLPGQAFCSS  2830
               +R  +LREL+S+IS  A      +++V  +   WF+L SMT SF +G GLPG+AF + 
Sbjct  98    NENRSTILRELSSMISDEALLVMEDEDDVEVSDPSWFYLTSMTVSFGSGFGLPGKAFATY  157

Query  2829  SPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRV  2650
              P+WI+G + +L S C+RA+    FGL+T+VCIP  NGV+ELGST  I Q+ DL+NK+RV
Sbjct  158   KPVWITGSELILGSGCDRAKTGGEFGLQTIVCIPLDNGVLELGSTAEIQQTPDLLNKIRV  217

Query  2649  LFNF  2638
             +F+F
Sbjct  218   VFSF  221



>ref|XP_009139989.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=297

 Score =   205 bits (521),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 155/247 (63%), Gaps = 49/247 (20%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGP------SLLGWGDGYYKGEEDKGKR  3031
             ++TLQQRLQ LI+GARE+WTYA+FWQ S  DFAG       +LL WGDG YKGEE++  R
Sbjct  59    EDTLQQRLQALIEGARESWTYAVFWQLSH-DFAGAEIGDTAALLSWGDGCYKGEEERKSR  117

Query  3030  NRPAS--SPAEQAHRKKVLRELNSLISGPAstdesvd------------eevtdtEWFFL  2893
              R  +  S AEQ HRK+V+RELNSLISG      +V             E+V+DTEWFFL
Sbjct  118   KRKPNPVSAAEQEHRKRVIRELNSLISGGGGGGGTVSSSGGGSSDEAGDEDVSDTEWFFL  177

Query  2892  VSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGV  2713
             VSMT SF NGSGLPG+AF SS  IW+SG + L  S CERARQ Q +GL TMVCIP+ NGV
Sbjct  178   VSMTQSFANGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGV  237

Query  2712  VELGSTDLILQSFDLMNKV--------------RVLFNFN-NPDMGSISGSASWAAPPEN  2578
             VELGS ++I QS +L++KV                 + FN NPD G            EN
Sbjct  238   VELGSLEIIHQSSELVDKVNSFFSFNGGGGGGESGSWAFNLNPDQG------------EN  285

Query  2577  DPSALWL  2557
             DP A W+
Sbjct  286   DP-ATWI  291



>gb|AEB35681.1| MYC2 [Helianthus annuus]
 gb|AEB35682.1| MYC2 [Helianthus annuus]
Length=138

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVAL  1591
             +QC KK+HPAARLM A+
Sbjct  121   VQCNKKSHPAARLMTAM  137



>ref|XP_006279851.1| hypothetical protein CARUB_v10028430mg [Capsella rubella]
 gb|EOA12749.1| hypothetical protein CARUB_v10028430mg [Capsella rubella]
Length=474

 Score =   210 bits (534),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 131/179 (73%), Gaps = 3/179 (2%)
 Frame = -3

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKSK E S
Sbjct  299   HGREKPLNHVEAERMRREKLNNRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSKAENS  358

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCT  1630
             ES    ++IQ + LKK +  +          K     K+ ++ ++VKVMG D MIR++  
Sbjct  359   ESGKTAVEIQLKELKKVMELQNATSSSVCKDK---EKKLSELKMEVKVMGSDVMIRVESG  415

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLA  1453
             K+NHP AR M AL DL+LEV H S+SVMNDLMIQQA VKMG R+Y Q+QLR  LISK++
Sbjct  416   KRNHPGARFMNALMDLELEVNHTSISVMNDLMIQQATVKMGLRIYEQEQLRDMLISKIS  474


 Score =   173 bits (438),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 132/202 (65%), Gaps = 17/202 (8%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG--EEDKGKRNRPA  3019
             + TLQ+RL  +++G    WTYA+FW+ S    +G S+L WGDG Y G  EE  G+R R  
Sbjct  33    ETTLQKRLHNVLNGTHVLWTYAVFWKPSYNLLSGDSVLKWGDGVYNGGDEEKNGRRMRRR  92

Query  3018  ------SSPAEQAHRKKVLRELNSLISGP---------AstdesvdeevtdtEWFFLVSM  2884
                   SSP  +  R KVLRELNS+ISG           + D+  D EVTDTEW++LVSM
Sbjct  93    KKKTVPSSPEGKERRSKVLRELNSMISGEPFPLVEVDDVNDDDDDDVEVTDTEWYYLVSM  152

Query  2883  THSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVEL  2704
             T S  NGSGL G+AF + +P+W++G D++  S C+RA+Q    GL+T+VCIP  NGV+EL
Sbjct  153   TWSSCNGSGLAGKAFDTCNPVWVTGLDQIYGSGCDRAKQGGGLGLQTIVCIPLDNGVLEL  212

Query  2703  GSTDLILQSFDLMNKVRVLFNF  2638
             GST+LI  + DL NK+R LF+F
Sbjct  213   GSTELIRHNSDLFNKIRFLFHF  234



>gb|AEB35702.1| MYC2 [Helianthus annuus]
Length=138

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVAL  1591
             +QC KK+HPAARLM A+
Sbjct  121   VQCNKKSHPAARLMTAM  137



>gb|AEB35566.1| MYC2 [Helianthus petiolaris]
Length=136

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIXYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGXKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVA  1594
             +QC KK+HPAARLM A
Sbjct  121   VQCNKKSHPAARLMTA  136



>gb|AEB35699.1| MYC2 [Helianthus annuus]
Length=138

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAZZNMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLMVAL  1591
             +QC KK+HPAARLM A+
Sbjct  121   VQCNKKSHPAARLMTAM  137



>ref|XP_002865159.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 5/181 (3%)
 Frame = -3

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PA+GR++PLNHVEAER RREKLN RFYALRAVVPN+SKMDK SLL DA+ YINELKSK E
Sbjct  328   PAHGRDQPLNHVEAERMRREKLNHRFYALRAVVPNISKMDKTSLLEDAVHYINELKSKAE  387

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQ  1636
              +ES  + ++IQ   LK+    +     +  P          +M ++VK+MG DAM+R++
Sbjct  388   NAESEKNAIQIQLNELKEMAGQR-----NAIPSVFKYEENASEMKIEVKIMGNDAMVRVE  442

Query  1635  CTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
              +K +HP ARLM AL DL+LEV +AS+SVMND MIQQA VKMG R+Y Q++LR  LISK+
Sbjct  443   SSKSHHPGARLMNALMDLELEVNNASMSVMNDFMIQQANVKMGLRIYKQEELRDVLISKI  502

Query  1455  A  1453
             +
Sbjct  503   S  503


 Score =   186 bits (473),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 135/202 (67%), Gaps = 16/202 (8%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASV-VDFAGPSLLGWGDGYYKGEEDKGKRNR---  3025
             + TL +RL  +++G  E WTY IFW+ S   D +G S+L W DG Y G +++  R R   
Sbjct  30    ETTLPKRLHAVLNGTNEPWTYVIFWKPSYDYDISGESVLKWSDGVYNGGDEEKTRERLRR  89

Query  3024  ---PASSPAEQAHRKKVLRELNSLISGPA---------stdesvdeevtdtEWFFLVSMT  2881
                  SSPAE+  R  VLRELNS+ISG A         + D+ V+ EVTD EWFFLVSMT
Sbjct  90    KKTIPSSPAERERRSNVLRELNSMISGEAFPVVEDEYVNKDDDVEAEVTDMEWFFLVSMT  149

Query  2880  HSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELG  2701
              SF +GSGL G+AF S +P+W++G D++  S C+RA+Q    GL+T+VCIPS NGV+ELG
Sbjct  150   WSFGSGSGLAGKAFASYNPVWVTGSDQIYGSGCDRAKQGGDLGLQTIVCIPSDNGVLELG  209

Query  2700  STDLILQSFDLMNKVRVLFNFN  2635
             ST+ I Q+ DL N++R LFNF+
Sbjct  210   STEHIQQNSDLFNRIRFLFNFD  231



>gb|AEB35693.1| MYC2 [Helianthus annuus]
Length=142

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  1962  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKI  1783
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KLE +E   D+L+ 
Sbjct  1     VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLENNEGNKDELRN  60

Query  1782  QAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARL  1603
             Q  +LKKELS K     +      TT     D DVDVKV+GWDAMIR+QC KK+HPAARL
Sbjct  61    QIDALKKELSNKVSAQENMKMSSVTTRGPPADXDVDVKVIGWDAMIRVQCNKKSHPAARL  120

Query  1602  MVALKDLDLEVTHASVSVMNDL  1537
             M A+ +LDLEV HASVSV+N+L
Sbjct  121   MTAMMELDLEVHHASVSVVNEL  142



>gb|AEB35704.1| MYC2 [Helianthus annuus]
Length=134

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  2001  RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSK  1822
             RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+K
Sbjct  1     RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  1821  LETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIR  1642
             LE +E   D+L+ Q  +LKKELS K     +      TT     D+DVDVKV+GWDAMIR
Sbjct  61    LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  1641  IQCTKKNHPAARLM  1600
             +QC K +HPAARLM
Sbjct  121   VQCNKMSHPAARLM  134



>gb|EMS55891.1| Transcription factor MYC4 [Triticum urartu]
Length=373

 Score =   201 bits (510),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = -3

Query  1962  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETSESYIDDLKI  1783
             V AERQRREKLNQRFY LRAVVPNVSKMDKASLLGDAI+YINEL+ K+   ES  + L  
Sbjct  198   VTAERQRREKLNQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKETLHS  257

Query  1782  QAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARL  1603
             Q ++LKKE   ++ R   P+        +   ++++ K++G +AMIR+QC K+NHPAA+L
Sbjct  258   QIEALKKE---RDARPAAPSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKL  314

Query  1602  MVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             M AL++LDL+V HASVSV+ D+MIQQ AVKM TR+Y+QDQL  AL  +LAE
Sbjct  315   MTALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQDQLNAALYGRLAE  365


 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 61/94 (65%), Gaps = 10/94 (11%)
 Frame = -3

Query  2814  SGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFN  2635
             +G   L S+PCERARQA TFGLRTMVCIP   GV+ELG+T++I Q+ D + ++R LFN N
Sbjct  8     AGPAGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTNDSLGRIRSLFNLN  67

Query  2634  NPDMGSISGSASW--AAPP----ENDPSALWLTE  2551
                     GS SW   APP    E DPS LWL +
Sbjct  68    G----GGGGSGSWPPIAPPPQEAETDPSVLWLAD  97



>ref|XP_010494874.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=478

 Score =   202 bits (513),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  1989  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLETS  1810
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKS  E +
Sbjct  304   HGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENA  363

Query  1809  ESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMGWDAMIRIQCT  1630
             ES  + ++ Q   LKK    +       N  K      + D+ ++VK MG D MIR++  
Sbjct  364   ESEKNAVQNQLNELKKITGRQNATSSVCNDDK----ENVSDLKIEVKAMGSDVMIRVESG  419

Query  1629  KKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             K+NHP ARLM AL DL+LEV HAS+SVMNDLMIQQA VKMG R Y Q+QLR  L SK+
Sbjct  420   KRNHPGARLMNALMDLELEVNHASISVMNDLMIQQATVKMGLRTYEQEQLRDMLKSKI  477


 Score =   200 bits (509),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 135/202 (67%), Gaps = 17/202 (8%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG--EEDKGKRNRPA  3019
             + TLQ+RL  ++ G  E WTYAIFW+ S  D +G S+L WGDG Y G  EE  G+R R  
Sbjct  32    ETTLQKRLHAVLSGTHEPWTYAIFWKPSYFDLSGESVLKWGDGVYNGDDEEKTGRRLRRT  91

Query  3018  ------SSPAEQAHRKKVLRELNSLISGP---------AstdesvdeevtdtEWFFLVSM  2884
                   SSP E+  R KVLRELNS+ISG          A  D     EVTDTEWFFLVSM
Sbjct  92    IKKTILSSPEEKERRSKVLRELNSMISGEPFPVVEEEDAKDDIDDVVEVTDTEWFFLVSM  151

Query  2883  THSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVEL  2704
             T +F NGSGLPG+AF + +P+W++G D++  S C+RA+Q    GL+T+VCIPS NGV+EL
Sbjct  152   TWTFGNGSGLPGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGGLGLQTIVCIPSHNGVLEL  211

Query  2703  GSTDLILQSFDLMNKVRVLFNF  2638
             GST+ I Q+ DL NK+R LF+F
Sbjct  212   GSTEHIRQNSDLFNKIRFLFSF  233



>ref|XP_008392629.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=321

 Score =   195 bits (496),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 161/238 (68%), Gaps = 21/238 (9%)
 Frame = -3

Query  3009  AEQAHRKKVLRELNSLISGP--AstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFC  2836
             AEQ + KKVLR+LNSLISG   ++ D++VD+EVTDTEWFFLVSMT SF+NG GLPGQAF 
Sbjct  50    AEQEYCKKVLRDLNSLISGTDTSADDDAVDQEVTDTEWFFLVSMTQSFVNGGGLPGQAFF  109

Query  2835  SSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKV  2656
              S+P+W++G D+L +SPCERARQ Q FGL+TMVC+P++NGVVELGST+LI QS DLMNKV
Sbjct  110   HSTPVWVAGXDRLAASPCERARQGQVFGLQTMVCVPTANGVVELGSTELIYQSSDLMNKV  169

Query  2655  RVLFNFNNPDMGS--ISGSASWAAPPENDPSALWLTEPTSSS---GVDVNTSVQENSIPS  2491
             RV F+FNN ++GS  +SG A+ A   ENDPS+L L +P++++      VNTS   N+   
Sbjct  170   RVXFDFNNLEVGSWPMSGGAT-ADQGENDPSSLXLXDPSTTTMEMKDXVNTSATTNTSNQ  228

Query  2490  SSVKEIVFRNEN------------SIPSSTGNNHHDSQPSQYFTRELNFSEF-GFDGA  2356
                K + F N                P          Q   +FT ELNFS + G+DG+
Sbjct  229   LISKPVQFDNHPSSSSLSENPSXIQXPQLQQQVQQQQQTQSFFTGELNFSXYNGYDGS  286



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   197 bits (500),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 143/207 (69%), Gaps = 19/207 (9%)
 Frame = -3

Query  2046  VETLAAAEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA  1870
             V  ++A EKR P+KRGRKP  GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKA
Sbjct  316   VNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKA  375

Query  1869  SLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP  1690
             SLL DA++YI ELK K++  ES +  L+ +++ +K E+S       D +   T+     P
Sbjct  376   SLLSDAVSYIRELKVKIDDLESQL--LQRESKKVKLEIS-------DNHSTTTSVDQARP  426

Query  1689  ---------DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
                      +++V+ K+MG DAMIR+Q    NHPAA+LM +L+DLDL++ HAS+S +NDL
Sbjct  427   SSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHHASMSCVNDL  486

Query  1536  MIQQAAVKMGTRLYNQDQLRLALISKL  1456
             M+Q   V++   L  +D LR AL+ +L
Sbjct  487   MLQDIVVRVPDGLRTEDALRSALLRRL  513


 Score =   143 bits (361),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 115/192 (60%), Gaps = 11/192 (6%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---PAS  3016
             TLQQRLQ ++    E W YAIFWQ    D  G   L WGDG+Y+G +D   R R   PA 
Sbjct  25    TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  3015  SPA----EQAHRKKVLREL----NSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGS  2860
             +P         RK+ +  +     S +            +VTDTEWF+++S+T SF  G 
Sbjct  85    APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             G+PG+A  S S +W++G  +L    CERA++AQ+ G+ T VCIP+S GV+ELGS+DLI +
Sbjct  145   GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGSSDLIRE  204

Query  2679  SFDLMNKVRVLF  2644
             ++ L+++V+ LF
Sbjct  205   NWGLVHQVKSLF  216



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   197 bits (500),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 143/207 (69%), Gaps = 19/207 (9%)
 Frame = -3

Query  2046  VETLAAAEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKA  1870
             V  ++A EKR P+KRGRKP  GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKA
Sbjct  316   VNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKA  375

Query  1869  SLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP  1690
             SLL DA++YI ELK K++  ES +  L+ +++ +K E+S       D +   T+     P
Sbjct  376   SLLSDAVSYIRELKVKIDDLESQL--LQRESKKVKLEIS-------DNHSTTTSVDQARP  426

Query  1689  ---------DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
                      +++V+ K+MG DAMIR+Q    NHPAA+LM +L+DLDL++ HAS+S +NDL
Sbjct  427   SSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHHASMSCVNDL  486

Query  1536  MIQQAAVKMGTRLYNQDQLRLALISKL  1456
             M+Q   V++   L  +D LR AL+ +L
Sbjct  487   MLQDIVVRVPDGLRTEDALRSALLRRL  513


 Score =   143 bits (360),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 115/192 (60%), Gaps = 11/192 (6%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNR---PAS  3016
             TLQQRLQ ++    E W YAIFWQ    D  G   L WGDG+Y+G +D   R R   PA 
Sbjct  25    TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  3015  SPA----EQAHRKKVLREL----NSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGS  2860
             +P         RK+ +  +     S +            +VTDTEWF+++S+T SF  G 
Sbjct  85    APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  2859  GLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQ  2680
             G+PG+A  S S +W++G  +L    CERA++AQ+ G+ T VCIP+S GV+ELGS+DLI +
Sbjct  145   GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGSSDLIRE  204

Query  2679  SFDLMNKVRVLF  2644
             ++ L+++V+ LF
Sbjct  205   NWGLVHQVKSLF  216



>ref|NP_199495.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
 sp|Q9LUK7.1|BH028_ARATH RecName: Full=Transcription factor bHLH28; AltName: Full=Basic 
helix-loop-helix protein 28; Short=AtbHLH28; Short=bHLH 28; 
AltName: Full=Transcription factor EN 40; AltName: Full=bHLH 
transcription factor bHLH028 [Arabidopsis thaliana]
 gb|AAL55721.1|AF252636_1 putative transcription factor bHLH28 [Arabidopsis thaliana]
 dbj|BAA97217.1| bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAH30619.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95431.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
Length=511

 Score =   194 bits (493),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 130/183 (71%), Gaps = 7/183 (4%)
 Frame = -3

Query  1995  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLE  1816
             PA+GR++PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKSK E
Sbjct  334   PAHGRDKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVCYINELKSKAE  393

Query  1815  TSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD-MDVDVKVM-GWDAMIR  1642
               E     ++IQ   LK+    +     +  P       K  + M ++VK+M   DAM+R
Sbjct  394   NVELEKHAIEIQFNELKEIAGQR-----NAIPSVCKYEEKASEMMKIEVKIMESDDAMVR  448

Query  1641  IQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALIS  1462
             ++  K +HP ARLM AL DL+LEV HAS+SVMNDLMIQQA VKMG R+Y Q++LR  L+S
Sbjct  449   VESRKDHHPGARLMNALMDLELEVNHASISVMNDLMIQQANVKMGLRIYKQEELRDLLMS  508

Query  1461  KLA  1453
             K++
Sbjct  509   KIS  511


 Score =   172 bits (435),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 127/195 (65%), Gaps = 12/195 (6%)
 Frame = -3

Query  3192  QETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKG---EEDKGKRNRP  3022
             + TL +RL  +++G  E W+YAIFW+ S  DF+G ++L WGDG Y G   E+ +G+  R 
Sbjct  31    ETTLPKRLHAVLNGTHEPWSYAIFWKPSYDDFSGEAVLKWGDGVYTGGNEEKTRGRLRRK  90

Query  3021  A---SSPAEQAHRKKVLRELNSLISGPA------stdesvdeevtdtEWFFLVSMTHSFI  2869
                 SSP E+  R  V+RELN +ISG A         +  D EVTD EWFFLVSMT SF 
Sbjct  91    KTILSSPEEKERRSNVIRELNLMISGEAFPVVEDDVSDDDDVEVTDMEWFFLVSMTWSFG  150

Query  2868  NGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDL  2689
             NGSGL G+AF S +P+ ++G D +  S C+RA+Q    GL+T++CIPS NGV+EL ST+ 
Sbjct  151   NGSGLAGKAFASYNPVLVTGSDLIYGSGCDRAKQGGDVGLQTILCIPSHNGVLELASTEE  210

Query  2688  ILQSFDLMNKVRVLF  2644
             I  + DL N++R LF
Sbjct  211   IRPNSDLFNRIRFLF  225



>emb|CBI34590.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   187 bits (476),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 131/188 (70%), Gaps = 23/188 (12%)
 Frame = -3

Query  2019  RPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYI  1840
             RP+KRGRKPA GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YI
Sbjct  141   RPKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYI  200

Query  1839  NELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKVMG  1660
             +ELK+K       IDDL+ + +        +E R P          +    M+VDVK++G
Sbjct  201   HELKTK-------IDDLETKLR--------EEVRKP--------KAYGAIRMEVDVKIIG  237

Query  1659  WDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQL  1480
              +AMIR+QC   N+P+A LM AL+DLDL V HASVS + +LM+Q   V++   L +++ +
Sbjct  238   SEAMIRVQCPDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEESM  297

Query  1479  RLALISKL  1456
             R A++ ++
Sbjct  298   RTAILKRM  305


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  2904  WFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPS  2725
             W+++VS+T SF+ G G+ G+ F S + +W++ ++ L    CER  +A+  G+RT++C+ +
Sbjct  10    WYYMVSVTKSFVVGDGVLGRVFSSGAFVWLTDRE-LQCYDCERVTEARMNGIRTLLCVST  68

Query  2724  SNGVVELGSTDLILQSFDLMNKVRVLF  2644
             S GV+ELGS D+I + + L+   + LF
Sbjct  69    SCGVLELGSLDMIKEDWGLVLLAKSLF  95



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   192 bits (487),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 138/211 (65%), Gaps = 13/211 (6%)
 Frame = -3

Query  2064  EADSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1885
             ++DS  +  +   ++ P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS
Sbjct  292   DSDSPFMAAVMTEKRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVS  351

Query  1884  KMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTT  1705
             +MDKASLL DA++YINELKSK       I DL+ Q Q   K +  +     D     T+ 
Sbjct  352   RMDKASLLSDAVSYINELKSK-------IGDLESQLQRESKRVKQEVTDATDNLSTTTSV  404

Query  1704  PHKIPD------MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMN  1543
              H  P       ++V+VK++G DAMIR+Q    N+P+ARLM A++DL+L + HAS+S +N
Sbjct  405   DHSSPSGCGGSLLEVEVKIVGCDAMIRVQSENANYPSARLMAAMRDLELHIHHASLSTVN  464

Query  1542  DLMIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             DLM+Q   V +   L  ++ LR AL+  L +
Sbjct  465   DLMLQDVVVSVPEGLKGEEDLRAALLRALEQ  495


 Score =   129 bits (324),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 113/187 (60%), Gaps = 15/187 (8%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPA  3007
             TLQQRLQ ++    + W YAIFWQ    D  G  LL WGDG+++G            + A
Sbjct  32    TLQQRLQLMVQSQPQWWAYAIFWQLLNHD-DGRLLLAWGDGHFQGSTKL--------TLA  82

Query  3006  EQAHRKKVLREL-----NSLISGPAstdesv-deevtdtEWFFLVSMTHSFINGSGLPGQ  2845
              ++ R+++L+ L     NS     A         +VTD EWF+++S+T SF  G G+PG+
Sbjct  83    SRSDRRRLLQALPRDPSNSRPDAAADVPLPAPAGDVTDAEWFYVMSLTRSFSAGDGIPGK  142

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
             A  + S +W++G  +L S  C+RA++A+  G+RTMVCIP+ +GV+ELGS D+I +++ L+
Sbjct  143   ALSTGSLVWLTGARELESYKCDRAKEAELHGIRTMVCIPTGDGVLELGSCDVIPENWGLV  202

Query  2664  NKVRVLF  2644
              + + LF
Sbjct  203   QRAKSLF  209



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score =   191 bits (484),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 138/200 (69%), Gaps = 22/200 (11%)
 Frame = -3

Query  2019  RPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYI  1840
             RP+KRGRKPA GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YI
Sbjct  278   RPKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYI  337

Query  1839  NELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD---------  1687
             +ELK+K       IDDL+ +   L++E+   +    +    ++TT   I D         
Sbjct  338   HELKTK-------IDDLETK---LREEVRKPKACLAEMYDNQSTTTTSIVDHGRSSSSYG  387

Query  1686  ---MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAV  1516
                M+VDVK++G +AMIR+QC   N+P+A LM AL+DLDL V HASVS + +LM+Q   V
Sbjct  388   AIRMEVDVKIIGSEAMIRVQCPDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVV  447

Query  1515  KMGTRLYNQDQLRLALISKL  1456
             ++   L +++ +R A++ ++
Sbjct  448   RIPEGLTSEESMRTAILKRM  467


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 109/187 (58%), Gaps = 7/187 (4%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYK---GEEDKGKRNR  3025
             N  +LQQRL  +I    E W YAIFWQ +  D  G  +L W DGY     G +D  K ++
Sbjct  20    NTPSLQQRLHFIIQNRPEWWAYAIFWQPAK-DPNGNHVLSWADGYCNKDLGSKDCNKLSQ  78

Query  3024  PASSPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQ  2845
             P         RKKV R +++L    +  D S+D +V   EW+++VS+T SF+ G G+ G+
Sbjct  79    PLF--GFDLERKKVNRGIHALFHDSSEIDGSMDGDVATWEWYYMVSVTKSFVVGDGVLGR  136

Query  2844  AFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLM  2665
              F S + +W++ ++ L    CER  +A+  G+RT++C+ +S GV+ELGS D+I + + L+
Sbjct  137   VFSSGAFVWLTDRE-LQCYDCERVTEARMNGIRTLLCVSTSCGVLELGSLDMIKEDWGLV  195

Query  2664  NKVRVLF  2644
                + LF
Sbjct  196   LLAKSLF  202



>ref|XP_006294316.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
 gb|EOA27214.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
Length=409

 Score =   189 bits (479),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 136/190 (72%), Gaps = 10/190 (5%)
 Frame = -3

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             +K  +KR  + +  RE+P +HVEAERQRR  LNQ FYALRAVVP VSKMDK SLL D I 
Sbjct  229   QKLLKKRVTRSSKSREKPRDHVEAERQRRNNLNQLFYALRAVVPKVSKMDKESLLSDTIT  288

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPDMDVDVKV  1666
             YINELK+K++ + S  ++++IQ + +KKEL+           ++  +  +   M+++VKV
Sbjct  289   YINELKAKVDKAVSERNEIEIQLEEVKKELA----------ERRVASSKEPEGMEIEVKV  338

Query  1665  MGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQD  1486
             +   AMI+++ +K+NHP AR+M AL D++LEV HASV V+NDLM+QQA VKM  ++Y Q+
Sbjct  339   IESYAMIKVKSSKQNHPEARMMKALMDMELEVDHASVVVVNDLMVQQATVKMDFKIYTQE  398

Query  1485  QLRLALISKL  1456
             QLR+ LISK+
Sbjct  399   QLRIMLISKI  408


 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 121/183 (66%), Gaps = 12/183 (7%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAE  3004
             +Q+ LQ ++DG    WTYAI+WQ S  D +G ++L WGDG+YKG+ED  ++ +  S+PA+
Sbjct  16    VQKLLQAVLDGTHRGWTYAIYWQPSF-DNSGETVLVWGDGFYKGQEDSKRKTK--STPAD  72

Query  3003  QAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCSSSP  2824
             Q    KV+ EL    S            VTD EWF+L SM+ SF  GSGL G AF +S+P
Sbjct  73    QEPWNKVMLELKPEDSD---------VIVTDIEWFYLKSMSWSFSRGSGLVGHAFSTSTP  123

Query  2823  IWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLF  2644
             +W+SG D++  S  ERA++   FG  T+ CIP +NGV+ELGST+LI QS DL+NK++ LF
Sbjct  124   VWVSGSDQIRRSGIERAKEEGDFGGETIACIPLANGVLELGSTELIPQSSDLINKIQNLF  183

Query  2643  NFN  2635
             N N
Sbjct  184   NLN  186



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   189 bits (481),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 136/201 (68%), Gaps = 16/201 (8%)
 Frame = -3

Query  2025  EKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
             EKR P+KRGRKP +G + P+NHVEAERQRREKLN RFYALR+VVPNVSKMDKASLL DA+
Sbjct  271   EKREPKKRGRKPLSGTQTPMNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAV  330

Query  1848  AYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTT-------PHKIP  1690
              YINELKSK+E  ES       Q +S K ++ T E    D N   TT+       P  + 
Sbjct  331   DYINELKSKIEDLESV-----QQKESKKVKMETMEI--VDNNSATTTSTVVDQKRPCNVN  383

Query  1689  DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKM  1510
               ++DVK++G DAM+R+Q    NHP ARLM  LKDL+ +V HAS+S +N++M+Q   V++
Sbjct  384   AFEIDVKIIGNDAMVRVQSENVNHPGARLMSVLKDLEFQVHHASISTVNEVMVQDVVVRI  443

Query  1509  GTRLYNQDQL-RLALISKLAE  1450
                +  ++ L R A++ KL +
Sbjct  444   PNEMNKEESLIRSAILMKLGQ  464


 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 100/185 (54%), Gaps = 32/185 (17%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPA  3007
             TLQQ+LQ L+    E W YAI WQ +  D  G  LL WG+GY++G ++    N+   S  
Sbjct  25    TLQQKLQFLVQTQSENWVYAILWQTTK-DEKGKPLLSWGEGYFQGTKETTNSNKQNDS--  81

Query  3006  EQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSG----LPGQAF  2839
                         N+  +  A              WF+++S+T  F  G+     LPG++F
Sbjct  82    ------------NTCANKDAE-------------WFYVMSLTRIFSIGNASSISLPGKSF  116

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
                S +W++ + +L    CER+ +A   G+ T++CIP++NGV+E+GS D I Q+++L+++
Sbjct  117   ALDSVLWLNSKHELQIYNCERSNEAHVHGIETLICIPTTNGVIEMGSYDNIQQNWNLVHQ  176

Query  2658  VRVLF  2644
              + +F
Sbjct  177   AKSMF  181



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   189 bits (479),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 20/200 (10%)
 Frame = -3

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             P+KRGRKP  GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+AYIN
Sbjct  271   PKKRGRKPVLGRETPINHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYIN  330

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD----------  1687
             ELK+K+E  ES       Q +   K++ T+     D N   TTT   +            
Sbjct  331   ELKAKIEDLESQ------QPRDSNKKMKTEMTDTLD-NQSATTTSTVVDQSGSGSRLGLG  383

Query  1686  ---MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAV  1516
                ++VDV+++G DAM+R+Q    NHP ARLM AL+DL+ +V HAS+S +NDLM+Q   V
Sbjct  384   PLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVV  443

Query  1515  KMGTRLYNQDQLRLALISKL  1456
             K+   + +++ L+ A+I +L
Sbjct  444   KLPNGMRSEESLKSAIIMRL  463


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 96/188 (51%), Gaps = 33/188 (18%)
 Frame = -3

Query  3138  WTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAEQAHRKKVLRELNSLI  2959
             W YAIFWQAS  D  G   L +G+G+++G     K   P S      ++  +    N  I
Sbjct  41    WVYAIFWQASH-DDNGNLYLSFGEGHFQGT----KETSPKSLTIPTKNKFLMKTPTNDNI  95

Query  2958  SGPAstdesvdeevtdtEWFFLVSMTHSF-------------INGSGLPGQAFCSSSPIW  2818
             +                EWF+++S+T SF              + S LPG++F   S +W
Sbjct  96    ND--------------AEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSLPGKSFALGSVLW  141

Query  2817  ISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNF  2638
              + + +L    CER+ +A   G+ T++CIP+ NGVVE+GS D I Q+++L+  V+ LF+ 
Sbjct  142   QNNRHELQFYNCERSNEAHVHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKSLFH-  200

Query  2637  NNPDMGSI  2614
              +PD  +I
Sbjct  201   TSPDPVTI  208



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   189 bits (479),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 20/200 (10%)
 Frame = -3

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             P+KRGRKP  GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+AYIN
Sbjct  272   PKKRGRKPVLGRETPINHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYIN  331

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD----------  1687
             ELK+K+E  ES       Q +   K++ T+     D N   TTT   +            
Sbjct  332   ELKAKIEDLESQ------QPRDSNKKMKTEMTDTLD-NQSATTTSTVVDQSGSGSRLGLG  384

Query  1686  ---MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAV  1516
                ++VDV+++G DAM+R+Q    NHP ARLM AL+DL+ +V HAS+S +NDLM+Q   V
Sbjct  385   PLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVV  444

Query  1515  KMGTRLYNQDQLRLALISKL  1456
             K+   + +++ L+ A+I +L
Sbjct  445   KLPNGMRSEESLKSAIIMRL  464


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 94/185 (51%), Gaps = 34/185 (18%)
 Frame = -3

Query  3138  WTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAEQAHRKKVLRELNSLI  2959
             W YAIFWQAS  D  G   L +G+G+++G     K   P S      ++  +    N  I
Sbjct  41    WVYAIFWQASH-DDNGNLYLSFGEGHFQGT----KETSPKSLTIPTKNKFLMKTPTNDNI  95

Query  2958  SGPAstdesvdeevtdtEWFFLVSMTHSF--------------INGSGLPGQAFCSSSPI  2821
             +                EWF+++S+T SF               + S LPG++F   S +
Sbjct  96    ND--------------AEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSSLPGKSFALGSVL  141

Query  2820  WISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFN  2641
             W + + +L    CER+ +A   G+ T++CIP+ NGVVE+GS D I Q+++L+  V+ LF+
Sbjct  142   WQNNRHELQFYNCERSNEAHMHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKSLFH  201

Query  2640  FNNPD  2626
               +PD
Sbjct  202   -TSPD  205



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 135/199 (68%), Gaps = 16/199 (8%)
 Frame = -3

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             ++ P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++
Sbjct  302   KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVS  361

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--------  1690
             YINELKSK       +D+L+ Q Q   K++  +   + D     T+     P        
Sbjct  362   YINELKSK-------VDELESQVQRESKKVKVETGDNLDNQSTTTSVEQTRPPNSSASGS  414

Query  1689  -DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVK  1513
               ++++VK++G DAMIR+Q    N+P+ARLM AL+DL+ E+ HAS+S MN+LM+Q   VK
Sbjct  415   TGLEMEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVVVK  474

Query  1512  MGTRLYNQDQLRLALISKL  1456
             +   + +++ ++ AL+  L
Sbjct  475   VPDNMRSEESIKAALLKIL  493


 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 124/216 (57%), Gaps = 22/216 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQAS---VVDFAGPSLLGWGDGYYKGEEDKGKRNR  3025
             N  +LQQRLQ ++    + W+YAIFWQ S    VD  G   L WGDG+++G +D    N 
Sbjct  21    NHPSLQQRLQFILQSQPDWWSYAIFWQTSNDRQVD-NGCLFLTWGDGHFQGPKDASPNNH  79

Query  3024  PASSPAEQAHRKKVLRELNSLISGP----------AstdesvdeevtdtEWFFLVSMTHS  2875
               +     + R+K+L+ + SLI+               +  ++ +VTD EWF++ S+  S
Sbjct  80    HHNPYGVLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNADVTDVEWFYVTSLARS  139

Query  2874  FING----SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVE  2707
             F  G    + +PG+AF S S +W++G  +L    CERA++AQ  G++T+VCIP+  GV+E
Sbjct  140   FSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTPTGVLE  199

Query  2706  LGSTDLILQSFDLMNKVRVLFN----FNNPDMGSIS  2611
             LGS+DLI ++ +L+ +   LF     +  PD G+ S
Sbjct  200   LGSSDLIRENGNLVQQTESLFGADVVWGQPDPGTRS  235



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   187 bits (476),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 137/205 (67%), Gaps = 22/205 (11%)
 Frame = -3

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             ++ P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++
Sbjct  290   KRTPKKRGRKPGMGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVS  349

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTT-----TPHKIPD--  1687
             YINELK+K       +D+L+ Q Q   K++  +   + D     TT     T    PD  
Sbjct  350   YINELKAK-------VDELESQLQRESKKVKVEMADNLDNQSTTTTASVEQTQTVTPDNN  402

Query  1686  --------MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMI  1531
                     ++++VK++G DAMIR+Q    N+P+ARLM A++DL+ ++ HAS+S +NDLM+
Sbjct  403   NNNNNGSGLEIEVKIVGTDAMIRVQSENVNYPSARLMTAMRDLEFQIHHASLSSINDLML  462

Query  1530  QQAAVKMGTRLYNQDQLRLALISKL  1456
             Q   VK+   + N++ L+ AL+  L
Sbjct  463   QDIVVKVPDNMKNEEGLKAALLGIL  487


 Score =   144 bits (363),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 127/201 (63%), Gaps = 14/201 (7%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGK--RNRPASS  3013
             TLQQRLQ ++    E W+YAIFW AS     G  LLGWGDG+++G ED      NR +SS
Sbjct  23    TLQQRLQFILQSQPELWSYAIFWLASNDVENGRLLLGWGDGHFQGPEDPSPDLNNRLSSS  82

Query  3012  ---PAEQAHRKKVLRELNSLISGP--------AstdesvdeevtdtEWFFLVSMTHSFIN  2866
                    + R+K+L+ + S+++               +++ +V+D EWF+++S+T SF  
Sbjct  83    GDGSLLHSDRRKILKGIQSILNDTNNNNPELDMDNFMALNGDVSDAEWFYVMSLTRSFAI  142

Query  2865  GSG-LPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDL  2689
             G G +PG+AF S S +W+SG  +L  + CERA++AQ  G+ T++CIP+SNGV+E+GS+ L
Sbjct  143   GDGSVPGKAFGSGSFVWLSGAHELQFNSCERAKEAQIHGIETLICIPTSNGVLEMGSSGL  202

Query  2688  ILQSFDLMNKVRVLFNFNNPD  2626
             + +++ L+ + + LF  + PD
Sbjct  203   VRENWGLIQQAKSLFGSDQPD  223



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   187 bits (475),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 137/202 (68%), Gaps = 22/202 (11%)
 Frame = -3

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             ++ P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++
Sbjct  302   KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVS  361

Query  1845  YINELKSKLETSESYI------------DDLKIQAQSLKKELSTKEPRHPDPNPKKTTTP  1702
             YINELK+K++  ES +            D+L IQ+ +   E   K P          ++ 
Sbjct  362   YINELKTKVDELESQVQRESKKVKVETGDNLDIQSTTTSVEQIAKPP----------SSS  411

Query  1701  HKIPDMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQA  1522
                  ++V+VK++G DAMIR+Q    N+P+ARLM AL+DL+L++ HAS+S +N+LM+Q  
Sbjct  412   ANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHHASLSCINELMLQDI  471

Query  1521  AVKMGTRLYNQDQLRLALISKL  1456
              +K+   + ++D L+ AL+  L
Sbjct  472   VLKVPENMRSEDSLKSALLRIL  493


 Score =   120 bits (300),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 117/198 (59%), Gaps = 21/198 (11%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFA--GPSLLGWGDGYYKGEEDKGKR--NRPA  3019
             +LQQRLQ ++    + W+YAIFWQ S  D    G   L WGDG+++G +D   +  N P 
Sbjct  24    SLQQRLQFIVQSQPDWWSYAIFWQPSN-DHQDNGRLFLTWGDGHFQGSKDPSAKHHNNPY  82

Query  3018  SSPAEQAHRKKVLRELNSLISG--------PAstdesvdeevtdtEWFFLVSMTHSFING  2863
                +E   R+K+L+ + SLI+                +D +V+D EWF+++S+  SF  G
Sbjct  83    GILSE---RRKILKGIQSLINDNNPDHHQDSIMDHMGLDADVSDGEWFYVMSLARSFSIG  139

Query  2862  -----SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGS  2698
                  + +PG+AF S S +W++G  +L    C+RA++AQ  G +T+VCIP+  GV+E+GS
Sbjct  140   ETTISASVPGKAFSSGSVVWLTGSHELQFYNCDRAKEAQMHGFQTLVCIPTPTGVLEMGS  199

Query  2697  TDLILQSFDLMNKVRVLF  2644
             +D I +++ L+ + + LF
Sbjct  200   SDSIRENWSLVQQAKSLF  217



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   186 bits (472),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 135/198 (68%), Gaps = 16/198 (8%)
 Frame = -3

Query  2016  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  1837
             P+KRGRKP  GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+AYI+
Sbjct  270   PKKRGRKPILGRETPVNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYIS  329

Query  1836  ELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPD-----------PNPKKTTTPHKIP  1690
             ELK+K+E  ES     +  ++ +K E++     H             P P+   +P    
Sbjct  330   ELKAKIEYLES--QQPRDSSKKVKTEMTDTLDNHSTTTISTVVDQSGPEPRLGPSPL---  384

Query  1689  DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKM  1510
              ++VDVK++G DAM+R+Q    NHP ARLM AL+DL+ +V HAS+S +NDLM+Q   VK+
Sbjct  385   GLEVDVKIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVVKL  444

Query  1509  GTRLYNQDQLRLALISKL  1456
                + +++ L+ A++ +L
Sbjct  445   PNGMRSEEGLKSAILMRL  462


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 95/172 (55%), Gaps = 26/172 (15%)
 Frame = -3

Query  3138  WTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAEQAHRKKVLRELNSLI  2959
             W YAIFWQAS  D  G   L +G+G+++G ++   ++    +       KK +R      
Sbjct  43    WVYAIFWQASH-DDNGNLYLSFGEGHFQGTKETSPKSLTIPT-------KKFMR------  88

Query  2958  SGPAstdesvdeevtdtEWFFLVSMTHSF-INGSG------LPGQAFCSSSPIWISGQDK  2800
                     +    + D EWF++VS+T +F +N +       LPG++F   S +W++   +
Sbjct  89    -----APTNDTNNINDAEWFYVVSLTRTFAVNNNASSSSSSLPGKSFALGSVLWLNNMHE  143

Query  2799  LLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLF  2644
             L    CER+ +AQ  G+ T++CIP+ NGVVE+GS D I Q+++L+  V+ LF
Sbjct  144   LQFYNCERSNEAQVHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKSLF  195



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   186 bits (472),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 135/198 (68%), Gaps = 6/198 (3%)
 Frame = -3

Query  2025  EKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
             EKR P+KRGRKP  GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+
Sbjct  300   EKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAV  359

Query  1848  AYINELKSKLETSESYID----DLKIQAQSLKKELSTKEPRHPDPNP-KKTTTPHKIPDM  1684
             +YINELK+K+E  ES +      +K++        ST         P   ++       +
Sbjct  360   SYINELKAKIEELESQLQRECKKVKVEMVDAMDNQSTTTSVDQAARPSNSSSGTAGSGGL  419

Query  1683  DVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVKMGT  1504
             + D+K+MG DAMIR+Q    N+P+ARLM+AL+DL+ +V HAS+S +N+LM+Q   V++  
Sbjct  420   EFDIKIMGNDAMIRVQSENVNYPSARLMIALRDLEFQVHHASMSCVNELMLQDIVVRVPD  479

Query  1503  RLYNQDQLRLALISKLAE  1450
              L  ++ L+ AL+ +L +
Sbjct  480   GLRTEEGLKSALLRRLEQ  497


 Score =   137 bits (346),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 116/185 (63%), Gaps = 5/185 (3%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKR--NRPASS  3013
             TLQQRLQ +I   ++ W YAIFWQ S  D  G   L WGDG+++G +D   +     ++ 
Sbjct  25    TLQQRLQFVIQSQQDWWAYAIFWQTSN-DEHGRLFLTWGDGHFQGTKDTSPKLGANISNI  83

Query  3012  PAEQAHRKKVLRELNSLI--SGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAF  2839
             P     R+KV++ + +LI  +           ++TD EWF+++S+T SF  G G+PG+A 
Sbjct  84    PGLNNERRKVMKGIQALIGDNHDIDMSMIDGTDITDAEWFYVMSLTRSFSAGDGIPGKAL  143

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
              + S +W++G  +L    CERAR+AQ   + T+VCIP+S GV+ELGS+++I +++ L+ +
Sbjct  144   STGSLVWLTGAHELQFYNCERAREAQMHAIETLVCIPTSCGVLELGSSEMIRENWGLVQQ  203

Query  2658  VRVLF  2644
             V+ +F
Sbjct  204   VKSVF  208



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   186 bits (472),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 132/199 (66%), Gaps = 16/199 (8%)
 Frame = -3

Query  2025  EKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIA  1846
             ++ P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++
Sbjct  302   KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVS  361

Query  1845  YINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIP--------  1690
             YINELK K       +D+L+ Q Q   K++  +   + D     T+     P        
Sbjct  362   YINELKXK-------VDELESQVQRESKKVKVETGDNLDNQSTTTSVEQTRPPNSSASGS  414

Query  1689  -DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAAVK  1513
                + +VK++G DAMIR+Q    N+P+ARLM AL+DL+ E+ HAS+S MN+LM+Q   VK
Sbjct  415   TGFETEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVVVK  474

Query  1512  MGTRLYNQDQLRLALISKL  1456
             +   + +++ ++ AL+  L
Sbjct  475   VPBNMRSEESIKAALLKIL  493


 Score =   130 bits (327),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 123/216 (57%), Gaps = 22/216 (10%)
 Frame = -3

Query  3195  NQETLQQRLQTLIDGARETWTYAIFWQAS---VVDFAGPSLLGWGDGYYKGEEDKGKRNR  3025
             N  +LQQRLQ ++    + W+YAIFWQ S    VD  G   L WGDG+++G +D    N 
Sbjct  21    NHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHQVD-NGRLFLTWGDGHFQGPKDASPNNH  79

Query  3024  PASSPAEQAHRKKVLRELNSLISGP----------AstdesvdeevtdtEWFFLVSMTHS  2875
               +     + R+K+L+ + SLI+               +  ++  VT+ EWF++ S+  S
Sbjct  80    HHNPYGGLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNAXVTNVEWFYVTSLARS  139

Query  2874  FING----SGLPGQAFCSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVE  2707
             F  G    + +PG+AF S S +W++G  +L    CERA++AQ  G++T+VCIP+  GV+E
Sbjct  140   FSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTPTGVLE  199

Query  2706  LGSTDLILQSFDLMNKVRVLFN----FNNPDMGSIS  2611
             LGS+DLI ++ +L+ +   LF     +  PD G+ S
Sbjct  200   LGSSDLIRENXNLVQQTESLFGSDVVWGQPDPGTRS  235



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   186 bits (472),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 140/223 (63%), Gaps = 27/223 (12%)
 Frame = -3

Query  2067  KEADSRAVETLAAAEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  1891
             + +DS         EKR P+KRGRKP  GR+ PLNHVEAERQRREKLN RFYALRAVVPN
Sbjct  281   EHSDSDCPLVAVTVEKRVPKKRGRKPRLGRDAPLNHVEAERQRREKLNHRFYALRAVVPN  340

Query  1890  VSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKT  1711
             VS+MDKASLL DA++YINELK+K       +D+L+ Q     K++  +     D N   T
Sbjct  341   VSRMDKASLLADAVSYINELKAK-------VDELESQVHKESKKVKLEMADTTD-NQSTT  392

Query  1710  TTPHKIPD------------------MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKD  1585
             T+  +                     ++V++K++G DAMIR+Q    NHP+ARLM AL+D
Sbjct  393   TSVDQTGPTPPPPPPPPSSATGGGVALEVEIKIVGPDAMIRVQSDNHNHPSARLMGALRD  452

Query  1584  LDLEVTHASVSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             L+ +V HAS+S +NDLM+Q   V++  R  N+D L+ AL+  L
Sbjct  453   LEFQVHHASMSSINDLMLQDVVVRLPDRFRNEDALKSALLPLL  495


 Score =   137 bits (346),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 124/215 (58%), Gaps = 23/215 (11%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRN---RPAS  3016
             +LQ+RLQ ++    E W YAIFWQ +  D  G   L WGDG+++G +    R    R   
Sbjct  34    SLQERLQFIVQSQAEWWAYAIFWQ-TCNDDNGRIFLAWGDGHFQGGKGMVPRQLGLRGDQ  92

Query  3015  SPAEQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFC  2836
             S A    RKK ++ + +LI+     D  +D +VTD EWF+++S+T  F  G G+PG+A  
Sbjct  93    SRAGLFTRKKAIKGIQALITENPDMDGLMDGDVTDVEWFYVMSLTRCFSAGDGVPGKALS  152

Query  2835  SSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKV  2656
             S S +W++G  +L+   CERA++AQ  G+ T VCIP+ NGV+ELGS+D+I +++ L+ + 
Sbjct  153   SGSLVWLTGAQELMFYNCERAKEAQIHGIDTFVCIPTGNGVLELGSSDVIRENWGLVQQA  212

Query  2655  RVLF-------------------NFNNPDMGSISG  2608
             + LF                   +F+  D+G ISG
Sbjct  213   KSLFGSDHFIGLVSKHSPPSAPIHFSFADIGIISG  247



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 138/214 (64%), Gaps = 18/214 (8%)
 Frame = -3

Query  2058  DSRAVETLAAAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKM  1879
             DS +   L   +K P+KRGRKP   RE PLNHVEAERQRREKLN RFYALR+VVP+V+KM
Sbjct  240   DSDSDCQLLVEKKTPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYALRSVVPHVTKM  299

Query  1878  DKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPH  1699
             DKASLL DA++YINELKSK+   E+     ++  +S K ++   +    D N   TT  +
Sbjct  300   DKASLLSDAVSYINELKSKVAELET-----QLTRKSKKLKIECTDSFSIDNNSTATTITN  354

Query  1698  KIPDM-------------DVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHAS  1558
              +  +             +V+VK++G DAM+R+Q    N+P+ RLM AL+DL+L V HAS
Sbjct  355   SVDQIRHNSFGVHSNLKVEVEVKILGPDAMVRVQSENVNYPSTRLMRALQDLELHVHHAS  414

Query  1557  VSVMNDLMIQQAAVKMGTRLYNQDQLRLALISKL  1456
             +S +ND+M+Q   VK+   L  +D+L+ ALI  +
Sbjct  415   ISSVNDIMLQDIVVKVPIGLSTEDRLKNALIRSI  448


 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 120/189 (63%), Gaps = 6/189 (3%)
 Frame = -3

Query  3183  LQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPAE  3004
             LQQ+LQ ++    ++W+YAIFWQ +  D  G   L WGDG++ G + K        S  +
Sbjct  28    LQQKLQNILKIQTDSWSYAIFWQTTNDDDDGHLFLAWGDGHFHGTKSKT----GVQSSEQ  83

Query  3003  QAHRKKVLRELNSLI--SGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCSS  2830
                RK V++ + +LI  +G    D+  D+EVTD EWF+++S+  SF  G G+PG+AF ++
Sbjct  84    STERKNVIKGIQALICENGDEKVDDDDDDEVTDAEWFYVMSLAQSFSIGDGVPGKAFSTA  143

Query  2829  SPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRV  2650
             S IW++G   L    C+RA++A   G++T VCIP+SNGV+E+GS  LI +++ L+ +V+ 
Sbjct  144   SIIWLTGSQNLQFHTCKRAKEAHLHGIQTFVCIPTSNGVIEMGSNQLIKENWVLIQQVKS  203

Query  2649  LFNFNNPDM  2623
             +FN + P +
Sbjct  204   IFNNSIPHI  212



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score =   185 bits (470),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 140/209 (67%), Gaps = 5/209 (2%)
 Frame = -3

Query  2067  KEADSRAVETLAAAEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  1891
             + +DS         EKR P+KRGRKP+ GRE PLNHVEAERQRREKLN RFYALRAVVPN
Sbjct  276   EHSDSDCPLVAPTVEKRTPKKRGRKPSLGRETPLNHVEAERQRREKLNHRFYALRAVVPN  335

Query  1890  VSKMDKASLLGDAIAYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKT  1711
             VS+MDKASLL DA+ YINELK+K++  +S +   + Q++ +K E++              
Sbjct  336   VSRMDKASLLSDAVCYINELKAKIDELDSQLQ--RDQSKRVKLEVTDNTDNQSTITSVDQ  393

Query  1710  TTPHKIP--DMDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDL  1537
               P  I    +D++VK++G DAMIR+Q    N+PAA+L+ AL+DL+ +V HAS+S +N+L
Sbjct  394   ARPSPISGFTLDIEVKILGDDAMIRVQSENVNYPAAKLLTALRDLEFQVHHASMSTVNEL  453

Query  1536  MIQQAAVKMGTRLYNQDQLRLALISKLAE  1450
             M+Q   V++      ++ ++ AL+ +L +
Sbjct  454   MLQDVVVRVPDGFRTEEGMKNALLRRLEQ  482


 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 107/180 (59%), Gaps = 11/180 (6%)
 Frame = -3

Query  3144  ETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKR-----NR-PASSPAEQAHRKKV  2983
             + W+YAIFWQ S  D  G   L WGDG+++       +     NR PA +  E   RK  
Sbjct  39    DRWSYAIFWQTSN-DDNGRIFLAWGDGHFQSSRQTPPKLTTINNRIPAINSGE---RKIA  94

Query  2982  LRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSGLPGQAFCSSSPIWISGQD  2803
             ++ +++L  G  +  +    + T+ EWF+++S+T SF  G G+PG+   + S +W++G  
Sbjct  95    MKGIHALF-GNNNDIDCSMMDDTNAEWFYVMSLTRSFSAGEGIPGKVLSTGSLVWLTGAQ  153

Query  2802  KLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNKVRVLFNFNNPDM  2623
             +L    CERA++AQ  GL T+VCIP+ NGV+ELGS D+I +++ L+ + + LF  +  D+
Sbjct  154   ELRYYNCERAKEAQMHGLETLVCIPTYNGVLELGSCDVIRENWGLVQEAKSLFGSDLVDL  213



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   184 bits (467),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 138/201 (69%), Gaps = 23/201 (11%)
 Frame = -3

Query  2025  EKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI  1849
             EKR P+KRGRKP  G   P++HVEAERQRREK+N RFYALRAVVPNVS+MDKASLL DA+
Sbjct  281   EKREPKKRGRKPLLGNPTPMSHVEAERQRREKINHRFYALRAVVPNVSRMDKASLLSDAV  340

Query  1848  AYINELKSKLETSESYIDDLKIQAQSLKKELSTKEPRHPDPNPKKTTTPHKIPD------  1687
              +INELKSK       I +L+++ Q   KEL  K+ +  + + + T T   + D      
Sbjct  341   DFINELKSK-------IVELELEQQ---KEL--KKLKIENMDNQSTATTSTVVDQKRISC  388

Query  1686  ----MDVDVKVMGWDAMIRIQCTKKNHPAARLMVALKDLDLEVTHASVSVMNDLMIQQAA  1519
                 +++DVK++G DAM+R+QC   NHP ARLM  LKDL+ +V HAS+S +N++M+Q   
Sbjct  389   NNISLEIDVKIIGGDAMVRVQCENVNHPGARLMSVLKDLEFQVHHASISCVNEIMVQDVV  448

Query  1518  VKMGTRLYNQDQLRLALISKL  1456
             V++   + N+++LR A++ +L
Sbjct  449   VQVPINMRNEERLRSAILMRL  469


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 116/254 (46%), Gaps = 57/254 (22%)
 Frame = -3

Query  3186  TLQQRLQTLIDGARETWTYAIFWQASVVDFAGPSLLGWGDGYYKGEEDKGKRNRPASSPA  3007
             TL+Q+LQ L+      W YAIFWQ +  D      L WG+G++              +  
Sbjct  34    TLEQKLQFLLQAQPNHWVYAIFWQTTK-DERDNIFLTWGEGHFH------------DTKE  80

Query  3006  EQAHRKKVLRELNSLISGPAstdesvdeevtdtEWFFLVSMTHSFINGSG----LPGQAF  2839
                   + + + ++  +G A               F+++S++ +F  G+     LPG+AF
Sbjct  81    TTTTSSETVNDNDTCTNGDALL-------------FYIMSLSRTFSVGNSSSNSLPGKAF  127

Query  2838  CSSSPIWISGQDKLLSSPCERARQAQTFGLRTMVCIPSSNGVVELGSTDLILQSFDLMNK  2659
               +S +W++ + +L    C+R+ +A   G+ T++CIP++NGV+E+GS + I Q+++L+++
Sbjct  128   ALNSVLWLNSKHELQFYNCDRSNEAHVHGIETLICIPTTNGVIEMGSYENIQQNWNLVHQ  187

Query  2658  VRVLF---------------------------NFNNPDMGSISGSASWAAPPENDPSALW  2560
              + +F                           N    D+G ISG+       +   +  W
Sbjct  188   AKSMFQTSLSESNSKLDLFSTDPLDRIKTFDQNILFTDVGIISGTGEETDEMQKMMNRTW  247

Query  2559  LTEPTSSSGVDVNT  2518
             L +P + S   V++
Sbjct  248   LQKPKTVSSCYVDS  261



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11094634769414