BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15287_g3_i1 len=817 path=[1061:0-816]

Length=817
                                                                      Score     E

ref|XP_009761202.1|  PREDICTED: pectinesterase                          288   9e-90   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     288   1e-89   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    288   1e-89   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     287   2e-89   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     286   6e-89   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     285   2e-88   
emb|CDO98832.1|  unnamed protein product                                283   2e-87   
emb|CDO98833.1|  unnamed protein product                                278   1e-85   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     271   9e-83   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          270   2e-82   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     268   4e-82   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     259   2e-78   
emb|CDO98834.1|  unnamed protein product                                258   6e-78   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     256   5e-77   
gb|EPS70728.1|  pectinesterase                                          252   9e-76   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     251   1e-75   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     251   1e-75   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     253   1e-75   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     248   2e-74   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     247   5e-74   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                248   7e-74   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     246   9e-74   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                246   9e-74   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                246   2e-73   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     246   2e-73   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                246   2e-73   
gb|EPS72184.1|  pectinesterase family protein                           246   2e-73   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    245   5e-73   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    245   6e-73   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     244   8e-73   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    238   2e-72   Petunia integrifolia [violet-flowered petunia]
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    242   6e-72   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    235   2e-71   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    239   8e-71   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    239   1e-70   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    238   2e-70   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                238   2e-70   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                238   2e-70   
gb|EPS59322.1|  pectinesterase                                          237   2e-70   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     237   4e-70   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     236   9e-70   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    236   1e-69   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     236   1e-69   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    238   2e-69   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     234   4e-69   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    235   4e-69   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     234   5e-69   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 235   5e-69   Ricinus communis
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         234   5e-69   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    234   9e-69   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    233   2e-68   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    233   2e-68   
ref|XP_002314364.1|  putative pectinesterase family protein             233   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             233   2e-68   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         233   2e-68   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         233   3e-68   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    234   3e-68   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     233   3e-68   
gb|EPS66910.1|  pectinesterase family protein                           220   8e-68   
gb|EYU33104.1|  hypothetical protein MIMGU_mgv1a012115mg                222   1e-67   
emb|CDY19737.1|  BnaA09g03900D                                          229   1e-67   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    231   2e-67   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     230   2e-67   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    230   3e-67   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    229   8e-67   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             228   9e-67   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     228   1e-66   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    229   1e-66   
gb|AEL79481.1|  pectin methylesterase-like protein                      228   1e-66   
emb|CDY05188.1|  BnaC05g46150D                                          229   1e-66   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    228   1e-66   
emb|CDY27751.1|  BnaA05g31600D                                          229   1e-66   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    228   1e-66   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    231   1e-66   
ref|XP_002872255.1|  pectinesterase family protein                      229   2e-66   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    231   2e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99968.1|  BnaC09g03330D                                          230   2e-66   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             228   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          228   3e-66   
emb|CDY40719.1|  BnaC03g34350D                                          224   4e-66   
ref|XP_002865716.1|  pectinesterase family protein                      226   6e-66   
emb|CDO99718.1|  unnamed protein product                                226   7e-66   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             229   9e-66   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    226   1e-65   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 226   1e-65   Ricinus communis
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    226   1e-65   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          226   2e-65   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    225   2e-65   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     224   2e-65   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                225   3e-65   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          225   4e-65   
ref|XP_006382447.1|  pectin methylesterase family protein               224   5e-65   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             224   5e-65   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    225   6e-65   
ref|XP_002884519.1|  pectinesterase family protein                      226   7e-65   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             224   7e-65   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          223   8e-65   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          224   9e-65   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     224   9e-65   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             224   1e-64   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             226   1e-64   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    223   1e-64   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             224   1e-64   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     223   1e-64   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     223   1e-64   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    224   1e-64   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    224   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    223   2e-64   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    226   2e-64   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             222   3e-64   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    222   4e-64   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    222   5e-64   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    221   6e-64   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    224   6e-64   
emb|CDX74137.1|  BnaA03g29100D                                          224   6e-64   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    221   6e-64   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    221   7e-64   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    224   7e-64   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    221   7e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KEH15723.1|  pectinesterase                                          211   8e-64   
dbj|BAC42986.1|  putative pectinesterase                                223   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     220   8e-64   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    221   9e-64   
gb|KHN16553.1|  Pectinesterase 2                                        217   1e-63   
dbj|BAK05856.1|  predicted protein                                      221   1e-63   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    221   1e-63   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          221   1e-63   
gb|ABK24761.1|  unknown                                                 220   1e-63   Picea sitchensis
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    221   1e-63   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                224   2e-63   
emb|CBI22967.3|  unnamed protein product                                226   2e-63   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    220   2e-63   
emb|CBI39537.3|  unnamed protein product                                223   2e-63   
gb|AAF16637.1|AC011661_15  T23J18.24                                    209   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             221   3e-63   
gb|AAQ21125.1|  pectinesterase                                          208   4e-63   Fragaria x ananassa
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    219   4e-63   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    219   4e-63   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    222   4e-63   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    217   4e-63   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    219   5e-63   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          219   5e-63   Vitis vinifera
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                221   5e-63   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    219   5e-63   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    218   5e-63   
emb|CDX80613.1|  BnaC07g28310D                                          221   6e-63   
gb|EPS69059.1|  hypothetical protein M569_05708                         225   6e-63   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    221   6e-63   
emb|CBI26012.3|  unnamed protein product                                219   6e-63   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    219   6e-63   
gb|KEH21378.1|  pectinesterase                                          213   6e-63   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    219   8e-63   
emb|CDY24663.1|  BnaA05g30620D                                          218   8e-63   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    219   9e-63   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    219   9e-63   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    218   1e-62   
emb|CDY68790.1|  BnaAnng28400D                                          220   1e-62   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     218   1e-62   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    218   1e-62   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    218   1e-62   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    218   1e-62   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    219   1e-62   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    216   1e-62   
emb|CAA96436.1|  pectin methylesterase                                  209   1e-62   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    219   1e-62   
emb|CDP19930.1|  unnamed protein product                                218   2e-62   
gb|AFC98398.1|  pectin methylesterase                                   217   2e-62   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    217   2e-62   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    214   2e-62   
emb|CAA96434.1|  pectin methylesterase                                  210   3e-62   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CAA96435.1|  pectin methylesterase                                  210   3e-62   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDO97717.1|  unnamed protein product                                208   3e-62   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     218   3e-62   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             217   4e-62   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     216   4e-62   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    218   4e-62   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     216   4e-62   
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    217   4e-62   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          217   4e-62   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    218   4e-62   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     216   5e-62   
tpg|DAA44943.1|  TPA: hypothetical protein ZEAMMB73_754551              212   5e-62   
ref|XP_003630894.1|  Pectinesterase                                     209   5e-62   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             216   5e-62   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 214   6e-62   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          217   6e-62   Sorghum bicolor [broomcorn]
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    215   7e-62   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    218   7e-62   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     216   8e-62   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             215   9e-62   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             216   9e-62   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               215   9e-62   Ricinus communis
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    215   1e-61   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          217   1e-61   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     215   1e-61   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    215   1e-61   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     215   1e-61   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     215   1e-61   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    215   1e-61   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     215   1e-61   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     215   1e-61   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    215   2e-61   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             214   2e-61   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    214   2e-61   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             214   2e-61   
dbj|BAK06954.1|  predicted protein                                      214   2e-61   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     214   2e-61   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               214   2e-61   Ricinus communis
ref|XP_010654104.1|  PREDICTED: pectinesterase                          214   2e-61   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     213   2e-61   Vitis vinifera
emb|CDY57858.1|  BnaC08g47740D                                          212   2e-61   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    216   2e-61   
emb|CDP21547.1|  unnamed protein product                                216   2e-61   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     214   2e-61   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         207   3e-61   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    214   3e-61   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 213   3e-61   
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...    216   3e-61   
gb|EAZ09211.1|  hypothetical protein OsI_31486                          210   3e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     205   3e-61   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    216   3e-61   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    213   3e-61   
ref|XP_010273994.1|  PREDICTED: pectinesterase 2-like                   206   3e-61   
gb|KHN34209.1|  Putative pectinesterase/pectinesterase inhibitor 13     213   3e-61   
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     205   3e-61   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          214   3e-61   
ref|NP_172624.1|  methylesterase PCR A                                  213   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    213   4e-61   
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   205   4e-61   
gb|AAK59760.1|  At1g11580/T23J18_33                                     213   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882495.1|  pectinesterase family protein                      214   4e-61   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    213   4e-61   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             213   4e-61   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    213   4e-61   
emb|CDY05295.1|  BnaC05g45080D                                          213   5e-61   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    214   5e-61   
ref|XP_006287480.1|  hypothetical protein CARUB_v10000691mg             213   5e-61   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     212   6e-61   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    214   6e-61   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     218   6e-61   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    215   6e-61   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     213   6e-61   
emb|CDY71928.1|  BnaCnng75130D                                          208   6e-61   
gb|AAN84553.1|  methyl pectinesterase                                   204   7e-61   Lolium perenne [perennial ryegrass]
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     213   7e-61   
emb|CDY34642.1|  BnaC08g42010D                                          210   7e-61   
ref|XP_007031046.1|  Pectinesterase-2 precursor                         213   8e-61   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    213   8e-61   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    214   8e-61   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    216   9e-61   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    213   9e-61   
gb|ABK94644.1|  unknown                                                 206   9e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    208   9e-61   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    213   9e-61   
emb|CBI38888.3|  unnamed protein product                                204   1e-60   
gb|EPS65387.1|  pectinesterase                                          212   1e-60   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     212   1e-60   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 212   1e-60   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    212   1e-60   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              212   1e-60   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      211   1e-60   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    211   1e-60   
gb|AAF63815.1|  pectin methylesterase, putative                         212   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   212   2e-60   
dbj|BAC42959.2|  putative pectin methylesterase                         212   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-60   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    212   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   211   2e-60   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    211   2e-60   Citrus sinensis [apfelsine]
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               211   2e-60   Ricinus communis
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     211   2e-60   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    212   2e-60   
gb|EPS66234.1|  hypothetical protein M569_08543                         212   3e-60   
ref|XP_010422610.1|  PREDICTED: probable pectinesterase/pectinest...    210   3e-60   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             210   3e-60   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             211   3e-60   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    210   3e-60   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          210   3e-60   Vitis vinifera
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             210   3e-60   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     216   3e-60   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    212   4e-60   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 209   4e-60   
gb|EPS69324.1|  hypothetical protein M569_05439                         211   4e-60   
emb|CBI27741.3|  unnamed protein product                                206   5e-60   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-60   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          210   5e-60   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   211   5e-60   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-60   
dbj|BAK06157.1|  predicted protein                                      216   5e-60   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    210   5e-60   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             210   5e-60   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               210   5e-60   
emb|CDP05792.1|  unnamed protein product                                208   6e-60   
gb|EAY94391.1|  hypothetical protein OsI_16158                          211   6e-60   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    210   6e-60   
ref|XP_006597897.1|  PREDICTED: putative pectinesterase/pectinest...    212   6e-60   
ref|XP_002324181.2|  pectinesterase family protein                      211   6e-60   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    210   7e-60   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            210   7e-60   
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    209   7e-60   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     210   7e-60   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   209   7e-60   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    211   8e-60   
ref|XP_002889876.1|  At1g11580/T23J18_33                                210   8e-60   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    210   8e-60   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             210   8e-60   
ref|NP_001063246.1|  Os09g0433700                                       211   8e-60   
ref|NP_001052981.1|  Os04g0458900                                       210   9e-60   
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    205   9e-60   
ref|NP_001042866.1|  Os01g0312500                                       207   9e-60   
gb|EAY94388.1|  hypothetical protein OsI_16156                          210   1e-59   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     209   1e-59   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-59   
emb|CDY34927.1|  BnaA01g32580D                                          209   1e-59   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        209   1e-59   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               209   1e-59   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-59   
emb|CAH67075.1|  OSIGBa0097P08.5                                        210   1e-59   
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-59   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     209   1e-59   
emb|CDY33925.1|  BnaA02g30620D                                          209   1e-59   
gb|EAY95754.1|  hypothetical protein OsI_17629                          214   1e-59   
emb|CAH68135.1|  B0414F07.5                                             214   1e-59   
ref|NP_001054042.1|  Os04g0641200                                       214   1e-59   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-59   
gb|KHN10486.1|  Putative pectinesterase/pectinesterase inhibitor 13     211   1e-59   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-59   
emb|CBI37070.3|  unnamed protein product                                201   1e-59   
ref|XP_010058465.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-59   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    210   2e-59   
ref|NP_001275775.1|  pectinesterase 2 precursor                         208   2e-59   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         209   2e-59   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          209   2e-59   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          209   2e-59   
ref|XP_006587076.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    209   2e-59   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     207   2e-59   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    208   2e-59   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          211   2e-59   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     210   2e-59   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     208   2e-59   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    209   3e-59   
ref|XP_010098738.1|  Pectinesterase 3                                   209   3e-59   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    209   3e-59   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     208   3e-59   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    208   3e-59   
gb|ACJ85756.1|  unknown                                                 204   3e-59   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               209   3e-59   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    209   3e-59   
ref|XP_003591164.1|  Pectinesterase                                     209   3e-59   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    208   3e-59   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    209   3e-59   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             208   3e-59   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   207   3e-59   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             209   4e-59   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             206   4e-59   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    209   4e-59   
gb|ABZ89800.1|  pectin methylesterase-like protein                      209   4e-59   
ref|XP_006344844.1|  PREDICTED: probable pectinesterase/pectinest...    207   4e-59   
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             206   4e-59   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          208   4e-59   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    208   5e-59   
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...    208   5e-59   
ref|XP_007138601.1|  hypothetical protein PHAVU_009G222600g             209   5e-59   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   207   5e-59   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         207   5e-59   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   207   5e-59   
gb|EAZ07185.1|  hypothetical protein OsI_29431                          209   5e-59   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    208   6e-59   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                208   6e-59   
ref|XP_003591166.1|  Pectinesterase                                     208   6e-59   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    207   7e-59   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 207   7e-59   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             207   7e-59   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    207   7e-59   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     207   7e-59   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             207   7e-59   
ref|XP_007012506.1|  Pectinesterase                                     208   7e-59   
gb|ABQ42392.1|  pectin methylesterase-like protein                      208   8e-59   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                208   8e-59   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    211   8e-59   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    206   8e-59   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    207   9e-59   
gb|ACR34431.1|  unknown                                                 204   9e-59   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    207   9e-59   
ref|XP_010496744.1|  PREDICTED: pectinesterase/pectinesterase inh...    201   1e-58   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    207   1e-58   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     207   1e-58   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             207   1e-58   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     206   1e-58   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   204   1e-58   
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                205   1e-58   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          206   1e-58   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    206   1e-58   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    206   1e-58   
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     198   1e-58   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   197   1e-58   
ref|XP_003604119.1|  Pectinesterase                                     208   1e-58   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          207   1e-58   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     206   2e-58   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 207   2e-58   
ref|XP_002317208.1|  pectin methylesterase family protein               206   2e-58   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          206   2e-58   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     207   2e-58   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    206   2e-58   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    206   2e-58   
ref|XP_010692199.1|  PREDICTED: probable pectinesterase/pectinest...    203   2e-58   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    206   2e-58   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    206   2e-58   
gb|AAF23891.1|  pectin methyl esterase                                  206   2e-58   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    206   2e-58   
emb|CDP00815.1|  unnamed protein product                                206   2e-58   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           199   2e-58   
emb|CDY08030.1|  BnaC03g34930D                                          197   2e-58   
gb|EEC70505.1|  hypothetical protein OsI_01594                          206   3e-58   
ref|NP_001274785.1|  pectin methyl esterase                             206   3e-58   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             205   3e-58   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460          207   3e-58   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    207   3e-58   
gb|KHN25547.1|  Pectinesterase 2                                        201   3e-58   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        205   3e-58   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    206   3e-58   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     206   3e-58   
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     205   3e-58   
gb|AGG23325.1|  pectin methylesterase 1                                 206   3e-58   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   203   3e-58   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    210   4e-58   
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    204   4e-58   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          206   4e-58   
ref|XP_009762316.1|  PREDICTED: probable pectinesterase/pectinest...    204   4e-58   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     205   4e-58   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     205   5e-58   
gb|ACQ85264.1|  pectin methylesterase                                   205   5e-58   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        204   5e-58   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     205   5e-58   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         202   5e-58   
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     205   5e-58   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   201   6e-58   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    204   6e-58   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 205   6e-58   
gb|EMT05022.1|  Pectinesterase 3                                        203   6e-58   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     206   6e-58   
emb|CDY41145.1|  BnaA09g38700D                                          204   6e-58   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            205   6e-58   
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    204   6e-58   
ref|XP_010417837.1|  PREDICTED: probable pectinesterase/pectinest...    200   7e-58   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     203   7e-58   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     205   7e-58   
ref|XP_010917364.1|  PREDICTED: pectinesterase                          204   7e-58   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     204   8e-58   
emb|CDO97787.1|  unnamed protein product                                197   8e-58   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     205   8e-58   
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    204   8e-58   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    202   9e-58   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             204   9e-58   
ref|XP_009771843.1|  PREDICTED: probable pectinesterase/pectinest...    205   9e-58   
ref|XP_008789972.1|  PREDICTED: probable pectinesterase/pectinest...    205   9e-58   
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     204   9e-58   
ref|XP_009771844.1|  PREDICTED: probable pectinesterase/pectinest...    205   9e-58   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     205   9e-58   
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg             205   1e-57   
ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    203   1e-57   
ref|XP_003591168.1|  Pectinesterase                                     205   1e-57   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    204   1e-57   
ref|XP_008803383.1|  PREDICTED: pectinesterase                          204   1e-57   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          204   1e-57   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    204   1e-57   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     203   1e-57   
emb|CAA64217.1|  pectinmethylesterase                                   198   1e-57   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          204   1e-57   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   203   1e-57   
ref|XP_009594446.1|  PREDICTED: probable pectinesterase/pectinest...    203   1e-57   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 204   1e-57   
ref|NP_001132793.1|  pectinesterase                                     205   1e-57   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     204   1e-57   
ref|XP_002876579.1|  pectinesterase family protein                      203   1e-57   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 204   1e-57   
gb|AAO11616.1|  At2g47550/T30B22.15                                     199   1e-57   
emb|CAD29733.1|  pectin methylesterase                                  204   1e-57   
gb|AHC69829.1|  pectin methylesterase PME2.1                            204   1e-57   
ref|XP_010431115.1|  PREDICTED: probable pectinesterase 56              201   1e-57   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     204   2e-57   
gb|KDP23441.1|  hypothetical protein JCGZ_23274                         204   2e-57   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     204   2e-57   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          203   2e-57   
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             204   2e-57   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    202   2e-57   
ref|NP_001049858.1|  Os03g0300500                                       204   2e-57   
emb|CAC09455.2|  H0423H10.1                                             206   2e-57   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  195   2e-57   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     202   2e-57   
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    202   2e-57   
ref|XP_007031044.1|  Pectinesterase, putative                           205   2e-57   
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             204   2e-57   
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    204   2e-57   
ref|NP_001169525.1|  pectinesterase                                     205   2e-57   
ref|XP_010462664.1|  PREDICTED: probable pectinesterase 56              199   2e-57   
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         203   2e-57   



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ+Y+DC+I+GTIDFIFGDASAVFQNCKMIVRKP   Q CMVTAQGR +H
Sbjct  375  YQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKMIVRKPGDNQACMVTAQGRKDH  434

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVG IVLQNC+I   P   + QPP + +LGRPWK+Y+RT+I +S+ID FI PEGW+PW 
Sbjct  435  RGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPEGWAPWN  494

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPG++  KRV W GY +NISPQE  KY+   +I  D WIK TGI
Sbjct  495  GNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGI  554

Query  277  PY  272
             Y
Sbjct  555  SY  556



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ+Y+DCSISGTIDFIFGDASAVFQNCKMIVRKP A Q CMVTAQGR +H
Sbjct  367  YQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKPGANQACMVTAQGRKDH  426

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVG I+L+NCEI   P     QPP + +LGRPWK+Y+RT+I +S ID FI PEGW+PW 
Sbjct  427  RGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGWAPWN  486

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPG++T +RV W GY K+ISPQE  KY+   +I  D WIK TGI
Sbjct  487  GNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEKYAPNIFIDQDSWIKKTGI  546

Query  277  PY  272
             Y
Sbjct  547  SY  548



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ+Y+DCSISGTIDFIFGDASAVFQNCKMIVRKP   Q CMVTAQGR +H
Sbjct  371  YQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKPGNNQACMVTAQGRKDH  430

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVG IVL+NCEI   P   + QPP + +LGRPWK+Y+RT+I ++ ID FI PEGW+PW 
Sbjct  431  RGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGWAPWN  490

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPG++T KRV W GY +NISPQE  KY+   +I  D WIK TGI
Sbjct  491  GNFALNTLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEAEKYAPNIFIDQDSWIKKTGI  550

Query  277  PY  272
             Y
Sbjct  551  SY  552



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ++RDC+I+GTIDFIFGDA+AVFQNCKMIVRKP+  Q CMVTAQGR +H
Sbjct  358  YQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRKPMDNQACMVTAQGRKDH  417

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVGGIV+QNC+I         QPP + +LGRPWK+++RT+I +S IDGFIAPEGWSPW 
Sbjct  418  RGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWV  477

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEYQNRGPGS T  RVNWKGY K I+PQ  ++++ G +I  D+W+K +G+
Sbjct  478  GNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPGVFIMGDEWVKLSGV  537

Query  277  PYD  269
            PY+
Sbjct  538  PYE  540



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ+Y+DC+I+GTIDFIFGDAS VFQNCKMIVRKP   Q CMVTAQGR +H
Sbjct  375  YQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKMIVRKPGDNQACMVTAQGRKDH  434

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVG IVLQNC+I   P   + QPP + +LGRPWK+Y+RT+I +S+ID FI PEGW+PW 
Sbjct  435  RGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPEGWAPWN  494

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPG++  KRV W GY +NISPQE  KY+   +I  D WIK TGI
Sbjct  495  GNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGI  554

Query  277  PY  272
             Y
Sbjct  555  SY  556



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+YRQ++RDC+I+GTIDFIFGDA+AVFQNC+MIVRKP+  Q CMVTAQGR +H
Sbjct  358  YQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRKPMDNQACMVTAQGRKDH  417

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVGGIV+QNC+I         QPP + +LGRPWK+++RT+I +S IDGFIAPEGWSPW 
Sbjct  418  RGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWV  477

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEYQNRGPGS T  RVNWKGY K I+PQ  ++++   +I  D+W+K +G+
Sbjct  478  GNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPAVFIMGDEWVKLSGV  537

Query  277  PYD  269
            PY+
Sbjct  538  PYE  540



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H YRQYYR+C+ISGTIDFIFGDASAVFQ+CKM+VRKP+  Q CMVTAQGR E 
Sbjct  375  YQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCKMVVRKPMENQGCMVTAQGRKER  434

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RG+G IVLQNC+I   P    VQPP + +LGRPWK+++RT+I ++ IDGFIAPEGWSPW 
Sbjct  435  RGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWM  494

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF +DT +YAEY NRGPG+DTSKRV WKG +K I+PQ    ++ G YIQ D WI  +G+
Sbjct  495  GNFGMDTCYYAEYNNRGPGADTSKRVQWKG-IKKITPQIAQSFTPGAYIQGDAWITASGV  553

Query  277  PY  272
            PY
Sbjct  554  PY  555



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 144/184 (78%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H YRQYYR+C+ISGTIDFIFGD SAVFQ CKM+VRKP+  Q CMVTAQGR E 
Sbjct  359  YQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMVVRKPMENQGCMVTAQGRKER  418

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RG+G IVLQNC+I   P    VQPP + +LGRPWK+++RT+I ++ IDGFIAPEGWSPW 
Sbjct  419  RGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWM  478

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF +DT +YAEY NRGPG+DTSKRV WKG +K I+PQ    ++ G YIQ D WI  +G+
Sbjct  479  GNFGMDTCYYAEYNNRGPGADTSKRVQWKG-IKKITPQIAQSFTPGAYIQGDAWITASGV  537

Query  277  PYDS  266
             Y S
Sbjct  538  TYAS  541



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAHAYRQYYRDC+I+GTIDFIFGDA+AVFQNC+MIVRKPLA Q CMVTAQGR E 
Sbjct  385  FQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKER  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R  G  V+QNC I   P   + +PP + +LGRPWKQ++RT+I ++ IDGFIAPEGW+PW+
Sbjct  445  RSTGVTVIQNCHILAEPAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWE  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y E++NRGPGSD S+RV WKG ++ I+P     ++ G+    D+W++ +G+
Sbjct  505  GNFALDTLYYGEFKNRGPGSDMSRRVRWKG-IQTITPAIAESFTPGRLFAGDEWVRQSGV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAHAYRQYYRDC+I+GTIDFIFGDA+AVFQNC+MIVRKPLA Q CMVTAQGR E 
Sbjct  385  FQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKER  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R  G  V+QNC I   P   +  PP + +LGRPWKQ++RT+I ++ IDGFIAPEGW+PW+
Sbjct  445  RSTGVTVIQNCHILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQ  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y E++NRGPGSD S+RV WKG ++ I+P     ++ G+    D+W++ +G+
Sbjct  505  GNFALDTLYYGEFKNRGPGSDMSRRVRWKG-IQTITPAIADSFTPGRLFAGDEWVRQSGV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HAYRQ++RDC+I+GTIDFIFGDAS+VFQ+CKMIVRKP+A Q CMVTAQGR + 
Sbjct  366  YQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKMIVRKPMANQACMVTAQGRKDR  425

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            RGVG IV+QNCEI    +  + QP  + +LGRPWK+++RT+I +S IDGFI P+GWS W 
Sbjct  426  RGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFIDPQGWSVWA  485

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY+NRG G++++ RVNW+GY KNI  +  + ++ G +I AD+W++ +G+
Sbjct  486  GDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIAAGFAPGVFILADEWVRLSGV  545

Query  277  PYDS  266
            PY+S
Sbjct  546  PYES  549



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDC+ISGTIDFIFGDA A+FQNC+ ++RKPL  Q CM+TAQGR++ 
Sbjct  404  YQDTLYAHTYRQYYRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITAQGRVDR  463

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN +I   P L    PP +++LGRPWKQ++ T+I +S I GFIAPEGWSPW 
Sbjct  464  RSVGAIVIQNGDIAAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIGGFIAPEGWSPWA  523

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+YAEY+NRGPGSD   RV WKG ++ +SPQ    ++ G+    D+WI+ +G+
Sbjct  524  GTFALDTLYYAEYKNRGPGSDVKNRVQWKG-IQTLSPQMAESWTGGKIYGGDEWIRISGV  582

Query  277  PY  272
            PY
Sbjct  583  PY  584



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY+H YRQ+YRD +ISGTIDFIFGDA+AVFQNCK+IVR PL  Q CMVTAQGR   
Sbjct  379  YQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLIVRMPLVNQACMVTAQGRNNS  438

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R  G IVLQNC I   P L +  PP R +LGRPWK+Y+RT+I +S IDGFI P+GWSPW 
Sbjct  439  RSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRTIIMQSNIDGFIDPQGWSPWM  498

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L TL+YAEYQNRGPG++T +RV+W G +++I+PQ    ++ G+Y   D WI  +G 
Sbjct  499  GTFGLKTLYYAEYQNRGPGANTDQRVDWPG-IQHITPQVAESFTPGKYFIGDSWITASGF  557

Query  277  PY  272
            PY
Sbjct  558  PY  559



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGD+ A+FQNCK +VRKP+A Q CMVTAQGR+E 
Sbjct  386  YQDTLYAHTYRQYYRDCSISGTIDFIFGDSQALFQNCKFVVRKPMANQACMVTAQGRVER  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  ++QN +    P L    PP +V+LGRPWK  +RT+I +S I GFIAPEGW+ W 
Sbjct  446  HSLGATIIQNGDFVAEPALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAEWS  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+YAEYQNRGPGSD   RV WKG ++ +SPQ    ++ G++   D+W+K +G+
Sbjct  506  GTFALDTLYYAEYQNRGPGSDLKNRVKWKG-IQTLSPQMAESWTGGKFYGGDEWVKNSGV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQ YR+C+ISGTIDFIFGDA+AVFQ C+MIVRKP   Q CMVTAQGR + 
Sbjct  376  YQDTLYAHGYRQLYRNCTISGTIDFIFGDATAVFQKCRMIVRKPDINQNCMVTAQGRKDQ  435

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R +G  V+Q+ EI P P    V P    FLGRPWK+Y+RT+I +++IDGFI P GWSPW 
Sbjct  436  RSIGITVIQDSEIVPEPGFTAVVPKIDAFLGRPWKEYSRTIIMQTYIDGFIDPAGWSPWM  495

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GN+AL+TL+Y EYQNRGPGSDTSKRV WKG +K I+P+    ++A +    D W+  + +
Sbjct  496  GNYALNTLYYGEYQNRGPGSDTSKRVTWKG-IKKITPELAQTFTAQKVFLNDGWVTNSSV  554

Query  277  PY  272
            PY
Sbjct  555  PY  556



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  359  YQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVER  418

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  V+QN +    P L    PP +V+LGRPWKQ +RT+I +S I GF+ PEGWS W 
Sbjct  419  HSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWD  478

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPGSDT  RV W G +++ SPQ    ++  +  Q D+WI+ +G+
Sbjct  479  GNFALNTLYYAEYQNRGPGSDTKNRVQWPG-IQHFSPQMAESWTGAKMYQGDEWIRNSGV  537

Query  277  PY  272
            PY
Sbjct  538  PY  539



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  359  YQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVER  418

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  V+QN +    P L    PP +V+LGRPWKQ +RT+I +S I GF+ PEGWS W 
Sbjct  419  HSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWD  478

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPGSDT  RV W G +++ SPQ    ++  +  Q D+WI+ +G+
Sbjct  479  GNFALNTLYYAEYQNRGPGSDTKNRVQWPG-IQHFSPQMAESWTGAKMYQGDEWIRNSGV  537

Query  277  PY  272
            PY
Sbjct  538  PY  539



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGDA A+FQNCK +VRKP   Q CM+TAQGR+E 
Sbjct  434  YQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMITAQGRVER  493

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  V+QN +I   P L    PP +V+LGRPWK  +RT+I +S I GFIAPEGW+PW 
Sbjct  494  HSLGVTVIQNGDIVAEPALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAPWA  553

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+YAEYQNRGPGSD   RV WKG ++ +SPQ    ++ G+    D+WI+ +G+
Sbjct  554  GTFALDTLYYAEYQNRGPGSDLKARVTWKG-IQKLSPQMAESWTGGKLFGGDEWIRGSGV  612

Query  277  PY  272
            PY
Sbjct  613  PY  614



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYR CSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  359  YQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVER  418

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  V+QN +    P L    PP +V+LGRPWKQ +RT+I +S I GF+ PEGWS W 
Sbjct  419  HSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWD  478

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPGSDT  RV W G +++ SPQ    ++  +  Q D+WI+ +G+
Sbjct  479  GNFALNTLYYAEYQNRGPGSDTKNRVQWPG-IQHFSPQMAESWTGAKMYQGDEWIRNSGV  537

Query  277  PY  272
            PY
Sbjct  538  PY  539



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  361  YQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMVTAQGRVEP  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R +G  V+QN +I   P L    PP +V+LGRPWK  +RT+I +S I GF+APEGW+ W 
Sbjct  421  RSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWS  480

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEYQNRGPGSD   RV W G +++ + Q    ++ G+    D+WI+ TG 
Sbjct  481  GNFALDTLYYAEYQNRGPGSDMKNRVKWPG-IQHFTQQMAESWTGGRIYGGDEWIRITGT  539

Query  277  PY  272
            PY
Sbjct  540  PY  541



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAHAYRQ+YRDC I+GTIDFIFGDA A+FQ C+++VR+P+  Q CMVTAQGR + 
Sbjct  398  YQDTLYAHAYRQFYRDCQITGTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQ  457

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG  VLQ C+I   P    V+PP   +LGRPWK+Y+RT++ +S IDGFIAPEGWSPW 
Sbjct  458  RSVGVTVLQGCDIVADPAFLAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWM  517

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GN+AL TL+Y EYQNRG GS  S RV WKG +K I+P     ++ G   + D W+  +GI
Sbjct  518  GNYALSTLYYGEYQNRGAGSGLSGRVTWKG-IKKITPAIAQSFTPGVVYKNDTWVSTSGI  576

Query  277  PYDSA  263
            PY S 
Sbjct  577  PYVSG  581



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYR CSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  359  YQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVER  418

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +G  V+QN +    P L    PP +V+LGRPWKQ +RT+I +S I GF+ PEGWS W 
Sbjct  419  HSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWD  478

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEYQNRGPGSDT  RV W G +++ SPQ    ++     Q D+WI+ +G+
Sbjct  479  GNFALNTLYYAEYQNRGPGSDTKNRVQWPG-IQHFSPQMAESWTENVMYQGDEWIRNSGV  537

Query  277  PY  272
            PY
Sbjct  538  PY  539



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDC+ISGTIDFIFGD+  +FQNC  IVRKP+  Q CMVTAQGR++ 
Sbjct  356  YQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDNQACMVTAQGRVDP  415

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN  I   P   + +P    +LGRPWK+ +RT+I +S IDGFI+P+GWSPW 
Sbjct  416  RSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGFISPKGWSPWM  475

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y EYQNRG GSD + RV WKG +++++ Q+  +++ G   + D+WI  +G+
Sbjct  476  GNFALDTLYYGEYQNRGAGSDLANRVTWKG-IQHMTQQKAEEWTGGAAFRGDEWITSSGV  534

Query  277  PY  272
            PY
Sbjct  535  PY  536



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRD +ISGTIDFIFGD+ A FQNCK IVRKP+  Q CMVTAQGR++ 
Sbjct  380  YQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMDNQACMVTAQGRVDP  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN +I   P      PP   +LGRPWK+ +RT+I ++ I GFIAPEGWSPW 
Sbjct  440  RSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWM  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +Y EYQNRG GS  +KRV WKG +K I+P+    ++AG   + D WIK  G+
Sbjct  500  GNFALDTCYYGEYQNRGAGSGLAKRVTWKG-IKKITPEIALSWTAGLAFKGDDWIKTAGV  558

Query  277  PYD  269
            PY+
Sbjct  559  PYN  561



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRDCSISGTIDFIFGDA A+FQNCK +VRKP   Q CMVTAQGR+E 
Sbjct  361  YQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMVTAQGRVEP  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R +G  V+QN +I   P L    PP +V+LGRPWK  +RT+I +S I GF+APEGW+ W 
Sbjct  421  RSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWS  480

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEYQNRGPGSD   RV W G +++ + Q    ++ G+    D+WI+ +G 
Sbjct  481  GNFALDTLYYAEYQNRGPGSDMKNRVKWPG-IQHFTQQMAESWTGGRIYGGDEWIRISGT  539

Query  277  PY  272
            PY
Sbjct  540  PY  541



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQYYRD +ISGTIDFIFGD+ A FQNCK IVRKP+  Q CMVTAQGR++ 
Sbjct  397  YQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMENQACMVTAQGRVDP  456

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN +I   P      PP   +LGRPWK+ +RT+I ++ I GFIAPEGWSPW 
Sbjct  457  RSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWM  516

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +Y EYQNRG GS  +KRV WKG +K I+P+    ++AG   + D WIK +G+
Sbjct  517  GNFALDTCYYGEYQNRGAGSGLAKRVTWKG-IKKITPEIALSWTAGLAFKGDDWIKSSGV  575

Query  277  PYD  269
            PY+
Sbjct  576  PYN  578



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQ+YR+C+ISGTIDF+FGDA+AVFQ C+ IVRKP   Q CMVTAQGR + 
Sbjct  376  YQDTLYAHGYRQFYRNCTISGTIDFVFGDATAVFQKCRFIVRKPDINQNCMVTAQGRKDS  435

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R +G  V+QN EI P      V+P    FLGRPWK+Y+RTLI  +FIDGFI P GWSPW 
Sbjct  436  RSIGVTVIQNSEIVPEAGFTAVKPKIDAFLGRPWKEYSRTLIMNTFIDGFIDPAGWSPWM  495

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GN+ L+TL+Y EYQN+GPG+DTSKRV WKG ++ I+P+    ++A +    D W+  + +
Sbjct  496  GNYGLNTLYYGEYQNKGPGADTSKRVTWKG-IQKITPEIALSFTAQKVYLNDGWVTNSSV  554

Query  277  PY  272
            PY
Sbjct  555  PY  556



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+I+GTIDFIFG+ + VFQNCK++VRKP+  Q+C+VTAQGR + 
Sbjct  383  YQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDNQQCIVTAQGRTQR  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +    I+LQNC I  AP    ++   + FLGRPWKQY+RT+I +S ID  I PEGW PW 
Sbjct  443  KEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWT  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAE  NRGPG+ T KRV WKG +K I+ +    ++A ++I+ D WIKPTG+
Sbjct  503  GNFALNTLFYAEINNRGPGAATDKRVKWKG-IKKITMEHALDFTAARFIRGDPWIKPTGV  561

Query  277  PYDS  266
            PY S
Sbjct  562  PYTS  565



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+I+GTIDFIFG+ + VFQNCK++VRKP+  Q+C+VTAQGR + 
Sbjct  386  YQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDNQQCIVTAQGRTQR  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +    I+LQNC I  AP    ++   + FLGRPWKQY+RT+I +S ID  I PEGW PW 
Sbjct  446  KEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWT  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAE  NRGPG+ T KRV WKG +K I+ +    ++A ++I+ D WIKPTG+
Sbjct  506  GNFALNTLFYAEINNRGPGAATDKRVKWKG-IKKITMEHALDFTAARFIRGDPWIKPTGV  564

Query  277  PYDS  266
            PY S
Sbjct  565  PYTS  568



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+I+GTIDFIFG+A+AVFQNCK++VRKP+  Q+C+VTAQGR + 
Sbjct  383  YQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQNCKILVRKPMDNQQCIVTAQGRTQR  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +    I+LQNC I   P    V+   + +LGRPWKQY+RT+I +  ID  I PEGW PW 
Sbjct  443  KEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWKQYSRTIIMQCQIDDLIQPEGWLPWM  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE  NRGPG+ T KRV WKG +K I+PQ    ++ G++I+ D WIKPTG+
Sbjct  503  GDFALHTLFYAEINNRGPGAATDKRVKWKG-IKKITPQHALDFTVGRFIRGDPWIKPTGV  561

Query  277  PYDS  266
            PY S
Sbjct  562  PYSS  565



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H YRQ+YRDC+I+GT+DFIFG+  AV QNCK+IVRKP   Q CMVTAQGR E 
Sbjct  184  YQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVLQNCKVIVRKPAQNQSCMVTAQGRTEP  243

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               G IVLQNCEI P     ++ PP++ +LGRPWK+Y+RT+I +S+ID FI PEGW+PW 
Sbjct  244  IQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPWKEYSRTIIMQSYIDKFIEPEGWAPWN  303

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQ-WIKPT  284
              NF  DT +YAEYQNRGPG+   KR+ WKG+ K  + +   K++AG YI  D+ W++  
Sbjct  304  ITNFGRDTSYYAEYQNRGPGAALDKRITWKGFQKGFTGEAAQKFTAGVYINNDENWLQKA  363

Query  283  GIPYDSA  263
             +PY++ 
Sbjct  364  NVPYEAG  370



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC+I+GTIDF+ GDA+AVFQNCKM++RKPL  Q+C+VTAQGR + 
Sbjct  388  YQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNCKMLIRKPLDNQQCIVTAQGRSKR  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I   P     +     +LGRPWK Y+RT+I ES+ID  I P+GW PW 
Sbjct  448  REASALILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGWMPWL  507

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+T +YAEY+NRGPG+ T++RV WKG +K I+PQ   +++AG++++ D+WI+  G+
Sbjct  508  GDFGLNTCFYAEYKNRGPGASTARRVKWKG-IKKITPQHAVEFTAGRFMKGDRWIRTAGV  566

Query  277  PY  272
            PY
Sbjct  567  PY  568



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+ VFQNCKMIVRKP+  Q CMVTAQGR++ 
Sbjct  176  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDR  235

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI+LQNC I   P+   V+   + +LGRPWK  ART++ +S IDG IAPEGW  W 
Sbjct  236  RQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWT  295

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ EY+NRGPGS  SKRV W G +KN+S  +   +++G++++ D+WIKP+G+
Sbjct  296  GSNNHQSCWFGEYRNRGPGSHMSKRVKWSG-IKNLSADQAVAFTSGKFVEGDKWIKPSGV  354

Query  277  PY  272
            PY
Sbjct  355  PY  356



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC++SGTIDFIFGDA+A+FQ+C  +VRKPL  Q+C+VTA GR E 
Sbjct  388  YQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCTFLVRKPLPNQQCIVTAHGRKER  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +++QNC   P   L  VQ   R FLGRPWK+Y+RT+I ES+I   I PEGW PW 
Sbjct  448  RQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWA  507

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G++ L T +Y EY N GPGSD SKRV W+G +KNI+PQ    ++ G++++ D+WIKPTG+
Sbjct  508  GDWGLRTCFYTEYNNYGPGSDKSKRVKWRG-IKNITPQHAVDFTPGRFLKGDRWIKPTGV  566

Query  277  PYDS  266
            PY S
Sbjct  567  PYVS  570



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+ VFQNCKMIVRKP+  Q CMVTAQGR++ 
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI+LQNC I   P+   V+   + +LGRPWK  ART++ +S IDG IAPEGW  W 
Sbjct  451  RQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWT  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ EY+NRGPGSD SKRV W G +KN+   +   +++G++++ D+WIKP+G+
Sbjct  511  GSNNHQSCWFGEYRNRGPGSDMSKRVKWSG-IKNLGADQAVAFTSGKFVEGDKWIKPSGV  569

Query  277  PY  272
            PY
Sbjct  570  PY  571



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+ VFQNCKMIVRKP+  Q CMVTAQGR++ 
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI+LQNC I   P+   V+   + +LGRPWK  ART++ +S IDG IAPEGW  W 
Sbjct  451  RQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWT  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ EY+NRGPGS  SKRV W G +KN+S  +   +++G++++ D+WIKP+G+
Sbjct  511  GSNNHQSCWFGEYRNRGPGSHMSKRVKWSG-IKNLSADQAVAFTSGKFVEGDKWIKPSGV  569

Query  277  PY  272
            PY
Sbjct  570  PY  571



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQ+Y DCSISGTIDFIFGD+ ++FQNCK IVRKP+  Q CMVTAQGR++ 
Sbjct  377  YQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN  I         +P    +LGRPWK+ +RT+I +S IDGFI+P+GWSPW 
Sbjct  437  RSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGWSPWM  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +Y EYQNRG GS  + RV WKG +K I+P+    ++ G   + D+WIK   +
Sbjct  497  GNFALDTCYYGEYQNRGAGSGLANRVTWKG-IKKITPEIAQSWTGGVAFKGDEWIKAARV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQ+Y DCSISGTIDFIFGD+ ++FQNCK IVRKP+  Q CMVTAQGR++ 
Sbjct  379  YQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDP  438

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VG IV+QN  I         +P    +LGRPWK+ +RT+I +S IDGFI+P+GWSPW 
Sbjct  439  RSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGWSPWM  498

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +Y EYQNRG GS  + RV WKG +K I+P+    ++ G   + D+WIK   +
Sbjct  499  GNFALDTCYYGEYQNRGAGSGLANRVTWKG-IKKITPEIAQSWTGGVAFKGDEWIKAARV  557

Query  277  PY  272
            PY
Sbjct  558  PY  559



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAHA+RQ+YR+C ISGTIDF+FG+A ++FQNC+ IVRKP+A Q CMVTAQGR + 
Sbjct  352  FQDTLYAHAHRQFYRNCRISGTIDFVFGNALSIFQNCQFIVRKPMANQACMVTAQGRDQR  411

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               G IV+QN EI         +P  + +LGRPWKQ++ T+I  S+I G I+P+GW+PW 
Sbjct  412  NSNGAIVIQNGEIRAEQAFINAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQGWAPWA  471

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDT +YAEY+NRGPGS+TS+RV WKG +K+I PQ  ++Y+ G+    DQWI+  G+
Sbjct  472  GSFALDTCYYAEYRNRGPGSNTSQRVKWKG-IKHIDPQTAARYAPGKAYGDDQWIRRAGV  530

Query  277  PYDS  266
            PY S
Sbjct  531  PYVS  534



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 137/190 (72%), Gaps = 7/190 (4%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKP--LATQECMVTAQGRM  644
            YQ TL  H  RQ+YRDC+I+GTIDFIFGDA AVFQNCK+I RKP  + TQ   + AQGR 
Sbjct  363  YQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEEMQTQAITIAAQGRN  422

Query  643  EHRGVGGIVLQNCEICPAPQLKTVQPP-ARVFLGRPWKQYARTLIAESFIDGFIAPEGWS  467
            +  G G I++QNC I   P L  + PP  + +LGRPWK Y+RT+I +S IDGFI PEGW+
Sbjct  423  QQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIMQSQIDGFIDPEGWT  482

Query  466  PWKGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ----ADQ  299
            PW G FALDTL++ EYQNRGPG++T KRVNWK Y+KN +P  ++K++ G  ++     D 
Sbjct  483  PWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKFTPGVVLKGGDNTDT  542

Query  298  WIKPTGIPYD  269
            W+  TG+PY+
Sbjct  543  WVTKTGVPYE  552



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 136/190 (72%), Gaps = 7/190 (4%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKP--LATQECMVTAQGRM  644
            YQ TL  H  RQ YRDC+I+GTIDFIFGDA AVFQNCK+I RKP  + TQ   + AQGR 
Sbjct  363  YQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEEMQTQAITIAAQGRN  422

Query  643  EHRGVGGIVLQNCEICPAPQLKTVQPP-ARVFLGRPWKQYARTLIAESFIDGFIAPEGWS  467
            +  G G I++QNC I   P L  + PP  + +LGRPWK Y+RT+I +S IDGFI PEGW+
Sbjct  423  QQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIMQSQIDGFIDPEGWT  482

Query  466  PWKGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ----ADQ  299
            PW G FALDTL++ EYQNRGPG++T KRVNWK Y+KN +P  ++K++ G  ++     D 
Sbjct  483  PWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKFTPGVVLKGGDNTDT  542

Query  298  WIKPTGIPYD  269
            W+  TG+PY+
Sbjct  543  WVTKTGVPYE  552



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC++SGTIDFIFGDA+A+FQ C  +VRKPL  Q+C+VTA GR E 
Sbjct  388  YQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCTFLVRKPLPNQQCIVTAHGRKER  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +++QNC I     L  VQ   R FLGRPWK+Y+RT+I ES+I   I PEGW PW 
Sbjct  448  RQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWA  507

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G++ L T +Y EY N GPGS+ SKRV W+G +K I+PQ    ++AG+++  D+WIKPTG+
Sbjct  508  GDWGLKTCFYTEYNNYGPGSNKSKRVKWRG-IKTITPQHALDFTAGRFVMGDRWIKPTGV  566

Query  277  PYDS  266
            PY S
Sbjct  567  PYVS  570



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+I+GT+DFIFGDASAVFQNCK+IVRKP   Q CM+TAQGR   
Sbjct  361  YQDTLYAHSFRQFYRDCTITGTVDFIFGDASAVFQNCKLIVRKPGNAQACMITAQGRTVP  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               GG V+QNC+I   P   +  PP + +LGRPWK+Y++T+I +S ID FI P GW+PW 
Sbjct  421  TSFGGFVIQNCDIKADPAFTSTTPPIKAYLGRPWKEYSKTIIMQSNIDAFIDPTGWAPWN  480

Query  457  G-NFALDTLWYAEYQNRGPGSDTSKRVN-WKGYLKNISPQEVSKYSAGQYIQADQ-WIKP  287
              +F L T +YAEYQNRGPG+   KRV+ W+GY K IS   ++KY+AG++I   Q W+  
Sbjct  481  STDFGLHTCFYAEYQNRGPGAALGKRVSTWRGYQKGISGDAINKYTAGKFINTQQPWLPK  540

Query  286  TGIPYDS  266
              IPYD+
Sbjct  541  FDIPYDA  547



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDFIFGD++ V QNCK+IVRKPL  Q+C+VTAQGR+E 
Sbjct  498  YQDTLYAHSHRQFYRDCTISGTIDFIFGDSATVLQNCKIIVRKPLENQQCIVTAQGRIER  557

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R V  +VLQNC I   P+   V+   + +LGRPWK+++RTLI +S ID  IAPEGW PW 
Sbjct  558  REVSALVLQNCTISGDPEYLPVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWN  617

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TLWYAE+ NRGPG+  + RV W+G +K I+     +++ G +++ D WI   G+
Sbjct  618  GDFALNTLWYAEFGNRGPGAVQTHRVTWRG-IKKINAAIARRFTPGVFLRGDDWIPKAGV  676

Query  277  PY  272
            PY
Sbjct  677  PY  678



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 141/187 (75%), Gaps = 3/187 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC+I+GTIDF+FGDASAVFQNCK+IVRKP   Q CM+TAQGRM  
Sbjct  361  YQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPGPNQACMITAQGRMRK  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +GG V+QNC+I     L +  PP +V+LGRPWK++++T+I +S IDGF+ P GWSPW 
Sbjct  421  DSLGGFVIQNCDIKADKALTSANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPSGWSPWN  480

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRVN-WKGYLKNISPQEVSKYSAGQYIQADQ-WIKP  287
              +F + T +YAEYQNRGPG+   KRV+ W+GY K+IS   ++ ++AG++I   Q W+  
Sbjct  481  TTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSFTAGKFINTQQPWLPM  540

Query  286  TGIPYDS  266
              IPY++
Sbjct  541  FDIPYEA  547



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+ISGTIDFIFGDASA+FQNCKM+VRKPL  Q+C+VTAQGR E 
Sbjct  385  YQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQNCKMLVRKPLDNQQCIVTAQGRKER  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I+LQNC I        V+   R FLGRPWK+Y+RT+I +SFID  I PEGW PW 
Sbjct  445  RQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQPEGWLPWM  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F + T +Y+E+ NRGPGS  + RV WKG +K I+P     ++ G +++ + W+   G+
Sbjct  505  GDFGIKTCFYSEFGNRGPGSSMTGRVKWKG-IKTITPAHAVDFTVGTFLRGNTWLPKFGV  563

Query  277  PYDS  266
            P+ +
Sbjct  564  PFSA  567



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 141/187 (75%), Gaps = 3/187 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC+I+GTIDF+FGDASAVFQNCK+IVRKP   Q CM+TAQGRM  
Sbjct  361  YQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPGPNQACMITAQGRMRK  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +GG V+QNC+I     L +  PP +V+LGRPWK++++T+I +S IDGF+ P GWSPW 
Sbjct  421  DSLGGFVIQNCDIKADQALTSANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPSGWSPWN  480

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRVN-WKGYLKNISPQEVSKYSAGQYIQADQ-WIKP  287
              +F + T +YAEYQNRGPG+   KRV+ W+GY K+IS   ++ ++AG++I   Q W+  
Sbjct  481  TTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSFTAGKFINTQQPWLPM  540

Query  286  TGIPYDS  266
              IPY++
Sbjct  541  FDIPYEA  547



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YRDC++SGTIDF+FGDA  VFQNC  +VRKPL  Q+C+VTAQGR   
Sbjct  395  YQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVVFQNCTFLVRKPLENQQCIVTAQGRKAR  454

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN  I   P+L+ V+   + +LGRPWK+++RT+I E+FID  I PEGWSPW 
Sbjct  455  RQPSAIIIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGWSPWF  514

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L T WY EY N GPGSD   RV W G +K +S Q    ++ G++++ D WIKPTG+
Sbjct  515  GSFGLKTCWYGEYNNYGPGSDMKNRVKWNG-IKPVSRQHAIDFTPGRFLRGDSWIKPTGV  573

Query  277  PY  272
            PY
Sbjct  574  PY  575



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTL+AH +RQ+YRDC+I+GTIDFIFGDA+AVFQNCK++VRKPL  Q C+VTAQGR E 
Sbjct  382  YQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCVVTAQGRNES  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQNC I   P+   V+   + +LGRPWK+Y+RT+  +  ID  I P+GW PW 
Sbjct  442  REATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWM  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL Y+EY+NRGPGS T  RV WKG +K +S Q+ + ++  ++I  D WI  TG+
Sbjct  502  GSFALDTLSYSEYENRGPGSVTKDRVTWKG-IKKLSAQDAAAFTVAKFIGGDLWIPATGV  560

Query  277  PYDS  266
             Y S
Sbjct  561  SYAS  564



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH  RQ+YRDC+I+GTIDFIFGDA AVFQNCK++VRKPL  Q+C+VTAQGR E 
Sbjct  384  YQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLENQQCIVTAQGRNET  443

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V+QNC I   P+   V+   + +LGRPW++ +RT++ +S ID  IAPEGW PW 
Sbjct  444  REPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWL  503

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF L+TL+Y+EY N+G G+  + RV W G +K ++P+    Y+A ++IQ D+WI  TG+
Sbjct  504  GNFGLNTLFYSEYDNKGQGAVETNRVKWAG-IKKLTPEAADGYTAAKFIQGDEWIPQTGV  562

Query  277  PY  272
            PY
Sbjct  563  PY  564



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+ VFQNCKMIVRKP+  Q CMVTAQGRM+ 
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRMDR  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +VLQNC I   P+   V+  ++ +LGRPWK  ART++ +S ID  I PEGW  W 
Sbjct  448  RQPTAMVLQNCTISGDPEYILVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWT  507

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ EY NRGPGSD ++RV W G +K ++P+    ++AG+ ++ D+WIKP+G+
Sbjct  508  GSTNHKSCWFGEYGNRGPGSDMTRRVTWSG-IKKLTPEHAVDFTAGRLMEGDKWIKPSGV  566

Query  277  PY  272
            PY
Sbjct  567  PY  568



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH +RQ+YR+C+ISGTIDFIFG+++ V Q C+++VRKPL  Q+ +VTA GR + 
Sbjct  391  YQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVVLQKCRIVVRKPLENQQNIVTAHGRKDR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I+LQ+C I   P L  V+   R +LGRPWK+Y+RT+I ++ ID  I P+GW PW 
Sbjct  451  REPTAIILQSCRIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGWLPWS  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNI-SPQEVSKYSAGQYIQADQWIKPTG  281
            G+FAL T +YAEY NRGPG+  ++RV W+G   +I +P++  +++AG++I+ D WIKPTG
Sbjct  511  GDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDSWIKPTG  570

Query  280  IPYDS  266
            +PYDS
Sbjct  571  VPYDS  575



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH  RQ+YRDC+I+GTIDFIFGDA AVFQNCK++VRKPL  Q+C+VTAQGR E 
Sbjct  384  YQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLDNQQCIVTAQGRNET  443

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V+QNC I   PQ   V+   + +LGRPW++ +RT++ +S ID  IAPEGW PW 
Sbjct  444  REPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWL  503

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+TL+Y+EY N+G G+  + RV W G +K ++P+    Y+A ++IQ D+WI  TG+
Sbjct  504  GSFGLNTLFYSEYNNKGQGAVETNRVKWAG-IKKLTPEAADGYTAAKFIQGDEWIPQTGV  562

Query  277  PY  272
            PY
Sbjct  563  PY  564



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+ VFQNCKMIVRKP+  Q CMVTAQGRM+ 
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRMDR  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +VLQNC I   P+   V+  ++ +LGRPWK  ART++ +S ID  I PEGW  W 
Sbjct  448  RQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWT  507

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ EY NRGPGSD ++RV W G +K ++P+    ++AG+ ++ D+WIKP+G+
Sbjct  508  GSTNHKSCWFGEYGNRGPGSDMTRRVTWSG-IKKLTPEHAVDFTAGRLMEGDRWIKPSGV  566

Query  277  PY  272
            PY
Sbjct  567  PY  568



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH +RQ+YRDC+I+GTIDFIFGDA+AVFQNCK++VRKPL  Q C+VTAQGR E 
Sbjct  382  YQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCIVTAQGRNES  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQNC I    +   V+   + +LGRPWK+Y+RT+  +  ID  I P+GW PW 
Sbjct  442  REATGFVLQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWM  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL Y+EY+NRGPGS T  RV WKG +K +S Q+   ++  ++I  D WI  TGI
Sbjct  502  GSFALDTLSYSEYENRGPGSVTKDRVTWKG-IKKLSAQDADAFTVAKFIGGDLWIPDTGI  560

Query  277  PYDS  266
             Y S
Sbjct  561  SYAS  564



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YR+CSISGTIDF+FGDA  VFQNCK +VRKPL  Q+C+VTAQGR + 
Sbjct  394  YQDTLYTHAKRQFYRECSISGTIDFVFGDAPVVFQNCKFLVRKPLENQQCIVTAQGRKQR  453

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI++QN      P+L  V+   + +LGRPWKQ++RT+I ES+ID  I PEGW PW 
Sbjct  454  RQPSGIIIQNGTFTAHPELVPVKKQYKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWF  513

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T WY E+ N GPGSD   RV W G +K I  Q    ++ G++++ D WIKPTGI
Sbjct  514  GTFGLKTCWYTEFNNYGPGSDKKARVKWNG-IKTIDRQHALDFTPGRFLRGDTWIKPTGI  572

Query  277  PY  272
            PY
Sbjct  573  PY  574



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  317  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  376

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I   P   TV+  ++ +LGRPWK+Y+RT+   +FI  FI PEGW PW 
Sbjct  377  RESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWL  436

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y+E +N GPG+  +KRV W G +K +S +E+ K++  +YIQ D WI   G+
Sbjct  437  GNFALDTLFYSEVRNTGPGAGVTKRVTWPG-IKKLSEEEILKFTPAEYIQGDAWIPGKGV  495

Query  277  PY  272
            PY
Sbjct  496  PY  497



>ref|XP_009414337.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=592

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC ISGTIDFIFGDASAVFQ+C + VR+PL  Q+ +V AQGR   
Sbjct  405  YQDTLYAHSHRQFYRDCLISGTIDFIFGDASAVFQHCTLTVRRPLNNQQNIVLAQGRSVL  464

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G V+QNC I   P L   +P  R +LGRPW++++ T+I ES I  FI PEG++PW+
Sbjct  465  QESTGFVIQNCRIVAIPALADAKPKLRSYLGRPWQEFSNTIIMESEIGDFIEPEGYTPWE  524

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL YAEY N+GPG+DTSKRV+W G+ K IS +E S Y+A  +IQ D WI   G 
Sbjct  525  GSFALDTLSYAEYNNKGPGADTSKRVHWAGF-KVISQEEASAYTASPFIQGDDWISKMGA  583

Query  277  P  275
            P
Sbjct  584  P  584



>gb|EPS66910.1| pectinesterase family protein, partial [Genlisea aurea]
Length=188

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 128/185 (69%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH  RQYYR+C ISGTIDF+FGDA ++FQNC  +VR PL  Q CMVTAQGR + 
Sbjct  1    YQDTLYAHIQRQYYRNCRISGTIDFVFGDALSIFQNCTFLVRNPLPNQSCMVTAQGRFDP  60

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R V  IV+  CEI   P   +  P  R +LGRPWK  +RT+I  + I GFIAPEGW+PW 
Sbjct  61   RSVTAIVIDGCEIRADPAFLSRNPMPRAYLGRPWKVRSRTIIMRTEIGGFIAPEGWAPWD  120

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+YAEY N GPGS+T+ RV W+G +++I  +  + +S  +    D WI  TGI
Sbjct  121  GEFALDTLYYAEYGNTGPGSNTTGRVTWRG-IQHIESEAAALWSPTRAYGGDGWITKTGI  179

Query  277  PYDSA  263
            PY S 
Sbjct  180  PYSSV  184



>gb|EYU33104.1| hypothetical protein MIMGU_mgv1a012115mg [Erythranthe guttata]
Length=261

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 132/182 (73%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C ISGT+DFIFGD++ V QNC +IVRKP+  Q+  VTAQGR + 
Sbjct  74   YQDTLYAQTHRQFYRNCVISGTVDFIFGDSAVVIQNCLIIVRKPMDNQQNTVTAQGRTQS  133

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   GIV+QNC I P  +L+ ++     +LGRPWK+Y++T+I ES +  FI P GW PW 
Sbjct  134  KETTGIVIQNCRIVPEQKLEPLRFKIPTYLGRPWKKYSKTIIMESTLADFIQPAGWMPWS  193

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y EY N+GPG+ T KRV WKGY    +  +  +++A  +IQADQW+  TG+
Sbjct  194  GNFALDTLYYREYANKGPGAPTDKRVKWKGYSVITNRDDALQFTAAPFIQADQWLTTTGV  253

Query  277  PY  272
            PY
Sbjct  254  PY  255



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+I+GTIDF+FGDA+AVFQNC ++VRKPLA Q C +TA GR + 
Sbjct  192  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPITAHGRKDP  251

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I        V+  ++ +LGRPWK+Y++T+I E+FI  FI  EGWSPW+
Sbjct  252  RESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQ  311

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E +N GPG+  + RV W+G +K +S +E+ +Y+  +YIQ D WI   G+
Sbjct  312  GNFGLDTLFYSEVRNTGPGAAVANRVTWQG-IKKLSEEEIVEYTPAKYIQGDDWIPGKGV  370

Query  277  PY  272
            PY
Sbjct  371  PY  372



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH +RQ+YRDC I+GTIDFIFGD++AVFQNCKM++RKPL  Q C+VTAQGR E 
Sbjct  390  YQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNCKMVIRKPLDNQNCIVTAQGRTER  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +VLQNC I   P    V+   + +LGRPWK+++RT+I  S ID  IAPEGW PW 
Sbjct  450  REATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEFSRTIIMNSRIDDVIAPEGWLPWA  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+T +Y E  NRGPGS    RV W+G +K +  Q   +Y+ G++I+ D WIK  G+
Sbjct  510  GDFALNTCFYTEILNRGPGSKLDGRVKWRG-IKKVPAQRAVEYTPGRFIRGDWWIKAAGV  568

Query  277  PYDS  266
            PY S
Sbjct  569  PYVS  572



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC ISGTIDF+FGDA+AVFQNCK+IVRKPL +Q CMVTAQGR   
Sbjct  364  YQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLIVRKPLDSQNCMVTAQGRTTS  423

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               G IV+QNCEI   P+     P    +LGRPWK+Y+RT+I +SFIDGFI P GWSPW 
Sbjct  424  GSKGAIVIQNCEIKADPEF-LAAPRKPAYLGRPWKEYSRTIIMQSFIDGFIDPAGWSPWN  482

Query  457  G-NFALDTLWYAEYQNRGPGSDTSKRV-NWKGYLKNISPQEVSKYSAGQYIQ--ADQWIK  290
              +F L T WYAEYQNRGPG+   KRV +W+GY + IS    + ++AGQ+I      ++ 
Sbjct  483  ATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGDVANSFTAGQFINPSGSSFLP  542

Query  289  PTGIPYDS  266
               IPY++
Sbjct  543  KADIPYEA  550



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY HA RQ+YRDCSISGTIDF+FGDASAVFQNCK +VRKPL  Q+C+VTAQGR   
Sbjct  390  HQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLENQQCIVTAQGRKMR  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +++QN  I   P L   +   + +LGRPWK+Y+RT+I ESFID  I PEGW PW 
Sbjct  450  RQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWL  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T WY E+ N GPGS  + RV W G +K I+ Q    ++ G++++ D WIK TGI
Sbjct  510  GTFGLKTCWYTEFNNYGPGSSKNLRVKWNG-IKTINRQHAMDFTPGRFLKGDSWIKATGI  568

Query  277  PY  272
            PY
Sbjct  569  PY  570



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTID+IFGDA + FQNC M+VRKP+  Q CMVTAQGR + 
Sbjct  386  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDK  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVL NC I   P    V+   + +LGRPWKQ++RT+I  + I+  I P+GW  W 
Sbjct  446  RETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWN  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL YAE++N+GPGS+ + RV W G +K  +P++  +++AG+++Q   WI  T +
Sbjct  506  GNFALDTLEYAEFENKGPGSNQATRVKWPG-IKKFTPRQAGEFTAGKFLQGGTWIPQTQV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+ISGT+DFIFGDA ++FQNC ++VRKP+  Q C+VTAQGR + 
Sbjct  382  YQDTLYVHAHRQFYRDCTISGTVDFIFGDAKSLFQNCNIVVRKPMGGQSCIVTAQGRTDV  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVL NC I   P    V+   + +LGRPWK ++RT++  + ID  I P GW PW 
Sbjct  442  RESTGIVLHNCRITGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGWLPWD  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEYQN GPGS+ ++RVNW G +KNISP++  K++  ++++ + WI  T +
Sbjct  502  GDFALNTLYYAEYQNSGPGSNQAQRVNWAG-IKNISPRQALKFTPARFLRGNLWIPQTHV  560

Query  277  PY  272
            PY
Sbjct  561  PY  562



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC I+GTIDF+FGDA+AVFQNCK+IVRKP   Q CMVTAQGR   
Sbjct  363  YQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKPGDGQNCMVTAQGRTTP  422

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               G +V+QNCEI   P+    +PP + FLGRPWK+Y+RT+I +S+IDGFI P GW+PW 
Sbjct  423  ASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQSYIDGFIDPTGWAPWN  482

Query  457  GN-FALDTLWYAEYQNRGPGSDTSKRV-NWKGYLKNISPQEVSKYSAGQYIQ--ADQWIK  290
               F + T WYAEYQNRGPG+   KR+ +W+GY K IS    + ++AG +I      ++ 
Sbjct  483  TTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANSFTAGLFINPTDSSFLP  542

Query  289  PTGIPYDS  266
               IPY++
Sbjct  543  KADIPYEA  550



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDV  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI P+GW PW 
Sbjct  443  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWL  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  QYIQ D W+   G+
Sbjct  503  GNFGLDTLFYSEVQNTGPGAALANRVTWPG-IKTLSNEEILKFTPDQYIQGDVWVHGKGV  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC+I+GTIDF+FG A+AVFQNCK+IVRKP  TQ CM+TAQG ++ 
Sbjct  362  YQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVFQNCKLIVRKPGDTQNCMMTAQGNVDV  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +  GG V+QNC+I   P+     P  + +LGRPWK Y+RT+I +S ID FI  EGW+PW 
Sbjct  422  KSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPWKMYSRTIIMQSNIDAFINSEGWAPWN  481

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRV-NWKGYLKNISPQEVSKYSAGQYIQAD-QWIKP  287
              +F + T +YAEYQNRGPG+   KRV +W+GY K+IS   ++K++A ++I  + QW+  
Sbjct  482  TTDFGIHTCFYAEYQNRGPGATLDKRVSHWRGYQKDISGDTINKFTADKFINTNPQWLPV  541

Query  286  TGIPYDS  266
              IPY++
Sbjct  542  ADIPYEA  548



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDV  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI P+GW PW 
Sbjct  443  RESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWL  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  QYIQ D W+   G+
Sbjct  503  GNFGLDTLFYSEVQNTGPGAALANRVTWPG-IKTLSNEEILKFTPDQYIQGDVWVHGKGV  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTID+IFGDA + FQNC M+VRKP+  Q CMVTAQGR + 
Sbjct  399  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDK  458

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVL NC I   P    V+   + +LGRPWKQ++RT+I  + I+  I P+GW  W 
Sbjct  459  RETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWN  518

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL YAE++N+GPGS+ + RV W G +K  +P++  +++AG+++Q   WI  T +
Sbjct  519  GNFALDTLEYAEFENKGPGSNQATRVKWPG-IKKFTPRQAGEFTAGKFLQGGTWIPQTQV  577

Query  277  PY  272
            PY
Sbjct  578  PY  579



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDV  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI P+GW PW 
Sbjct  443  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWL  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  QYIQ D W+   G+
Sbjct  503  GNFGLDTLFYSEVQNTGPGAALANRVTWPG-IKTLSNEEILKFTPDQYIQGDVWVHGKGV  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 134/184 (73%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+I+GTIDFIFGD++ VFQNC ++VRKPL  Q+C+VTAQGR E 
Sbjct  398  YQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDNQQCIVTAQGRNER  457

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC I  A      +   + +LGRPWK ++RT+I +S ID  I+PEGW PW 
Sbjct  458  REPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWM  517

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+T +YAEY NRGP S T+ RV W+G +K I+ Q V+ ++ G++I    W+  +G+
Sbjct  518  GDFGLNTCFYAEYGNRGPASATTSRVTWRG-IKQITGQHVNDFTVGRFISGHLWLGASGV  576

Query  277  PYDS  266
            PY S
Sbjct  577  PYTS  580



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+I+GTIDF+FGDA+AVFQNC ++VRKPLA Q C +TA GR + 
Sbjct  377  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPITAHGRKDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I        V+  ++ +LGRPWK+Y++T+I E+FI  FI  EGWSPW+
Sbjct  437  RESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQ  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E +N GPG+  + RV W+G +K +S +E+ +Y+  +YIQ D WI   G+
Sbjct  497  GNFGLDTLFYSEVRNTGPGAAVANRVTWQG-IKKLSEEEIVEYTPAKYIQGDDWIPGKGV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  377  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLNQACPITAHGRKDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI PEGW PW 
Sbjct  437  RESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWL  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+TL+Y+E QN GPG+  +KRV W G +K +S +E+  ++  QYIQ D WI   G+
Sbjct  497  GDFGLNTLFYSEVQNTGPGAPITKRVTWPG-IKKLSEEEILTFTPAQYIQGDAWIPGKGV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  378  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLNQACPITAHGRKDP  437

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ PEGW PW 
Sbjct  438  RESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWL  497

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L+TL+Y+E QN GPG+  +KRV W G +K +S +E+ K++  QYIQ D WI   G+
Sbjct  498  GEFGLNTLFYSEVQNTGPGAAITKRVTWPG-IKKLSDEEILKFTPAQYIQGDAWIPGKGV  556

Query  277  PY  272
            PY
Sbjct  557  PY  558



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+I+GTIDF+FGDA+AVFQNC ++VRKPLA Q C +TA GR + 
Sbjct  377  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPITAHGRTDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I        V+  ++ +LGRPWK+Y++T+I E+FI  FI  EGWSPW+
Sbjct  437  RESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQ  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E +N GPG+  + RV W G +K +S +E+ +Y+  +YIQ D WI   G+
Sbjct  497  GNFGLDTLFYSEVRNTGPGAAVANRVTWPG-IKKLSEEEIVEYTPAKYIQGDDWIPGKGV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY HA RQ+YRDCSISGTIDF+FGDASAVFQNCK +VRKPL  Q+C+VTAQGR   
Sbjct  390  HQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLENQQCIVTAQGRKMR  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    +++Q+  I   P L   +   + +LGRPWK+Y+RT+I ESFID  I PEGW PW 
Sbjct  450  RQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWL  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T WY E+ N GPGS  + RV W G +K I+ Q    ++ G++++ D WIK TGI
Sbjct  510  GTFGLKTCWYTEFNNYGPGSSKNLRVKWNG-IKTINRQHAMDFTPGRFLKGDSWIKATGI  568

Query  277  PY  272
            PY
Sbjct  569  PY  570



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  814  QDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEHR  635
            QDTLYAHA+RQYYR C I+GTIDFIFG+A+AVFQNC+++VR+PL  Q+ ++TAQGR + R
Sbjct  404  QDTLYAHAHRQYYRSCVITGTIDFIFGNAAAVFQNCQIVVRQPLPNQQNIITAQGRTDKR  463

Query  634  GVGGIVLQNCEICPAPQLKTVQPPA--RVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
               G+V+  C+I P  +L      A  R +LGRPWKQY+RT+  ES I GFI PEGW PW
Sbjct  464  ETTGVVIHKCKILPDKKLVAGSSTAKTRSYLGRPWKQYSRTVYMESTIGGFIEPEGWMPW  523

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+FALDTL+Y EY N+GPG+  +KRVNWKGY    S +E   ++  ++IQ  +WIK TG
Sbjct  524  DGDFALDTLFYGEYMNQGPGATLTKRVNWKGYRVLKSKEEAMAFTVDKFIQGGEWIKATG  583



>emb|CDY40719.1| BnaC03g34350D [Brassica napus]
Length=448

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  79   YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDA  138

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPW++++RT+I  SF+  F+ P+GW PW 
Sbjct  139  REATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWM  198

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  Q+IQ   W+   G+
Sbjct  199  GNFGLDTLFYSEAQNTGPGAGLANRVTWAG-IKTLSNEEILKFTPDQFIQGGIWVPGKGV  257

Query  277  PY  272
            PY
Sbjct  258  PY  259



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGT+DFIFGDA  V QNC ++VRKP+  Q CM+TAQGR + 
Sbjct  387  YQDTLYVHSHRQFFRDCTISGTVDFIFGDAKVVLQNCNIVVRKPMKGQSCMITAQGRTDV  446

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VLQNC I   P    V+   + +LGRPWK+++RT+I  + ID  I P GW PW 
Sbjct  447  RESSGLVLQNCHITGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNIIDPAGWLPWN  506

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY+N GPGSD ++RV W G +K ISP++  +++  ++++ + WI P  +
Sbjct  507  GDFALNTLYYAEYENNGPGSDQAQRVKWPG-IKKISPKQARRFTPARFLRGNLWIPPNRV  565

Query  277  PY  272
            PY
Sbjct  566  PY  567



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H+ RQ++RDC I+GT+DFIFGDA+ VFQN K+  RKP++ Q+ MVTAQGR++ 
Sbjct  363  FQDTLYTHSLRQFFRDCYITGTVDFIFGDAAVVFQNSKLAARKPMSNQQNMVTAQGRVDP  422

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC++ P+  L  V+   + +LGRPWK+Y+RT++ +S ID  I PEGWS W 
Sbjct  423  NSNTGTSIQNCDVIPSSDLAPVKGSIKTYLGRPWKEYSRTVVMQSNIDNHIVPEGWSVWS  482

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EYQNRGPG+ TS RV W GY    S  E SK++  Q IQ  +W+K TG+
Sbjct  483  GDFALKTLYYGEYQNRGPGAGTSGRVKWPGYHVITSAAEASKFTVAQLIQGGEWLKNTGV  542

Query  277  PY  272
             Y
Sbjct  543  AY  544



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   229 bits (584),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  376  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  435

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I   P    V+  ++ +LGRPWK+++RT+I  +FI  FI PEGW PW 
Sbjct  436  RESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIMNTFIPDFIPPEGWQPWL  495

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF L+TL+Y+E +N GPGS  +KRV W G +K +S +E+  ++  QYIQ D WI   G+
Sbjct  496  GNFGLETLFYSEVRNIGPGSGLTKRVTWPG-IKKLSEEEILTFTPAQYIQGDAWIPGKGV  554

Query  277  PY  272
            PY
Sbjct  555  PY  556



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YR+C+ISGTIDF+FGDA+ VFQNC M+VRKP+A Q+C+VTAQGR + 
Sbjct  391  YQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMANQQCIVTAQGRKDR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVL NC I   P L +       +LGRPWK+Y+RT+I +S IDG I  +GW PW 
Sbjct  451  HEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWL  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T +Y E  NRGPG+ T+KRV WKGY K +      KY+  Q+IQ   W+  TG+
Sbjct  511  GEFGLKTCFYTEIGNRGPGAATTKRVTWKGY-KKVDLTHAHKYTVQQFIQGKTWLPKTGV  569

Query  277  PY  272
            P+
Sbjct  570  PF  571



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQ+TL++H YRQ+YR+C+I+GTIDFI GDA+AVFQNCKM+VRKPL  Q C +TAQGR   
Sbjct  392  YQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNCKMVVRKPLENQRCTITAQGRNNT  451

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQNC I        V+  +  FLGRPWK Y+RT++ +S ID  I P+GW+PW 
Sbjct  452  REPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDIIDPKGWAPWM  511

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F +DT   +EY NRGPG+  + RV WKG +K +SPQ+   ++AG++++ D WI  TG+
Sbjct  512  GTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LSPQDAEAFTAGKFLEGDSWIAATGV  570

Query  277  PYDS  266
            PY S
Sbjct  571  PYTS  574



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDA  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+  ++  QYIQ D W+   G+
Sbjct  501  GNFGLDTLFYSEVQNIGPGAALAGRVTWPG-IKTLSDEEILSFTPDQYIQGDVWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_010687597.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 128/178 (72%), Gaps = 1/178 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR C ISGTIDFIFGDASA+FQNC +IVRKP+  Q+ +VTAQGR + 
Sbjct  414  YQDTLYAQTHRQFYRSCYISGTIDFIFGDASAIFQNCMIIVRKPMENQQNIVTAQGRADK  473

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI+L NC I P   L  V+   + +LGRPWKQY+RT++ ES I   IAPEGW PW+
Sbjct  474  HENTGIILHNCRIYPDKDLFPVKHKYKTYLGRPWKQYSRTIVMESTIGELIAPEGWMPWQ  533

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPT  284
            G FAL TL+YAEY N GPGSDTSKRV W GY K+IS QE   ++   ++Q   WI+ +
Sbjct  534  GEFALKTLYYAEYNNHGPGSDTSKRVKWGGYKKSISKQEAQNFTVTPFLQG-SWIRDS  590



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRDC+ISGT+DFIFGD   V Q C ++VRKP+  Q CM+TAQGR + 
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTDE  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P+   V+   + +LGRPWKQ++RT+I  + ID  + P GW PW 
Sbjct  445  RESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWN  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY+N GPGSD S+RV W G +K +SP++  +++  ++++ + WI PT +
Sbjct  505  GSFALNTLYYAEYENNGPGSDQSQRVKWPG-IKKLSPKQALRFTPARFLRGNLWIPPTRV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC ISGTIDF+FGDA+AVFQNCK+IVR+P   Q CMVTAQGR   
Sbjct  363  YQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLIVRRPGDGQNCMVTAQGRTTS  422

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               G  V+QNCEI   P+    +P  + FLGRPWK+Y+RT+I +SFIDGFI P GW+PW 
Sbjct  423  ASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRTIIMQSFIDGFIDPSGWAPWN  482

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRV-NWKGYLKNISPQEVSKYSAGQYIQ--ADQWIK  290
              +F + T WYAEYQNRG G+   KRV +W+GY + IS    + ++AG +I    + ++ 
Sbjct  483  ITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGDVANSFTAGVFINPTDNSFLP  542

Query  289  PTGIPYDS  266
               IPY++
Sbjct  543  KADIPYEA  550



>gb|EYU26212.1| hypothetical protein MIMGU_mgv1a003546mg [Erythranthe guttata]
Length=579

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 132/182 (73%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C ISGT+DFIFGD++ V QNC +IVRKP+  Q+  VTAQGR + 
Sbjct  392  YQDTLYAQTHRQFYRNCVISGTVDFIFGDSAVVIQNCLIIVRKPMDNQQNTVTAQGRTQS  451

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   GIV+QNC I P  +L+ ++     +LGRPWK+Y++T+I ES +  FI P GW PW 
Sbjct  452  KETTGIVIQNCRIVPEQKLEPLRFKIPTYLGRPWKKYSKTIIMESTLADFIQPAGWMPWS  511

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y EY N+GPG+ T KRV WKGY    +  +  +++A  +IQADQW+  TG+
Sbjct  512  GNFALDTLYYREYANKGPGAPTDKRVKWKGYSVITNRDDALQFTAAPFIQADQWLTTTGV  571

Query  277  PY  272
            PY
Sbjct  572  PY  573



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 127/184 (69%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTL AH YRQ+YRDC+I GTIDF+FGDA+AVFQNC + VRKP+  Q C+VTAQGR + 
Sbjct  381  YQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDL  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC I        V+  A+ +LGRPWKQY+RT+I ES ID  I PEGW  W 
Sbjct  441  RQPSGIVLQNCSIVADESYNEVKGEAKTYLGRPWKQYSRTIIMESKIDDLIQPEGWLEWN  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FA DTL+Y E+ N+G GS  + RV W G +K +  + V +++A  ++ AD WI  TG+
Sbjct  501  KTFAFDTLFYTEFNNKGLGSSKADRVTWSG-VKELPIERVQRFTASNFLDADLWIPSTGV  559

Query  277  PYDS  266
            PY S
Sbjct  560  PYTS  563



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDT+Y HA RQ+YRDCSISGTIDF+FGDASAVFQNCK ++RKPL  Q+C+VTAQGR   
Sbjct  391  HQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLIRKPLENQQCIVTAQGRKMR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN  I   P L   +   + +LGRPWK+++RT+I ESFID  I PEGW PW 
Sbjct  451  RQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWL  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T WY E+ N GPGS  + RV W G +K I  Q    ++ G++ +   WIK TGI
Sbjct  511  GTFGLKTCWYTEFNNNGPGSSKAARVKWNG-IKTIDRQHALDFTPGRFFKGGAWIKTTGI  569

Query  277  PY  272
            PY
Sbjct  570  PY  571



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC++SGT+DFIFGDA  + QNCK++VRKP   Q CMVTAQGR + 
Sbjct  382  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKGGQSCMVTAQGRTDV  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P    V+   + +LGRPWK+++RT+I ++ ID  I P GW PW+
Sbjct  442  RESTGLVLHNCHIVGEPAYIPVKSVNKAYLGRPWKKFSRTIIMKTTIDDVIDPAGWLPWR  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAE+ N GPGS+ ++RVNW G +K +SP+E   Y+ G+++  D WI  T +
Sbjct  502  GDFALETLYYAEHLNIGPGSNQAQRVNWPG-IKKLSPEEALLYTGGRFLHGDTWIPQTQV  560

Query  277  PY  272
            PY
Sbjct  561  PY  562



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ R ++RDC+ISGTID+IFG+  ++FQNCKM++RKP+  Q  +VTAQGR   
Sbjct  405  YQDTLYAHSGRHFFRDCTISGTIDYIFGNGESIFQNCKMVIRKPMVNQANIVTAQGRKTE  464

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R V  IVLQ C I   P L   +   + +LGRPWK+++RT+I E+ ID  I+P+GW PW 
Sbjct  465  REVSAIVLQGCTISADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWM  524

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L T +YAE+ NRGPG+  + RV W G    ++P++  +Y+A  YIQAD W+KP GI
Sbjct  525  GDFGLQTCYYAEFNNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQADDWVKPLGI  584

Query  277  PY  272
            PY
Sbjct  585  PY  586



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R V G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW 
Sbjct  441  REVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPGS  + RV W G +K +S +++ K++  QYIQ D W+   G+
Sbjct  501  GDFGLKTLFYSEVQNTGPGSALANRVTWAG-IKTLSDEDILKFTPAQYIQGDTWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRDC+ISGT+DFIFGD   V QNC ++VRKP+  Q CM+TAQGR + 
Sbjct  386  YQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVVLQNCNIVVRKPMKNQSCMITAQGRTDV  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P+   V+   + +LGRPWK+++RT+I  + ID  I P GW PW 
Sbjct  446  RESTGLVLHNCHIMGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVIDPAGWLPWD  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE++N GPGSD S+RV W G +K +SP++  +++  ++++ + WI P  +
Sbjct  506  GDFALSTLYYAEFENTGPGSDQSQRVKWPG-IKKLSPKQALRFTPARFLRGNLWIPPNRV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKP--LATQECMVTAQGRM  644
            YQ TL  H  RQ+YRDC+ISGTIDFIFGDA AV QNCK+I RKP  + TQ   + AQGRM
Sbjct  364  YQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVLQNCKIIARKPEEMQTQAITIAAQGRM  423

Query  643  EHRGVGGIVLQNCEICPAPQLKTVQPP-ARVFLGRPWKQYARTLIAESFIDGFIAPEGWS  467
            E  G G I++QNC I   P L  + PP  + FLGRP K Y+RT++ +S IDGFI PEGW+
Sbjct  424  EPSGTGIIIIQNCTITAEPALVAINPPRNKAFLGRPAKMYSRTIVMQSQIDGFIEPEGWT  483

Query  466  PWKGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEV-SKYSAGQYIQ----AD  302
            P+ G F L+TL++ EYQNRGPG++T +RV WK Y+KN  PQ+V +K++ G  ++     D
Sbjct  484  PFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYMKN-PPQDVIAKFAPGVVLKGGDNTD  542

Query  301  QWIKPTGIPYDSA  263
             W+  TG+PY+ A
Sbjct  543  GWVTKTGVPYEPA  555



>ref|XP_006851559.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
 gb|ERN13140.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
Length=586

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ YR+C +SGTIDFIFGD++AV QNCK+IVR+P+  Q+ +VTA GR++ 
Sbjct  402  YQDTLYAHSHRQLYRNCVVSGTIDFIFGDSAAVLQNCKIIVRRPMDNQQNIVTASGRLDK  461

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R  GGI++ NC I P  +L   +   R +LGRPWK+YART++ ES +   I P+GW PW+
Sbjct  462  RSTGGIIIHNCRIVPDKRLYPERLKFRTYLGRPWKEYARTIVMESTLGDLIQPDGWMPWE  521

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N+GPG+ T++RV W   +K     +  +++AG ++QA QW+  TG+
Sbjct  522  GDFALKTLFYAEYGNKGPGAQTARRVKWSRVIKR---SDALQFTAGPFLQARQWLPSTGV  578

Query  277  PY  272
            PY
Sbjct  579  PY  580



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+Y+ C ISGT+DFIFGDA+A+FQNC + VRKP+  Q+ +VTAQGR + 
Sbjct  409  YQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIVTAQGRTDK  468

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++ +S I+  I P+GW+PW+
Sbjct  469  QETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMDSTIEDLIHPDGWTPWQ  528

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N+GPG+ T  RV W GY K I  QE  KY+ G +++ + W++  G+
Sbjct  529  GDFALKTLYYAEYNNKGPGAKTDNRVKWSGY-KVIDKQEAMKYTVGPFLKGNAWLRVKGV  587

Query  277  P  275
            P
Sbjct  588  P  588



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 133/181 (73%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+Y+ C ISGT+DFIFGDA+A+FQNC + VRKP+  Q+ +VTAQGR + 
Sbjct  409  YQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIVTAQGRTDK  468

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++  S I+  I P+GW+PW+
Sbjct  469  RETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMGSTIEDLIHPDGWTPWQ  528

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N+GPG+ T  RV W GY K I  QE  KY+ G +++ + W++  G+
Sbjct  529  GDFALKTLYYAEYNNKGPGAKTDNRVKWSGY-KVIDKQEAMKYTVGPFLKGNAWLRVKGV  587

Query  277  P  275
            P
Sbjct  588  P  588



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW+
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWQ  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPG+  + RV W G +K +S +++ K++  QYIQ D W+   G+
Sbjct  501  GDFGLKTLFYSEVQNTGPGATVANRVTWAG-IKTLSDEDILKFTPAQYIQGDTWVPGKGV  559

Query  277  PYDS  266
            PY S
Sbjct  560  PYTS  563



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 132/184 (72%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAHA+RQ+YRDC+ISGTIDF+FG+A+  FQNCK++VRKPL  Q+C+VTA GR+  
Sbjct  391  YQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPLDNQQCIVTAHGRLNR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +    ++ Q+C     P     +   + +LGRPWK+Y+RT+I  S ID  I PEGW PW 
Sbjct  451  KEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSRTIIIGSTIDDIIQPEGWLPWM  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+TL+YAE QN+G G+D SKRV W+G +K+I+PQ  + ++  ++I  D WI   GI
Sbjct  511  GDFGLNTLFYAEVQNKGAGADESKRVKWRG-IKHITPQHAADFTPRRFIDGDAWIPAKGI  569

Query  277  PYDS  266
            PY S
Sbjct  570  PYSS  573



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S  E+ K++  QYIQ + W+   G+
Sbjct  501  GNFGLDTLFYSEVQNTGPGAALASRVTWPG-IKTLSNDEILKFTPDQYIQGNVWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 3/186 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQE-CMVTAQGRME  641
            YQDT++AH +RQ++RDC+ISGTIDFIFG+A AVFQNC ++VRKPL  Q+ C+VTA+GR  
Sbjct  377  YQDTVFAHNHRQFFRDCTISGTIDFIFGNARAVFQNCTLLVRKPLENQKACLVTAEGRTT  436

Query  640  HRGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
                  IVLQNC I PAP+     P  + +LGRPWK Y+RT+I +S +D  + PEGW+PW
Sbjct  437  INETSAIVLQNCRILPAPEYPVNDPTYKTYLGRPWKPYSRTVIMDSHLDSLVDPEGWAPW  496

Query  460  KGNFA-LDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPT  284
                A LDT WYAE  N+GPG+D S+RV W G +K I+  E   ++ GQ++  D WI   
Sbjct  497  NVTSAHLDTCWYAELNNKGPGADLSRRVAWPG-IKKITVNEADDFTPGQFMVGDSWIAGK  555

Query  283  GIPYDS  266
            GIPYDS
Sbjct  556  GIPYDS  561



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR+C +SGT+DFIFGDA+AV QN  ++VRKP+  Q+  VTA GR + 
Sbjct  379  YQDTLYVQAHRQFYRNCVVSGTVDFIFGDAAAVIQNSLIVVRKPMDNQQNTVTAHGRTDK  438

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G+V+QNC I P  +L  V+     +LGRPWKQY+RT+I ES I   I P G+ PW 
Sbjct  439  HETTGLVIQNCRIVPEQKLYPVRLQIPSYLGRPWKQYSRTVIMESTIGDLIQPAGYMPWS  498

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY NRGPG+ T KRV WKG+    +  E  +++A  +IQ +QW+KPTG+
Sbjct  499  GNFALDTLYYAEYANRGPGAATDKRVKWKGFHVIKNRNEALQFTASPFIQGNQWLKPTGM  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  383  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDP  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C+I   P   +V+  ++ +LGRPWK Y+RT+I  +FI  F+ P+GW PW 
Sbjct  443  REPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWN  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPGSD   RV W G +K ++  ++ +++  Q+IQ D WI  TG+
Sbjct  503  GDFGLSTLFYSEIQNTGPGSDVVNRVTWAG-IKKLTNNDLLQFTPAQFIQGDSWIPATGV  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPGS  + RV W G +K +S +++ K++  QYIQ D WI   G+
Sbjct  501  GDFGLKTLFYSEVQNTGPGSALANRVTWAG-IKTLSEEDILKFTPAQYIQGDDWIPGKGV  559

Query  277  PYDS  266
            PY +
Sbjct  560  PYTT  563



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY+H  RQ+YRDC+I+GTIDFIFGDA+++FQNC + VRKPLA Q+C+VTA GR + 
Sbjct  395  FQDTLYSHTKRQFYRDCTITGTIDFIFGDAASIFQNCIIRVRKPLANQQCIVTASGRKDR  454

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I+L NC I   P    ++     +LGRPWK Y+RTL+ +S ID FI P+GW PW 
Sbjct  455  REATAIILHNCTIGADPDYLPLRARNPSYLGRPWKPYSRTLVVQSQIDDFIHPQGWLPWL  514

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+T +YAE  NRGPG+  +KRV WKGY K I      K++  Q+IQ + W+KPTG+
Sbjct  515  GDFGLNTCFYAEVDNRGPGATIAKRVAWKGY-KKIDYSHAQKFTVEQFIQGNSWLKPTGV  573

Query  277  PY  272
            PY
Sbjct  574  PY  575



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQ+C ++VRKPL  Q C +TA GR + 
Sbjct  378  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSCTLLVRKPLPNQACPITAHGRKDP  437

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I   P   TV+  ++ +LGRPWK+Y+RT+   +FI  FI PEGW PW 
Sbjct  438  RESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWL  497

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF L+TL+Y+E  N GPG+D +KRV W G +K +S +E+ K +  +YIQ D WI   G+
Sbjct  498  GNFGLETLFYSEVGNTGPGADVTKRVTWPG-IKKLSEEEILKITPAEYIQGDAWIPGKGV  556

Query  277  PY  272
            PY
Sbjct  557  PY  558



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTAQGR++ 
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAQGRLDR  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I  + +    +   + +LGRPWK YAR ++ +S ID  IAPEGW  W 
Sbjct  448  RSPSALILQNCTI--SGERGYDKELNKAYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWT  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G    +T W+ E+ NRG G++ SKRV W+G +K ++P+  + ++AG++I  D+WI P+G+
Sbjct  506  GTANHNTCWFGEFGNRGVGAELSKRVTWRG-MKKLTPEHAADFTAGKFIFGDRWILPSGV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAHA+RQ+YRDC+ISGTIDF+FG+A+  FQNCK++VRKP+  Q+C+VTA GRM  
Sbjct  390  YQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPMDNQQCIVTAHGRMNR  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +    ++ Q C     P     +   + +LGRPWKQY+RT+I  S ID  I PEGW PW 
Sbjct  450  KEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEGWLPWM  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+TL+YAE QN+GPG+  +KRV W+G +K+I+PQ  + ++  ++I  D WI   GI
Sbjct  510  GDFGLNTLFYAEVQNKGPGAVETKRVKWRG-IKHITPQHAADFTPRRFIDGDAWIPAKGI  568

Query  277  PYDSA  263
            PY S 
Sbjct  569  PYSSG  573



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDT+YA  +RQ++R C I+GTIDFIFGDASA+FQNC + VRKPL  Q+ +VTAQGR + 
Sbjct  409  YQDTVYAQTHRQFFRGCVITGTIDFIFGDASAIFQNCLITVRKPLDNQQNIVTAQGRTDK  468

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC I P   L   +   + +LGRPWK+++RT++ ES I+  I P+GW PW+
Sbjct  469  RETTGIVLQNCRILPDQDLIPTKTQVKSYLGRPWKEFSRTIVMESTIEDLIQPQGWLPWE  528

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIK  290
            GNFAL TL+YAEY N+GPG+  S RV W GY K I  +E  KY+ G +IQ D W+K
Sbjct  529  GNFALSTLYYAEYNNKGPGAALSARVKWPGY-KVIEKEEAVKYTVGPFIQGDDWLK  583



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTA GR++ 
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDR  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI+LQNC I   P  +  +   + +LGRPWK YAR ++ +S ID  IAPEGW  W 
Sbjct  448  RSPTGIILQNCTISGEPGYE--KDLNKAYLGRPWKNYARAIVMQSQIDDVIAPEGWMEWI  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+    + W+ E+ NRG G+D +KR  W+G +K ++ Q  + ++AG+++  D+WI+P+G+
Sbjct  506  GSNNHQSCWFGEFGNRGLGADQTKRATWRG-IKELTAQHAADFTAGRFVFGDRWIQPSGV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDA  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPW++++RT+I  SF+  F+ P+GW PW 
Sbjct  441  REATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWM  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  Q+IQ   W+   G+
Sbjct  501  GNFGLDTLFYSEAQNTGPGAGLANRVTWAG-IKKLSNEEILKFTPDQFIQGGIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDA  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPW++++RT+I  SF+  F+ P+GW PW 
Sbjct  441  REATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWM  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  Q+IQ   W+   G+
Sbjct  501  GNFGLDTLFYSEAQNTGPGAGLANRVTWAG-IKKLSNEEILKFTPDQFIQGGIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC+ISGTIDFIFGDA+ +FQNC  +VRKPL  Q+C+VTAQGR E 
Sbjct  390  YQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQCIVTAQGRKER  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN      P+    +   + +LGRPWK+++RT+I ES+I+  I P GW PW 
Sbjct  450  RQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWA  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL T +Y E++NRGPG+ T  RV W+G +K I P     ++ G+++  D+WI  TG+
Sbjct  510  GDFALRTCFYTEFRNRGPGAKTHDRVKWRG-IKTIKPSHAIDFAPGRFLSGDRWIPSTGV  568

Query  277  PYDS  266
            PY+S
Sbjct  569  PYNS  572



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRDC+ISGT+DFIFGD   V Q C ++VRKP+ +Q CM+TAQGR + 
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKSQSCMITAQGRTDE  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P+   V+   + +LGRPWKQ++RT+I  + I+  + P GW PW 
Sbjct  445  RESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWN  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY+N G GSD S+RV W G +K +SP++  +++  ++++ + WI PT +
Sbjct  505  GSFALNTLYYAEYENNGLGSDQSQRVKWPG-IKKLSPKQALRFTPARFLRGNLWIPPTRV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   224 bits (571),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDA  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPW++++RT+I  SF+  F+ P+GW PW 
Sbjct  441  REATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWM  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E QN GPG+  + RV W G +K +S +E+ K++  Q+IQ   W+   G+
Sbjct  501  GNFGLDTLFYSEAQNTGPGAGLANRVTWAG-IKKLSNEEILKFTPDQFIQGGIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC++SGT+DFIFGD   V QNC ++VRKP+ +Q CM+TAQGR + 
Sbjct  386  YQDTLYVHSHRQFFRDCTVSGTVDFIFGDGIVVLQNCNIVVRKPMKSQSCMITAQGRSDK  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VLQNC I   P    V+   + +LGRPWK+++RT+I  + ID  I P GW PW 
Sbjct  446  RESTGLVLQNCHITGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVIDPAGWLPWN  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY+N GPGS+ ++RV W G +K +SP++  +++  ++++ + WI P  +
Sbjct  506  GDFALNTLYYAEYENNGPGSNQAQRVKWPG-IKKLSPKQALRFTPARFLRGNLWIPPNRV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>gb|KEH15723.1| pectinesterase [Medicago truncatula]
Length=228

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 126/185 (68%), Gaps = 0/185 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY +A RQ+YRDC+I GTIDFIFG+A  V QNC + VRKP++ Q+  VTAQGR + 
Sbjct  43   FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQQNTVTAQGRTDP  102

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIV+ NC I  +  LK +Q   + +LGRPW++Y+RT++ +S +DG I  EGW+PW 
Sbjct  103  NENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWM  162

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N G G++T  RV W G+    +P +  K+S G ++  D WI  +G+
Sbjct  163  GGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGV  222

Query  277  PYDSA  263
            P+D+ 
Sbjct  223  PFDAG  227



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQ+TLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  381  YQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPGS  + RV W G +K +S +++ K++  QYIQ D WI   G+
Sbjct  501  GDFGLKTLFYSEVQNTGPGSALANRVTWAG-IKTLSEEDILKFTPAQYIQGDDWIPGKGV  559

Query  277  PYDS  266
            PY +
Sbjct  560  PYTT  563



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 138/187 (74%), Gaps = 6/187 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAH++RQ+YRDC I+GTIDF+FGDASAVFQNC++IVRKP  TQ CMVTAQGR   
Sbjct  362  FQDTLYAHSFRQFYRDCIITGTIDFMFGDASAVFQNCQIIVRKPGNTQACMVTAQGRTVP  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              VGG V+QNC+I P P   +     + +LGRPWK++++T+I +S ID FI P GW+PW 
Sbjct  422  TSVGGFVIQNCDIKPEPGFPST---TKAYLGRPWKEFSKTIIMQSNIDAFIDPSGWAPWN  478

Query  457  -GNFALDTLWYAEYQNRGPGSDTSKRVN-WKGYLKNISPQEVSKYSAGQYIQADQ-WIKP  287
              +F + T +YAEYQNRGPG+   KRV+ W+GY + IS   +++++AG++I  +  W+  
Sbjct  479  TTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQRGISGDAINQFTAGKFINTESPWLPK  538

Query  286  TGIPYDS  266
              IPYD+
Sbjct  539  GDIPYDA  545



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQ+TLY   +RQ+Y+ C ISGT+DFIFGDA+ +FQNC + VRKPL  Q+  VTAQGR + 
Sbjct  407  YQETLYVQTHRQFYKSCVISGTVDFIFGDAATIFQNCLIYVRKPLENQQNTVTAQGRTDK  466

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++ ES I+  I P+GW+PW+
Sbjct  467  RETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHPDGWTPWE  526

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N+GPG+ T  RV W GY K I+ +E  +Y+ G +++   W+K  G+
Sbjct  527  GDFALKTLYYAEYNNKGPGAKTDNRVKWDGY-KKINKEEAMQYTVGPFLKGHAWLKVEGV  585

Query  277  P  275
            P
Sbjct  586  P  586



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY +A RQ+YRDC I GT+DFIFGDA AV QNC + VRKP++ Q+  VTAQGR + 
Sbjct  231  YQDTLYVYANRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSNQQNTVTAQGRTDP  290

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI++ NC I  A  LK VQ   R FLGRPW++Y+RT++ +S +DG I+P GW PW 
Sbjct  291  NENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTVVMKSALDGLISPAGWFPWS  350

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL TL+YAE+ N G G+ T  RV+W G+ + IS  E  K++ G ++    WI  +G+
Sbjct  351  GNFALSTLYYAEHANTGAGASTGGRVDWAGF-RVISSTEAVKFTVGNFLAGGSWIPGSGV  409

Query  277  PYD  269
            P+D
Sbjct  410  PFD  412



>dbj|BAK05856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAH+  Q+YR+C ISGTIDFIFGDA+AVFQNC + +R+PL  Q+ +VTAQGR + 
Sbjct  420  FQDTLYAHSKAQFYRNCVISGTIDFIFGDAAAVFQNCIITLRRPLDNQQNIVTAQGRADA  479

Query  637  RGVGGIVLQNCEICPAPQLKT-VQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G VLQ CEI   P L    +PP + +LGRPW++ +RT+I ES I   I   G+ PW
Sbjct  480  REATGFVLQKCEITAEPGLTAPGKPPIKNYLGRPWRECSRTIIMESDIPALIDKAGYLPW  539

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+FAL TL+YAEY N+GPG+DT+ RVNW+GY K IS  + +K++ G +I A  WI PTG
Sbjct  540  NGDFALKTLFYAEYGNKGPGADTAGRVNWEGYKKTISKDDATKFTLGNFIHAQAWIDPTG  599

Query  280  IP  275
             P
Sbjct  600  TP  601



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAHA+RQ+YRDC+ISGTIDFIFGDA AVFQNC+M V+KPL  Q+C+VTA GR E 
Sbjct  391  FQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQNCQMFVKKPLENQQCIVTASGRSER  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IVLQNC I   P    ++   + +LGRPWK Y+RT+I +S ID  I P+GW  W 
Sbjct  451  RSASAIVLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWM  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQ-WIKPTG  281
            GNFAL+T +YAEY NRG GS T+ R  W+G +K+++ Q +  ++   + + D  WI  TG
Sbjct  511  GNFALNTCFYAEYGNRGAGSATTGRAKWRG-IKSMTAQHIVDFTPKAFFKGDDAWITATG  569

Query  280  IPY  272
            +PY
Sbjct  570  VPY  572



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 133/182 (73%), Gaps = 2/182 (1%)
 Frame = -1

Query  814  QDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEHR  635
            QDTLYA   RQ+YRDC++SGTIDFIFGDA AVFQNCK++VRKP   Q+CMVTAQGR E +
Sbjct  396  QDTLYALRGRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEEK  455

Query  634  GVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWKG  455
            G G  + + C +   P  K V+     +LGRPWK+Y++T+   S ID  IAP+GW+ W+G
Sbjct  456  GPGAFIFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQG  515

Query  454  NFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYS-AGQYIQADQWIKPTGI  278
            NFALDTL+YAE++N+G G+D S+RV WKG +K +S QE   ++ A  ++  D+WI  +G+
Sbjct  516  NFALDTLYYAEFENKGAGADKSQRVKWKG-IKTLSAQEADGFTPAKLFVSGDKWIPESGV  574

Query  277  PY  272
            PY
Sbjct  575  PY  576



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YR+C ISGT+DFIFG+A+ VFQ+C ++ RKP A Q+  +TAQGR + 
Sbjct  370  YQDTLYAHSLRQFYRECKISGTVDFIFGNAAVVFQSCILVPRKPGANQKNAITAQGRTDP  429

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI + NC+I P   L  V+     +LGRPWK+Y+RT+  +S+IDGFI P GW  W 
Sbjct  430  NQNTGISIHNCKITPGTDLVPVKSSFPTYLGRPWKEYSRTVFMQSYIDGFIQPAGWLEWD  489

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N GPGS T  RV W GY    SPQE SK++ G++IQ D W++ TG+
Sbjct  490  GDFALKTLYYGEYMNTGPGSGTGNRVKWPGYRVIKSPQEASKFTVGEFIQGDSWLQSTGV  549

Query  277  PY  272
             Y
Sbjct  550  HY  551



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQ+TLYA  +RQ+Y+ C ISGT+DFIFGDA+A+FQNC + VRKPL  Q+  VTAQGR + 
Sbjct  412  YQETLYAQTHRQFYKSCXISGTVDFIFGDAAAIFQNCLIYVRKPLENQQNTVTAQGRTDK  471

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++ ES I+  I  +GW+PW+
Sbjct  472  RETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHXDGWTPWE  531

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N+GPG  T  RV W GY K I+ +E  +Y+ G +++   W+K  G+
Sbjct  532  GDFALKTLYYAEYNNKGPGXKTDNRVKWDGY-KKINKEEAMQYTVGPFLKGHAWLKVEGV  590

Query  277  P  275
            P
Sbjct  591  P  591



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   224 bits (572),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H YRQ+Y+DC ISGT+DFIFGD++AVFQ C ++VRKP+  Q+C+VTAQGR + 
Sbjct  361  YQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPMDNQQCIVTAQGRKDV  420

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+QNC     P+L  V+     +LGRPWK+Y+RT+I ESF+D FI P+GW  W 
Sbjct  421  RQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLDDFIQPDGWMKWN  480

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y E+ NRGP +   KRV W G +K + P  V +++ G+++  ++WI PT +
Sbjct  481  ETFALETLFYTEFNNRGPAAPKMKRVKWPG-VKELPPSRVQRFTPGEFLDGNRWIPPTQV  539

Query  277  PY  272
            PY
Sbjct  540  PY  541



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 134/184 (73%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA+RQ+YRDC+I+GTIDFIFGD++ VFQNC ++VRKPL  Q+C+VTAQGR E 
Sbjct  358  YQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDNQQCIVTAQGRNER  417

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC I  A      +   + +LGRPWK ++RT+I +S ID  I+PEGW PW 
Sbjct  418  REPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWM  477

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L+T +YAEY NRGP S T+ RV W+G +K I+ Q V+ ++ G++I    W+  +G+
Sbjct  478  GDFGLNTCFYAEYGNRGPASATTSRVTWRG-IKQITGQHVNDFTVGRFISGHLWLGASGV  536

Query  277  PYDS  266
            PY S
Sbjct  537  PYTS  540



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTA GR++ 
Sbjct  389  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDR  448

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I         +   + +LGRPWK YAR ++ +S ID  IAPEGW  W 
Sbjct  449  RSPTALILQNCTISGESGYD--KELNKAYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWT  506

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G    +T W+ E+ NRG G++ SKRV W+G +K ++P+  + ++AG++I  D+WI P+G+
Sbjct  507  GASNHNTCWFGEFGNRGVGAELSKRVTWRG-MKKLTPEHAADFTAGKFIFGDRWILPSGV  565

Query  277  PY  272
            PY
Sbjct  566  PY  567



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC+ISGTIDFIFGDA+ +FQNC  +VRKPL  Q+C+VTAQGR E 
Sbjct  390  YQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQCIVTAQGRKER  449

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN      P+    +   + +LGRPWK+++RT+I ES+I+  I P GW PW 
Sbjct  450  RQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWA  509

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL T +Y E++NRGPG+ T  RV W+G +K I P     ++ G+++  D+WI  TG+
Sbjct  510  GDFALRTCFYTEFRNRGPGAKTHDRVKWRG-IKTIKPSHAIDFAPGRFLSGDRWIPSTGV  568

Query  277  PYDS  266
            PY+S
Sbjct  569  PYNS  572



>gb|AAF16637.1|AC011661_15 T23J18.24 [Arabidopsis thaliana]
Length=223

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ R P A Q+ M+TAQGR + 
Sbjct  38   YQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNMLTAQGREDQ  97

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  98   NQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWD  157

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRVNWKG+      +E  +++  + IQ   W+KPTG+
Sbjct  158  GEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLIQGGLWLKPTGV  217

Query  277  PY  272
             +
Sbjct  218  TF  219



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  379  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDP  438

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I        V+  ++ +LGRPWK+Y++T+I  +FI  F+  +GW PW+
Sbjct  439  RESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFVPAQGWQPWQ  498

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF LDTL+Y+E +N GPG+  + RV W G +K +S +EV +++  +YIQ D WI   G+
Sbjct  499  GNFGLDTLFYSEVRNTGPGAPVTNRVTWPG-IKKLSEEEVLEFTPSRYIQGDAWIPGKGV  557

Query  277  PY  272
            PY
Sbjct  558  PY  559



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 125/185 (68%), Gaps = 0/185 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY ++ RQ+YRDC+I GT+DFIFGDASA+ QNC + VRKP + Q   VTAQ R + 
Sbjct  8    YQDTLYVYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKPSSNQINTVTAQSRRDP  67

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI++ NC I  AP L+ VQ   R +LGRPW++Y+R +I +S +DG IAP+GW PW 
Sbjct  68   NENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIAPQGWFPWS  127

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F LDTL+Y EY N G G+ T  RV W G+    S  E  K++ G ++  D W+  TG+
Sbjct  128  GSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLPGTGV  187

Query  277  PYDSA  263
            P+++ 
Sbjct  188  PFEAG  192



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC ISGTIDF+FGDA AVFQNC+ +VR+P+  Q+C+VTAQGR + 
Sbjct  402  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCQFVVRRPMENQQCIVTAQGRKDR  461

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+    I   P    V+   R +LGRPWK+Y+RT+I  S ID  I PEGW  W 
Sbjct  462  RETTGIVIHKSRIMGDPTYLPVKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWN  521

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FALDTL+YAEYQN GPGSD + RV W G ++++S    ++Y+   +++ + WI  T +
Sbjct  522  ETFALDTLYYAEYQNTGPGSDQAGRVRWNG-IQHLSDSAATQYTPDNFLRGNTWIPKTRV  580

Query  277  PY  272
            PY
Sbjct  581  PY  582



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRDC+ISGT+DFIFGD   V Q C ++VRKP+  Q CM+TAQGR   
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTNE  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P+   V+   + +LGRPWKQ++RT+I  + I+  + P GW PW 
Sbjct  445  RESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWN  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY+N G GSD S+RV W G +K +SP++  +++  ++++ + WI PT +
Sbjct  505  GSFALNTLYYAEYENNGLGSDQSQRVKWPG-IKKLSPKQALRFTPARFLRGNLWIPPTRV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC  +VRKPL  Q C +TA GR + 
Sbjct  380  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTFLVRKPLPNQACPITAHGRKDP  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G VLQ C I        V+  ++ +LGRPWK+Y+RT+I  +FI  FI PEGW PW 
Sbjct  440  RETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWL  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
             NF L+TL+Y+E +N GPG+    RV W G +K +  +E+ K++  QYIQ D WI   G+
Sbjct  500  DNFGLETLFYSEVRNTGPGAPAMNRVTWPG-IKKLGEEEILKFTPAQYIQGDAWIPGKGV  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            ++DTLY H  RQ+YRDC I+GT+DFIFG+A+ VFQN K+  RKP++ Q+ MVTAQGR + 
Sbjct  301  FRDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAARKPMSGQKNMVTAQGREDP  360

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              V G  +QNCEI P+  L  V+   + +LGRPWK Y+RT+  +S I   I P GWS W 
Sbjct  361  NQVTGTSIQNCEIIPSSDLAPVKGSVKTYLGRPWKAYSRTVYMQSNIGDHIDPAGWSEWD  420

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+G G+  SKRVNW GY K ++  E +K++ GQ IQ   W+K TG+
Sbjct  421  GDFALKTLYYGEYMNKGAGAGISKRVNWAGYHKALTTSEAAKFTVGQLIQGAAWLKSTGV  480

Query  277  PY  272
             Y
Sbjct  481  AY  482



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTID+IFGDA + FQNCKM+VRKP+  Q CMVTAQGR + 
Sbjct  387  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCKMVVRKPMGGQSCMVTAQGRTDK  446

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI+L NC I   P    V+   + +LGRPWK+++RT+I  + ID  I P+GW  W 
Sbjct  447  RESTGIILHNCRIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWN  506

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL Y EY+N G GS    RV W G +K +S ++  +++AG++++ + WI    +
Sbjct  507  GNFALDTLEYGEYENNGSGSGQEMRVKWPG-IKKLSARQALQFTAGRFLRGNTWIPRRRV  565

Query  277  PY  272
            PY
Sbjct  566  PY  567



>ref|XP_002275000.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=570

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR+C ISGT+DFIFGD++ + QN  +IVRKPL  Q+  +TA GR E 
Sbjct  382  YQDTLYVQAHRQFYRNCVISGTVDFIFGDSTTLIQNSLIIVRKPLDNQQNTITAHGRAEK  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V+QNC I P  +L   +     +LGRPWK Y+RT++ ES +  FI P GW PW 
Sbjct  442  RETTGLVIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWM  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY N+GPG++T++RV WKGY    +  E  +++AG +IQ ++W++ TG 
Sbjct  502  GNFALDTLYYAEYANKGPGANTAQRVKWKGYKVITNRNEALQFTAGPFIQGNEWLRLTGA  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH YRQ+YRDC ISGTIDFIFGD++AVFQ C ++VRKPL  Q+C+VTAQGR + 
Sbjct  389  YQDTLYAHTYRQFYRDCVISGTIDFIFGDSAAVFQGCSLVVRKPLDNQDCIVTAQGRKDL  448

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VLQNC   P P    V+   + +LGRPWK+++RT+I ES+I       GW PW 
Sbjct  449  RQPTGLVLQNCSFVPDPAYYPVRNTNKAYLGRPWKEFSRTIIMESYISDSFQAAGWLPWF  508

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
             +FALDTL+YAE+ NRGP S+ + RV W G +K +  + V +++A +++  ++WI  T +
Sbjct  509  EDFALDTLFYAEFNNRGPSSNKTDRVKWHG-IKELPAKRVKRFTADEFLDGERWIPRTKV  567

Query  277  PYD  269
            PYD
Sbjct  568  PYD  570



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTA GR++ 
Sbjct  389  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDM  448

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I  + +    +   + +LGRPWK YAR ++ +S ID  IAPEGW  W 
Sbjct  449  RSPSALILQNCTI--SGERGYNKELNKAYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWT  506

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G    +T W++E+ NRG G++ SKRV W G +K ++P+  + ++AG+++  D+WI P+G+
Sbjct  507  GTANHNTCWFSEFGNRGVGAELSKRVTWSG-MKKLTPEHAADFTAGKFMFGDRWILPSGV  565

Query  277  PY  272
            PY
Sbjct  566  PY  567



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+A+ VFQNC ++ RKP   Q+ M+TAQGR + 
Sbjct  370  YQDTLYTHTLRQFYRDSYITGTVDFIFGNAAVVFQNCDIVARKPDKGQKNMLTAQGREDP  429

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC++ P+  L  V+   + +LGRPWK Y+RT+  +S+I+  I P GW PW 
Sbjct  430  NQNTGTSIQNCKVTPSSDLAPVKGTFKTYLGRPWKMYSRTVFMQSYIEDHIDPSGWFPWD  489

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N GPGSDTSKRVNWKGY     P+E  +++  + IQ   W+KPTG+
Sbjct  490  GDFALSTLYYGEYANTGPGSDTSKRVNWKGYRVIKDPKEAEQFTVAKLIQGGSWLKPTGV  549

Query  277  PY  272
             Y
Sbjct  550  AY  551



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  363  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDP  422

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G VLQ C I        V+  ++ +LGRPWK Y++T+I ++FI  FIA EGW  WK
Sbjct  423  KETTGFVLQGCTIAGEADYLAVKESSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWK  482

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF +DTL+Y+E +N GPG+  + RV W G +K +S +++  Y+  +YIQ D+WI   G+
Sbjct  483  GNFGIDTLFYSEARNTGPGAGVTGRVTWPG-IKKLSDEDILGYTPAKYIQGDEWIPSKGV  541

Query  277  PY  272
            PY
Sbjct  542  PY  543



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   225 bits (573),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAHAYRQ+YR+C ISGTIDFIFGD++AVFQNC ++VRKPL  Q+C+VTAQGR E 
Sbjct  374  YQDTLYAHAYRQFYRNCRISGTIDFIFGDSAAVFQNCTLLVRKPLENQQCVVTAQGRKEI  433

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G +LQNC I P   L  ++   + +LGRPWKQY+RT+I ESF+D  I P GW PW 
Sbjct  434  RQPTGFILQNCSIRPDRDLYAIRKNIKTYLGRPWKQYSRTVIMESFLDDLICPTGWLPWN  493

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+Y E+ NRGP +   +R  W G +K +    + +++A +++  + WI  T +
Sbjct  494  GTFALDTLFYTEFNNRGPAAPKKQRARWPG-VKELPSSRIQRFTAVEFLDGNGWIPRTQV  552

Query  277  PY  272
            PY
Sbjct  553  PY  554



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  377  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G VLQ C I        V+  ++ +LGRPWK Y++T+I ++FI  FIA EGW  WK
Sbjct  437  KETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWK  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF +DTL+Y+E +N GPG+  + RV W G +K +S +++  Y+  +YIQ D+WI   G+
Sbjct  497  GNFGIDTLFYSEARNTGPGAGVTGRVTWPG-IKKLSDEDILGYTPAKYIQGDEWIPSKGV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>emb|CBI26012.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR+C ISGT+DFIFGD++ + QN  +IVRKPL  Q+  +TA GR E 
Sbjct  382  YQDTLYVQAHRQFYRNCVISGTVDFIFGDSTTLIQNSLIIVRKPLDNQQNTITAHGRAEK  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V+QNC I P  +L   +     +LGRPWK Y+RT++ ES +  FI P GW PW 
Sbjct  442  RETTGLVIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWM  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY N+GPG++T++RV WKGY    +  E  +++AG +IQ ++W++ TG 
Sbjct  502  GNFALDTLYYAEYANKGPGANTAQRVKWKGYKVITNRNEALQFTAGPFIQGNEWLRLTGA  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 131/181 (72%), Gaps = 2/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR C I+GTIDFIFGDA+A+FQNC M++RKPL  Q+ MVTAQGR + 
Sbjct  410  YQDTLYTQAHRQFYRSCLITGTIDFIFGDAAAIFQNCNMMIRKPLDNQQNMVTAQGRTDK  469

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++ ES I+  I P+GW  W+
Sbjct  470  HETTGIVLQNCKILPDKTLEPVKSQFKSYLGRPWKEFSRTIVMESTIEDVIHPDGWMAWE  529

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N+GPG+ T  RV W GY K I   E +K++ G +++ D WI+ T  
Sbjct  530  GDFALKTLYYAEFNNKGPGAKTDARVKWPGY-KVIDKDEAAKFTIGTFLELD-WIESTSA  587

Query  277  P  275
            P
Sbjct  588  P  588



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 126/185 (68%), Gaps = 0/185 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY +A RQ+YRDC+I GTIDFIFG+A  V QNC + VRKP++ Q+  VTAQGR + 
Sbjct  187  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQQNTVTAQGRTDP  246

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIV+ NC I  +  LK +Q   + +LGRPW++Y+RT++ +S +DG I  EGW+PW 
Sbjct  247  NENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWM  306

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N G G++T  RV W G+    +P +  K+S G ++  D WI  +G+
Sbjct  307  GGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGV  366

Query  277  PYDSA  263
            P+D+ 
Sbjct  367  PFDAG  371



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 132/181 (73%), Gaps = 2/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA A+RQ+YR C I+GTIDFIFGDA+A+FQNC M++RKPL  Q+ +VTAQGR + 
Sbjct  411  YQDTLYAQAHRQFYRSCLITGTIDFIFGDAAAIFQNCNMMIRKPLDNQQNIVTAQGRTDK  470

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNC+I P   L+ V+   + +LGRPWK+++RT++ ES I+  I P+GW  W+
Sbjct  471  HETTGIVLQNCKILPDKTLEAVKSQFKSYLGRPWKEFSRTIVMESKIEDVIHPDGWMAWQ  530

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N+GPG+ T  RV W GY K I   E +K++ G +++ D WI+ T  
Sbjct  531  GDFALKTLYYAEFNNQGPGAKTDARVKWPGY-KVIDKDEAAKFTIGTFLELD-WIESTSA  588

Query  277  P  275
            P
Sbjct  589  P  589



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC++SGT+DFIFGDA  + QNC ++VRKP   Q CMVTAQGR + 
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDV  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P    V+   + +LGRPWK+++RT+I ++ ID  I P GW PWK
Sbjct  445  RESTGLVLHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWK  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N GPGS+ + RV W G +K +SP+E   Y+ G+++  D WI  T +
Sbjct  505  GDFALKTLYYAEHLNAGPGSNEALRVKWPG-IKKLSPEEALLYTGGRFLVGDTWIPQTQV  563

Query  277  PYDS  266
            PY +
Sbjct  564  PYSA  567



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  382  YQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDP  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  SFI  F+ P+GW PW 
Sbjct  442  REPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQPQGWQPWL  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E QN GPG+  + RV W G +K +S +E+ K++  ++IQ+D W+   G+
Sbjct  502  GDFGLKTLFYSEVQNIGPGAALASRVTWAG-IKTLSNEEILKFAPAEFIQSDAWVPGKGV  560

Query  277  PY  272
            PY
Sbjct  561  PY  562



>ref|XP_010107091.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
 gb|EXC13612.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
Length=607

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 132/181 (73%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA A+RQ+YR C I+GT+DFIFGDA++VFQNC ++VRKPL  Q+ +VTAQGR + 
Sbjct  421  YQDTLYAQAHRQFYRSCVIAGTVDFIFGDAASVFQNCMIVVRKPLDNQQNIVTAQGRTDK  480

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   GIVL NC I    +L+ V+   R +LGRPWK+Y+RT++ ES I   I P+GW PW+
Sbjct  481  QQTTGIVLHNCRILADRKLEPVKDRIRSYLGRPWKEYSRTIVMESTIHDVIHPDGWLPWQ  540

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+YAEY N+GPG+   KRV+W GY   I+ +E  +Y+   ++Q D W+   G+
Sbjct  541  GDFALNTLYYAEYNNKGPGAKVDKRVHWPGYKSVITREEALQYTVQNFLQGD-WVTVKGV  599

Query  277  P  275
            P
Sbjct  600  P  600



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC++SGT+DFIFGDA  + QNC ++VRKP   Q CMVTAQGR + 
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDV  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P    V+   + +LGRPWK+++RT+I ++ ID  I P GW PWK
Sbjct  445  RESTGLVLHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWK  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N GPGS+ + RV W G +K +SP+E   Y+ G+++  D WI  T +
Sbjct  505  GDFALKTLYYAEHLNAGPGSNEALRVKWPG-IKKLSPEEALLYTGGRFLVGDTWIPQTQV  563

Query  277  PYDS  266
            PY +
Sbjct  564  PYSA  567



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ+YRDC+ISGTIDF+FGDA+AVFQNC ++VRKPL  Q C +TA GR + 
Sbjct  377  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDP  436

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G VLQ C I        V+  ++ +LGRPWK Y++T+I ++FI  FIA EGW  WK
Sbjct  437  KETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWK  496

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNF +DTL+Y+E +N GPG+  + RV W G +K +S +++  Y+  +YIQ D+WI   G+
Sbjct  497  GNFGIDTLFYSEARNTGPGAGVTGRVTWPG-IKKLSDEDILGYTPAKYIQGDEWIPSKGV  555

Query  277  PY  272
            PY
Sbjct  556  PY  557



>ref|XP_011078157.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=590

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQD+LYA  +RQ+YR C I+GTIDFIFG+A+AVFQNC + VRKP+A Q+ +VTAQGR + 
Sbjct  404  YQDSLYAQTHRQFYRGCYITGTIDFIFGNAAAVFQNCLIYVRKPMANQQNIVTAQGRTDK  463

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQNC I  A  LK  +   + +LGRPWK+Y+RT+I E+ I  FI  EGW  W+
Sbjct  464  RQTTGIVLQNCRILAADTLKPEKAKFKSYLGRPWKEYSRTIIMETEIGDFIQAEGWMEWE  523

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N+GPGS TS RV W GY K I  +E  +++ G ++Q + WIK   +
Sbjct  524  GDFALKTLYYAEFNNKGPGSSTSGRVKWPGY-KTIKKEEALEFTVGPFLQGESWIKNADV  582

Query  277  P  275
            P
Sbjct  583  P  583



>ref|XP_004508050.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cicer arietinum]
Length=593

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 131/181 (72%), Gaps = 2/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR C +SGTIDFIFGDA+ VFQNC M+VR+P+  Q+ MVTAQGRM+ 
Sbjct  408  YQDTLYTQTHRQFYRSCIVSGTIDFIFGDAAVVFQNCIMVVRRPMDNQQNMVTAQGRMDK  467

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G VL  C+I    +L  V+   + +LGRPWK+++RT++ ES I  FI P+GW+PW 
Sbjct  468  QQATGTVLHKCQIKADEKLVPVKDTIKSYLGRPWKEFSRTIVMESEIGDFIHPDGWTPWM  527

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAE+ N GPG+ TS RV W GY K I  +E S+Y+ G +++   W++ +G+
Sbjct  528  GNFALDTLYYAEFNNTGPGASTSARVKWPGY-KVIDKEEASQYTVGAFLKG-AWVQTSGV  585

Query  277  P  275
            P
Sbjct  586  P  586



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   YRQ+YRDC+I+GT+DFIFGD  A+FQNCKM+VRKP  TQ CMVTAQGR +H
Sbjct  382  YQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKPGETQACMVTAQGRTDH  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              + GI LQNC I   P    V+   + +LGRPWK +AR ++ +S ID  IAPEGW+ W 
Sbjct  442  NEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKNFARVVVMQSSIDEAIAPEGWTEWT  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G       ++ EY N GPGSD ++RV W   +K ++P + + ++  +  + D+WIKP+G+
Sbjct  502  GEEYHQNCFFGEYGNTGPGSDVTQRVKW-STVKRLTPDQAAAFTPARVFEGDKWIKPSGV  560

Query  277  PY  272
            PY
Sbjct  561  PY  562



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 2/186 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YRDC++SGTIDF+FGDA+AVFQNC+ IVR+P+  Q+C+VTAQGR E 
Sbjct  393  YQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAVFQNCRFIVRRPMDNQQCIVTAQGRKER  452

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN      P    V+     +LGRPWK+++RT+I ESFID  I P GW PW 
Sbjct  453  RQPSAIIIQNGTFVADPDYYPVRFELPAYLGRPWKEFSRTIIMESFIDDLIQPRGWLPWA  512

Query  457  GNFALDTLWYAEYQNRGPGS-DTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
            G+F L T +Y E+ NRGPG+ + S+R  WKG +KNI+ +    ++ G + + D WIK TG
Sbjct  513  GDFGLRTCFYTEFGNRGPGAVEPSRRAKWKG-VKNITAKHARDFTPGSFFKGDWWIKRTG  571

Query  280  IPYDSA  263
            IPY S 
Sbjct  572  IPYVSG  577



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGD++ VFQNC ++VRKPL  Q C +TA GR + 
Sbjct  380  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTLLVRKPLPNQACPITAHGRQDP  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  F+ P+GW PW 
Sbjct  440  REPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWN  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
             +F L TL+Y+E QN GPGSD + RV W G +K ++ +++ +++  ++IQ D WI  TG+
Sbjct  500  ADFGLKTLFYSEIQNTGPGSDLASRVTWAG-IKKLTSKDIDQFTPAKFIQGDSWIPATGV  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_003530788.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=526

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY +A RQ+YRDC I GT+DFIFGDA AV QNC + VRKP++ Q+  VTAQGR + 
Sbjct  342  YQDTLYVYANRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSNQQNTVTAQGRTDP  401

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI++ NC I  A  LK VQ   R FLGRPW++Y+RT++ +S +DG I+P GW PW 
Sbjct  402  NENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTVVMKSALDGLISPAGWFPWS  461

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL TL+YAE+ N G G+ T  RV+W G+ + IS  E  K++ G ++    WI  +G+
Sbjct  462  GNFALSTLYYAEHANTGAGASTGGRVDWAGF-RVISSTEAVKFTVGNFLAGGSWIPGSGV  520

Query  277  PYD  269
            P+D
Sbjct  521  PFD  523



>emb|CAA96436.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=274

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H+ RQ+YRDC I+GT+DFIFG+A+ VFQN K+  RKP + Q+ MVTAQGR + 
Sbjct  90   FQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQGREDP  149

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC+I P+  L  V+   + +LGRPWK Y+RT+  +S I   I PEGWS W 
Sbjct  150  NQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWD  209

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+GPG+ TSKRV W GY   +S  E +K++ GQ IQ   W+K TG+
Sbjct  210  GDFALKTLYYGEYMNKGPGAGTSKRVKWPGY-HILSAAEATKFTVGQLIQGGVWLKSTGV  268

Query  277  PY  272
             Y
Sbjct  269  AY  270



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGD++AVFQNC ++VRKPL  Q C +TA GR++ 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y+RT+I  +FI  FI P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWLPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E +N GPG+  + RV W G +K +S +EV  ++  QYIQ D W+   G+
Sbjct  501  GDFGLKTLFYSEVKNTGPGAGLANRVTWAG-IKTLSDEEVLMFTPAQYIQGDIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>emb|CDP19930.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQYYR C I+GT+DFIFGDA+AVFQNC + VRKP+  Q+ +VTAQGR++ 
Sbjct  405  YQDTLYAQTHRQYYRSCYITGTVDFIFGDAAAVFQNCMIYVRKPMDNQQNIVTAQGRVDK  464

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVLQ C I     L  V+   + +LGRPWK+Y+RT+I E+ I  FI  +G+ PW+
Sbjct  465  RETTGIVLQGCRILADASLSPVKSQFKSYLGRPWKEYSRTIIMETEIGDFIHGDGYMPWQ  524

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+YAEY N+GPG+ TS RV W GY   I   E  KY+ G +IQ + W+K   +
Sbjct  525  GNFALNTLYYAEYNNKGPGAQTSARVKWPGYKGLIKRDEALKYTVGPFIQGEGWLKVDNV  584

Query  277  P  275
            P
Sbjct  585  P  585



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 124/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC I+GT+DFIFG+++ VFQNC ++ RKP A Q+ M+TAQGR + 
Sbjct  371  YQDTLYTHTLRQFYRDCFITGTVDFIFGNSAVVFQNCDIVARKPDAGQKNMLTAQGREDP  430

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C I P+ +L  V+   + +LGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  431  NQNTAISIQKCNIKPSSELAPVKESVKTYLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWD  490

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+ TSKRV WKGY      +E +K++    IQ   W+KPTG+
Sbjct  491  GEFALSTLYYGEYANNGPGAGTSKRVTWKGYRVIKDSKEAAKFTVANLIQGGLWLKPTGV  550

Query  277  PY  272
             +
Sbjct  551  AF  552



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+YRQ+YR C++SGTIDFIFG+A+AVFQNCK+++RKPL  + C++TAQ R   
Sbjct  402  YQDTLYAHSYRQFYRHCTVSGTIDFIFGNAAAVFQNCKLVIRKPLEDEGCVITAQARQHV  461

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G +LQNC I   P    ++  ++ FLG PWK+++RT+I +SF+   IAPEGW PW 
Sbjct  462  REPTGFILQNCTIMADPLYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWM  521

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F   + +++EY+NRGPG+    RV W G +K I+PQ+   ++  ++ Q + WI PTG+
Sbjct  522  GTFGQSSCFFSEYENRGPGAALLGRVKWHG-IKKITPQQADGFTPSKFYQGNHWIIPTGV  580

Query  277  PYD  269
            PY+
Sbjct  581  PYE  583



>ref|XP_010098737.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB75640.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=454

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR+C ISGT+DFIFGDASA+ QNC +IVRKP   Q+  VTAQGR + 
Sbjct  267  YQDTLYVQAHRQFYRNCVISGTVDFIFGDASAIIQNCLIIVRKPGEGQKNAVTAQGRADK  326

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+QNC I P  +L T +     +LGRPWKQY+RT+I E+ +   I P GW  W 
Sbjct  327  RETTGIVIQNCRIVPEEKLFTERFKYPTYLGRPWKQYSRTVIMETTMGDLIQPVGWMEWN  386

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+Y EY NRGPG+ T KRV W+GY       E   ++ G +IQ + W++ TG 
Sbjct  387  GNFALDTLYYREYANRGPGAGTDKRVKWRGYKVITDRNEALHFTPGPFIQGNLWLRYTGA  446

Query  277  PY  272
            PY
Sbjct  447  PY  448



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H+ RQ+YRDC I+GT+DFIFG+A+ VFQN K+  RKP + Q+ MVTAQGR + 
Sbjct  131  FQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQGREDP  190

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC+I P+  L  V+   + +LGRPWK Y+RT+  +S I   I PEGWS W 
Sbjct  191  NQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWD  250

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+GPG+ TSKRV W GY   +S  E +K++ GQ IQ   W+K TG+
Sbjct  251  GDFALKTLYYGEYMNKGPGAGTSKRVKWPGY-HILSAAEATKFTVGQLIQGGVWLKSTGV  309

Query  277  PY  272
             Y
Sbjct  310  AY  311



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H+ RQ+YRDC I+GT+DFIFG+A+ VFQN K+  RKP + Q+ MVTAQGR + 
Sbjct  131  FQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQGREDP  190

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC+I P+  L  V+   + +LGRPWK Y+RT+  +S I   I PEGWS W 
Sbjct  191  NQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWD  250

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+GPG+ TSKRV W GY   +S  E +K++ GQ IQ   W+K TG+
Sbjct  251  GDFALKTLYYGEYMNKGPGAGTSKRVKWPGY-HILSAAEATKFTVGQLIQGGVWLKSTGV  309

Query  277  PY  272
             Y
Sbjct  310  AY  311



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 122/185 (66%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YR+C I GT+DFIFG+A+ VFQ+C +  R P   +   +TAQGR + 
Sbjct  75   YQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQSCNIYARNP-PNKTNTITAQGRTDP  133

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI + N  +  A  LK VQ   + +LGRPWK+Y+RT+  ++F+DG I P GW PW 
Sbjct  134  NQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFLDGLINPAGWMPWS  193

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL+TL+Y EY N GPGS T+KRVNWKGY    S  E SK++ G +I    W+  T +
Sbjct  194  GNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGNFIAGSSWLPATNV  253

Query  277  PYDSA  263
            P+ S 
Sbjct  254  PFTSG  258



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTL  H YRQ+YRDC I GTIDF+FGD +AVFQNC + VRKPL  Q C+VTAQGR + 
Sbjct  380  YQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDA  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V QNC I        V+   + +LGRPWK+Y+RT+I ES ID  I PEGW  W 
Sbjct  440  RQPTGLVFQNCSIVADSSYNEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWN  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y E+ NRG GS   +RV W+G +K +    V +++A Q++  D WI  TGI
Sbjct  500  KTFALNTLFYTEFNNRGSGSSKKERVKWQG-VKELQINRVQRFTASQFLDGDAWIPSTGI  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC+ISGTIDF+FGDA+A+FQNC  +V KPL  Q C+VTAQGR E 
Sbjct  404  YQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVHKPLPDQSCIVTAQGRKEG  463

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IV+QN  I   P    V+   + +LGRPWK+Y+RT+I ES+ID  I PEGW PW 
Sbjct  464  RQPSAIVIQNSTITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWA  523

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G + L T +Y E++N GP ++ ++RV W+G +K I+ +  ++++ G++ + D+WIK +G+
Sbjct  524  GQWGLRTCFYTEFRNTGPAANKARRVTWQG-IKQITRRHAAQFTPGKFFRGDEWIKLSGV  582

Query  277  PY  272
            PY
Sbjct  583  PY  584



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C ISGT+DFIFGD+  + QN  +IVRKP+  Q+  VTAQGR + 
Sbjct  380  YQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDR  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IV+QNC I P   L  ++     +LGRPWK YART+I ES +  FI P GW PW 
Sbjct  440  RENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWS  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY NRGPG+ T++RV WKGY   I+  +  +++AG ++ AD+W+K TGI
Sbjct  500  GNFALDTLYYAEYGNRGPGAATNQRVRWKGY-HVINRNDAVQFTAGPFLLADRWLKTTGI  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTL AH YRQ+YRDC+I GTIDF+FGDA+AVFQNC + VRKP+  Q C+VTAQGR + 
Sbjct  381  YQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDA  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V QNC I        V+   + +LGRPWKQY+RT+I ES ID  I PEGW  W 
Sbjct  441  RQPTGLVFQNCSIVADESYNEVKGEVKTYLGRPWKQYSRTIIMESNIDDLIQPEGWLEWN  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FA +TL+Y E+ N+G GS  + RV W G +K +  + V +++   +I AD WI  TG+
Sbjct  501  KTFAFETLFYTEFNNKGSGSSKTDRVRWSG-VKELPIERVQRFTTSSFIDADLWIPSTGV  559

Query  277  PYDS  266
            PY S
Sbjct  560  PYTS  563



>ref|XP_009623162.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=584

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C +SGT+DFIFGDA+A+ QNC +I RKP+  Q+  VTAQGR   
Sbjct  397  YQDTLYAQTHRQFYRNCVVSGTVDFIFGDAAAILQNCLIIARKPMDNQQNTVTAQGRSNV  456

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+++QNC I P   L+ V+     +LGRPWK Y+R++I ES +  FI P GW PW 
Sbjct  457  RETTGLIMQNCRIVPEQLLEPVRFNIPTYLGRPWKMYSRSVIMESTLADFIQPAGWMPWS  516

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +YAEY NRGPG++T+ RV WKG+       E  +++   +IQ +QW+  TG 
Sbjct  517  GNFALDTCYYAEYGNRGPGANTNNRVKWKGFKVITDRNEALQFTTAPFIQGNQWLGSTGS  576

Query  277  PY  272
            PY
Sbjct  577  PY  578



>ref|XP_008646066.1| PREDICTED: uncharacterized protein LOC100384243 isoform X1 [Zea 
mays]
 tpg|DAA48840.1| TPA: hypothetical protein ZEAMMB73_037702 [Zea mays]
Length=630

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+  Q+YR+C ISGTIDFIFGDA+AVFQNC +++R+P+  Q+ + TAQGR + 
Sbjct  442  YQDTLYAHSKAQFYRNCVISGTIDFIFGDAAAVFQNCILVLRRPMDNQQNIATAQGRADG  501

Query  637  RGVGGIVLQNCEICPAPQLKTV-QPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G V Q C       LK   +PP R +L RPW++++RTLI ES I  FI   G+ PW
Sbjct  502  RESTGFVFQYCRFTAETGLKDASRPPIRSYLARPWREFSRTLIMESDIPAFIDKAGYLPW  561

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+F L TLWYAEY NRGPG+DT+ RV W GY K IS +E  K++   ++ A+ W+KPTG
Sbjct  562  NGDFGLKTLWYAEYANRGPGADTAGRVTWPGYKKVISKEEAEKFTVQNFLHAEPWLKPTG  621

Query  280  IP  275
             P
Sbjct  622  TP  623



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YRDC+ISGTIDF+FGDA+A+FQNC  ++RKPL  Q C+VTAQGR E 
Sbjct  404  YQDTLYTHAQRQFYRDCTISGTIDFVFGDATAIFQNCTFLIRKPLPNQSCIVTAQGRKER  463

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN  I   P    V+   + +LGRPWK+Y+RT+I +S+ID  I PEGW PW+
Sbjct  464  RQPSAIIIQNSTITADPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWE  523

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G + L T +YAE  N GP ++ ++RV W+G +K I+    + ++ G++ + D+WI+ +G+
Sbjct  524  GEWGLKTCFYAELGNTGPAANKARRVTWRG-IKKITENHAADFTPGRFFRGDKWIRLSGV  582

Query  277  PY  272
            PY
Sbjct  583  PY  584



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGD++AVFQNC ++VRKPL  Q C +TA GR++ 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y++T+I  +FI  FI P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E +N GPG+  + RV W G +K +S +EV  ++  QYIQ D W+   G+
Sbjct  501  GDFGLKTLFYSEVKNTGPGAGLANRVTWAG-IKTLSDEEVLMFTPAQYIQGDIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 0/183 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR+C I+GTIDFIFGD+S V QN  +IVRKP+  Q+  VTA GR + 
Sbjct  375  YQDTLYVQTHRQFYRNCVITGTIDFIFGDSSTVIQNSLIIVRKPMDNQQNTVTAHGRKDK  434

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G+V+QNC I P  +L   +   R +LGRPWK+Y+RT+I ES I   I PEGW PW 
Sbjct  435  GERTGLVIQNCRIVPEEKLFPQRFKIRSYLGRPWKEYSRTVIMESTIGDLIQPEGWMPWS  494

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL+YAEY NRGPG+ T KRVNWKG+    + +E  +++AG +++ D+W+  T  
Sbjct  495  GDFALDTLFYAEYGNRGPGAATGKRVNWKGFKVITNKREALQFTAGPFLEGDKWLPGTTT  554

Query  277  PYD  269
            P+D
Sbjct  555  PFD  557



>tpg|DAA44943.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=403

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQYYRDC I+GTIDFIFG+A  VFQNC + VRK +  Q+ +VTAQGR E 
Sbjct  208  YQDTLYTHTSRQYYRDCVITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKER  267

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R VGG V+ NC + P P+ +      R FLGRPWK+++RTL  +S I GFI P+GW PW 
Sbjct  268  RSVGGTVIHNCTVAPHPEFEKSVGRFRTFLGRPWKEHSRTLYIQSEIGGFIDPQGWLPWL  327

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQE-VSKYSAGQYIQADQWIKPTG  281
            G+F L T +YAE +N GPG++ ++RV W+G +KNI+ Q  + KY+   +IQ   W+   G
Sbjct  328  GDFGLSTCYYAEVENHGPGANMTRRVKWRG-IKNITYQHALQKYTVESFIQGQHWLPQLG  386

Query  280  IPY  272
            +P+
Sbjct  387  VPF  389



>ref|XP_003630894.1| Pectinesterase [Medicago truncatula]
Length=326

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY +A RQ+YRDC+I GTIDFIFG+A  V QNC + VRKP++ Q+  VTAQGR + 
Sbjct  124  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQQNTVTAQGRTDP  183

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIV+ NC I  +  LK +Q   + +LGRPW++Y+RT++ +S +DG I  EGW+PW 
Sbjct  184  NENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWM  243

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N G G++T  RV W G+    +P +  K+S G ++  D WI  +G+
Sbjct  244  GGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGV  303

Query  277  PYDS  266
            P+D+
Sbjct  304  PFDA  307



>ref|XP_006417343.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
 gb|ESQ35696.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
Length=557

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRDC I+GT+DFIFG+++ VFQNC ++ RKP A Q+ MVTAQGR + 
Sbjct  372  YQDTLYTHTLRQFYRDCYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQ  431

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I  Q C+I  +  L  V+   + FLGRPWK Y+RT+I +SFI   I P GW PW 
Sbjct  432  NQNTAISFQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIGDHIDPAGWFPWD  491

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPGSDTSKRV WKG+    + +E  +++  + IQ   W+KPTG+
Sbjct  492  GEFALSTLYYGEYANNGPGSDTSKRVKWKGFRVIRNSKEAEQFTVAKLIQGGLWLKPTGV  551

Query  277  PY  272
             Y
Sbjct  552  TY  553



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRD  I+GT+DFIFGDA+ VFQNCK++VRKP+  Q  MVTAQGR++ 
Sbjct  292  YQDTLYTHSNRQFYRDSEITGTVDFIFGDAAVVFQNCKLVVRKPMDKQSNMVTAQGRIDP  351

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +Q+C I  +  L+ V+   + +LGRPWK+Y+RT++ +S I   I P GWS W 
Sbjct  352  NQNTGTSIQSCNIIASSDLEPVKGSFKSYLGRPWKEYSRTVVMQSHIGDHIDPSGWSVWT  411

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+GPG+ TSKRV W GY    S  E  K++    IQ   W+KPTG+
Sbjct  412  GDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHVITSADEAKKFTVAGLIQGGSWLKPTGV  471

Query  277  PY  272
             +
Sbjct  472  TF  473



>ref|XP_002445591.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
 gb|EES15086.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
Length=626

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+  Q+YR+C ISGTIDF+FGDA+AVFQNC +++R+PL +Q+ + TAQGR + 
Sbjct  438  YQDTLYAHSKAQFYRNCVISGTIDFVFGDAAAVFQNCILLLRRPLDSQQNIATAQGRADG  497

Query  637  RGVGGIVLQNCEICPAPQLKTV-QPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G V Q C       L+   +PP R +L RPW++++RTLI ES I  FI   G+ PW
Sbjct  498  RESTGFVFQYCRFAAEAGLRDASRPPIRSYLARPWREFSRTLIMESEIPAFIDKAGYLPW  557

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+F L TLWYAEY NRGPG+DT+ RV W GY K IS +E  K++   ++ A+ W+KPTG
Sbjct  558  NGDFGLKTLWYAEYGNRGPGADTAGRVAWPGYKKVISKEEADKFTVQNFLHAEPWLKPTG  617

Query  280  IP  275
             P
Sbjct  618  TP  619



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC++SGT+DFIFGD+  + QNCK++VRKP+A Q CMVTAQGR + 
Sbjct  376  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPMAGQSCMVTAQGRSDV  435

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIVL NC I   P    V+  ++ +LGRPWK+++RT++ ++ +D  I P GW PW 
Sbjct  436  REPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVMKTIVDDVIDPAGWLPWS  495

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N GPG++ ++RV W G +K ++P++   Y+  +++  + WI  T +
Sbjct  496  GDFALKTLYYAEHLNVGPGANQAQRVKWPG-IKKLTPEQALSYTGDRFLSGNTWIPRTQV  554

Query  277  PY  272
            PY
Sbjct  555  PY  556



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ++RDC+ISGTIDF+FGD++AVFQNC ++VRKPL  Q C +TA GR++ 
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDP  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G V Q C I   P    V+  ++ +LGRPWK+Y++T+I  +FI  FI P+GW PW 
Sbjct  441  RESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWL  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y+E +N GPG+  + RV W G +K +S +EV  ++  QYIQ D W+   G+
Sbjct  501  GDFGLKTLFYSEVKNTGPGAGLANRVTWAG-IKTLSDEEVLMFTPAQYIQGDIWVPGKGV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_004229041.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=585

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 124/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR+C +SGT+DFIFGD+SA+ QNC +I RKP+  Q+  VTAQGR   
Sbjct  398  YQDTLYVQTHRQFYRNCVVSGTVDFIFGDSSAILQNCLIIARKPMEKQQNTVTAQGRTNI  457

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V+QNC I P   L+ ++     FLGRPWK YART++ ES +  FI P  W PW 
Sbjct  458  RATTGLVIQNCRIVPEQLLEPLRFKIPTFLGRPWKMYARTVVMESTLADFIQPAVWMPWD  517

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT  YAEY NRGPG++T+ RV WKG+       E  +Y+   +IQ +QW++ TG 
Sbjct  518  GNFALDTCVYAEYANRGPGANTNNRVKWKGFKVITDRNEALQYTTTPFIQGNQWLQSTGA  577

Query  277  PY  272
            P+
Sbjct  578  PH  579



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTA GR++ 
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDM  447

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I  + +    +   + +LGRPW   AR ++ +S ID  IAPEGW  W 
Sbjct  448  RSPSALILQNCTI--SGERGYDKELNKAYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWT  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G    +T W+ E+ NRG G++ SKRV W G +K ++P++ + ++AG++I  D+WI P+G+
Sbjct  506  GTANHNTCWFGEFGNRGVGAELSKRVTWSG-MKKLTPEQAADFTAGKFIFGDRWILPSGV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YRDC+ISGTIDFIFGDA+AVFQNCKMIVRKPL  Q CMVTA GR++ 
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDM  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++LQNC I  + +    +   + +LGRPW   AR ++ +S ID  IAPEGW  W 
Sbjct  451  RSPSALILQNCTI--SGERGYDKELNKAYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWT  508

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G    +T W+ E+ NRG G++ SKRV W G +K ++P++ + ++AG++I  D+WI P+G+
Sbjct  509  GTANHNTCWFGEFGNRGVGAELSKRVTWSG-MKKLTPEQAADFTAGKFIFGDRWILPSGV  567

Query  277  PY  272
            PY
Sbjct  568  PY  569



>ref|XP_002512460.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF49912.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=548

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC I GTIDFIFG+A+ VFQNCK+  R PL+ Q   +TAQGR + 
Sbjct  362  YQDTLYTHSLRQFYRDCEIYGTIDFIFGNAAVVFQNCKIYSRLPLSNQFNTITAQGRTDP  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC I  A  L +     + +LGRPWK+Y+RT++ +SFID  I P GW+PW 
Sbjct  422  NQNTGTSIQNCSIIAAEDLASSNGTTKTYLGRPWKEYSRTVVMQSFIDSLIGPAGWAPWS  481

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL YAE+ N GPGSD S RV W GY ++ +  +   ++  ++IQ D W+  +G+
Sbjct  482  GDFALATLHYAEFDNHGPGSDISNRVIWPGYDRDFNATDADSFTVSKFIQGDAWLPTSGV  541

Query  277  PY  272
            PY
Sbjct  542  PY  543



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY  A RQ+ RDCS+SGTIDF+FG ASAVFQNCK ++RKPL  Q+C+VTAQGR   
Sbjct  391  HQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQNCKFLIRKPLENQQCIVTAQGRKMR  450

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IV+QN  I   P L   +   + +LGRPWK+++RT+I ESFID  I PEGW PW 
Sbjct  451  RQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWL  510

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G F L T WY E+ N GPGS  + RV W G +K I  Q    ++ G++ +   WIK TGI
Sbjct  511  GTFGLKTCWYTEFNNNGPGSSKAARVKWNG-IKTIDRQHALDFTPGRFFKGGAWIKTTGI  569

Query  277  PY  272
            PY
Sbjct  570  PY  571



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTL  H YRQ+YRDC I GTIDF+FGD +AVFQNC + VRKPL  Q C+VTAQGR + 
Sbjct  380  YQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDA  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V QNC I        V+   + +LGRPWK+Y+RT+I ES ID  I PEGW  W 
Sbjct  440  RQPTGLVFQNCSIVADSSYDEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWN  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y E+ NRG GS  ++R  W+G +K +    V +++A Q++  D WI  TGI
Sbjct  500  KTFALNTLFYTEFNNRGSGSSKTERAKWQG-VKELQINRVQRFTASQFLDGDAWIPSTGI  558

Query  277  PY  272
            PY
Sbjct  559  PY  560



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C ISGT+DFIFGD+  + QN  +IVRKP+  Q+  VTAQGR + 
Sbjct  381  YQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDR  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IV+QNC I P   L  ++     +LGRPWK YART+I ES +  FI P GW PW 
Sbjct  441  RENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWS  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY NRGPG+ T++RV WKGY   I+  +  +++AG ++ AD+W+K +GI
Sbjct  501  GNFALDTLYYAEYGNRGPGAATNQRVRWKGY-HVINRNDALQFTAGPFLLADRWLKTSGI  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 132/181 (73%), Gaps = 2/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR C I+GT+DFIFGDA+A+ QNC ++VRKPL  Q+ +VTAQGR++ 
Sbjct  405  YQDTLYVQTHRQFYRSCVIAGTVDFIFGDATAILQNCLIVVRKPLDNQQNIVTAQGRVDG  464

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNC I    +L  V+   + +LGRPWK+++RT+I ES I+ FI P G+ PW+
Sbjct  465  HETTGIVLQNCRITADKKLIPVKSKFQTYLGRPWKEFSRTIIMESSIEDFIDPAGFMPWE  524

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N+GPG++ + RV W GY K I+ QE +K++ G ++  D WIK  G+
Sbjct  525  GDFALKTLYYAEFNNKGPGANINARVKWPGY-KKINKQEAAKFTVGTFLDGD-WIKGAGV  582

Query  277  P  275
            P
Sbjct  583  P  583



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C ISGT+DFIFGD+  + QN  +IVRKP+  Q+  VTAQGR + 
Sbjct  381  YQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDR  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IV+QNC I P   L  ++     +LGRPWK YART+I ES +  FI P GW PW 
Sbjct  441  RENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWS  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY NRGPG+ T++RV WKGY   I+  +  +++AG ++ AD+W+K +GI
Sbjct  501  GNFALDTLYYAEYGNRGPGAATNQRVRWKGY-HVINRNDALQFTAGPFLLADRWLKTSGI  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_010694101.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+YR+C +SGT+DFIFGD + V QN  +IVRKPL  Q+  VTAQG+ + 
Sbjct  382  YQDTLYTQAHRQFYRNCVVSGTVDFIFGDGNVVIQNSLIIVRKPLDNQQNTVTAQGKKDR  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+ NC I P  +L  ++     FLGRPWK+Y+ T+I +S +  FI P GW PW 
Sbjct  442  RETTGIVIHNCRIVPEQKLFPIRYQIPTFLGRPWKEYSTTIIMQSMLADFIQPVGWMPWA  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+Y EY NRGPG+DTS+RV WKGY    +  E  +++ G++IQ  QW+  + +
Sbjct  502  GTFALDTLYYGEYGNRGPGADTSRRVRWKGYHVITNRDEAIRFTVGRFIQGQQWLPFSSM  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|XP_003536855.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=574

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A RQ+YR+C ISGTIDFIFG A  + QN ++IVRKP A Q   VTA G  + 
Sbjct  380  YQDTLYTQANRQFYRNCEISGTIDFIFGAAPTLIQNSRIIVRKPEANQFNTVTADGTKQK  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNCEI P   L   +   + +LGRPWK +ART++ ES I  FI PEGW+PW 
Sbjct  440  NMATGIVLQNCEILPEQALFPTRFQTKSYLGRPWKDFARTVVMESNIGDFIQPEGWTPWS  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ------ADQW  296
            GN  LDTL+YAEY N GPGS+   RV WKGY  NI+  E  +++AGQ+++      AD W
Sbjct  500  GNLFLDTLYYAEYANVGPGSNVQGRVKWKGYHPNINKNEAEQFTAGQFLRGGPSGNADDW  559

Query  295  IKPTGIPY  272
            +K TG+PY
Sbjct  560  LKATGVPY  567



>gb|KHN00313.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=574

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A RQ+YR+C ISGTIDFIFG A  + QN ++IVRKP A Q   VTA G  + 
Sbjct  380  YQDTLYTQANRQFYRNCEISGTIDFIFGAAPTLIQNSRIIVRKPEANQFNTVTADGTKQK  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNCEI P   L   +   + +LGRPWK +ART++ ES I  FI PEGW+PW 
Sbjct  440  NMATGIVLQNCEILPEQALFPTRFQTKSYLGRPWKDFARTVVMESNIGDFIQPEGWTPWS  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ------ADQW  296
            GN  LDTL+YAEY N GPGS+   RV WKGY  NI+  E  +++AGQ+++      AD W
Sbjct  500  GNLFLDTLYYAEYANVGPGSNVQGRVKWKGYHPNINKNEAEQFTAGQFLRGGPSGNADDW  559

Query  295  IKPTGIPY  272
            +K TG+PY
Sbjct  560  LKATGVPY  567



>gb|KHN00235.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=573

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YR+C ISGTIDFIFG ++ + QN ++IVRKP A Q   VTA G  + 
Sbjct  380  YQDTLYVHANRQFYRNCEISGTIDFIFGASATLIQNSRVIVRKPEANQFNTVTADGTKQK  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNCEI P   L   +   + +LGRPWK++ART++ ES I  FI PEGW+PW 
Sbjct  440  NMATGIVLQNCEILPEQALFPSRFQTKSYLGRPWKEFARTVVMESNIGDFIQPEGWTPWD  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ------ADQW  296
            GN  LDTL+YAEY N GPGS+   RV W+GY  NI+  E ++++A Q+++      AD W
Sbjct  500  GNLYLDTLYYAEYANVGPGSNVQGRVKWRGYHPNINKNEAAQFTAAQFLRGGPAGDADGW  559

Query  295  IKPTGIPY  272
            +K TG+PY
Sbjct  560  LKATGVPY  567



>ref|XP_003519736.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=573

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+YR+C ISGTIDFIFG ++ + QN ++IVRKP A Q   VTA G  + 
Sbjct  380  YQDTLYVHANRQFYRNCEISGTIDFIFGASATLIQNSRVIVRKPEANQFNTVTADGTKQK  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIVLQNCEI P   L   +   + +LGRPWK++ART++ ES I  FI PEGW+PW 
Sbjct  440  NMATGIVLQNCEILPEQALFPSRFQTKSYLGRPWKEFARTVVMESNIGDFIQPEGWTPWD  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ------ADQW  296
            GN  LDTL+YAEY N GPGS+   RV W+GY  NI+  E ++++A Q+++      AD W
Sbjct  500  GNLYLDTLYYAEYANVGPGSNVQGRVKWRGYHPNINKNEAAQFTAAQFLRGGPAGDADGW  559

Query  295  IKPTGIPY  272
            +K TG+PY
Sbjct  560  LKATGVPY  567



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH  RQ+YRDC I+GT+DFIFG+A+ V QNCK+  RKP++ Q  MVTAQGR + 
Sbjct  371  YQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDP  430

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +Q CE+  +  L+ V+   R +LGRPWK+Y+RT++ +S I G I P GWS W 
Sbjct  431  NQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGGHIDPAGWSEWS  490

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY NRGPG+ TSKRV W GY     P E  K++  + I    W+K TG+
Sbjct  491  GDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPGEAKKFTVAELIGGGSWLKSTGV  550

Query  277  PY  272
             Y
Sbjct  551  AY  552



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH  RQ+YRDC I+GT+DFIFG+A+ V QNCK+  RKP++ Q  MVTAQGR + 
Sbjct  371  YQDTLYAHTNRQFYRDCDITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDP  430

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +Q CE+  +  L+ V+   R +LGRPWK+Y+RT++ +S I   I P GWS W 
Sbjct  431  NQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWS  490

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY NRGPG+ TSKRV W GY     P+E  K++  + I    W+K TG+
Sbjct  491  GDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAELIGGGSWLKSTGV  550

Query  277  PY  272
             Y
Sbjct  551  AY  552



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ RKP A Q+ MVTAQGR + 
Sbjct  362  YQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQ  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  422  NQNTAISIQKCKITASSDLAPVKGSVQTFLGRPWKLYSRTVIMQSFIDNHINPAGWFPWD  481

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRV WKG+      +E  +++  + IQ   W+KPTG+
Sbjct  482  GEFALSTLYYGEYANTGPGADTSKRVTWKGFKVIRDAKEAEQFTVAKLIQGGLWLKPTGV  541

Query  277  PY  272
             Y
Sbjct  542  TY  543



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 126/183 (69%), Gaps = 2/183 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQYYRDC++SGTIDFIFG+A  VFQNC + VRK +  Q+ ++TAQGR E 
Sbjct  368  YQDTLYTHTSRQYYRDCTVSGTIDFIFGNAQVVFQNCLIQVRKCMENQQNIITAQGRKER  427

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
               GGIV+ NC I P P+ K      R FLGRPWK+++RTL  +S I  F+ PEGW PW 
Sbjct  428  HSAGGIVIHNCTIEPHPEFKDHMGRLRTFLGRPWKEHSRTLYIQSEIGDFVDPEGWLPWL  487

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEV-SKYSAGQYIQADQWIKPTG  281
            G F L+T +YAE +NRGPG+D S R  WKG +K+I+ Q+   KY+  ++IQ   WI   G
Sbjct  488  GEFGLNTCYYAEVENRGPGADMSNRATWKG-VKHITYQQAEEKYTVERFIQGQLWISKYG  546

Query  280  IPY  272
            +P+
Sbjct  547  VPF  549



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H  RQ+YRDC I+GT+DFIFG+A+ VFQN K+  RKP++ Q  MVTAQGR + 
Sbjct  363  FQDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAARKPMSGQSNMVTAQGREDP  422

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC+I P+  L+ V+   + +LGRPWK Y+RT+  +S I   I P GWS W 
Sbjct  423  NQNTGTSIQNCDIIPSSDLEPVKGSVKTYLGRPWKAYSRTVYMQSNIGDHIDPAGWSEWD  482

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N+G G+  SKRVNW GY K ++  E +K++ GQ IQ   W+K TG+
Sbjct  483  GDFALKTLYYGEYMNKGAGAGISKRVNWPGYHKALTTSEATKFTVGQLIQGAAWLKSTGV  542

Query  277  PY  272
             Y
Sbjct  543  AY  544



>ref|XP_002519324.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF43188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=570

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY HA+RQ+YR+C ISGT+DFIFGDA+AV QN  +I+R P   Q   VTA GR + 
Sbjct  382  HQDTLYQHAHRQFYRNCVISGTVDFIFGDATAVIQNSLIIIRTPDPGQRNAVTAHGRADK  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V+QNC I P   L  V      +LGRPWKQYART+I ES I   I P GW  W 
Sbjct  442  RESTGLVIQNCRILPEQSLFPVISEFPSYLGRPWKQYARTVIMESEIGSVIQPAGWLEWT  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GN  LDTL+YAEY NRGPG++T+ RV WKGY       EV++++AG ++Q DQW++ TG 
Sbjct  502  GNLYLDTLFYAEYGNRGPGANTNLRVKWKGYHVLTDKSEVTQFTAGPFLQGDQWLQATGF  561

Query  277  PY  272
            PY
Sbjct  562  PY  563



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 123/184 (67%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YR C + GT+DFIFGDA AV QNC + VR+P++ Q  ++TAQGR + 
Sbjct  349  YQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQ  408

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI + N  +  AP L+ VQ   + +LGRPW++Y+RT+  ++ +DG I PEGWSPWK
Sbjct  409  NENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWK  468

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y EY N G G+ T  RV W+GY    S  E  K++ G+++  D WI  TG+
Sbjct  469  GDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGV  528

Query  277  PYDS  266
            PY S
Sbjct  529  PYAS  532



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 123/184 (67%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YR C + GT+DFIFGDA AV QNC + VR+P++ Q  ++TAQGR + 
Sbjct  322  YQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSNQPNVITAQGRSDQ  381

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI + N  +  AP L+ VQ   + +LGRPW++Y+RT+  ++ +DG I PEGWSPWK
Sbjct  382  NENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWK  441

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+F L TL+Y EY N G G+ T  RV W+GY    S  E  K++ G+++  D WI  TG+
Sbjct  442  GDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGV  501

Query  277  PYDS  266
            PY S
Sbjct  502  PYAS  505



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC ISGTIDF+FGDA AVFQNC+ ++R+P+  Q+C+VTAQGR + 
Sbjct  285  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDNQQCIVTAQGRKDR  344

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+ N  I      + V+   R FLGRPWK+Y+RT+I  + ID  I PEGW  W 
Sbjct  345  RETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVIDPEGWLKWN  404

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL TL+Y+EY+NRG GS  ++RV W+G ++ IS ++   ++ G++++ + WI    I
Sbjct  405  ETFALKTLFYSEYRNRGRGSGQARRVRWRG-IQRISARQARGFAPGEFLRGNAWITKRRI  463

Query  277  PYDS  266
            PY++
Sbjct  464  PYNA  467



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC ISGTIDFIFGDA AVFQNC  ++R+P+  Q+C+VTAQGR + 
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRKDR  567

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+ N  I        V+   R FLGRPWK+Y+RT+I  + ID  I PEGW  W 
Sbjct  568  RETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWN  627

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y EY+NRG GS  ++RV W+G ++ ISP++  +++ G +++ + WI  T I
Sbjct  628  ETFALNTLYYTEYRNRGRGSGQARRVKWRG-IRRISPRDAREFAPGNFLRGNTWIPQTRI  686

Query  277  PYDS  266
            PY++
Sbjct  687  PYNA  690



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAH YRQ+YR+C ISGTIDF+FGD++AV QNC + VRKPL  Q+C+VTAQGR + 
Sbjct  379  FQDTLYAHTYRQFYRNCKISGTIDFVFGDSAAVLQNCTLEVRKPLDNQQCIVTAQGRKDV  438

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VLQNC     P     +   + +LGRPWK+++RT+I ESFID  I PEGW  W 
Sbjct  439  RQPTGLVLQNCSFVADPAYFPYRFQLKSYLGRPWKEFSRTIIMESFIDDLIQPEGWLAWN  498

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL+YAE+ NRGP S+   R  W G +K +    V ++   ++I  + WIK   +
Sbjct  499  GSFALDTLFYAEFNNRGPSSNKMLRAQWNG-VKELPSSRVERFLPSKFIDGNHWIKSARV  557

Query  277  PYDS  266
            PY+S
Sbjct  558  PYNS  561



>ref|XP_009800039.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=586

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YR+C +SGT+DFIFGDA+A+ QNC +I RKP+  Q+  VTAQGR   
Sbjct  399  YQDTLYAQTHRQFYRNCVVSGTVDFIFGDAAAILQNCLIIARKPMDNQQNTVTAQGRTNI  458

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+++QNC I P   L+ V+     +LGRPWK Y+RT+I ES +  FI P GW  W 
Sbjct  459  RETTGLIIQNCRIVPEQLLEPVRFKIPSYLGRPWKMYSRTVIMESTLADFIQPAGWMHWS  518

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT +YAEY NRGPG++T+ RV WKG+       E  +++   +IQ +QW+  TG 
Sbjct  519  GNFALDTCYYAEYGNRGPGANTNNRVKWKGFKVITDRNEALQFTTAPFIQGNQWLGSTGS  578

Query  277  PY  272
            PY
Sbjct  579  PY  580



>gb|KDP23442.1| hypothetical protein JCGZ_23275 [Jatropha curcas]
Length=315

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 121/185 (65%), Gaps = 1/185 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC I GTID+IFG+A+ V QNC +  R PL  Q   +TAQGR + 
Sbjct  130  YQDTLYTHSLRQFYRDCDIYGTIDYIFGNAAVVLQNCNIYSRLPLPGQYNTITAQGRTDI  189

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +QNC I  A  L T     + +LGRPWK+Y+RT++ +SFID  I P GW+PW 
Sbjct  190  NQNTGTSIQNCSIVAAADLATSNGTTKSYLGRPWKEYSRTIVMQSFIDSLIDPTGWAPWS  249

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N GPGS+TS RV W GY   I+  + + ++   + Q D W+  TG+
Sbjct  250  GDFALATLYYAEYDNNGPGSNTSSRVTWPGY-HVINATDAANFTVTNFTQGDFWLNTTGV  308

Query  277  PYDSA  263
            PY S 
Sbjct  309  PYFSG  313



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 127/184 (69%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   YRQYYRDC+ISGT+DFIFGD  A+FQNC+M+VRKP  +Q CMVTAQGR + 
Sbjct  382  YQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDK  441

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +  IVLQNC I   P    V+   + +LGRPWK +AR ++ +S ID  IAPEGW+ W 
Sbjct  442  NEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDDAIAPEGWTEWT  501

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G     + + AE  NRG G+D SKRV W+  LK ++P++ + ++  +  + D+W+KP+G+
Sbjct  502  GEKFHTSCFVAESGNRGAGADMSKRVKWQ-TLKKLTPEQAAAFTPARLFEGDKWVKPSGV  560

Query  277  PYDS  266
            PY S
Sbjct  561  PYVS  564



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 126/185 (68%), Gaps = 0/185 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY +A RQ+YRDC+I GTIDFIFG+A  V QNC + VRKP++ Q+  VTAQGR + 
Sbjct  356  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQKNTVTAQGRTDP  415

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GIV+ NC I  +  LK +Q   + +LGRPW++Y+RT++ +S +DG I  EGW+PW 
Sbjct  416  NENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWM  475

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N G G++T  RV W G+    +P +  K+S G ++  D WI  +G+
Sbjct  476  GGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGV  535

Query  277  PYDSA  263
            P+D+ 
Sbjct  536  PFDAG  540



>ref|XP_004973589.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Setaria italica]
Length=669

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+  Q+YR+C ISGTIDF+FGDA+AVFQNC +++R+P+  Q+ + TAQGR + 
Sbjct  481  YQDTLYAHSKAQFYRNCVISGTIDFVFGDAAAVFQNCILVLRRPMDNQQNIATAQGRADG  540

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPA-RVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G V Q C       L+    PA R +L RPW++++RTLI ES I  FI   G+ PW
Sbjct  541  RESTGFVFQYCRFTAESALRDASRPAIRSYLARPWREFSRTLIMESEIPAFIDKAGYLPW  600

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+F L TLWYAEY NRGPG+DT+ RVNW GY K I+ +E SK++   ++ A+ W+KP G
Sbjct  601  NGDFGLKTLWYAEYANRGPGADTAGRVNWPGYKKVIAEEEASKFTVQNFLHAEPWLKPAG  660

Query  280  IP  275
             P
Sbjct  661  AP  662



>gb|EAZ09211.1| hypothetical protein OsI_31486 [Oryza sativa Indica Group]
Length=413

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAH+  Q+YR+C I+GTIDF+FGDA+AVFQNC + +R+P+  Q+ + TAQGR + 
Sbjct  225  FQDTLYAHSKAQFYRNCVITGTIDFVFGDAAAVFQNCVLTLRRPMDNQQNIATAQGRADG  284

Query  637  RGVGGIVLQNCEICPAPQLKTVQ-PPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G VLQ CE    P L   + PP R +LGRPW++++RT+I ES I   I   G+ PW
Sbjct  285  REATGFVLQKCEFNAEPALTDAKLPPIRNYLGRPWREFSRTVIMESDIPAIIDKAGYMPW  344

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G FAL TL+YAEY N+GPG+DT+ RV W GY K IS  + +K++   ++ A  WI PTG
Sbjct  345  NGEFALKTLYYAEYANKGPGADTAGRVAWPGYKKVISKADATKFTVDNFLHAKPWIDPTG  404

Query  280  IP  275
             P
Sbjct  405  TP  406



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 122/185 (66%), Gaps = 0/185 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YR+C + GTIDFIFGDA+ V QNC +  RKP++ Q+ + TAQGR + 
Sbjct  53   YQDTLYVHSLRQFYRECDVYGTIDFIFGDAAVVLQNCNLYARKPMSNQQNVFTAQGREDP  112

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI +  C++  A  L  VQ     +LGRPWK+++RT+  +S++D  I P GW  W 
Sbjct  113  NQNTGISIHKCKVAAAADLIPVQSNFSTYLGRPWKEFSRTVFMQSYLDNLIDPAGWLEWN  172

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+Y EY NRGPGS+T+ RV W GY    S  E S ++   +IQ DQW+  T +
Sbjct  173  GDFALNTLYYGEYMNRGPGSNTTGRVKWPGYRVINSTAEASNFTVTSFIQGDQWLGSTSV  232

Query  277  PYDSA  263
            P+ S 
Sbjct  233  PFTSG  237



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 128/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC ISGTIDF+FGDA AVFQNC  ++R+P+  Q+C+VTAQGR + 
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRKDR  567

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+ N  I        V+   R FLGRPWK+Y+RT+I  + ID  I PEGW  W 
Sbjct  568  RETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWN  627

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y EY+NRG GS  ++RV W+G ++ ISP+   ++S G +++ + WI  T I
Sbjct  628  ETFALNTLYYTEYRNRGRGSGQARRVKWRG-IRRISPRAAREFSPGNFLRGNTWIPQTRI  686

Query  277  PYDS  266
            PY++
Sbjct  687  PYNA  690



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ RKP A Q+ MVTAQGR + 
Sbjct  365  YQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQ  424

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I ++FID  I P GW PW 
Sbjct  425  NQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHIDPAGWFPWD  484

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRV WKG+      +E  +++  + IQ   W+KPTG+
Sbjct  485  GEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLIQGGLWLKPTGV  544

Query  277  PY  272
             Y
Sbjct  545  TY  546



>ref|XP_010273994.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=293

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 130/184 (71%), Gaps = 2/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH++RQ YR+C+I GTIDFIFG+A+A+FQNC ++VRKP+  Q+ M+TAQGR + 
Sbjct  106  YQDTLYAHSFRQLYRECTIQGTIDFIFGNAAAIFQNCLILVRKPIPGQKNMITAQGRDDP  165

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPA-RVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
                GI LQNC I  AP+L++V   +   FLGRPW+ Y+RT++ +S++   I P+GW  W
Sbjct  166  NQNTGISLQNCTIMAAPELRSVGLGSFSTFLGRPWRNYSRTVVMKSYLGELIHPQGWYQW  225

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQ-ADQWIKPT  284
                 LDT+ Y EY N GPGSDT +RV W GY  N S + V +++ G+++  AD W++ T
Sbjct  226  DEYSRLDTVEYVEYMNTGPGSDTRRRVTWSGYKSNCSEEIVRRFTVGEFLHGADDWLRST  285

Query  283  GIPY  272
            G P+
Sbjct  286  GFPF  289



>gb|KHN34209.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=537

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYA  +RQ+YRDC ISGTIDFIFGDASAVFQNC M+VRKPL  Q+ +VTAQGR++ 
Sbjct  352  YQDTLYAQTHRQFYRDCYISGTIDFIFGDASAVFQNCTMVVRKPLENQQNIVTAQGRLDK  411

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +   G VLQ C I     L  ++   + +LGRPWK+Y+RT+I E+ ID  I P+G+ PW+
Sbjct  412  QENTGFVLQKCVIKADTDLVPLKDTIKNYLGRPWKEYSRTIIMETQIDDLIHPDGFLPWE  471

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFAL TL+Y EY N G GS T+ RVNW G  K I+  E ++Y+   ++Q   WI  TG+
Sbjct  472  GNFALSTLYYGEYNNNGAGSSTTARVNWPGR-KVINRDEATRYTVEAFLQG-TWINGTGV  529

Query  277  P  275
            P
Sbjct  530  P  530



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 120/184 (65%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC + GT+DFIFGDA+ VFQNC +  RKP   Q+ + TAQGR + 
Sbjct  54   YQDTLYVHSLRQFYRDCDVYGTVDFIFGDAAVVFQNCNLYARKPDPNQKNIFTAQGREDP  113

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI +Q C++  A  L  VQ     +LGRPWKQY+RT+  +S++   I P GW  W 
Sbjct  114  NQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSRTVFMQSYLGSLINPAGWLEWD  173

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N GPGS+TS+RV W GY    S  E S ++   +IQ DQW+  T +
Sbjct  174  GDFALSTLYYGEYMNLGPGSNTSRRVTWPGYRVITSAAEASNFTVQSFIQGDQWLGATSV  233

Query  277  PYDS  266
            P+ S
Sbjct  234  PFTS  237



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH +RQ+YR+C+ISGTIDFIFG+++ VFQNC+++VRKPL  Q+  +TAQGR + 
Sbjct  394  YQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVFQNCQIVVRKPLDNQQNTITAQGRTDR  453

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    ++L NC I   P+   ++     +LGRPWK+Y+R  I +S ID  + P GW PW 
Sbjct  454  RSPTALILHNCSIVADPEYYPLRNTLPTYLGRPWKEYSRAFILQSEIDDLVQPAGWLPWA  513

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+Y+EY NRGPG+ T++RV W+G LK+I+ +   K++  +++   +WIK   +
Sbjct  514  GDFALNTLFYSEYDNRGPGAATAERVKWRG-LKSITAEHAEKFTVARFLGGTEWIKNASV  572

Query  277  PY  272
            P+
Sbjct  573  PF  574



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ R P A Q+ M+TAQGR + 
Sbjct  372  YQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNMLTAQGREDQ  431

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  432  NQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWD  491

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRVNWKG+      +E  +++  + IQ   W+KPTG+
Sbjct  492  GEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLIQGGLWLKPTGV  551

Query  277  PY  272
             +
Sbjct  552  TF  553



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ RKP A Q+ MVTAQGR + 
Sbjct  362  YQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQ  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I ++FID  I P GW PW 
Sbjct  422  NQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHIDPAGWFPWD  481

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRV WKG+      +E  +++  + IQ   W+KPTG+
Sbjct  482  GEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLIQGGLWLKPTGV  541

Query  277  PY  272
             Y
Sbjct  542  TY  543



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 124/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC ++GT+DFIFG+A+ VFQ C+++ RKP   Q+ MVTAQGR + 
Sbjct  57   YQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNMVTAQGRTDP  116

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G  +Q C+I  +P L+ V+   + +LGRPWK+Y+RT++ ES++   I P GWS W 
Sbjct  117  NQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLIDPAGWSEWS  176

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N GPG+ TSKRV W GY    +P E   ++  + IQ   W+  TG+
Sbjct  177  GDFALKTLYYGEYMNNGPGAGTSKRVKWSGYHIITNPAEAMPFTVAELIQGGSWLSSTGV  236

Query  277  PY  272
             +
Sbjct  237  TF  238



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 123/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ R P A Q+ M+TAQGR + 
Sbjct  372  YQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNMLTAQGREDQ  431

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  432  NQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWD  491

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRVNWKG+      +E  +++  + IQ   W+KPTG+
Sbjct  492  GEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLIQGGLWLKPTGV  551

Query  277  PY  272
             +
Sbjct  552  TF  553



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLY H++RQ+YRDC++SGT+DFIFGDA  + QNCK++VRKP   Q CMVTAQGR   
Sbjct  386  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNV  445

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL  C I   P    V+   + +LGRPWK+++RT+I ++ ID  I P GW PW 
Sbjct  446  RESTGLVLHGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWS  505

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N GPGS+ ++RV W G +K ++PQ+   Y+  ++++ D WI  T +
Sbjct  506  GDFALKTLYYAEHMNTGPGSNQAQRVKWPG-IKKLTPQDALLYTGDRFLRGDTWIPQTQV  564

Query  277  PY  272
            PY
Sbjct  565  PY  566



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++R ++RDC++SGT+DFIFGDA  + QNCK++VRKP   Q CMVTAQGR + 
Sbjct  381  YQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKLGQSCMVTAQGRTDV  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P    V+  ++ +LGRPWKQ++RT++ ++ ID  I P GW  W 
Sbjct  441  RESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVIDPAGWLEWS  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY N GPGS+ ++RV W G ++ I+PQ+   Y+  +++  + WI  T +
Sbjct  501  GDFALKTLYYAEYLNTGPGSNQAQRVKWPG-IRKITPQDALSYTGDRFLGGNTWIPQTQV  559

Query  277  PY  272
            PY
Sbjct  560  PY  561



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 127/184 (69%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   YRQYYRDC+ISGT+DFIFGD  A+FQNC+M+VRKP  +Q CMVTAQGR + 
Sbjct  383  YQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDK  442

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
              +  IVLQNC I   P    V+   + +LGRPWK +AR ++ +S ID  IAPEGW+ W 
Sbjct  443  NEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDNAIAPEGWTEWT  502

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G     + + AE  NRG G+D SKRV W+  +K ++P++ + ++  +  + D+W+KP+G+
Sbjct  503  GEKFHTSCFVAESGNRGAGADMSKRVKWQTLMK-LTPEQAAAFTPARLFEGDKWVKPSGV  561

Query  277  PYDS  266
            PY S
Sbjct  562  PYVS  565



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ RKP A Q+ MVTAQGR + 
Sbjct  362  YQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQ  421

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I +Q C+I  +  L  V+   + FLGRPWK Y+RT+I ++FID  + P GW PW 
Sbjct  422  NQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHVDPAGWFPWD  481

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FAL TL+Y EY N GPG+DTSKRV WKG+    + +E  +++  + IQ   W+KPTG+
Sbjct  482  GEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRNSKEAEQFTVAKLIQGGLWLKPTGV  541

Query  277  PY  272
             Y
Sbjct  542  TY  543



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ+YRDC++SGT+DFIFGDA  + QNCK++VRK    Q CMVTAQGR + 
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKAKRGQSCMVTAQGRSDV  444

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+VL NC I   P    V+   + +LGRPWK+++RT+I ++ ID  I P GW PWK
Sbjct  445  RESTGLVLHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWK  504

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAE+ N G GS+ + RV W G +K +SP+E   Y+ G+++  D WI  T +
Sbjct  505  GDFALKTLYYAEHLNAGAGSNEALRVKWPG-IKKLSPEEALLYTGGRFLVGDTWIPQTQV  563

Query  277  PY  272
            PY
Sbjct  564  PY  565



>ref|XP_006338009.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Solanum tuberosum]
Length=584

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 122/182 (67%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR+C +SGT+DFIFGD+S + QNC +I RKP+  Q+  V AQGR   
Sbjct  397  YQDTLYVQTHRQFYRNCVVSGTVDFIFGDSSTILQNCLIIARKPMEKQQNTVAAQGRTNI  456

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   G+V+QNC I P   L+ ++     FLGRPWK YART+I ES +  FI P GW PW 
Sbjct  457  RATTGLVIQNCRIVPEQLLEPLRFKIPTFLGRPWKMYARTVIMESTLADFIQPAGWMPWD  516

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDT   AEY NRGPG++T+ RV WKG+       E  +Y+   +IQ +QW++ TG 
Sbjct  517  GNFALDTCLCAEYANRGPGANTNNRVKWKGFKVITDRNEALQYTTTPFIQGNQWVQSTGA  576

Query  277  PY  272
            P+
Sbjct  577  PH  578



>ref|XP_006287480.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
 gb|EOA20378.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
Length=530

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDT+YAH+++Q+YR+C I GT+DFIFGDAS VFQNC +  R+P   Q  + TAQGR + 
Sbjct  345  YQDTIYAHSHKQFYRECDIYGTVDFIFGDASVVFQNCSLFARRPNPNQRIIYTAQGREDS  404

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI + N +I  AP+L  VQ   + +LGRPW+ ++RT+I +SFID  I P GW  WK
Sbjct  405  RQPTGISIINSKILAAPELIPVQANFKAYLGRPWQLFSRTVIMKSFIDDLIDPAGWLKWK  464

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL+TL+Y EY N GPGS+ + RV W G+ +  + +E +++S G +I+ ++W+  TGI
Sbjct  465  GDFALETLFYGEYMNEGPGSNLTNRVQWPGFKRIETEEEAAEFSVGPFIEGNKWLNSTGI  524

Query  277  PY  272
            PY
Sbjct  525  PY  526



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ +Q+YR+C+I GTIDFIFGDA+ VFQNC + VRKP+  Q+  VTAQGR + 
Sbjct  330  YQDTLYVHSKQQFYRNCNIYGTIDFIFGDATVVFQNCNIYVRKPMTGQKNTVTAQGRTDE  389

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GI + +  +  AP LK VQ   + +LGRPWK+Y+RT+  ++F+D  I P GW  W 
Sbjct  390  RTDTGISIHDSVVTAAPDLKPVQSSFQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWD  449

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N G G+DTS+RV W GY    S  E S+++ G ++  + WI  TG+
Sbjct  450  GDFALKTLYYGEYMNTGAGADTSQRVTWPGYHVITSAAEASQFTVGNFLSGNSWIPATGV  509

Query  277  PY  272
            PY
Sbjct  510  PY  511



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY HA RQ+Y DC+ISGTIDF+FGDA+AVFQNC  ++RKPL  Q C+VTAQGR E 
Sbjct  399  YQDTLYTHAQRQFYCDCTISGTIDFVFGDATAVFQNCTFLIRKPLPNQSCIVTAQGRKER  458

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    I++QN  I   P    V+   + +LGRPWK+Y+RT+I +S+ID  I PEGW PW+
Sbjct  459  RQPSAIIIQNSTITAEPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWE  518

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G + L T +YAE  N GP ++ ++RV W+G +K I+    + ++ G++ + D+WI+ +G+
Sbjct  519  GEWGLKTCFYAESGNTGPAANKARRVTWRG-IKQITENHTADFTPGRFFRGDKWIRLSGV  577

Query  277  PY  272
            PY
Sbjct  578  PY  579



>gb|EMS52976.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=1044

 Score =   218 bits (555),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 98/181 (54%), Positives = 125/181 (69%), Gaps = 1/181 (1%)
 Frame = -1

Query  817   YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
             YQDTLY HA RQ++R+C + GTIDFIFG+++AVFQNC M VRKP+ +Q  MVTA GR + 
Sbjct  858   YQDTLYVHANRQFFRNCEVLGTIDFIFGNSAAVFQNCLMTVRKPMESQGNMVTAHGRTDP  917

Query  637   RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 GIVLQ C+I P   L  V+     +LGRPWK+Y+RT++ ES I   I PEGWS W 
Sbjct  918   NMPTGIVLQGCKIVPEDALFPVRQTVPSYLGRPWKEYSRTVVMESTIGDLIKPEGWSEWM  977

Query  457   GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
             G+F L TL+YAEY N GPG+ TSKRV W GY + I   E ++++AG +I    W+K TG 
Sbjct  978   GDFGLKTLYYAEYANTGPGAGTSKRVTWPGY-RVIGQAEATQFTAGVFIDGMSWLKNTGT  1036

Query  277   P  275
             P
Sbjct  1037  P  1037



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   215 bits (548),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 1/184 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H +RQ+YRDC ISGTIDF+FGDA AVFQNC  ++R+P+  Q+C+VTAQGR + 
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRKDR  567

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+ N  I        V+   R FLGRPWK+Y+RT+I  + ID  I PEGW  W 
Sbjct  568  RETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWN  627

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
              FAL+TL+Y EY+NRG GS  ++RV W+G ++ ISP+   +++ G +++ + WI  T I
Sbjct  628  ETFALNTLYYTEYRNRGRGSGQARRVKWRG-IRRISPRAAREFAPGNFLRGNTWIPQTRI  686

Query  277  PYDS  266
            PY++
Sbjct  687  PYNA  690



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC+I+GTIDFIFGD++ +FQNC +I RKP+  Q+ +VTAQGR E 
Sbjct  380  YQDTLYAHSERQFYRDCTITGTIDFIFGDSATIFQNCMIIARKPMDNQQNIVTAQGRKER  439

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            +G G IVLQNC I   P     +     +LGRPWK Y+RTLI +S +D  I P+GW PW 
Sbjct  440  QGNGAIVLQNCTITSDPAYYPHRKVLPTYLGRPWKPYSRTLILQSQLDDLIHPDGWLPWT  499

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+  LDT +YAE  NRGPG+D +KRV W G +KN++  E  +Y+   Y+    WI   G+
Sbjct  500  GDVGLDTCFYAELDNRGPGADLTKRVTWPG-IKNLTYVEAQEYTIENYLYGQTWISRAGV  558

Query  277  PY  272
            P+
Sbjct  559  PF  560



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H++RQ+YRD +ISGT+DFIFGD+ A+FQNC ++VRKP+  Q CMVTAQGR + 
Sbjct  186  YQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDV  245

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R    IVL NC I   P    V+   + +LGRPWK++ART++  + I   I P GWS W 
Sbjct  246  REPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWSAWS  305

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+YAEY+N GPGS+ ++RV W G  +   PQ +  ++ G+++    WI  TG+
Sbjct  306  GDFALKTLFYAEYENSGPGSNKAQRVKWPGIQRITRPQALG-FAPGRFLSGGSWIPQTGV  364

Query  277  PY  272
            PY
Sbjct  365  PY  366



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 121/184 (66%), Gaps = 0/184 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H+ RQ++R+C I GTIDF+FG+++ V Q+C +  R+PLA+Q  + TAQGR + 
Sbjct  41   YQDTLYVHSLRQFFRECDIYGTIDFVFGNSAVVLQSCNLYARRPLASQSNIYTAQGRTDP  100

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI +Q C++  A  L  VQ   R +LGRPWKQY+RT+  +S +D  + P+GW  W 
Sbjct  101  NQNTGISIQKCKVAAASDLAAVQTSFRTYLGRPWKQYSRTVYLQSELDSVVDPKGWLEWD  160

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G FALDTL+Y EYQN G G+ TS RV WKGY    S  E S ++ G +I  D W+  T I
Sbjct  161  GTFALDTLYYGEYQNTGAGASTSNRVKWKGYRVISSSSEASTFTVGSFIDGDVWLAGTSI  220

Query  277  PYDS  266
            P+ +
Sbjct  221  PFST  224



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY   +RQ+YR+C ISGT+DFIFGD+  + QNC +IVRKP+  Q+  VTAQGR + 
Sbjct  381  YQDTLYVQTHRQFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDK  440

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
            R   GIV+QNC I P   L   +   + +LGRPWK Y+R +I ES +  FI P GW  W 
Sbjct  441  RETTGIVIQNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWS  500

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL++AEY NRGPG+ T+ RV WKG+    +  E  +++AG ++  DQW++ TG+
Sbjct  501  GNFALDTLYFAEYGNRGPGAVTNGRVRWKGFHVIRNRNEALQFTAGPFLLGDQWLRNTGV  560

Query  277  PY  272
            PY
Sbjct  561  PY  562



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 122/182 (67%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY H  RQ+YRD  I+GT+DFIFG+++ VFQNC ++ RKP A Q+ M+TAQGR + 
Sbjct  266  YQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMLTAQGREDP  325

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                 I  Q C +  +  L  V+   + FLGRPWK Y+RT+I +SFID  I P GW PW 
Sbjct  326  NQNTAISFQKCRLTASSYLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWD  385

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FAL TL+Y EY N GPG+DTSKRV WKG+      +E  K++  + IQ   W+KPTG+
Sbjct  386  GDFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDSKEADKFTVAKLIQGGLWLKPTGV  445

Query  277  PY  272
             +
Sbjct  446  TF  447



>ref|XP_007031046.1| Pectinesterase-2 precursor [Theobroma cacao]
 gb|EOY11548.1| Pectinesterase-2 precursor [Theobroma cacao]
Length=560

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 125/183 (68%), Gaps = 0/183 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+ RQ+YRDC I GTIDFIFG+A+ VFQNC +  R PL  Q   +TAQGR++ 
Sbjct  373  YQDTLYAHSLRQFYRDCDIYGTIDFIFGNAAVVFQNCNIYPRLPLENQFNTITAQGRIDP  432

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                GI + N  I  A  L +     + +LGRPWKQY+RT+  +SF+D  I P GWS W 
Sbjct  433  NQNTGISIHNSVIKAADDLASSNGATKTYLGRPWKQYSRTVYMQSFMDKLIEPSGWSEWS  492

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            GNFALDTL+YAEY+N+GPGS+T  RV W GY  NI+  + +  +  ++IQ + W+  TG+
Sbjct  493  GNFALDTLYYAEYKNKGPGSNTDSRVRWPGYHGNINDIDAANLTVSKFIQGESWLPATGV  552

Query  277  PYD  269
            P++
Sbjct  553  PFE  555



>ref|XP_006659464.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Oryza brachyantha]
Length=602

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLYAH+  Q+YR+C +SGT+DFIFGDA+AVFQNC + +R+PL  Q+   TAQGR + 
Sbjct  414  YQDTLYAHSKTQFYRNCVVSGTVDFIFGDAAAVFQNCVLTLRRPLDNQQNTATAQGRADG  473

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPA-RVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G VLQ+C     P LK    PA R +L RPW++Y+RTLI +S I  F+   G+ PW
Sbjct  474  REATGFVLQHCRFAAEPALKDASRPAVRSYLARPWREYSRTLIMDSDIPAFVDKAGYLPW  533

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
             G+F L TLWYAEY N+G G+ T+ RV+W GY K IS +E +K++   ++ A+ WIKPTG
Sbjct  534  SGDFGLRTLWYAEYGNKGAGAATAGRVSWPGYKKVISKEEATKFTVQNFLHAEPWIKPTG  593

Query  280  IP  275
             P
Sbjct  594  TP  595



>ref|XP_004956918.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Setaria italica]
Length=634

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            +QDTLYAH+  Q+YR+C ISGT+DFIFGDA+AVFQNC +++R+P+  Q+ + TAQGR + 
Sbjct  446  FQDTLYAHSKAQFYRNCVISGTVDFIFGDAAAVFQNCILVLRRPMDNQQNIATAQGRADA  505

Query  637  RGVGGIVLQNCEICPAPQLK-TVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPW  461
            R   G VLQ CE      L+   +PP + +LGRPW++ +RTL+ ES +  FI   G+ PW
Sbjct  506  REATGFVLQKCEFQAETALRDAARPPIKNYLGRPWRECSRTLVMESELPDFIDKAGYMPW  565

Query  460  KGNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTG  281
            +G+FAL TLWYAEY N GPG+DT+ RVNW GY K IS  + +K++   +++A  WI PTG
Sbjct  566  QGDFALKTLWYAEYGNTGPGADTAGRVNWPGYKKVISKADAAKFTVENFLRAQPWIDPTG  625

Query  280  IP  275
             P
Sbjct  626  TP  627



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   216 bits (551),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 0/182 (0%)
 Frame = -1

Query  817  YQDTLYAHAYRQYYRDCSISGTIDFIFGDASAVFQNCKMIVRKPLATQECMVTAQGRMEH  638
            YQDTLY  A+RQ+Y++C+ISGTIDFIFGD+S V QN  +IVR+PL  Q+  VTAQG+   
Sbjct  384  YQDTLYVQAHRQFYKNCAISGTIDFIFGDSSTVIQNSLIIVRRPLDNQQNTVTAQGKKFK  443

Query  637  RGVGGIVLQNCEICPAPQLKTVQPPARVFLGRPWKQYARTLIAESFIDGFIAPEGWSPWK  458
                G+VLQNC+I P  +L   +     +LGRPWK+YA T+I ES I   I PEGW PW 
Sbjct  444  DESTGLVLQNCKIVPEQRLVAERLKIPSYLGRPWKEYAVTVIMESTIGDVIRPEGWMPWA  503

Query  457  GNFALDTLWYAEYQNRGPGSDTSKRVNWKGYLKNISPQEVSKYSAGQYIQADQWIKPTGI  278
            G+FALDTL+YAEY NRGPG++T  RV WKG+       E  +Y+ G +IQ D+W+K TG 
Sbjct  504  GDFALDTLFYAEYNNRGPGANTDHRVKWKGFKVITKKDEALRYTVGPFIQGDEWLKDTGS  563

Query  277  PY  272
            P+
Sbjct  564  PF  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1549013027184