BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15287_g2_i1 len=621 path=[3247:0-620]

Length=621
                                                                      Score     E

ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     247   7e-75   
emb|CDO98833.1|  unnamed protein product                                246   9e-75   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          246   1e-74   
emb|CDO98832.1|  unnamed protein product                                246   2e-74   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    244   5e-74   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    242   9e-73   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     239   4e-72   
emb|CDO98834.1|  unnamed protein product                                239   8e-72   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     238   1e-71   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     234   4e-70   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     234   6e-70   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     233   1e-69   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     233   1e-69   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                231   6e-69   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     228   2e-68   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     229   4e-68   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    229   8e-68   
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...    224   1e-67   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    228   1e-67   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     228   1e-67   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    228   1e-67   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                228   1e-67   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    228   1e-67   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             228   2e-67   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     227   2e-67   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                228   2e-67   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    228   2e-67   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             230   3e-67   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     228   3e-67   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    228   3e-67   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     227   3e-67   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    230   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                227   4e-67   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                227   4e-67   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    227   4e-67   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    227   5e-67   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     226   5e-67   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                229   6e-67   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     221   1e-66   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    226   1e-66   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    225   2e-66   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 225   3e-66   Ricinus communis
ref|XP_002872255.1|  pectinesterase family protein                      226   3e-66   
ref|XP_003591166.1|  Pectinesterase                                     225   3e-66   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     222   3e-66   
ref|XP_003604119.1|  Pectinesterase                                     226   3e-66   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    224   3e-66   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    224   7e-66   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    224   8e-66   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     223   8e-66   
ref|XP_003591168.1|  Pectinesterase                                     223   1e-65   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    223   1e-65   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    225   1e-65   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         223   1e-65   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             223   1e-65   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             222   2e-65   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     222   2e-65   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                221   3e-65   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     221   3e-65   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    224   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    222   4e-65   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    221   7e-65   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    221   7e-65   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    223   7e-65   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    224   7e-65   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     220   1e-64   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     220   1e-64   
ref|XP_002884519.1|  pectinesterase family protein                      222   1e-64   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    220   2e-64   
ref|XP_003591164.1|  Pectinesterase                                     220   2e-64   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    221   2e-64   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    222   2e-64   
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     220   2e-64   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    219   3e-64   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    219   5e-64   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    218   6e-64   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 218   7e-64   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    221   7e-64   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             218   7e-64   
emb|CDP21547.1|  unnamed protein product                                220   7e-64   
emb|CDX99968.1|  BnaC09g03330D                                          220   9e-64   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    218   9e-64   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             218   9e-64   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    218   1e-63   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42986.1|  putative pectinesterase                                219   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     217   2e-63   
emb|CBI39537.3|  unnamed protein product                                220   2e-63   
ref|XP_003604120.1|  Pectinesterase                                     218   2e-63   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-63   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    217   2e-63   
ref|XP_002865716.1|  pectinesterase family protein                      217   2e-63   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    217   2e-63   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     217   3e-63   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 217   3e-63   Ricinus communis
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             214   3e-63   
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    213   3e-63   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    216   4e-63   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         216   4e-63   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         216   7e-63   
gb|EPS72184.1|  pectinesterase family protein                           215   7e-63   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    215   8e-63   
ref|XP_003626199.1|  Pectinesterase                                     216   9e-63   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    219   1e-62   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             218   1e-62   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    212   1e-62   Medicago sativa [alfalfa]
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    214   2e-62   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    216   2e-62   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             215   2e-62   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    214   2e-62   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    214   2e-62   
gb|EPS59322.1|  pectinesterase                                          213   2e-62   
emb|CDY19737.1|  BnaA09g03900D                                          213   2e-62   
gb|EPS70728.1|  pectinesterase                                          214   2e-62   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          215   3e-62   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     215   4e-62   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    216   5e-62   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             215   6e-62   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    213   7e-62   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    215   7e-62   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    215   7e-62   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             214   8e-62   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-61   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    212   1e-61   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    213   1e-61   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    212   1e-61   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     212   1e-61   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-61   
ref|XP_002314364.1|  putative pectinesterase family protein             212   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-61   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     212   2e-61   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-61   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    212   3e-61   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    211   3e-61   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   211   3e-61   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             211   4e-61   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             211   4e-61   
emb|CDX80613.1|  BnaC07g28310D                                          213   4e-61   
emb|CDY05188.1|  BnaC05g46150D                                          212   5e-61   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-61   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-61   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     210   8e-61   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    211   9e-61   
ref|XP_010489680.1|  PREDICTED: probable pectinesterase/pectinest...    204   1e-60   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          209   1e-60   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             210   1e-60   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     209   1e-60   
emb|CDY27751.1|  BnaA05g31600D                                          210   2e-60   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    210   5e-60   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             208   5e-60   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    208   6e-60   
emb|CBI22967.3|  unnamed protein product                                214   6e-60   
emb|CDY68790.1|  BnaAnng28400D                                          210   6e-60   
emb|CDY33925.1|  BnaA02g30620D                                          208   6e-60   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    207   9e-60   
ref|XP_006382447.1|  pectin methylesterase family protein               207   9e-60   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    207   1e-59   
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             207   2e-59   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                210   2e-59   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             207   2e-59   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    206   4e-59   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     206   4e-59   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    206   5e-59   
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 205   6e-59   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     207   7e-59   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    205   8e-59   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     204   1e-58   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    204   2e-58   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          204   2e-58   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    203   3e-58   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    204   3e-58   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            203   4e-58   Medicago truncatula
ref|XP_008370617.1|  PREDICTED: pectinesterase                          203   5e-58   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    204   6e-58   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    202   7e-58   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    201   1e-57   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             202   1e-57   Populus trichocarpa [western balsam poplar]
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 201   3e-57   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    201   3e-57   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    202   3e-57   
emb|CDX74137.1|  BnaA03g29100D                                          202   3e-57   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    201   3e-57   
gb|EPS66234.1|  hypothetical protein M569_08543                         201   3e-57   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    201   3e-57   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    201   4e-57   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    196   4e-57   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    200   4e-57   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          201   5e-57   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    199   6e-57   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    200   7e-57   
gb|AAF63815.1|  pectin methylesterase, putative                         199   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             199   8e-57   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    199   9e-57   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    199   1e-56   
emb|CDY34927.1|  BnaA01g32580D                                          198   2e-56   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 198   3e-56   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     197   5e-56   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    192   8e-56   Petunia integrifolia [violet-flowered petunia]
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    197   9e-56   
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    195   9e-56   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    197   1e-55   
dbj|BAC42959.2|  putative pectin methylesterase                         196   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    196   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    196   3e-55   
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             196   3e-55   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    196   3e-55   
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 195   6e-55   
emb|CAB65290.2|  pectin methyl-esterase PER                             195   8e-55   Medicago truncatula
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    194   8e-55   
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 195   1e-54   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 194   1e-54   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    197   2e-54   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          194   3e-54   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-54   
emb|CDY71928.1|  BnaCnng75130D                                          187   7e-54   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    191   9e-54   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                192   1e-53   
gb|EPS65387.1|  pectinesterase                                          191   1e-53   
gb|EPS58111.1|  pectinesterase                                          187   1e-53   
gb|AFW03475.1|  pectin methylesterase 1                                 191   2e-53   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    190   2e-53   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    191   2e-53   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    190   4e-53   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    190   5e-53   
emb|CDY24663.1|  BnaA05g30620D                                          189   5e-53   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          190   5e-53   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    189   5e-53   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             189   1e-52   
gb|AFB77929.1|  pectin methylesterase                                   189   1e-52   
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  187   1e-52   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             188   2e-52   
emb|CDY05295.1|  BnaC05g45080D                                          188   2e-52   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    188   2e-52   
gb|KHG08631.1|  Pectinesterase 3                                        187   2e-52   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     187   3e-52   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         187   3e-52   
gb|AFW03480.1|  pectin methylesterase 1                                 187   3e-52   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  187   4e-52   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    187   4e-52   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     187   4e-52   
ref|XP_002882495.1|  pectinesterase family protein                      187   5e-52   
gb|ACN40984.1|  unknown                                                 187   6e-52   Picea sitchensis
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             186   7e-52   
gb|ABG46324.1|  putative pectin methylesterase                          182   1e-51   Picea abies
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                186   1e-51   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     185   1e-51   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    185   1e-51   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    185   1e-51   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             186   2e-51   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    185   2e-51   
gb|AFQ23194.1|  pectin methylesterase                                   185   3e-51   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    185   3e-51   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     184   4e-51   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    184   4e-51   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    184   4e-51   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         183   7e-51   Linum usitatissimum
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     184   8e-51   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    183   9e-51   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     184   9e-51   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    183   1e-50   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    183   2e-50   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    183   2e-50   
ref|XP_004495868.1|  PREDICTED: probable pectinesterase/pectinest...    182   2e-50   
ref|XP_007149847.1|  hypothetical protein PHAVU_005G103500g             180   2e-50   
ref|XP_007145106.1|  hypothetical protein PHAVU_007G210300g             181   4e-50   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              181   4e-50   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 181   4e-50   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     182   4e-50   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               182   4e-50   Ricinus communis
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     181   7e-50   
ref|XP_007031044.1|  Pectinesterase, putative                           181   7e-50   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     181   8e-50   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    181   1e-49   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          180   1e-49   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     180   1e-49   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    180   2e-49   
ref|XP_003535290.1|  PREDICTED: probable pectinesterase/pectinest...    180   2e-49   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     180   2e-49   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          180   2e-49   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    179   2e-49   
ref|XP_003627458.1|  Pectinesterase                                     180   2e-49   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     180   2e-49   
ref|XP_002324181.2|  pectinesterase family protein                      179   3e-49   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     179   3e-49   
ref|XP_009135375.1|  PREDICTED: pectinesterase 1-like                   179   3e-49   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               179   4e-49   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    179   4e-49   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    179   5e-49   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    178   5e-49   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       179   5e-49   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     178   5e-49   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   179   6e-49   
dbj|BAK05856.1|  predicted protein                                      179   6e-49   
ref|XP_004309290.1|  PREDICTED: putative pectinesterase/pectinest...    171   7e-49   
gb|ACF79975.1|  unknown                                                 178   7e-49   
gb|ABZ89800.1|  pectin methylesterase-like protein                      178   8e-49   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             178   8e-49   
ref|NP_001274969.1|  pectin methyl esterase                             178   8e-49   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     178   1e-48   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          178   1e-48   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             179   1e-48   
ref|XP_010276571.1|  PREDICTED: uncharacterized protein LOC104611288    180   1e-48   
ref|XP_003591317.1|  Pectinesterase                                     177   1e-48   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     177   1e-48   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     177   1e-48   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    177   1e-48   
gb|EPS69059.1|  hypothetical protein M569_05708                         181   2e-48   
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   177   2e-48   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             178   2e-48   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     177   2e-48   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    177   2e-48   
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                177   2e-48   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             178   3e-48   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             177   3e-48   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             177   3e-48   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         176   3e-48   
gb|AFI23411.1|  pectin methylesterase                                   176   3e-48   
emb|CDP19930.1|  unnamed protein product                                176   3e-48   
ref|NP_001105487.1|  pectin methylesterase1                             176   4e-48   
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    176   4e-48   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    176   4e-48   
ref|NP_001049858.1|  Os03g0300500                                       176   4e-48   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    176   4e-48   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    176   4e-48   
gb|ACR34431.1|  unknown                                                 173   5e-48   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     176   5e-48   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     176   6e-48   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    176   6e-48   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    176   6e-48   
gb|KHN23786.1|  Putative pectinesterase/pectinesterase inhibitor 21     173   7e-48   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     175   8e-48   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    176   8e-48   
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...    175   8e-48   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     175   9e-48   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    175   9e-48   
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2             175   9e-48   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    175   1e-47   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          175   1e-47   
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1             175   1e-47   
emb|CDX75763.1|  BnaC03g38460D                                          175   1e-47   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     175   1e-47   
emb|CAB95025.1|  pectin methylesterase                                  175   1e-47   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          175   1e-47   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    175   1e-47   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    174   1e-47   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     175   1e-47   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     174   1e-47   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    175   1e-47   
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g            172   2e-47   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     174   2e-47   
gb|AAO85706.1|  pectin methyl-esterase                                  174   2e-47   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          174   2e-47   
ref|XP_006363205.1|  PREDICTED: probable pectinesterase/pectinest...    174   2e-47   
dbj|BAA89480.1|  pectin methylesterase                                  174   2e-47   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     174   3e-47   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     174   3e-47   
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         174   3e-47   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             174   3e-47   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     171   3e-47   
ref|NP_001132793.1|  pectinesterase                                     174   4e-47   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             173   4e-47   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             174   5e-47   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    173   5e-47   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          173   5e-47   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          173   5e-47   
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     173   6e-47   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    173   6e-47   
ref|XP_007145105.1|  hypothetical protein PHAVU_007G210200g             173   6e-47   
gb|AAC14494.1|  putative pectinesterase                                 172   6e-47   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    172   9e-47   
gb|KHG28352.1|  Pectinesterase 3                                        172   9e-47   
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    172   1e-46   
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg                172   1e-46   
gb|EAZ09211.1|  hypothetical protein OsI_31486                          169   1e-46   
ref|XP_003622696.1|  Pectinesterase                                     172   1e-46   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     171   2e-46   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     171   2e-46   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    172   2e-46   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          171   2e-46   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    171   2e-46   
ref|XP_007012506.1|  Pectinesterase                                     171   2e-46   
emb|CBI26012.3|  unnamed protein product                                171   2e-46   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    171   2e-46   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     171   2e-46   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     171   2e-46   
ref|NP_850077.1|  probable pectinesterase/pectinesterase inhibito...    172   2e-46   
emb|CDP16868.1|  unnamed protein product                                171   2e-46   
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    171   3e-46   
ref|XP_011079312.1|  PREDICTED: pectinesterase 1-like                   171   3e-46   
gb|EYU21271.1|  hypothetical protein MIMGU_mgv1a022830mg                171   3e-46   
ref|XP_010543643.1|  PREDICTED: probable pectinesterase/pectinest...    171   3e-46   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    171   3e-46   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    171   3e-46   
ref|XP_004289016.1|  PREDICTED: probable pectinesterase/pectinest...    171   4e-46   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               171   4e-46   
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg             171   4e-46   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          171   4e-46   
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     170   4e-46   
gb|AAP40488.1|  putative pectin methylesterase                          171   4e-46   
gb|AAC14742.1|  pectin methylesterase                                   170   5e-46   
dbj|BAC67661.1|  pectin methylesterase                                  170   5e-46   
emb|CAA47810.1|  pectinesterase                                         170   5e-46   
gb|KFK22175.1|  hypothetical protein AALP_AAs39369U000100               171   6e-46   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    170   6e-46   
ref|NP_001169525.1|  pectinesterase                                     171   6e-46   
ref|XP_007012502.1|  Pectin methylesterase 3                            170   6e-46   
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    171   7e-46   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     170   7e-46   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          169   7e-46   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              166   7e-46   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          170   7e-46   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     170   8e-46   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          170   8e-46   
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    170   8e-46   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         170   9e-46   
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                        170   9e-46   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    170   1e-45   
emb|CAC18727.1|  putative pectin methylesterase                         169   1e-45   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   170   1e-45   
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                169   1e-45   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          169   1e-45   
gb|KHN30453.1|  Pectinesterase 2.2                                      168   1e-45   
ref|NP_001063246.1|  Os09g0433700                                       170   1e-45   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   169   1e-45   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    170   1e-45   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    169   1e-45   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    169   1e-45   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    165   2e-45   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     169   2e-45   
emb|CAH67075.1|  OSIGBa0097P08.5                                        169   2e-45   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          169   2e-45   
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                167   2e-45   
ref|XP_003598363.1|  Pectinesterase                                     169   2e-45   
ref|XP_010526136.1|  PREDICTED: probable pectinesterase/pectinest...    169   2e-45   
ref|XP_002316458.2|  pectinesterase family protein                      169   2e-45   
ref|NP_001052981.1|  Os04g0458900                                       168   2e-45   
gb|EAY94388.1|  hypothetical protein OsI_16156                          168   2e-45   
ref|XP_009122673.1|  PREDICTED: putative pectinesterase/pectinest...    168   2e-45   
gb|EAY94391.1|  hypothetical protein OsI_16158                          168   2e-45   
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             169   3e-45   
emb|CDY36269.1|  BnaA01g31490D                                          168   3e-45   
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    168   3e-45   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             168   3e-45   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               168   3e-45   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     168   3e-45   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    169   3e-45   
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    167   4e-45   
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             168   4e-45   
gb|AER38243.1|  PME2                                                    167   4e-45   
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             167   4e-45   
ref|XP_010247944.1|  PREDICTED: probable pectinesterase/pectinest...    166   4e-45   
gb|EYU19492.1|  hypothetical protein MIMGU_mgv1a025514mg                168   4e-45   
gb|AFW03481.1|  pectin methylesterase 2                                 167   4e-45   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     167   4e-45   
ref|XP_006407095.1|  hypothetical protein EUTSA_v10022003mg             168   5e-45   
gb|AFW03476.1|  pectin methylesterase 2                                 167   5e-45   
ref|XP_003609936.1|  Pectinesterase                                     168   5e-45   
ref|XP_010542351.1|  PREDICTED: pectinesterase 1                        168   5e-45   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     167   5e-45   
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    167   5e-45   
ref|XP_009391197.1|  PREDICTED: pectinesterase 3                        167   6e-45   
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    167   6e-45   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    167   6e-45   
gb|AEL79481.1|  pectin methylesterase-like protein                      167   6e-45   
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 167   6e-45   
gb|AFB77928.1|  pectin methylesterase                                   167   6e-45   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     167   7e-45   
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    167   7e-45   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              167   7e-45   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     167   7e-45   
gb|EPS73427.1|  pectinesterase                                          167   7e-45   
emb|CAC18726.1|  putative pectin methylesterase                         167   7e-45   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              167   7e-45   
emb|CAC01624.1|  putative pectin methylesterase                         167   7e-45   
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    167   8e-45   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    167   8e-45   
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    167   8e-45   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     167   1e-44   
gb|KHN23785.1|  Pectinesterase 4                                        166   1e-44   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             166   1e-44   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    166   1e-44   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     166   1e-44   
ref|XP_003535291.1|  PREDICTED: probable pectinesterase/pectinest...    166   1e-44   
ref|XP_006295415.1|  hypothetical protein CARUB_v10024513mg             167   1e-44   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          166   1e-44   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         166   1e-44   
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...    167   1e-44   
ref|XP_010465322.1|  PREDICTED: pectinesterase 1-like                   166   1e-44   
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                166   1e-44   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    165   1e-44   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    166   1e-44   
ref|NP_196115.1|  putative pectinesterase/pectinesterase inhibito...    166   2e-44   
gb|AAO42295.1|  unknown protein                                         166   2e-44   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             166   2e-44   
ref|XP_011005059.1|  PREDICTED: pectinesterase 3-like                   166   2e-44   
ref|XP_011047961.1|  PREDICTED: pectinesterase-like                     166   2e-44   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    166   2e-44   
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 166   2e-44   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     166   2e-44   



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            G+TGEKMK LLKTAGELTSNGLA++T+  E  + L      RRLL+ +  +   AF++A 
Sbjct  178  GETGEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGISRRLLTTDSEYT-SAFVEAG  236

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            +RRLL  +    KPN VVA+DGSG++K+I +A+   PP N+  YVI IKAG Y E V +P
Sbjct  237  SRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIP  294

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            +++ +VVFIG+GPTKTKIT NKN  DG GTY TATVA+ G+ F ARDIGFEN+AGA+KHQ
Sbjct  295  RSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAGAKKHQ  354

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVSAD  +F NC IDGYQDTLY
Sbjct  355  AVALRVSADKTVFYNCNIDGYQDTLY  380



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GDTGE+MK LLKTAGELTSNGLA++T+++E  +    +  +RRL+S +     P F+DAT
Sbjct  162  GDTGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLMSSSVE---PDFVDAT  218

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            AR+L+ A+  S+KPN VVA+DGSG+FKSI  A+N  P  N+  +VI IKAG+Y EYV +P
Sbjct  219  ARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLP  278

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K++N +V +G+GPTKTKIT NKN VDG+GT+QT T+++ G+    +D+G ENSAGA KHQ
Sbjct  279  KHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAGAVKHQ  338

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVS D  I  NC ID YQDTLY
Sbjct  339  AVALRVSGDRTIVYNCQIDAYQDTLY  364



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            G+TGEKMK LLKTAGELTSNGLA++++  E  + L      RRLL+ +  +   AF++A 
Sbjct  178  GETGEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGISRRLLTTDSEYT-SAFVEAG  236

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            +RRLL  +    KPN VVA+DGSG++K+I +A+   PP N+  YVI IKAG Y E V +P
Sbjct  237  SRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIP  294

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            ++M +VVFIG+GPTKTKIT NKN  DG GTY TATVA+ G+ F ARDIGFEN+AGA+KHQ
Sbjct  295  RSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAGAKKHQ  354

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVSAD  +F NC IDGYQDTLY
Sbjct  355  AVALRVSADKTVFYNCNIDGYQDTLY  380



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GDTGE+MK LLKTAGELTSNGLA++T+++E  +    +  +RRL+S +     P F+DAT
Sbjct  178  GDTGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLMSSSVE---PDFVDAT  234

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            AR+L+ A+  S+KPN VVA+DGSG+FKSI  A+N  P  N+  +VI IKAG+Y EYV +P
Sbjct  235  ARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLP  294

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K++N +V +G+GPTKTKIT NKN VDG+GT+QT T+++ G+    +D+G ENSAGA KHQ
Sbjct  295  KHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAGAVKHQ  354

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVS D  I  NC ID YQDTLY
Sbjct  355  AVALRVSGDRTIVYNCQIDAYQDTLY  380



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 151/205 (74%), Gaps = 5/205 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GDTGEKMK LLKTAGELTSNGLA+IT+  +  +++      R L  ND   + +F++  +
Sbjct  177  GDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGISRRLLAND---YTSFVEDGS  233

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            RRLL  +  S KPN VVA DGSG+FK+I +A+   PP N  PYVI IKAG Y E V VP+
Sbjct  234  RRLLQVS--STKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEIVDVPR  291

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
             + +VVFIG+GPTKTKIT NKN  DG  T+ TATVA+ G+ F ARDIGFEN+AGA KHQA
Sbjct  292  GVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGFVARDIGFENTAGAMKHQA  351

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRVSAD A+F NC IDGYQDTLY
Sbjct  352  VALRVSADKAVFYNCNIDGYQDTLY  376



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 154/214 (72%), Gaps = 8/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN--------F  465
            G+ GE M+  LKTAGELT NGLA++T +    ++L+   +RRLLS              F
Sbjct  184  GNAGESMRKALKTAGELTQNGLAMVTEVASILTSLQMPSKRRLLSSEQQSQCPFAMEDEF  243

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P +  A  RRLL A+  +IKPN+ VAKDGSG++K+I++A+   P N++  +VI IKAGVY
Sbjct  244  PTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKAGVY  303

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            +E V + ++M H++ IGDGPTKTKIT NKN VDG  T++TATVA+ G+ F A+DIGFENS
Sbjct  304  HEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVAVIGDGFMAKDIGFENS  363

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG +KHQAVALRV +D +IF NC IDGYQDTLYA
Sbjct  364  AGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYA  397



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 152/206 (74%), Gaps = 7/206 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GDTGEKMK LLKTAGELTSNGLA+IT+  +  + +      RRLL+D+    + +F++  
Sbjct  173  GDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGISRRLLADD----YTSFVEDG  228

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            +RRLL  +  + KPN VVA DGSG+FK+I +A+   PP N  PYVI IKAG Y E V +P
Sbjct  229  SRRLLQVS--NTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEMVDIP  286

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            + + +VVFIG+GPTKTKIT NKN  DG  T+ T+TVA+ G+ F A+DIGFEN+AGA KHQ
Sbjct  287  RGVTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGFVAKDIGFENTAGAMKHQ  346

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVSAD  +F NC IDGYQDTLY
Sbjct  347  AVALRVSADKTVFYNCNIDGYQDTLY  372



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL--EAKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK L++TA +L+SNGLAI+T+ +E   TL      RR L ++    +   F++ 
Sbjct  181  GDTGEKMKQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLSRRLLSAEKRKLDEENFVE-  239

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL  +  SIKPN ++A+DGSG FK+I DAIN  P NN  P+VI IKAGVY E +++
Sbjct  240  --RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKEVILI  297

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            P+ +N+VV +G+GP  TKIT NKN VDGIGT+ TATVAI G+    RDIG ENSAG +KH
Sbjct  298  PRRINNVVIMGEGPNVTKITANKNYVDGIGTFHTATVAINGDGCILRDIGIENSAGPEKH  357

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D  I  NC IDGYQDTLY+
Sbjct  358  QAVALRVSGDRTIVYNCQIDGYQDTLYS  385



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 148/208 (71%), Gaps = 15/208 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK---KRRRLLSDNDGFNFPAFID  450
            G+TGEKM+ LLK AGELTSN LA++++  +  + L  K     RRLL            +
Sbjct  176  GETGEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVNRRLL------------N  223

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
            A  R L   N+  +KPNVVVA DGSG++KSIN+A+   P  N   +VI IKAG+Y EY+ 
Sbjct  224  AHERMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAGIYKEYID  283

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            +PK MNH+VFIG+GPTKTKIT NKN  DGIGT+QTATVAI G++F A+DIG EN+AGA K
Sbjct  284  IPKKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAINGDNFMAKDIGIENTAGAIK  343

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRVS D AIF NC  DGYQDTLY
Sbjct  344  HQAVALRVSGDKAIFHNCQFDGYQDTLY  371



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 148/206 (72%), Gaps = 17/206 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GDTGEKMK LLK AGELTSNGLA++++  E  + L      RRLL            DA 
Sbjct  174  GDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLL------------DAH  221

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             R L    + S+KPNVVVA DGSG++KSIN+A+N  P  N   YVI IKAGVYNE+V +P
Sbjct  222  ERML----SDSLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNEHVEIP  277

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            + MN++VFIG+GPTKTKIT + N  DG GT++TAT A+ G++F A+DIGFEN+AG  KHQ
Sbjct  278  RKMNNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQ  337

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVS D AIF NC IDGYQDTLY
Sbjct  338  AVALRVSGDMAIFHNCQIDGYQDTLY  363



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 148/206 (72%), Gaps = 17/206 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GDTGEKMK LLK AGELTSNGLA++++  E  + L      RRLL            DA 
Sbjct  174  GDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLL------------DAH  221

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             R L    + S+KPNV+VA DGSG++KSIN+A+N  P  N   YVI IKAGVYNE+V +P
Sbjct  222  ERML----SDSLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNEHVEIP  277

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            + MN+++FIG+GPTKTKIT + N  DG GT++TAT A+ G++F A+DIGFEN+AG  KHQ
Sbjct  278  RKMNNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQ  337

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRVS D AIF NC IDGYQDTLY
Sbjct  338  AVALRVSGDMAIFHNCQIDGYQDTLY  363



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 150/208 (72%), Gaps = 7/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMKHL+KT  E++SNGLA++TN++   ++L+      R+LLS+ +G     F+  
Sbjct  165  GDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEG---ALFLSN  221

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL A+  S+KPN VVA DGSG+F +I+ AI   PP N+  +VI +KAG+Y EYV +
Sbjct  222  NQRRLLAAS--SLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQI  279

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK MN +V IGDGP KT+I+  KN  +G+ T+ TATVA+  + F A+DIGFEN+AG Q H
Sbjct  280  PKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTAGPQGH  339

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D A+F N  IDGYQDTLYA
Sbjct  340  QAVALRVSGDRAVFFNVHIDGYQDTLYA  367



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 150/208 (72%), Gaps = 7/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMKHL+KT  E++SNGLA++TN++   ++L+      R+LLS+ +G     F+  
Sbjct  165  GDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEG---ALFLSN  221

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL A+  S+KPN VVA DGSG+F +I+ AI   PP N+  +VI +KAG+Y EYV +
Sbjct  222  NQRRLLAAS--SLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQI  279

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK MN +V IGDGP KT+I+  KN  +G+ T+ TATVA+  + F A+DIGFEN+AG Q H
Sbjct  280  PKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTAGPQGH  339

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D A+F N  IDGYQDTLYA
Sbjct  340  QAVALRVSGDRAVFFNVHIDGYQDTLYA  367



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 153/212 (72%), Gaps = 11/212 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-----AKKRRRLLSDNDGFNFPAF  456
            GDT EKMK+LLKTA EL+SNGLA++++++     L+         RRLLS++     P +
Sbjct  180  GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSED-----PYW  234

Query  455  IDAT-ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            I +   RRLL+A A  +KPN VVA DGSG+FK+I DAIN  P  N  P+VI IKAG+Y E
Sbjct  235  IKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKAGLYKE  294

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            +V +PK +N VV IG+GP KT+IT +K+   G+ T+ TATVA+ GE F A+DIGFEN+AG
Sbjct  295  HVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFMAKDIGFENTAG  354

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            A+ HQAVALRVS D AIF N AIDGYQDTLYA
Sbjct  355  AEGHQAVALRVSGDRAIFLNVAIDGYQDTLYA  386



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  63   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  118

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  119  -HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  177

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  178  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  237

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  238  HQAVALRVQADKSIFYNCSMDGYQDTLYA  266



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 145/206 (70%), Gaps = 14/206 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK+LLK A EL++N L I+++  E    L+      RRLL+          ++A
Sbjct  174  GDTGEKMKNLLKNAHELSTNALDIVSSFEEQVENLQILGINNRRLLT----------VEA  223

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL      +KPNVVVA+DGSG+ KSIN+A+   PPNN  PYVI IKAG+YNEYV V
Sbjct  224  GNRRLLQV--APLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNEYVQV  281

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
               M +VVFIG+GP KTKIT NKN +DG+  + TATVAI G+ F A+DIGFENSAG  KH
Sbjct  282  ANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKH  341

Query  86   QAVALRVSADHAIFSNCAIDGYQDTL  9
            QAVALRVSA+ A+F NC IDGYQ TL
Sbjct  342  QAVALRVSAEMAVFQNCQIDGYQYTL  367



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 153/212 (72%), Gaps = 10/212 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLS----DNDGFNFPA  459
            G+  EKMK  LKT+ +L+SNGLA+++ ++   S L+     RRRLL      +D  ++P 
Sbjct  185  GNAAEKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGISRRRLLEIPVLGHD--DYPD  242

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPN-NDAPYVIKIKAGVYN  282
            + +   RRLL A +  +KPNVVVAKDGSG+FK+I +AI++ P   N+A YVI IKAGVY 
Sbjct  243  WANPGMRRLLAAGS-KVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQ  301

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            EYV+V K + H++ IGDGP KT IT NKN +DG  T++TATVA+  EHF ARDIGFEN+A
Sbjct  302  EYVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAVTAEHFMARDIGFENTA  361

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G QKHQAVALRV AD A+F NC + GYQDTLY
Sbjct  362  GPQKHQAVALRVQADKAVFYNCEMHGYQDTLY  393



>ref|XP_003557034.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=402

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T L +  +     K   RRLL D++    P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA D SG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFN--------  468
            GD GEKMK LL +  ELTSNGLA+++ +T    +   K+ +RRLL+   G          
Sbjct  179  GDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGAGGGTKKNTPKV  238

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNN-DAPYVIKIKAG  291
             P +ID     +  A   S+KP+V VAKDGSG+ KSI +A+ + P NN D  +VI +K G
Sbjct  239  IPVWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEG  298

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VYNEYV++ K M +V+ IGDGPTKTKIT NKN  DG  T+QTATVA+ G++F A+DIGFE
Sbjct  299  VYNEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFE  358

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            NSAGA+ HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  359  NSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLY  393



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+TNL +        +  RRRLL D+     P ++D  
Sbjct  179  DAGKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRRRLLQDS---KLPVWVDQ-  234

Query  443  ARRLLNANAGSI--KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN N   +  KPNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  235  -HRLLNENESLLRHKPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVYQEYVE  293

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+IT NKN +DG  TY+TATVAI+G++F A ++GFENSAG QK
Sbjct  294  VTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQK  353

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLY 
Sbjct  354  HQAVALRVQADKSIFYNCSMDGYQDTLYV  382



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA  +K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 152/214 (71%), Gaps = 17/214 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-------AKKRRRLLSDNDGFNFP  462
            GDT EKMK+LLKTA EL+SNGLA++++++     L+       A   RRL S++D  N  
Sbjct  181  GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSNDDWIN--  238

Query  461  AFIDATARRLLNANAGSI-KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
                   RR+L     +  KPN VVA+DGSG+FK+I +AI+  P NN+  +VI IKAGVY
Sbjct  239  -------RRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVY  291

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             E+V +PK MN +VFIGDGP KT+IT +K+   G+ T+QTATVA+  E FTA++IGFEN+
Sbjct  292  KEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEEFTAKNIGFENT  351

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AGA+ HQAVALRVS D A+F N AIDGYQDTLYA
Sbjct  352  AGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYA  385



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA  +K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 151/215 (70%), Gaps = 10/215 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFN--------  468
            GD GEKMK LL +  ELTSNGLA+++ +T    +   K+ +RRLL+   G +        
Sbjct  179  GDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGAGGDTKKNTPKI  238

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNN-DAPYVIKIKAG  291
             P +ID  A  +  A   S+KP+V VAKDGSG+ KSI +A+ + P NN D  +VI +K G
Sbjct  239  IPVWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEG  298

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VYNE+V++ K M +V+ IGDGPTKTKIT NKN  DG  T+QTATVA+ G++F A+DIGFE
Sbjct  299  VYNEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFE  358

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            NSAGA+ HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  359  NSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLY  393



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  160  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  215

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  216  -HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  274

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  275  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  334

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  335  HQAVALRVQADKSIFYNCSMDGYQDTLYA  363



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 17/213 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-------AKKRRRLLSDNDGFNFP  462
            GDT EKMK+LLKTA EL+SNGLA++++++     L+       A   RRL S++D     
Sbjct  181  GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSNDDWIK--  238

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
                   RR+L   A + KPN VVA+DGSG+FK+I +AI+  P NN+  +VI IKAGVY 
Sbjct  239  -------RRVLRGKAYA-KPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVYK  290

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E+V +PK MN +VFIGDGP KT+IT +K+   G+ T+QTATVA+  E FTA++IGFEN+A
Sbjct  291  EHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEFTAKNIGFENTA  350

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            GA+ HQAVALRVS D A+F N AIDGYQDTLYA
Sbjct  351  GAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYA  383



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 146/209 (70%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D   +  P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQD---YELPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 151/208 (73%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT NGLA+++ ++     L+  +   RRLLS +    FP+++DA
Sbjct  179  GDAGETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMSSRRLLSQD----FPSWMDA  234

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             ARRLLNA    +KP++VVA+DGSG++K+IN+A+   P   +  +V+ IK G+Y EYV V
Sbjct  235  RARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIKGGIYKEYVQV  294

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDG  KT IT +KN  DGI TY+TATVAI G+HF A++IGFEN+AG  KH
Sbjct  295  NRSMTHLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGDHFIAKNIGFENTAGPIKH  354

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV AD +IF NC  DGYQDTLYA
Sbjct  355  QAVAIRVLADQSIFYNCRFDGYQDTLYA  382



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D  
Sbjct  189  DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  244

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  245  -HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  303

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  304  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  363

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  364  HQAVALRVQADKSIFYNCSMDGYQDTLYA  392



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 145/206 (70%), Gaps = 14/206 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK+LLK A EL++N L I+++  +    L+      RRLL+          ++A
Sbjct  174  GDTGEKMKNLLKNAHELSTNALDIVSSFEKQVEDLQILGINNRRLLT----------VEA  223

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL      +KPNVVVA+DGSG+ KSIN+A+   PPNN  PYVI IKAG+YNEYV V
Sbjct  224  GNRRLLQV--APLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNEYVQV  281

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
               M +VVFIG+GP KTKIT NKN +DG+  + TATVAI G+ F A+DIGFENSAG  KH
Sbjct  282  ANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKH  341

Query  86   QAVALRVSADHAIFSNCAIDGYQDTL  9
            QAVALRVSA+ A+F NC IDGYQ TL
Sbjct  342  QAVALRVSAEMAVFQNCQIDGYQYTL  367



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 152/208 (73%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G+ GE +K  LKTA +LT NGLA++T ++     ++  +   RRLLS      FP+++DA
Sbjct  181  GNAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQE----FPSWMDA  236

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             ARRLLNA    +KP++VVA+DGSG++K+IN+A+N  P   +  +V+ IK G+Y EYV V
Sbjct  237  RARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQV  296

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDGP KT I+ +K+  DGI TY+TATVAI G+HF A++I FEN+AGA KH
Sbjct  297  NRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIAFENTAGAIKH  356

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV AD +IF NC  DGYQDTLYA
Sbjct  357  QAVAIRVLADESIFYNCKFDGYQDTLYA  384



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 154/224 (69%), Gaps = 18/224 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-----AKKRRRLLSDNDGFNF---  465
            GDT EKMK+LLKTA EL+SNGLA++++++     L+         RRLLS  +   +   
Sbjct  180  GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLYGGD  239

Query  464  ---------PAFIDAT-ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP  315
                     P +I +  +RRLL+A A  +KPN VVA DGSG+FK+I DAIN  P  N  P
Sbjct  240  PTDYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQP  299

Query  314  YVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHF  135
            +VI IKAG+Y E+V +PK +N VV IG+GP KT+IT +K+   G+ T+ TATVA+ GE F
Sbjct  300  FVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDF  359

Query  134  TARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             A+DIGFEN+AGA+ HQAVALRVS D AIF N AIDGYQDTLYA
Sbjct  360  MAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYA  403



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 154/226 (68%), Gaps = 20/226 (9%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDND------------  477
            GDTGEKMK+LL+T+GEL SNGLA++T+ +   S+L     RRLLSD              
Sbjct  179  GDTGEKMKNLLQTSGELLSNGLAMVTDFSSILSSLGGFSSRRLLSDEGRSLYHLDPTDYA  238

Query  476  -------GFN-FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND  321
                   GF   P+F+D+ AR+LL A   ++KPN VVAKDGSG++ +I  A+   P   +
Sbjct  239  PGEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKKTN  298

Query  320  APYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGE  141
              +VI +KAGVY E V++P+++N++V IGDGP KT+I  NKN  DG+ T+ TA +A+ G+
Sbjct  299  QTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQTFHTAVLAVNGD  358

Query  140  HFTARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             F A+DIG EN+AGA KHQAVA+RVS D+AIF N  +DGYQDTLYA
Sbjct  359  GFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYA  404



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 153/215 (71%), Gaps = 10/215 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSD---------NDGF  471
            GD GEKMK LLK+AGELTSNGLA+I  ++   + L+     RRLLSD         ++G 
Sbjct  189  GDAGEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLSDESGKGEYRSDEGG  248

Query  470  NFPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
             +P++     R+L  A   +IKPNV+VA+DGSG++K+IN+A+ + P N +  +V+ +K G
Sbjct  249  LYPSWASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEG  308

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VY E V   K+M +V+ IGDGPTKT I+ + N +DGIGT++TATVA  G +F A+DIGFE
Sbjct  309  VYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFE  368

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            N+AGA KHQAVALRV +D AIF NC +DGYQDTLY
Sbjct  369  NNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTLY  403



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+TNL +        +  RRRLL D+     P ++D  
Sbjct  179  DAGKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRRRLLQDS---KLPVWVDQ-  234

Query  443  ARRLLNANAGSI--KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN N   +  KPNV VA DGSG+F+SIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  235  -HRLLNENESLLRHKPNVTVAIDGSGDFESINEALKQVPKENRKPFVIYIKEGVYQEYVE  293

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+IT NKN +DG  TY+TATVAI+G++F A ++GFENSAG QK
Sbjct  294  VTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQK  353

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLY 
Sbjct  354  HQAVALRVQADKSIFYNCSMDGYQDTLYV  382



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 153/220 (70%), Gaps = 16/220 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE---AKKRRRLLSDNDGF-------  471
            GDTGEKMK+LLKTA E++SNGLA++  ++   S+L+   A  R+ LLS   G+       
Sbjct  175  GDTGEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLLLSGKIGYGGDPTDY  234

Query  470  ---NFPAF-IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIK  303
                 P F +D+  RRLL+A   S+KPN VVA+DGSG+F +I+ AI   PP N+  +VI 
Sbjct  235  APGEEPHFNLDSNRRRLLSAT--SLKPNAVVAQDGSGQFNTISAAIASVPPKNNQTFVIH  292

Query  302  IKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARD  123
            +KAGVY EYV +PK +N +V IGDGP KT+I+  KN  +G+ TY TATVA+  + F A+D
Sbjct  293  VKAGVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVAVNADDFLAKD  352

Query  122  IGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            IGFEN+AGA  HQAVALRVS D A+F N  IDGYQDTLYA
Sbjct  353  IGFENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTLYA  392



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 152/223 (68%), Gaps = 17/223 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL-----EAKKRRRLLSDNDGFN----  468
            GD  EKMK LLKT  E+TSNGLA++T ++    ++          RRLLS+ND       
Sbjct  173  GDATEKMKELLKTGMEMTSNGLAMVTGISSVLQSIGGLGSYTTTSRRLLSNNDIIQIIGN  232

Query  467  ----FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDA----INKAPPNNDAPY  312
                 P +ID+  R LL ++   IKPN+VVAKDGSG + ++N+A    +N     N+  +
Sbjct  233  SDDEMPGWIDSNRRNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTF  292

Query  311  VIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFT  132
            V+ IK GVY E VVV  ++ +++F+GDGPTKTKIT   N +DG  TYQTATVAI+G+HF 
Sbjct  293  VLYIKEGVYEEKVVVNSSLTNLMFLGDGPTKTKITGRLNFIDGTNTYQTATVAIQGDHFI  352

Query  131  ARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            ARDIGFENSAGA+KHQAVALRVSAD  IF NC +DGYQDTLYA
Sbjct  353  ARDIGFENSAGAEKHQAVALRVSADMVIFYNCQMDGYQDTLYA  395



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 143/204 (70%), Gaps = 9/204 (4%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDATARRLL  429
            MK LL     ++SN LAI+T+L +  +     K   RRLL D++    P+++D    RLL
Sbjct  1    MKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ--HRLL  55

Query  428  NANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNM  255
            N NA   K  PNV VA DGSG+FKSIN+A+ + P  N  P+VI IK GVY EYV V K M
Sbjct  56   NENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKM  115

Query  254  NHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVA  75
             HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  KHQAVA
Sbjct  116  THVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVA  175

Query  74   LRVSADHAIFSNCAIDGYQDTLYA  3
            LRV AD +IF NC++DGYQDTLYA
Sbjct  176  LRVQADKSIFYNCSMDGYQDTLYA  199



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 150/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT NGLA++T ++     ++  +   RRLLS      FP+++D 
Sbjct  120  GDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQE----FPSWMDG  175

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLLN+    +K ++VVA+DGSG++K+IN+A+N  P   +  +V+ IK G+Y EYV V
Sbjct  176  RTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQV  235

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G+HF A+++GFEN+AGA KH
Sbjct  236  NRSMTHLVFIGDGPDKTVISGDKNYKDGITTYRTATVAIVGDHFIAKNMGFENTAGAIKH  295

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  296  QAVAIRVLSDESIFYNCRFDGYQDTLYA  323



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 146/213 (69%), Gaps = 8/213 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA-KKRRRLLSDNDGFN-------F  465
            G+ GEKMK  LKTA ELTSNGLA+++ ++    +L +   RRRLL  + G          
Sbjct  175  GEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGSLNSNSHRRRLLGSSSGGQSKRVYKPL  234

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P++I A    LL A   S+KPNVVVA+DG+G++KSI +A+ + P  +  P+VI IK GVY
Sbjct  235  PSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKEGVY  294

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             EYV+V K M +VV IGDGPTKT+I+ +KN  DG  T  TAT A  G++F A+ IGFEN+
Sbjct  295  KEYVIVDKEMTNVVMIGDGPTKTRISGSKNYADGTATMYTATFAAVGDYFVAKGIGFENT  354

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            AGA KHQAVALRV +D +IF NC ID YQDTLY
Sbjct  355  AGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLY  387



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 155/211 (73%), Gaps = 9/211 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFN--------FPA  459
            GEKMK  LKTA E++SNGL I++ ++   + L+     RRLL D+            FPA
Sbjct  190  GEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVSRRLLQDDIPVAGHGDISQAFPA  249

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            +ID   RRLL+A   +IKP++VVAKDGSG++K+I +A+ + P  ++  +V+ IK G+Y E
Sbjct  250  WIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKEGIYEE  309

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            YV   ++M ++V IGDGP KT+IT +KN VDGI TY+TATVA+ G++F AR+IGFENSAG
Sbjct  310  YVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATVAVIGDNFVARNIGFENSAG  369

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            A KHQAVALRVS+D+A+F NC++DGYQDTLY
Sbjct  370  AIKHQAVALRVSSDYAVFYNCSMDGYQDTLY  400



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 152/208 (73%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G+ GE +K  LKTA +LT NGLA+++ ++     ++  +   RRLLS      FP+++D 
Sbjct  180  GNAGETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEMNSRRLLSQE----FPSWMDG  235

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             ARRLLNA    +K ++VVA+DGSG++K+IN+A+N  P   +  +V+ IKAG+Y EYV V
Sbjct  236  RARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIKAGIYKEYVQV  295

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDGP KT I+ +K+  DGI TY+TATVAI G+HF A++IGFEN+AGA KH
Sbjct  296  NRSMTHLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIGFENTAGAIKH  355

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  356  QAVAIRVLSDESIFYNCKFDGYQDTLYA  383



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 149/211 (71%), Gaps = 10/211 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDA  447
            GD  +KMKHLL ++  ++SN LAI++N  +  S +   K   RRLL D++    P++++ 
Sbjct  189  GDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSE---IPSWVEH  245

Query  446  TARRLLNA--NAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND-APYVIKIKAGVYNEY  276
              R LL+A  N    KPNV VA DGSG+FKSIN+A+ K P   D  P+VI IKAGVY EY
Sbjct  246  --RILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYREY  303

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            V V KNM H+VF+GDG  K+ IT NKN +DG+ TY T TVAI+G+HFTA ++GFENSAG 
Sbjct  304  VEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAINMGFENSAGP  363

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QKHQAVALRV  D  IF NC++DGYQDTLY 
Sbjct  364  QKHQAVALRVQGDKTIFFNCSMDGYQDTLYV  394



>gb|KHN20255.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=475

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 152/218 (70%), Gaps = 13/218 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFN--------  468
            + G KMK+LL ++  ++SN LAII+ + +  + +   K   R L+ D+ G          
Sbjct  74   EAGNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDGHRELVEDSRGGEHVFGHEEV  133

Query  467  FPAFID---ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIK  297
             P++++      RRLL+ +   +KPNVVVAKDGSG++KSIN A+ K P  N  P+VI IK
Sbjct  134  IPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYIK  193

Query  296  AGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIG  117
             GVY+EYV V K M HVVF+GDG +KT+IT NKN VDGI TY+TA+VAI G++F A +IG
Sbjct  194  EGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINIG  253

Query  116  FENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            FENSAG +KHQAVA+RV AD +IF  C++DGYQDTLYA
Sbjct  254  FENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYA  291



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 150/211 (71%), Gaps = 10/211 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDA  447
            GD  +KMKHLL ++  ++SN LAI++N  +  S +   K   RRLL D++    P++++ 
Sbjct  189  GDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSE---IPSWVEH  245

Query  446  TARRLLNA--NAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND-APYVIKIKAGVYNEY  276
              R LL+A  N    KPNV VA DGSG+FKSIN+A+ K P   D  P+VI IKAGVY EY
Sbjct  246  --RILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYREY  303

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            V V KNM H+VF+GDG  K+ IT NKN +DG+ TY T TVAI+G+HFTA ++GFENSAG 
Sbjct  304  VEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAINMGFENSAGP  363

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QKHQAVALRV  D AIF NC++DGYQDTLY 
Sbjct  364  QKHQAVALRVQGDKAIFFNCSMDGYQDTLYV  394



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 145/214 (68%), Gaps = 11/214 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--------AKKRRRLLSDNDGFNFP  462
            D  ++M  + KT+ ELTSNGLA+++ L+                   R+LLS  DGF  P
Sbjct  181  DLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGSYARKLLSTEDGF--P  238

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++   AR+L+ A    +KPN VVA DGSG+FKSIN A+   P  N  P+VI IK G+Y 
Sbjct  239  TWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYK  298

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENS  105
            E V V K M++V FIGDGPTKT+IT N N   G + TYQTATVA+ GEHFTA+DIGFEN+
Sbjct  299  EKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQTATVAVNGEHFTAKDIGFENT  358

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG + HQAVALRVSAD+A+F NC IDGYQDTLYA
Sbjct  359  AGPKGHQAVALRVSADYAVFHNCQIDGYQDTLYA  392



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            D G+KMK LL     ++SN LAI+T L +  +     K   RRLL D++    P+++D  
Sbjct  184  DAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLLQDSE---LPSWVDQ-  239

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA   K  PNV VA D SG+FKSIN+A+ + P  N  P+VI IK GVY EYV 
Sbjct  240  -HRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVE  298

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVFIG+G  KT+I+ NKN +DG  TY+TATVAI+G+HF A ++GFENSAG  K
Sbjct  299  VTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHK  358

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLYA
Sbjct  359  HQAVALRVQADKSIFYNCSMDGYQDTLYA  387



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 145/212 (68%), Gaps = 9/212 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDND-------GFNFPAFI  453
            GEKMK +L+TA  ++SNGL+II  L++  + ++   RR L  D +        F FP ++
Sbjct  185  GEKMKEILQTAMHMSSNGLSIINELSKTFTEMKPAGRRLLKDDGELHVVGRGDFEFPEWV  244

Query  452  D--ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            D     R+LL      ++ +VVVAKDG+G F +IN+A+   P  N  P+VI IK G+YNE
Sbjct  245  DDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALKHVPKKNLRPFVIYIKEGIYNE  304

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            YV V +NM HVVFIGDG  K++IT NKN +DG+GTY+TATVAI G+ F    IGFENSAG
Sbjct  305  YVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGVGTYRTATVAILGDFFVGIGIGFENSAG  364

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             +KHQAVALRV AD +IF  C +DGYQDTLYA
Sbjct  365  PEKHQAVALRVQADRSIFYKCRMDGYQDTLYA  396



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 153/221 (69%), Gaps = 18/221 (8%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR----RRLLSDN-DGFNF------  465
            G KMK+LLK+   ++SN LAII+ L +    +    +    R+L+ D+ D   F      
Sbjct  163  GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVI  222

Query  464  PAFID-------ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVI  306
            P++++          RRLL+ +A  IKPNVVVAKDGSG++KSIN A+ K P  N  P+VI
Sbjct  223  PSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVI  282

Query  305  KIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTAR  126
             IK GVY+EYV V K M HVVF+GDG  KT+IT NKN VDG+ TY+TA+VA+EG++F A 
Sbjct  283  YIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGDYFVAV  342

Query  125  DIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            +IGFENSAG +KHQAVA+RV AD +IF  C++DGYQDTLYA
Sbjct  343  NIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYA  383



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 150/223 (67%), Gaps = 18/223 (8%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR-RRLLSD-------------N  480
            D  +KMK++L T+  ++SN LA+I++L +    L A    RRL+ D             +
Sbjct  181  DASKKMKNILTTSMHMSSNALAVISDLADNVLDLNATTDGRRLIDDYKGEYVGEQVVAKD  240

Query  479  DGFNFPAFI----DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPY  312
            D  + P+++        RRLL+ N   +K NVVVAKDGSG+FK INDA+ + P  N  P+
Sbjct  241  DVNDVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKINDALKQVPKKNQKPF  300

Query  311  VIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFT  132
            VI IK GVY+EYV V K M HVVF+GDG  KT+IT NKN +DGI TYQT TVAIEG++F 
Sbjct  301  VIHIKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGINTYQTPTVAIEGDNFV  360

Query  131  ARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            A +IGFENSAG QKHQAVA+RV AD AIF  C++DGYQDTLY 
Sbjct  361  AINIGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYV  403



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 153/221 (69%), Gaps = 18/221 (8%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR----RRLLSDN-DGFNF------  465
            G KMK+LLK+   ++SN LAII+ L +    +    +    R+L+ D+ D   F      
Sbjct  186  GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVI  245

Query  464  PAFID-------ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVI  306
            P++++          RRLL+ +A  IKPNVVVAKDGSG++KSIN A+ K P  N  P+VI
Sbjct  246  PSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVI  305

Query  305  KIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTAR  126
             IK GVY+EYV V K M HVVF+GDG  KT+IT NKN VDG+ TY+TA+VA+EG++F A 
Sbjct  306  YIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGDYFVAV  365

Query  125  DIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            +IGFENSAG +KHQAVA+RV AD +IF  C++DGYQDTLYA
Sbjct  366  NIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYA  406



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 151/213 (71%), Gaps = 10/213 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-------RRRLLSDNDGFNFP  462
            G+ G+KM+ LLKT+ ELTSNGLA+++ ++     L  +        +RRL ++N    FP
Sbjct  295  GEAGKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRRLFAEN---GFP  351

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++ +  R  +     +IKPNVVVAKDGSG++ SIN+A+ + P +N   +VI IKAGVY 
Sbjct  352  MWVSSEQRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKDNPTTFVIYIKAGVYK  411

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E V+V K+M +V+FIGDG TKTKIT + N  DG GT++TATV + G+ F A+DIGFEN+A
Sbjct  412  EQVIVTKSMTNVMFIGDGRTKTKITGDLNYADGTGTFRTATVGVVGDGFIAKDIGFENTA  471

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            GA KHQAVALRV +D +IF NC +DGYQDTLYA
Sbjct  472  GAIKHQAVALRVQSDQSIFYNCQMDGYQDTLYA  504



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 151/215 (70%), Gaps = 11/215 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGF-------NFP  462
            D GEKMK  +K A E+++NGL II  L+ A + L+     RRLL +++          FP
Sbjct  185  DAGEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVNRRLLQEDEVLGHDDVPSKFP  244

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSIN---DAINKAPPNNDAPYVIKIKAG  291
            +++DA  RRLL A    IKPN+ VAKDGSG+FK+I    D+I K    +   +V+ IKAG
Sbjct  245  SWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFVLYIKAG  304

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VY EYV   K+M++++ IGDGP KT+IT NKN VDG+ TY TATV + G++F A++IGFE
Sbjct  305  VYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGVNTYHTATVVVLGDNFIAKNIGFE  364

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            NSAGA KHQAVALRVSAD A+F NCA+DGYQDTLY
Sbjct  365  NSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLY  399



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 147/214 (69%), Gaps = 9/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFN--------  468
            G+ GEKMK  LKTA ELTSNGLA+++ ++    ++ +   RRRLL  + G          
Sbjct  175  GEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGSVNSNTHRRRLLGSSSGDQKSKRVYKP  234

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
             P++I A    LL A   S+KPNVVVA+DG+G++KSI +A+ + P  +  P+VI IK GV
Sbjct  235  LPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKEGV  294

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            Y EYV+V K+M +VV IGDGPTKT+I+ +KN  DG  T  TAT A  G++F A+ IGFEN
Sbjct  295  YKEYVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTTTMYTATFAAVGDYFVAKGIGFEN  354

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AGA KHQAVALRV +D +IF NC ID YQDTLY
Sbjct  355  TAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLY  388



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 149/211 (71%), Gaps = 13/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + MK++ KT+ ELTSN LA+IT         N+TE    L     R+LLS  +G   P++
Sbjct  180  QDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDL-GNYARKLLSTEEGI--PSW  236

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
            +    RRL+ A  G +K NVVVA+DGSG++KSI++A+   P NN  P+VI IK G+Y E 
Sbjct  237  VGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALKAVPQNNRWPFVIYIKQGIYKEN  296

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            V V K M HV FIGDGPT+TKIT N N ++  + TYQTATVAI G++FTA++IGFEN+AG
Sbjct  297  VDVTKKMTHVTFIGDGPTRTKITGNLNFRIGKVKTYQTATVAINGDNFTAKNIGFENTAG  356

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             + HQAVALRVSAD+A+F NC +DGYQDTLY
Sbjct  357  PEGHQAVALRVSADYAVFHNCQMDGYQDTLY  387



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 150/208 (72%), Gaps = 10/208 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK++L+TA +++SNGLA+++N++   ++L+  +   R+LLS+ +      FI  
Sbjct  166  GDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSTASRKLLSEEEA---DLFISI  222

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRL+      ++PN VVA+DGSG+FK+I+ AI   P  N+ P+VI +KAGVY EYV +
Sbjct  223  KQRRLMG-----LQPNAVVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAGVYKEYVEI  277

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK +N +V IGDGP KT+I+  KN  +G+ T+ TATV++  + F A+DIGFEN+AG Q H
Sbjct  278  PKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAGPQGH  337

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D AIF N  IDGYQDTLYA
Sbjct  338  QAVALRVSGDRAIFHNVHIDGYQDTLYA  365



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 152/214 (71%), Gaps = 16/214 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTE--------AASTLEAKKRRRLLSDNDGFNF  465
            GDT EKMK+LLKTA EL+SN LA++++++               A   RRL+S+ +    
Sbjct  157  GDTAEKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGASSGRRLMSEEEE---  213

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P +   T  RLL AN   +KPN VVA+DGSG+FK+I +AIN  P  N+  ++I IKAG+Y
Sbjct  214  PYW---TKGRLLAAN--PLKPNAVVAQDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGLY  268

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             E+V +PK +N VVFIGDGP KT+IT +K+   G+ T+QTATVA+ GE FTA++I FEN+
Sbjct  269  KEHVEIPKKVNKVVFIGDGPFKTRITGSKSFAGGVKTFQTATVAVNGEEFTAKNIAFENT  328

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AGA+ HQAVALRVSAD AIF N AIDGYQDTLYA
Sbjct  329  AGAEGHQAVALRVSADKAIFQNVAIDGYQDTLYA  362



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 149/208 (72%), Gaps = 10/208 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK++L+TA +++SNGLA+++N++   ++L+  +   R+LLS+ +      FI  
Sbjct  166  GDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA---DLFISM  222

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              R L+      ++PN VVA+DGSG+FK+I+ AI   P  N+ P+VI +KAGVY EYV +
Sbjct  223  KQRSLMG-----LQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEI  277

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK +N +V IGDGP KT+I+  KN  +G+ TY TATV++  + F A+DIGFEN+AG Q H
Sbjct  278  PKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVSVNADEFFAKDIGFENTAGPQGH  337

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D AIF N  IDGYQDTLYA
Sbjct  338  QAVALRVSGDRAIFHNVHIDGYQDTLYA  365



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 149/209 (71%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL++     FP+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEG----FPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL A A    +KP++VVA+DGSG++K+IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K M+H+VFIGDGP KT I+ NKN  DGI TY+TATVAI G +F A++IGFEN+AGA 
Sbjct  298  QVNKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVA+RV +D +IF NC  DGYQDTLY
Sbjct  358  KHQAVAVRVQSDESIFFNCRFDGYQDTLY  386



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 152/218 (70%), Gaps = 13/218 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFN--------  468
            + G KMK+LL ++  ++SN LAII+ + +  + +   K   R L+ D+ G          
Sbjct  184  EAGNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDGHRELVEDSRGGEHVFGHEEV  243

Query  467  FPAFID---ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIK  297
             P++++      RRLL+ +   +KPNVVVAKDGSG++KSIN A+ K P  N  P+VI IK
Sbjct  244  IPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYIK  303

Query  296  AGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIG  117
             GVY+EYV V K M HVVF+GDG +KT+IT NKN VDGI TY+TA+VAI G++F A +IG
Sbjct  304  EGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINIG  363

Query  116  FENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            FENSAG +KHQAVA+RV AD +IF  C++DGYQDTLYA
Sbjct  364  FENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYA  401



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 147/216 (68%), Gaps = 14/216 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNF  465
            D  + M  + KT+ ELTSNGLA+++         N+TE    L     R+LLS  DGF  
Sbjct  181  DLAQDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDL-GSYARKLLSTEDGF--  237

Query  464  PAFIDATARRLLNANAG-SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
            P ++    R+L+ A  G  +KPN VVA DGSG+FKSINDA+   P NN  P+VI IK G+
Sbjct  238  PTWMRPETRKLMAAVTGPKVKPNAVVALDGSGQFKSINDALKTVPKNNKFPFVIYIKQGI  297

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFE  111
            Y E V V K M +V FIGDGPTKT +T N N  +  + TYQTATVA+ GE+FTA+DIGFE
Sbjct  298  YKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNFGIGNVKTYQTATVAVNGENFTAKDIGFE  357

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            N+AG + HQAVALRVSAD+A+F NC IDGYQDTLYA
Sbjct  358  NTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTLYA  393



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 150/212 (71%), Gaps = 10/212 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLS----DNDGFNFPA  459
            G+  EKMK  LKT+ +L+SNGLA+++  +   + L+     RRRLL      +D  ++P 
Sbjct  185  GNAAEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGISRRRLLEIPVLGHD--DYPD  242

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPN-NDAPYVIKIKAGVYN  282
            + +   RRLL A +  +KPNVVVAKDGSG+F++I  A+++ P   N+A YVI IKAGVY 
Sbjct  243  WANPGMRRLLAAGS-RVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQ  301

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            EY+ + K + H++ IGDGP KT IT NKN VDG  T++TATVA+  EHF ARDIGFEN+A
Sbjct  302  EYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAVTAEHFMARDIGFENTA  361

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G QKHQAVALRV AD A+F NC + GYQDTLY
Sbjct  362  GPQKHQAVALRVQADKAVFYNCEMHGYQDTLY  393



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 147/207 (71%), Gaps = 5/207 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA +LT NGLAI+T +++    ++      RRLLS N    +P+++DA
Sbjct  185  GNAGETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLNSRRLLSSN---GYPSWVDA  241

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             ARRLL A    +KP++VVA+DGSG++ +IN+A+   P   +  +V+ IKAGVY EY+ V
Sbjct  242  RARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIKAGVYKEYIQV  301

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K+M  +VFIGDGP KT I+ +K   DGI TY+T TVAI G+ F A+DIGFEN+AGA KH
Sbjct  302  NKSMTDLVFIGDGPDKTIISGDKGFKDGITTYRTQTVAIVGDRFIAKDIGFENTAGAIKH  361

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QAVA+RV +D ++F NC  DGYQDTLY
Sbjct  362  QAVAVRVQSDMSVFYNCRFDGYQDTLY  388



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 150/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT NGLA++T ++     ++  +   RRLLS      FP+++D 
Sbjct  183  GDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPELNSRRLLSQE----FPSWMDG  238

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             AR+LL A    +KP++VVA+DGSG++ +IN+A+N  P   +  +V+ IKAG+Y E+V V
Sbjct  239  RARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIKAGIYKEFVQV  298

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDGP KT I+ +K+  DGI TY+T TVAI G+HF A+++GFEN+AGA KH
Sbjct  299  NRSMTHLVFIGDGPDKTVISGSKSFKDGITTYRTTTVAIVGDHFIAKNMGFENTAGAIKH  358

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  359  QAVAIRVLSDESIFYNCRFDGYQDTLYA  386



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 149/208 (72%), Gaps = 10/208 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK++L+TA +++SNGLA+++N++   ++L+  +   R+LLS+ +      FI  
Sbjct  166  GDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA---DLFISM  222

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              R L+      ++PN VVA+DGSG+FK+I+ AI   P  N+ P+VI +KAGVY EYV +
Sbjct  223  KQRSLM-----GLQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEI  277

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK +N +V IGDGP KT+I+  KN  +G+ T+ TATV++  + F A+DIGFEN+AG Q H
Sbjct  278  PKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAGPQGH  337

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D AIF N  IDGYQDTLYA
Sbjct  338  QAVALRVSGDRAIFHNVHIDGYQDTLYA  365



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 149/208 (72%), Gaps = 10/208 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK++L+TA +++SNGLA+++N++   ++L+  +   R+LLS+ +      FI  
Sbjct  166  GDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA---DLFISM  222

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              R L+      ++PN VVA+DGSG+FK+I+ AI   P  N+ P+VI +KAGVY EYV +
Sbjct  223  KQRSLMG-----LQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEI  277

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK +N +V IGDGP KT+I+  KN  +G+ T+ TATV++  + F A+DIGFEN+AG Q H
Sbjct  278  PKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAGPQGH  337

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRVS D AIF N  IDGYQDTLYA
Sbjct  338  QAVALRVSGDRAIFHNVHIDGYQDTLYA  365



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 148/209 (71%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL++     FP+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEG----FPSWLDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL A A    +KP++VVA+DGSG++ +IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTFVVHIKAGLYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ NKN  DGI TY+TATVAI G +F A++IGFEN+AGA 
Sbjct  298  QVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D +IF NC  DGYQDTLY
Sbjct  358  KHQAVALRVQSDESIFFNCRFDGYQDTLY  386



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 151/213 (71%), Gaps = 8/213 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-AKKRRRLLSDN--DGFN-----F  465
            GD GEKM+ +LKT+ EL+SNGLAI+  ++   S L+ A   RRLLSD+  D  N     F
Sbjct  183  GDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLSDDPADPDNHIDDEF  242

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P +  +  R+LL AN   +KPN+ VAKDGSG+FK+IN+AI + P  ++  +++ IK G+Y
Sbjct  243  PYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIY  302

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             E V + K   +++ +GDGPTKTKIT + N VDG  T++TATVA+ G+ F A+ IGFENS
Sbjct  303  EEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENS  362

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            AGA KHQAVALRV +D +IF NC +DGYQDTLY
Sbjct  363  AGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLY  395



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 149/210 (71%), Gaps = 10/210 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            + G+KMK LL ++  ++SN LAIIT+  +  S +   K   RRLL D   +  P++++  
Sbjct  185  EAGKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKIVGRRLLQD---YKTPSWVEH-  240

Query  443  ARRLLNANAGSIK--PNVVVAKDGSGEFKSINDAINKAP-PNNDAPYVIKIKAGVYNEYV  273
             R+LL+A   + K  PNV VA DGSG+FKSIN+A+ K P   +  P+VI IKAGVY EYV
Sbjct  241  -RKLLDAKTNAFKHTPNVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKAGVYREYV  299

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V  NM H+VF+GDG  K+ IT NKN +DG+ TY TATVAI+G+HFTA ++GFENSAG Q
Sbjct  300  EVLTNMTHIVFVGDGGKKSIITGNKNFMDGVTTYHTATVAIQGDHFTAINMGFENSAGPQ  359

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVALRV  D AIF NC++DGYQDTLY 
Sbjct  360  KHQAVALRVQGDKAIFYNCSMDGYQDTLYV  389



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 146/209 (70%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL+D      P+++D 
Sbjct  183  GNAGETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLNSRRLLADE----VPSWVDQ  238

Query  446  TARRLLNANA--GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A A     K ++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  239  RGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVHIKAGIYKEYV  298

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V ++M H+VFIGDGP KT I+ NKN  DGI TY+TATVAI G+HF A++IGFEN+AGA 
Sbjct  299  QVNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIVGDHFIAKNIGFENTAGAI  358

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVA+RV +D AIF NC  DGYQDTLY
Sbjct  359  KHQAVAVRVQSDEAIFFNCRFDGYQDTLY  387



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 150/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE MK  LKTA +LT NGLA+++ +      +E  +   RRLLS      FP+++D 
Sbjct  180  GDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQE----FPSWVDG  235

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLLNA    +KP++VVA+DGSG++K+IN+A+   P  N+A +V+ IK+G Y EYV V
Sbjct  236  RVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQV  295

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             + M ++VFIGDGPTK+ I+ NK+  DGI TY+TATVAI G++F A+++GFEN+AGA  +
Sbjct  296  NRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALNY  355

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  356  QAVAVRVLSDESIFYNCRFDGYQDTLYA  383



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 147/213 (69%), Gaps = 8/213 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDN----DGFNFPAF  456
            D   KM+ LL++A  ++SNGL+IIT L++  S +   K  RRRLL++N    D F+ P +
Sbjct  182  DASLKMQRLLQSAMHMSSNGLSIITELSKTLSEMHIGKPGRRRLLNNNVLGHDYFDLPEW  241

Query  455  ID--ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
            +D     R+LL+        +VVVAKDGSG F +IN+A+   P  N  P+VI +K GVYN
Sbjct  242  VDDQVGVRKLLHMTGRKRMAHVVVAKDGSGNFTTINEALKHVPKKNLRPFVIYVKEGVYN  301

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            EYV V KNM HVV IGDG  K++IT NKN VDG+GT++TA+ AI G+ F    +GFENSA
Sbjct  302  EYVEVSKNMTHVVMIGDGGKKSRITGNKNFVDGVGTFRTASAAILGDFFVGIGMGFENSA  361

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            GA+KHQAVALRV AD +IF  C +DGYQDTLYA
Sbjct  362  GAEKHQAVALRVQADRSIFYKCRMDGYQDTLYA  394



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GD G +M+  LK+A E+T+NGL I+  L+    +L+      RRLL D+D    P++I  
Sbjct  190  GDAGTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMTGRRLLEDDD-HEMPSWISD  248

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRL+ A A  +KP+++VA+DGSG++K+IN A+   P  ++  +VI +KAG+Y E VV+
Sbjct  249  GKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKEIVVI  308

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK+M H+   GDGPTKT +T + N +DGI T++TAT +  G +F ARD+GFEN+AG+ KH
Sbjct  309  PKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAGSAKH  368

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D +IF NC IDGYQDTLYA
Sbjct  369  QAVALRVQSDRSIFYNCQIDGYQDTLYA  396



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTE--AASTLEAKKRRRLLSDNDGFNFP-AFID  450
            G+ G +MK +L+++ ELTSNGLA++T ++   A+  L     RRLLS  DG +   +++ 
Sbjct  188  GEAGLRMKAMLRSSQELTSNGLAMVTEISSILASYNLPFNVSRRLLSSEDGDDTELSWLS  247

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRLL A   +IK +VVVAKDGSG+++++N+A+   P   +  +VI IK GVY E V+
Sbjct  248  DGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKEQVM  307

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
              K+M HV+ IGDGPTKT+IT + N +DG+ T++TATV++ G +F A+DIGFENSAG QK
Sbjct  308  FAKSMTHVMIIGDGPTKTRITGSLNFIDGVQTFKTATVSVIGSNFIAKDIGFENSAGPQK  367

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV +D +IF NC +DGYQDTLYA
Sbjct  368  HQAVALRVQSDMSIFYNCHMDGYQDTLYA  396



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            GD G +M+  LK+A ++T+NGL I+  L+    +L+      RRLL D+D    P+++  
Sbjct  191  GDAGVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMSGRRLLEDDDR-EMPSWVSD  249

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRL+ A A ++KP++VVA+DGSG++K+IN A+   P  ++  +VI +KAG+Y E VV+
Sbjct  250  GKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVKAGIYKEIVVI  309

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            PK+M H+   GDGPTKT +T + N +DGI T++TAT +  G +F ARD+GFEN+AGA KH
Sbjct  310  PKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAGAAKH  369

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D +IF NC IDGYQDTLYA
Sbjct  370  QAVALRVQSDRSIFFNCQIDGYQDTLYA  397



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 10/211 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDA  447
            GD  +KMKHLL ++  ++SN LAI++N  +  S +   K   R LL D++    P++++ 
Sbjct  171  GDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRCLLQDSE---IPSWVEH  227

Query  446  TARRLLNA--NAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND-APYVIKIKAGVYNEY  276
              R LL+A  N    KPNV VA DGSG+FKSIN+A+ K P   D  P+VI IK GVY EY
Sbjct  228  --RILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYREY  285

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            V V KNM H+VF+GDG  K+ IT NKN +DG+ TY T TVAI+ +HFTA ++GFENSAG 
Sbjct  286  VEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSAGP  345

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QKHQAVALRV  D AIF NC++DGYQDTLY 
Sbjct  346  QKHQAVALRVQGDKAIFFNCSMDGYQDTLYV  376



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   221 bits (562),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 152/214 (71%), Gaps = 8/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA-KKRRRLLSDND-----GFNF-P  462
            G+ GEKMK  L  + +LTSN L++IT +++  ++L A   RRRLL D+      G    P
Sbjct  174  GEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLGHGIELLP  233

Query  461  AFIDATARRLLNAN-AGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
             +ID   RRLL  N +  IKP+VVVAKDGSG++K INDA+   P + +  YV+ IK GVY
Sbjct  234  DWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVY  293

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            NE V +   M+++V IGDGPTKT+IT N++  DGI TYQT+TVAI G++F A+DIGFEN+
Sbjct  294  NEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVAIMGDYFVAKDIGFENT  353

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG  KHQA+ALRV+AD +IF NC +DGYQDTL A
Sbjct  354  AGPDKHQALALRVAADKSIFYNCHVDGYQDTLCA  387



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 147/212 (69%), Gaps = 14/212 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M  + KT+ ELTSNGLA+IT         N+T     L     R+LLS  DG   P++
Sbjct  185  QDMHKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDL-GHYARKLLSTKDGI--PSW  241

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
            +    RRL+ A  G +KPNVVVA+DGSG++K+IN+A+N  P  N  P+VI IK GVYNE 
Sbjct  242  VGPNTRRLM-ATQGVVKPNVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQGVYNEK  300

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            V V K M HV FIGDGPTKTKIT + N  +  + TY TATVA+ G++FTA++IGFEN+AG
Sbjct  301  VNVTKKMTHVTFIGDGPTKTKITGSLNYHIGKVKTYHTATVAVNGDNFTAKNIGFENTAG  360

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             + HQAVALRVSAD+A+F NC IDGYQDTLY 
Sbjct  361  PEGHQAVALRVSADYAVFHNCQIDGYQDTLYV  392



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 148/212 (70%), Gaps = 6/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDN---DGFN-FPA  459
            GD GEKM+  L+T+ ELTSNGLA+I +++   ++LE  A   RRLLSD+    G +  P+
Sbjct  174  GDAGEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFTNRRLLSDDILGHGMDILPS  233

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            +ID   RRLL A    +KP+++VAKDGSG F +IN+A+     N +  +V+ IK GVY E
Sbjct  234  WIDEGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEKEFVLYIKEGVYEE  293

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
             V   KN+ H+  IGDGPTKT+IT   N +DG+ TY TATVA+ G+ F A+DIGFEN+AG
Sbjct  294  KVTFHKNLLHLTVIGDGPTKTRITGKLNFIDGVPTYHTATVAVLGDFFIAKDIGFENAAG  353

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             +KHQAVA+RV AD  IF NC  DG+QDTLYA
Sbjct  354  PEKHQAVAVRVGADKTIFYNCHFDGFQDTLYA  385



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 149/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE MK  LKTA +LT NGLA+++ +      +E  +   RRLLS      FP+++D 
Sbjct  180  GDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQE----FPSWVDG  235

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLLNA    +KP++VVA+DGSG++K+IN+A+   P  N+A +VI IK+G Y EYV V
Sbjct  236  RVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIKSGTYKEYVQV  295

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             + M ++VFIGDGP K+ I+ NK+  DGI TY+TATVAI G++F A+++GFEN+AGA  +
Sbjct  296  NRTMPNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALNY  355

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  356  QAVAVRVLSDESIFYNCRFDGYQDTLYA  383



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 143/214 (67%), Gaps = 11/214 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--------AKKRRRLLSDNDGFNFP  462
            D  ++M  + KT+ ELTSNGLA+++ L+                   R+LLS  DGF  P
Sbjct  181  DLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGSYARKLLSTEDGF--P  238

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++   AR+L+ A    +KPN VVA DGSG+FKSIN A+   P  N  P+VI IK G+Y 
Sbjct  239  TWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYK  298

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENS  105
            E V V K M++V FIGDGPTKT+IT N N   G + TYQTATVA+ GEHFTA+DIGFEN+
Sbjct  299  EKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQTATVAVNGEHFTAKDIGFENT  358

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG + HQAVALRVSAD+A+F NC IDGY D+ YA
Sbjct  359  AGPKGHQAVALRVSADYAVFHNCQIDGYVDSFYA  392



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNF---PAFID  450
            G+ G+KMK  LKTA ELTSNGLA++T ++    +L     RRLLS +   N+   P+++ 
Sbjct  175  GEAGDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNLNSHRRLLSAHSKRNYQAVPSWMG  234

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
            A   +LL A   S+KPNVVVA+DGSG++K+I +A+ + P  ++  +VI IK GVY E ++
Sbjct  235  ARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKEGVYKEEII  294

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            + + M +V  IGDGPTKTKI+ +KNK DG  T  TAT A  G++F A+DI FEN+AG  K
Sbjct  295  IDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGDYFVAKDIRFENTAGHIK  354

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV +D +IF NC +D YQDTLY
Sbjct  355  HQAVALRVQSDFSIFYNCHMDAYQDTLY  382



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 145/211 (69%), Gaps = 12/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLEA--------KKRRRLLSDNDGFNFPAFI  453
            + M+ + KT+ ELTSNGLA+ITN++                K  R+LLS  DG   P+++
Sbjct  185  QDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLGKYARKLLSAEDGI--PSWV  242

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
                RRL+ A  G +K NVVVA DGSG++K+IN+A+N  P  N  P+VI IK GVYNE V
Sbjct  243  GPNTRRLM-ATKGGVKANVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGVYNEKV  301

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGA  96
             V K M HV FIGDGPTKTKIT + N   G + TY TATVAI G++FTA++IGFEN+AG 
Sbjct  302  DVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYLTATVAINGDNFTAKNIGFENTAGP  361

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            + HQAVALRVSAD A+F NC IDGYQDTLY 
Sbjct  362  EGHQAVALRVSADLAVFYNCQIDGYQDTLYV  392



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 148/209 (71%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL++     FP+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEG----FPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL A A    +KP++VVA+DGSG++K+IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K M+H+VFIGDGP KT I+ NKN  DGI  Y+TATVAI G +F A++IGFEN+AGA 
Sbjct  298  QVNKTMSHLVFIGDGPDKTIISGNKNYKDGITAYRTATVAIVGNYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVA+RV +D +IF NC  DGYQ+TLY
Sbjct  358  KHQAVAVRVQSDESIFFNCRFDGYQNTLY  386



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDG-------FNF  465
            D G+KM+ LL+TA  ++SNGL+II  L++  S +   +  RRRLL++ D        F+ 
Sbjct  160  DAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPGRRRLLNNVDDLPVLGHDFDL  219

Query  464  PAFID--ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
            P ++D     R+LL         +VVVAKDGSG F +IN+A+   P  N  P+VI +K G
Sbjct  220  PEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYVPKKNLRPFVIYVKEG  279

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VYNEYV V KNM HVV IGDG  K++IT +KN +DG+GTY+TA+ AI G+ F    +GFE
Sbjct  280  VYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASAAILGDFFVGIGMGFE  339

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            NSAGA+KHQAVALRV AD +IF  C +DGYQDTLYA
Sbjct  340  NSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYA  375



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 151/213 (71%), Gaps = 8/213 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-AKKRRRLLSDN--DGFN-----F  465
            GD GEKM+ +LKT+ EL+SNGLAI+  ++   S L+ A   RRLLSD+  D  N     F
Sbjct  183  GDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLSDDPADPDNHIDDEF  242

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P +  +  R+LL AN   +KPN+ VAKDGSG+FK+IN+AI + P  ++  +++ IK G+Y
Sbjct  243  PYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIY  302

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             E V + K   +++ +GDGPTKTKIT + N VDG  T++TATVA+ G+ F A+ IGFENS
Sbjct  303  EEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENS  362

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            AGA KHQAVALRV +D +IF NC +DGYQDTLY
Sbjct  363  AGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLY  395



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 10/211 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDA  447
            GD  +KMKHLL ++  ++SN LAI++N  +  S +   K   R LL D++    P++++ 
Sbjct  171  GDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRCLLQDSE---IPSWVEH  227

Query  446  TARRLLNA--NAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND-APYVIKIKAGVYNEY  276
              R LL+A  N    KPNV VA DGSG+FKSIN+A+ K P   D  P+VI IK GVY EY
Sbjct  228  --RILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYREY  285

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            V V KNM H+VF+GDG  K+ IT NKN +DG+ TY T TVAI+ +HFTA ++GFENSAG 
Sbjct  286  VEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSAGP  345

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QKHQAVALRV  D AIF NC++DGYQDTLY 
Sbjct  346  QKHQAVALRVQGDKAIFFNCSMDGYQDTLYV  376



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 147/209 (70%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ L+     ++  +   RRLLS+      P+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLSEG----IPSWVDQ  237

Query  446  TARRLLN--ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL   A     KP++VVA+DGSG++ +IN+A+   P   +  +V+ IKAG+YNEYV
Sbjct  238  RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIYNEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ NK+  DGI TY+T TVAI G++F A++IGFEN+AGA 
Sbjct  298  QVNKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D AIF NC  DGYQDTLY
Sbjct  358  KHQAVALRVQSDEAIFFNCRFDGYQDTLY  386



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 11/209 (5%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLT----EAASTL---EAKKRRRLLSDNDGFNFPAFID  450
            + M  + +T+ ELTSN LA+IT+++    E  + L        R+LLS  DG   P+++ 
Sbjct  185  QDMHKIFETSKELTSNALAMITSISSFLGEHITGLIGDHGNHARKLLSTEDGI--PSWVG  242

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRL+ A  G +KP+VVVA+DGSG++K+IN+A++  P  N  P+VI IK GVYNE V 
Sbjct  243  PNTRRLM-AEQGVVKPDVVVAQDGSGQYKTINEALSVVPKANQKPFVIYIKQGVYNEKVD  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            VPK M HV FIGDGPTKTKIT + N   G + TY TATVAI G++FTA++IGFEN+AG +
Sbjct  302  VPKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTAKNIGFENTAGPE  361

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             HQAVALRVSAD+A+F NC IDGYQDTLY
Sbjct  362  GHQAVALRVSADYAVFHNCQIDGYQDTLY  390



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 144/211 (68%), Gaps = 12/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLE--------AKKRRRLLSDNDGFNFPAFI  453
            + M  + KT+ ELTSNGLA+ITN++                   R+LLS  DG   P+++
Sbjct  186  QDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDLGNYARKLLSTEDGI--PSWV  243

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
                R+L+ A  G +K NVVVA+DGSG++K+IN+A+N  P  N  P+VI IK GVYNE V
Sbjct  244  GPNTRQLM-ATKGGVKANVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQGVYNEKV  302

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGA  96
             V K M HV FIGDGPTKTKIT + N   G + TY TATVAI G+HFTA++IGFEN+AG 
Sbjct  303  DVTKKMTHVTFIGDGPTKTKITGSLNFYIGKVKTYHTATVAINGDHFTAKNIGFENTAGP  362

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            + HQAVALRVS D+A+F NC IDGYQDTLY 
Sbjct  363  EGHQAVALRVSGDYAVFYNCQIDGYQDTLYV  393



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDG-------FNF  465
            D G+KM+ LL+TA  ++SNGL+II  L++  S +   +  RRRLL++ D        F+ 
Sbjct  181  DAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPGRRRLLNNVDDLPVLGHDFDL  240

Query  464  PAFID--ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
            P ++D     R+LL         +VVVAKDGSG F +IN+A+   P  N  P+VI +K G
Sbjct  241  PEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYVPKKNLRPFVIYVKEG  300

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VYNEYV V KNM HVV IGDG  K++IT +KN +DG+GTY+TA+ AI G+ F    +GFE
Sbjct  301  VYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASAAILGDFFVGIGMGFE  360

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            NSAGA+KHQAVALRV AD +IF  C +DGYQDTLYA
Sbjct  361  NSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYA  396



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 148/208 (71%), Gaps = 4/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAAST--LEAKKRRRLLSD-NDGFNFPAFID  450
            GDTGEKM  LLKT+ ELTSNGL +++ +    ++  L A  RR L  + N     P+++ 
Sbjct  182  GDTGEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVGRRLLTEESNQQEEEPSWV-  240

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               R LL A   ++K +VVVAKDGSG++K++ +A+N  P  ++  +VI +KAGVY E V+
Sbjct  241  GDRRGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGVYQEQVM  300

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K+M  V+ IGDGPTKTKIT  KN VDG  T++TATV++ G +F A+DIGFENSAGA K
Sbjct  301  VDKSMTWVMMIGDGPTKTKITAGKNYVDGTPTFKTATVSVIGSNFIAKDIGFENSAGAAK  360

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  361  HQAVALRVQSDMSIFYNCQMDGYQDTLY  388



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 146/209 (70%), Gaps = 5/209 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK---RRRLLSDNDGFNFPAFID  450
            G  G+KMK +L T+ +LTSNGLA++T L+     L+      R+ L   ND  NFP+++ 
Sbjct  192  GPAGQKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLAQGND--NFPSWLS  249

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRLL     +IKPN+VVA+DGSG++K+IN+AI   P + ++ +V+ IK GVY E V 
Sbjct  250  PAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVVT  309

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
              +++ H++ IGDGPTKTKIT + +   G+  Y+TATV++ G HF A+DIGFENSAGA  
Sbjct  310  FSRSLTHIMLIGDGPTKTKITGDLSFAGGVQIYKTATVSVSGSHFMAKDIGFENSAGATG  369

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQA+AL+V +D ++F NC IDGYQ+TL++
Sbjct  370  HQAIALKVQSDMSVFYNCQIDGYQNTLFS  398



>ref|XP_007149854.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
 gb|ESW21848.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
Length=460

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDN--DGFNFPAFIDAT  444
            + G+KMK LL    E++SN LAI+T   E A T+       LL      G   P++ D  
Sbjct  63   EAGKKMKDLLMIGMEMSSNVLAIVT---ELADTITNSNVTNLLGHRHLQGSESPSWNDH-  118

Query  443  ARRLLNANAGSI--KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              RLLN NA  +  KPNV VAKDG+G+FK+IN+A+ + P  N  P+VI IK G+Y EYV 
Sbjct  119  -HRLLNENASLVNHKPNVTVAKDGNGDFKNINEALKQVPEKNKRPFVIYIKEGIYQEYVQ  177

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K+M HVVFIGDG  KT+IT NKN +DGI TY+T+T+AI+G++F A ++GFEN AG QK
Sbjct  178  VTKDMTHVVFIGDGGKKTRITGNKNFIDGINTYKTSTIAIQGDYFVAINMGFENFAGPQK  237

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD +IF NC++DGYQDTLY 
Sbjct  238  HQAVALRVQADKSIFYNCSMDGYQDTLYV  266



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 141/208 (68%), Gaps = 14/208 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK +LKTA EL+S  L I+++  E  + L+      RRLL            +A
Sbjct  175  GDTGEKMKSILKTASELSSVALDIVSSFEEQMAGLQGLGIANRRLL----------VAEA  224

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL     ++KPNVVVA+DGSG+ KSIN+A+   PPNN  PYVI IKAG+YNE V V
Sbjct  225  GNRRLLQI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENVEV  282

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
               M +VVFIG+G  KTKIT NKN +DG+  + TATV+I G+ F A+DIGFENSAG  K 
Sbjct  283  ANTMTNVVFIGEGSNKTKITGNKNYLDGLPIFLTATVSISGQGFMAKDIGFENSAGPLKK  342

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            +AVALRVSA+  +F NC IDGYQ TL A
Sbjct  343  EAVALRVSAEMIVFQNCQIDGYQSTLMA  370



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 150/212 (71%), Gaps = 7/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN------FPA  459
            G+ G KMK+ LKT+ ELT N LA+ T +     T   K +RRLL+D            P+
Sbjct  178  GEAGAKMKNFLKTSQELTKNALAMATEIGNLFRTSSLKSQRRLLADTPMDPKKAPKIIPS  237

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNND-APYVIKIKAGVYN  282
            +I+     +  AN  S+KP+V+VAKDGSG++K++N+A+   P +N    +VI IK GVY+
Sbjct  238  WIEGRKLDIATANPISLKPDVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGVYS  297

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E VV+ K+M +V+FIGDGPTKTKIT NKN  DG+ T++TATVA+ G++F A+DIGFEN+A
Sbjct  298  EQVVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQTFKTATVAVIGDYFIAKDIGFENTA  357

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            GA+ HQAVALRV +D +IF NC IDGYQDTLY
Sbjct  358  GARGHQAVALRVQSDLSIFYNCQIDGYQDTLY  389



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 145/208 (70%), Gaps = 4/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G  G KMK +L  + +L+SNGLA+IT L+     L       RRLL DN    FP+++  
Sbjct  183  GPAGAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFTGRRLLKDNS--EFPSWLSH  240

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL     +IKP++VVAKDGSG++K+IN+A++K P   +  +VI IK G+Y + V +
Sbjct  241  EKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQQVTI  300

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++++H++ IGDG TKTKIT + N   G+ T++T+TV++ G HF A+DIGFEN+AGA  H
Sbjct  301  SRSLSHIMMIGDGATKTKITGDLNYAAGVQTFKTSTVSVSGSHFIAKDIGFENTAGAIGH  360

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D +IF NC +DGYQDTLYA
Sbjct  361  QAVALRVQSDMSIFYNCQMDGYQDTLYA  388



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 144/208 (69%), Gaps = 4/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAAS--TLEAKKRRRLLSDNDGFNFPAFIDA  447
            G  G KMK +L  + +L+SNGLA+IT L+       L     RRLL DN    FP+++  
Sbjct  183  GPAGAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLTGRRLLKDNS--EFPSWLSH  240

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL     ++KP++VVAKDGSG++K+IN+A++K P N +  +VI IK G+Y E V +
Sbjct  241  EKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKEQVTI  300

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             +++ H++ IGDG TKT+IT + N   G+ T QT+TV++ G HF A+DIGFEN+AGA  H
Sbjct  301  SRSVTHIMMIGDGATKTRITGDLNYAAGVQTLQTSTVSVSGNHFIAKDIGFENTAGAIGH  360

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D +IF NC +DGYQDTL+A
Sbjct  361  QAVALRVQSDMSIFYNCQMDGYQDTLFA  388



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA---KKRRRLLSDNDGFNFPAFID  450
            GDT EKMK LL T  E+ SNGLAI+T+ +   S+L+      RRRL+ + +      F+ 
Sbjct  174  GDTAEKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLMGEGEENPDDGFVQ  233

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
            +  RRLL  N  +IK NV VA+DGSG+FK+I  A+   P  ++  +VI +KAGVY E V+
Sbjct  234  SARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVKAGVYKETVI  293

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            VPK +N+VV  GDGP KT++  NKN  DG+ T+ TAT+A+  + F A+DI FENSAG  K
Sbjct  294  VPKKVNNVVIYGDGPEKTRVVNNKNYADGVQTFHTATLAVNSDGFMAKDIAFENSAGPTK  353

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVA+RVS D A+F N  +DGYQDTLYA
Sbjct  354  HQAVAVRVSGDKAVFYNVVMDGYQDTLYA  382



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=559

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 150/207 (72%), Gaps = 2/207 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTE-AASTLEAKKRRRLLSDNDGFNF-PAFIDA  447
            GD G+KMK+ LK + ELT NGLA+I+ +++     ++ K +RRLL+D D     P++ID 
Sbjct  177  GDAGDKMKNFLKQSQELTKNGLAMISEISKLMGGAIDIKPQRRLLADGDSSKTSPSWIDG  236

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
                L  A+A S+KP+VVVA+DGSG++K++ +A+   P  +   +VI IK G Y E+VV+
Sbjct  237  RKLDLATASASSLKPDVVVAQDGSGKYKTVGEALKDIPKESPKTFVIYIKEGEYKEHVVL  296

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K M +V+FIGDGPTKTKIT +KN  DG   ++TATV + G++F A+D+GFENSAGA+ H
Sbjct  297  EKEMKNVMFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDYFIAKDMGFENSAGAKGH  356

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QA+ALRV +D +IF NC +DGYQ+TL+
Sbjct  357  QAMALRVQSDQSIFYNCQMDGYQNTLF  383



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 147/219 (67%), Gaps = 14/219 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDN-DG----------F  471
            D G+KMK +L+T+  ++SNGL+II  L++    ++    RRLL ++ DG          F
Sbjct  184  DAGKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPAGRRLLKESVDGEEDVLGHGGDF  243

Query  470  NFPAFID--ATARRLLNANAG-SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKI  300
              P ++D  A  R+LLN   G  ++ +VVVAKDGSG F +I +A+   P  N  P+VI I
Sbjct  244  ELPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEALKHVPKKNLKPFVIYI  303

Query  299  KAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDI  120
            K GVY EYV V K M HVVFIGDG  KT+IT NKN +DG+GT++TA+VAI G+ F    I
Sbjct  304  KEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGVGTFKTASVAITGDFFVGIGI  363

Query  119  GFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            GFENSAG +KHQAVALRV +D +IF  C +DGYQDTLYA
Sbjct  364  GFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTLYA  402



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   219 bits (558),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 111/208 (53%), Positives = 150/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT NGLA++T ++     ++  +   RRLLS      FP+++D 
Sbjct  181  GDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQE----FPSWMDG  236

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLLNA    +K ++VVA+DGSG++K+IN+A+N  P   +  +V+ IK G+Y EYV V
Sbjct  237  RTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQV  296

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G+HF A+++GFEN+AGA KH
Sbjct  297  NRSMTHLVFIGDGPDKTVISGDKNYKDGITTYKTATVAIVGDHFIAKNMGFENTAGAIKH  356

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  357  QAVAIRVLSDESIFYNCRFDGYQDTLYA  384



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   218 bits (554),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL++     FP+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEG----FPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A A    +KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVVHIKAGIYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ NK+  DGI TY+TATVAI G++F A++IGFEN+AGA 
Sbjct  298  QVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D AIF NC  DGYQDTLY
Sbjct  358  KHQAVALRVQSDEAIFFNCRFDGYQDTLY  386



>sp|Q42920.1|PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=P65; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Medicago sativa]
 gb|AAA91128.1| putative pectinesterase [Medicago sativa]
Length=447

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 142/205 (69%), Gaps = 8/205 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAI---ITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GE M  +LKT+ EL+SN + +   ++ + +   T +    RRLLSD DG   P++++   
Sbjct  63   GETMTKVLKTSMELSSNAIDMMDAVSRILKGFDTSQYSVSRRLLSD-DGI--PSWVNDGH  119

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            RRLL    G+++PN VVA+DGSG+FK++ DA+   PP N  P+VI +KAGVY E V V K
Sbjct  120  RRLLAG--GNVQPNAVVAQDGSGQFKTLTDALKTVPPKNAVPFVIHVKAGVYKETVNVAK  177

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
             MN+V  IGDGPTKTK T + N  DGI TY TAT  + G +F A+DIGFEN+AG  KHQA
Sbjct  178  EMNYVTVIGDGPTKTKFTGSLNYADGINTYNTATFGVNGANFMAKDIGFENTAGTGKHQA  237

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRV+AD AIF NC +DG+QDTLY
Sbjct  238  VALRVTADQAIFYNCQMDGFQDTLY  262



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 143/213 (67%), Gaps = 9/213 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA---KKRRRLLSDND-----GFNFP  462
            D GEKM+  L    ELTSNGLA++T ++   + L        RRLL D++        FP
Sbjct  178  DAGEKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGNRRLLQDSEVQVLGHGEFP  237

Query  461  AFIDATARRLLNANAG-SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
             ++D   RRLL A  G ++KP++VVAKDGSG++K+I +A+   P  ++  +V+ +K GVY
Sbjct  238  MWMDPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVY  297

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
             E ++  K M  +  IGDGPTKT+I  N N VDG+ T++TATVA+ GE F A+DIGFEN 
Sbjct  298  REQIIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGVNTFKTATVAVLGEQFLAKDIGFEND  357

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            AGA KHQAVALRV +D ++F NC +DGYQDTLY
Sbjct  358  AGAIKHQAVALRVQSDFSVFYNCHMDGYQDTLY  390



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 146/210 (70%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      RRLL+       P+++D 
Sbjct  184  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSRRLLAQE----IPSWVDQ  239

Query  446  TARRLLNANA--GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A +     KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  240  RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G++F A++IGF N+AGA 
Sbjct  300  QVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGAI  359

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  360  KHQAVAIRVQSDESIFFNCRFDGYQDTLYA  389



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 148/218 (68%), Gaps = 13/218 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR-RRLLS----------DNDGF  471
            D G+KM+  L+TA  +TSNGLAII+ L++  S +   K  RRLL+          + D F
Sbjct  182  DAGKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSGRRLLTAADDLPVLGHETDDF  241

Query  470  NFPAFIDAT--ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIK  297
            + P ++++    RRLL+        +VVVAKDGSG F +INDA+   P  N  P++I IK
Sbjct  242  DLPDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFIIYIK  301

Query  296  AGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIG  117
             GVY+EYV V +NM HVV IGDG  K++IT +KN +DG+GTY+TA+ AI G+ F A  +G
Sbjct  302  EGVYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGVGTYKTASAAIIGDFFVAIGMG  361

Query  116  FENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            FEN+AGA+KHQAVALRV +D +IF  C +DGYQDTLYA
Sbjct  362  FENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYA  399



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 147/209 (70%), Gaps = 11/209 (5%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLT----EAASTL---EAKKRRRLLSDNDGFNFPAFID  450
            + M  + +T+ ELTSN LA+IT+++    E  + L        R+LLS  DG   P+++ 
Sbjct  185  QDMHKIFETSKELTSNALAMITSISSFLGEHITGLIGDHGNHARKLLSTEDGI--PSWVG  242

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRL+ A  G +KPNVVVA+DGSGE+K+IN+A++  P  N  P+VI IK GVYNE V 
Sbjct  243  PNTRRLM-AEQGVVKPNVVVAQDGSGEYKTINEALSVVPKANQKPFVIYIKQGVYNEKVD  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            V K M HV FIGDGPTKTKIT + N   G + TY TATVAI G++ TA++IGFEN+AG +
Sbjct  302  VTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNLTAKNIGFENTAGPE  361

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             HQAVALRVSAD+A+F NC IDGYQDTLY
Sbjct  362  GHQAVALRVSADYAVFHNCQIDGYQDTLY  390



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDND----GFNFPAF  456
            G+ G KM+  LK++ ELTSN LA++  ++ A + +      R+LLSD++    G +F  +
Sbjct  184  GNAGHKMREALKSSEELTSNVLAMVDEISLALAKMNLTNFNRKLLSDDNVIGHGDDFSMW  243

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
              +  R+LL+     +KPN+VVAKDGSG F++IN+A+   P N+   +V+ IKAGVY E 
Sbjct  244  ATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTFVLHIKAGVYKEQ  303

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            VV  + M +V+ +GDGPTKT+I+ NKN  DG  T++TATV++ G++F ARDIGFENSAGA
Sbjct  304  VVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFGDNFIARDIGFENSAGA  363

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             KHQAVAL V +D AIF NC +DGYQDTLYA
Sbjct  364  IKHQAVALMVRSDMAIFHNCHMDGYQDTLYA  394



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 143/212 (67%), Gaps = 18/212 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE------AKKRRRLLSDNDGFNFPA  459
            GDTGEKMK LLKT GELTSNGL ++T+LT   S L+      +  RRRLLSD        
Sbjct  159  GDTGEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQIGIGNVSAGRRRLLSD--------  210

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            + +   R L    AG I+ N VVA DGSG++KSIN AIN AP  N  P+VI +KAG+Y E
Sbjct  211  WAEPKMRML----AGGIRANAVVALDGSGQYKSINAAINAAPSKNARPFVIHVKAGLYRE  266

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            YV VPK+  ++V +GDG T+T+IT  KN   G+ T+ TAT A+  + FTA+DIG EN+AG
Sbjct  267  YVEVPKHKTNIVILGDGATRTRITGRKNLAGGVKTFATATFAVNADDFTAKDIGIENTAG  326

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             + HQAVALRV+ D A+  N  IDG+QDTLYA
Sbjct  327  PEGHQAVALRVTGDRAVLYNLNIDGFQDTLYA  358



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 146/202 (72%), Gaps = 6/202 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDATARRLL  429
            MK  LKTA +LT NGLA+++ +      +E  +   RRLLS      FP+++D   RRLL
Sbjct  1    MKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQE----FPSWVDGRVRRLL  56

Query  428  NANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNH  249
            NA    +KP++VVA+DGSG++K+IN+A+   P  N+A +V+ IK+G Y EYV V + M +
Sbjct  57   NAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQVNRTMPN  116

Query  248  VVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALR  69
            +VFIGDGPTK+ I+ NK+  DGI TY+TATVAI G++F A+++GFEN+AGA  +QAVA+R
Sbjct  117  LVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALNYQAVAVR  176

Query  68   VSADHAIFSNCAIDGYQDTLYA  3
            V +D +IF NC  DGYQDTLYA
Sbjct  177  VLSDESIFYNCRFDGYQDTLYA  198



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFN--FPAFI  453
            GDT EKMK +L    E+ SNGLAI+T+ +   S+L+  +   RRL+ +++       +F+
Sbjct  173  GDTAEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRLMGEDEQQQPGIDSFV  232

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
            +   R+LL  N  S+KPN  VA+DGSG+FK+I  A++  P  ++A +VI +KAGVY E V
Sbjct  233  EFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATFVIHVKAGVYKETV  292

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            ++PK +N+VV  GDGP KT++  NKN  DG+ T+ TAT+A+  + F A+DI FENSAGA 
Sbjct  293  IIPKKVNNVVIYGDGPNKTRVVNNKNYADGVETFHTATLAVNSDGFMAKDIAFENSAGAS  352

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVA+RVS D AIF N  +DGYQDTLYA
Sbjct  353  KHQAVAVRVSGDKAIFYNVVMDGYQDTLYA  382



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 8/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA-KKRRRLLSDND-----GFNF-P  462
            G+ GEKMK  L  + +LTSN L++IT +++  ++L A   RRRLL D+      G    P
Sbjct  174  GEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLGHGIELLP  233

Query  461  AFIDATARRLLNAN-AGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
             +ID   RRLL  N +  IKP+VVVAKDGSG++K INDA+   P + +  YV+ IK GVY
Sbjct  234  DWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVY  293

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            +E V +   M+++V IGDGPTKT+IT N++   G+ TYQT+TVAI G++F A+DIGFEN+
Sbjct  294  DEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAIMGDYFVAKDIGFENT  353

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG  KHQA+ALRV+AD +IF NC +DGYQDTL A
Sbjct  354  AGPDKHQALALRVAADKSIFYNCHMDGYQDTLCA  387



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 157/266 (59%), Gaps = 60/266 (23%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE---AKKRRRLLSDNDGF-------  471
            GDTGEKMK+LLKTA E++SNGLA++  ++   S+L+   A  R+ LLS+  G+       
Sbjct  175  GDTGEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQLGNAASRKLLLSEKIGYGGDPTDY  234

Query  470  ---NFPAF-IDATARRLLNA-----NAG--------------------------------  414
                 P F +D+  RRLL+A     NAG                                
Sbjct  235  APGEEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGYGGDPTDYAPGEEPHFNLDS  294

Query  413  ---------SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
                     S+KPN VVA+DGSG+F +I+ AI   PP N+  +VI +KAGVY EYV +PK
Sbjct  295  NRRHLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVYKEYVQIPK  354

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
             MN +V IGDGP KT+I+  KN  +G+ TY TATVA+  + F A+DIGFEN+AGA  HQA
Sbjct  355  KMNKIVLIGDGPLKTRISGRKNFAEGVKTYHTATVAVNADDFLAKDIGFENTAGALGHQA  414

Query  80   VALRVSADHAIFSNCAIDGYQDTLYA  3
            VALRVS D A+F N  IDGYQDTLYA
Sbjct  415  VALRVSGDRAVFYNVHIDGYQDTLYA  440



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   216 bits (551),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 112/212 (53%), Positives = 150/212 (71%), Gaps = 7/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL--EAKKRRRLLSDNDGF-----NFP  462
            G+ GEKM+  L  A ++TSN LA++  L+    +L  E+   RRLLS+N+         P
Sbjct  171  GEAGEKMRVSLTKAMQMTSNALAMMAELSTYIKSLGIESSTSRRLLSENEAVVGHDDELP  230

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++D   RRLL+A+   I+P++VVAKDGSG+F++IN+A+   P   D  +V+ IK GVY 
Sbjct  231  NWMDLNKRRLLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYE  290

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E V V  ++ H++FIGDGPTKT+IT   N +DG  TY+TATVA++G++F A +IGFENSA
Sbjct  291  ERVQVNSSLTHLLFIGDGPTKTRITGKLNFIDGTNTYRTATVAVQGDNFMAVNIGFENSA  350

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G QKHQAVALRVSAD AIF NC +DGYQDTLY
Sbjct  351  GPQKHQAVALRVSADKAIFYNCHMDGYQDTLY  382



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 148/205 (72%), Gaps = 5/205 (2%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDATAR  438
            GE MK  LKTA +LT NGLA+++ ++ +   ++  +   RRLLS +    FP+++D  AR
Sbjct  184  GETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPELNSRRLLSQD---QFPSWLDVRAR  240

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
             LLN  +   KP++VVA+DGSG++K+IN+A+   P   +A +V+ IK G+Y EYV V ++
Sbjct  241  SLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIKEGIYKEYVQVNRS  300

Query  257  MNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
            M  +VFIGDGP KT ++ +K+  DGI TY+TATV I G+HF A+++GFEN+AGA KHQAV
Sbjct  301  MPDLVFIGDGPDKTVLSGDKSFKDGITTYRTATVGIIGDHFIAKNMGFENTAGAIKHQAV  360

Query  77   ALRVSADHAIFSNCAIDGYQDTLYA  3
            A+RV +D +IF NC  DGYQDTLYA
Sbjct  361  AIRVLSDESIFYNCRFDGYQDTLYA  385



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 143/209 (68%), Gaps = 5/209 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G  GEKMK LL  + +LTSNGLA++  +T     L       RRLL  +D   FP++++ 
Sbjct  184  GSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEADD--EFPSWVNG  241

Query  446  TARRLL-NANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              R LL      +IK + +VA+DGSG++K+I +AI K P  N+  +V+ IK GVY E V 
Sbjct  242  GKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKEQVS  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            + ++  HV+ IGDGPTKTKIT N N  +G+ T++TATV+I G+HF A+DIGFENSAGA  
Sbjct  302  LARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAGAIG  361

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD ++F NC IDGYQDTLYA
Sbjct  362  HQAVALRVQADMSVFYNCQIDGYQDTLYA  390



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ L+     ++  +   RRLL+       P+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQG----IPSWVDQ  237

Query  446  TARRLLN--ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL   A     KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDG  KT I+ NK+  DGI TY+TATVAI G++F A++IGFEN+AGA 
Sbjct  298  QVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D AIF NC  DGYQDTLY
Sbjct  358  KHQAVALRVQSDEAIFFNCRFDGYQDTLY  386



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ L+     ++  +   RRLL+       P+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQG----IPSWVDQ  237

Query  446  TARRLLN--ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R+LL   A     KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDG  KT I+ NK+  DGI TY+TATVAI G++F A++IGFEN+AGA 
Sbjct  298  QVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D AIF NC  DGYQDTLY
Sbjct  358  KHQAVALRVQSDEAIFFNCRFDGYQDTLY  386



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 143/209 (68%), Gaps = 8/209 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     +E      RRLL+       P+++D 
Sbjct  182  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMEIPGLNSRRLLAQE----IPSWVDQ  237

Query  446  TARRLLN--ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL   A     KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVVHIKAGLYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ NKN  DGI TY+TATVAI G++F A++IGF N+AG  
Sbjct  298  QVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGPI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVA+RV +D +IF NC  DGYQDTLY
Sbjct  358  KHQAVAVRVQSDESIFFNCRFDGYQDTLY  386



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 148/209 (71%), Gaps = 11/209 (5%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLT----EAASTL---EAKKRRRLLSDNDGFNFPAFID  450
            + M  + +T+ ELTSN LA+IT+++    E  + L        R+LLS  DG   P+++ 
Sbjct  185  QDMHKIFETSKELTSNALAMITSISTFLGEHITGLIGDHGNHGRKLLSTEDGI--PSWVG  242

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRL+ A  G +KP+VVVA+DGSG++K+IN+A++  P  N  P+VI IK GVYNE V 
Sbjct  243  PNTRRLM-AEQGVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIKQGVYNEKVD  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            V K M HV FIGDGPTKTKIT + N   G + TY TATVAI G++FTA++IGFEN+AG +
Sbjct  302  VTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTAKNIGFENTAGPE  361

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             HQAVALRVSAD+A+F NC IDGYQDTLY
Sbjct  362  GHQAVALRVSADYAVFHNCQIDGYQDTLY  390



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLS-DNDGFNF---PAFI  453
            G+ G+KMK  LKTA ELTSNGLA+ T ++    +L     RRLLS +    N+   P+++
Sbjct  173  GEAGDKMKGFLKTAQELTSNGLAMATQISSLLGSLNLNSHRRLLSAEKSKRNYQAVPSWM  232

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
             A   +LL A   ++KPNVVVA+DG+G++K+I +A+ + P  ++  +VI IK GVY E +
Sbjct  233  GARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFVIYIKEGVYKEQI  292

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            ++ + M +V  IGDGPTKTKI+ NKNK DG  T  TAT A  G++F A+DI FEN+AG  
Sbjct  293  IIDRQMTNVFMIGDGPTKTKISGNKNKADGTATMHTATFAAVGDYFVAKDIRFENTAGHI  352

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV +D +IF NC +D YQDTLY
Sbjct  353  KHQAVALRVQSDFSIFYNCHMDAYQDTLY  381



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 9/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR-RRLLSDNDGFNFPA-----  459
            G+  EKMK  LKT+  L+SNGL +++ ++   S L+     RRL SD +    P      
Sbjct  185  GEAAEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMGRRLFSDEEESELPVLGHSD  244

Query  458  ---FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
               +     RRL+  +   +KPN+VVAKDGSG++ +IN+A+   P  ++  +VI IK GV
Sbjct  245  EAEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKEGV  304

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            Y EYV + +NM +++ IGDG  KT+IT +KN +DG  T  TATV + G+HF ARDIGFEN
Sbjct  305  YKEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTATVVVLGDHFRARDIGFEN  364

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AGA KHQAVALRV+AD AIF  CA+DGYQDTLY
Sbjct  365  TAGAHKHQAVALRVNADEAIFYRCAMDGYQDTLY  398



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 147/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLL------SDNDGFN---  468
            GD GEKM+  LKT+ ELTSNGLA+++ ++    TL  K  RRLL      +D + F    
Sbjct  179  GDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIKTGRRLLQAAATATDENRFQRAK  238

Query  467  -FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKA  294
              PA+ID     L  A   ++KP+VVV+  G G++K+IN+A+   P NN+   +VI +K 
Sbjct  239  IIPAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVKE  298

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+E+V   K+M +V+ IGDGPTKT IT  KN  +G  TYQTATVA+ G++F A+DIGF
Sbjct  299  GVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGF  358

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  359  ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLY  394



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 143/209 (68%), Gaps = 11/209 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GDTGEKM  LL T  EL+ NGLA++ +  E  +      R+ L +D       +F++A+ 
Sbjct  169  GDTGEKMAKLLNTTRELSINGLAMVNSFGEMITQTTGLSRKLLTTDES-----SFVEASN  223

Query  440  RRLLN-ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            R+LL  +NA   KPN VVA+DGSG++K+I DA+   P  N  P+VI IKAG+Y EYV V 
Sbjct  224  RKLLQISNA---KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVDVE  280

Query  263  KNMNHVVFIGDGPTKTKITENKN-KVDGIG-TYQTATVAIEGEHFTARDIGFENSAGAQK  90
            K M +VVFIG+G TKTKIT NK  K  GIG T+ T TV + GE F ARDIGFEN+AGA K
Sbjct  281  KGMTNVVFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENTAGAVK  340

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             QAVALRV+AD A+  NC IDGYQDTLYA
Sbjct  341  EQAVALRVNADKAVIYNCKIDGYQDTLYA  369



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLL------SDNDGFN---  468
            GD GEKM+  LKT+ ELTSNGLA+++ ++     L  K  RRLL      +D   F    
Sbjct  179  GDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTGRRLLQAAATATDEKRFQKAK  238

Query  467  -FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKA  294
              PA+ID     L  A   ++KP+VVV+K G G++K+IN+A+   P NN+   +VI +K 
Sbjct  239  IIPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKE  298

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+E+V   K+M +V+ IGDGPTKT IT  KN  +G  TYQTATVA+ G++F A+DIGF
Sbjct  299  GVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGF  358

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  359  ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLY  394



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 142/209 (68%), Gaps = 5/209 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDA  447
            G  GEKMK LL  + +LTSNGLA++  +T     L       RRLL  +D   FP++++ 
Sbjct  184  GSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEADD--EFPSWVNG  241

Query  446  TARRLL-NANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
              R LL      +IK + +VA+DGSG++K+I +AI K P   +  +VI IK GVY E V 
Sbjct  242  GKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKEQVS  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            + ++  HV+ IGDGPTKTKIT N N  +G+ T++TATV+I G+HF A+DIGFENSAGA  
Sbjct  302  LARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAGAIG  361

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV AD ++F NC IDGYQDTLYA
Sbjct  362  HQAVALRVQADMSVFYNCQIDGYQDTLYA  390



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 146/208 (70%), Gaps = 9/208 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            + G KMK LL ++  + SN LAII++  +  +   A K   RRLL D++    P+++D  
Sbjct  186  EAGAKMKELLTSSMHMGSNALAIISDFADTLADWNATKVFGRRLLHDSET---PSWVDH-  241

Query  443  ARRLLNANAGSI--KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
             R+L++    +   KPNV VA DG+G+FK+IN+A+ K P     P++I IK GVY+EYV 
Sbjct  242  -RQLIDTKTNTFRHKPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIKEGVYSEYVE  300

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K M HVVF+GDG  K+ IT NKN +DG+ TY+TA+VAI+G+HFTA ++GFENSAG  K
Sbjct  301  VTKRMTHVVFVGDGGKKSVITGNKNFIDGVNTYRTASVAIQGDHFTAINMGFENSAGPHK  360

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV  D +IF NC++DGYQDTLY
Sbjct  361  HQAVALRVQGDKSIFFNCSMDGYQDTLY  388



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 152/237 (64%), Gaps = 33/237 (14%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGF--------  471
            GDTGEKMK+LLKTA E++SNGLA++T+++   ++L+      R+LLS+   F        
Sbjct  176  GDTGEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQLGNVASRKLLSEEGRFASKPNAGR  235

Query  470  --------------------NFPAF-IDATARRLLNANAGSIKPNVVVAKDGSGEFKSIN  354
                                  P F +D+  R LL+A   S+KPN VV++DGSG+F +I+
Sbjct  236  KLQLSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSAT--SLKPNAVVSQDGSGQFNTIS  293

Query  353  DAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGT  174
             AI   P  ND  +VI +KAGVY E V++PK+MN +V IGDGP KT++T   N  +G+ T
Sbjct  294  AAIATVPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKTRVTGRLNFAEGVKT  353

Query  173  YQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            Y TATVA+  + F A+DIGFEN+AGA+ HQAVALR S D A+F N  IDGYQDTLYA
Sbjct  354  YHTATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFYNVHIDGYQDTLYA  410



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 145/228 (64%), Gaps = 23/228 (10%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSD---------------  483
            D  +KM+++L T+  ++SN LAII++L ++   L      R L D               
Sbjct  183  DASKKMQNILTTSMHMSSNALAIISDLAKSVLDLNLTNNERRLIDNNNNNNNNNNNDVGE  242

Query  482  ----NDGFNFPAFI----DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPN  327
                +D    P++         RRLL+AN   +K NV+VAKDGSG+FK INDA+   P  
Sbjct  243  QVFGHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGKFKKINDALKHVPKK  302

Query  326  NDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIE  147
            N   +VI IK GVY+EYV V K M HVVF+GDG  KT+IT NKN +DG+ TY+T TVAI 
Sbjct  303  NKKIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFIDGVNTYKTPTVAIA  362

Query  146  GEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            G++F A +IGFENSAG QKHQAVA+RV AD +IF  C+IDGYQDTLYA
Sbjct  363  GDYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTLYA  410



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 143/208 (69%), Gaps = 6/208 (3%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDAT  444
            + G KMK LL ++  ++SN LAII++  +  S   A +  RRRLL D++    P+ +D  
Sbjct  186  EAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRRLLHDSET---PSSVDHH  242

Query  443  ARRL-LNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             ++     N    KPNV VA DGSG+FKSIN+A+ + P  +  P+VI IK GVY EYV V
Sbjct  243  HKQHNAKKNVFKHKPNVTVALDGSGDFKSINEALTQVPKKSKKPFVIYIKEGVYPEYVEV  302

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K+M HVVF+GDG  KT IT NKN +DG+ TY+TA+VAI+G+HF A ++GFENSAG  KH
Sbjct  303  TKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENSAGPHKH  362

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV  D  IF NC++DGYQDTLY 
Sbjct  363  QAVALRVQGDKTIFFNCSMDGYQDTLYV  390



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 140/207 (68%), Gaps = 5/207 (2%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDAT  444
            + G KMK LL ++  ++SN LAII++  +  S   A    RR LL D++    P+ +D  
Sbjct  186  EAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRHLLHDSET---PSSVDHH  242

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             +     N    KPNV VA DGSG+FKSIN+A+ + P  +  P+VI IK GVY EYV V 
Sbjct  243  KQHNAMKNVFKHKPNVTVALDGSGDFKSINEALTRVPEKSKKPFVIYIKEGVYPEYVEVT  302

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K+M HVVF+GDG  KT IT NKN +DG+ TY+TA+VAI+G+HF A ++GFENSAG  KHQ
Sbjct  303  KHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENSAGPHKHQ  362

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVALRV  D  IF NC++DGYQDTLY 
Sbjct  363  AVALRVQGDKTIFFNCSMDGYQDTLYV  389



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 9/208 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDAT  444
            D G+KMK +L ++  ++SN LAII++  +  ++    K   RRLL D D    P+++ + 
Sbjct  187  DAGKKMKDILTSSMHMSSNALAIISDFADTVTSWNVTKIFGRRLL-DTDT---PSWV-SE  241

Query  443  ARRLLNANAGS--IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
             R LL+A   S  +KPNV VA DG+G+ K+IN+A+ K P  ++ P+ I IK GVYNEYV 
Sbjct  242  HRMLLDAKTSSFKLKPNVTVALDGTGDVKTINEALLKVPEKSEKPFFIYIKEGVYNEYVE  301

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K+M +VVF+GDG  K++IT +KN +DG+ TY+TA+VAI+G+HFTA ++GFENSAGA K
Sbjct  302  VGKHMTYVVFLGDGGQKSRITGSKNFIDGVNTYKTASVAIQGDHFTAINMGFENSAGAHK  361

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV  D +IF NC++DGYQDTLY
Sbjct  362  HQAVALRVQGDKSIFFNCSMDGYQDTLY  389



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLL------SDNDGFN---  468
            GD G KM+  LKT+ ELTSNGLA+++ ++     L  K  RRLL      +D + F    
Sbjct  181  GDAGAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTGRRLLQDAATATDENRFQRAK  240

Query  467  -FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKA  294
              PA+ID     L  A   ++KP+VVV+K G G++K+IN+A+   P NN+   +VI +K 
Sbjct  241  IIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKE  300

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+E+V   K+M +V+ IGDGPTKT IT  KN  DG  TYQTATVA+ G++F A+D+GF
Sbjct  301  GVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGF  360

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  361  ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLY  396



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLL------SDNDGFN---  468
            GD G KM+  LKT+ ELTSNGLA+++ ++     L  K  RRLL      +D + F    
Sbjct  178  GDAGAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTGRRLLQDAATATDENRFQRAK  237

Query  467  -FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKA  294
              PA+ID     L  A   ++KP+VVV+K G G++K+IN+A+   P NN+   +VI +K 
Sbjct  238  IIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKE  297

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+E+V   K+M +V+ IGDGPTKT IT  KN  DG  TYQTATVA+ G++F A+D+GF
Sbjct  298  GVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGF  357

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  358  ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLY  393



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 145/208 (70%), Gaps = 7/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT NGLA++T ++     ++  +   RRLL+       P+++D 
Sbjct  167  GDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTELNSRRLLAQE-----PSWVDG  221

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL A    +KP++VVA+DGSG++K+I++A+   P N +  +V+ IK GVY E+V V
Sbjct  222  RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  281

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             + M+ +VFIGDGP KT IT  K+  DGI TY+TATVAI G+ F A+++GFEN+AGA KH
Sbjct  282  DRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFENTAGAAKH  341

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAV +RV +D +IF NC  DGYQDTLYA
Sbjct  342  QAVGIRVLSDQSIFYNCRFDGYQDTLYA  369



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 145/210 (69%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++      R LL+       P+++D 
Sbjct  184  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGLNSRGLLAQE----IPSWVDQ  239

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
               RLL A +G    KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  240  RGPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G++F A++IGF N+AGA 
Sbjct  300  QVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGAI  359

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  360  KHQAVAIRVQSDESIFFNCRFDGYQDTLYA  389



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 147/208 (71%), Gaps = 4/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAAST--LEAKKRRRLLSD-NDGFNFPAFID  450
            GDTGEKM  LL+T+ ELT NGL +++ +T   ++  L A  RR +  + N+    P+++ 
Sbjct  182  GDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTEESNEQREEPSWV-  240

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               R LL A   +IK + VVAKDGSG++K++  A+N  P  ++  +VI +KAGVY E V+
Sbjct  241  RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVM  300

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K+M  V+ IGDGPTKTKIT  KN +DG  T++TATV++ G +F A+DIGFENSAGA K
Sbjct  301  VEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFENSAGAAK  360

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV +D ++F NC +DGYQDTLY
Sbjct  361  HQAVALRVQSDMSVFYNCQMDGYQDTLY  388



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 147/208 (71%), Gaps = 4/208 (2%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAAST--LEAKKRRRLLSD-NDGFNFPAFID  450
            GDTGEKM  LL+T+ ELT NGL +++ +T   ++  L A  RR +  + N+    P+++ 
Sbjct  185  GDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTEESNEQREEPSWV-  243

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               R LL A   +IK + VVAKDGSG++K++  A+N  P  ++  +VI +KAGVY E V+
Sbjct  244  RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVM  303

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K+M  V+ IGDGPTKTKIT  KN +DG  T++TATV++ G +F A+DIGFENSAGA K
Sbjct  304  VEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFENSAGAAK  363

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV +D ++F NC +DGYQDTLY
Sbjct  364  HQAVALRVQSDMSVFYNCQMDGYQDTLY  391



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 143/209 (68%), Gaps = 11/209 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GDTGEKM  LL T  EL+ NGLA++ +  E  +      R+ L +D       +F++A+ 
Sbjct  169  GDTGEKMVKLLNTTRELSINGLAMVNSFGEMITQTTGLSRKLLTTDES-----SFVEASN  223

Query  440  RRLLN-ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            R+LL  +NA   KPN VVA+DGSG++K+I DA+   P  N  P+VI IKAG+Y EYV V 
Sbjct  224  RKLLQISNA---KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVEVE  280

Query  263  KNMNHVVFIGDGPTKTKITENKN-KVDGIG-TYQTATVAIEGEHFTARDIGFENSAGAQK  90
            K M +VVFIG+G TKTKIT NK+ K  GIG T+ T TV + GE F ARDIGFEN+AG  +
Sbjct  281  KGMTNVVFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPAQ  340

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             QAVALRV+AD A+  NC IDGYQDTLYA
Sbjct  341  EQAVALRVNADKAVIYNCKIDGYQDTLYA  369



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 144/210 (69%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G  GE MK  LKTA ELT NGLAII+ ++     +   +   RRLLS +     P+++D 
Sbjct  182  GKAGETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPELNSRRLLSQD----IPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              R LL A  G    K ++VVA+DGSG++ +INDA+   P   +  +V+ IKAGVY EYV
Sbjct  238  RGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVHIKAGVYKEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G++F A++IGF N+AGA 
Sbjct  298  QVNKSMTHLVFIGDGPDKTIISGSKNYKDGITTYRTATVAIIGDYFIAKNIGFVNTAGAI  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  358  KHQAVAVRVQSDESIFFNCRFDGYQDTLYA  387



>ref|XP_010489680.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21, 
partial [Camelina sativa]
Length=341

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 8/199 (4%)
 Frame = -2

Query  590  LKTAGELTSNGLAIITNLTEAASTLE--AKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            LKTA ELT NGLAII+ L+     ++  +   RRLLS+      P+++D   R+LL A A
Sbjct  119  LKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLSEG----IPSWVDQRGRKLLQAAA  174

Query  416  GSIKP--NVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVV  243
                   ++VVA+DGSG++ +IN+A+   P   +  +V+ IKAG+YNEYV V K+M H+V
Sbjct  175  AYSDAKADIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIYNEYVQVNKSMTHLV  234

Query  242  FIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVS  63
            FIGDGP KT I+ NK+  DGI TY+T TVAI G++F A++IGFEN+AGA KHQAVALRV 
Sbjct  235  FIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDYFIAKNIGFENTAGAIKHQAVALRVQ  294

Query  62   ADHAIFSNCAIDGYQDTLY  6
            +D AIF NC  DGYQDTLY
Sbjct  295  SDEAIFFNCRFDGYQDTLY  313



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 139/206 (67%), Gaps = 14/206 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            GDTGEKMK++LKTA EL+S  L I+++  E    L+      RRLL            +A
Sbjct  175  GDTGEKMKNILKTASELSSVALDIVSSFEEQMVGLQGLGITNRRLL----------VAEA  224

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL     ++KPNVVVA+DGSG+ KSIN+A+   PPNN  PYVI IKAG+YNE + V
Sbjct  225  GNRRLLQI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENIEV  282

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
               M +VVFIG+G  KTKIT NKN +DG+  +QTATV+I G+ F A+DI FENSAG  K 
Sbjct  283  ANTMTNVVFIGEGSNKTKITSNKNYLDGLPIFQTATVSISGQGFVAKDIAFENSAGPLKK  342

Query  86   QAVALRVSADHAIFSNCAIDGYQDTL  9
            +AVALRVSA+   F NC IDGYQ TL
Sbjct  343  EAVALRVSAEMTAFQNCQIDGYQSTL  368



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 143/207 (69%), Gaps = 5/207 (2%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--RRLLSDNDGFNFPAFIDAT  444
            + G+KMK  L T+  ++SN LA++T L +  + L   +   RRLL D++    P+++D  
Sbjct  185  EAGQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLLQDSES---PSWVDHQ  241

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
                 N +  + K NV VA+DG+G+FKSIN+A+ + P  N  P+VI IK G Y EYV V 
Sbjct  242  GLPNANTSLFNHKLNVTVAQDGNGDFKSINEALKQVPEKNKKPFVIYIKEGTYQEYVEVT  301

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K+M HVVFIGDG  KT+I  NKN +DGI TY+TATVAI+G++F A ++GFEN AG  KHQ
Sbjct  302  KDMTHVVFIGDGGKKTRIIGNKNFIDGINTYRTATVAIQGDYFVAINMGFENFAGPHKHQ  361

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVALRV AD +IF NC++DGYQDTLY 
Sbjct  362  AVALRVQADKSIFYNCSMDGYQDTLYV  388



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 140/208 (67%), Gaps = 8/208 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GDTGEKM  LL T  EL+ NGLA++ +  E  +      R+ L +  +     +FI+A+ 
Sbjct  169  GDTGEKMVKLLNTTRELSINGLAMVNSFGEMITQTTGLSRKLLTTTEES----SFIEASN  224

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            R+LL  +  S KPN VVA+DGSG++K+I DA+   P  N  P+VI IKAG+Y EYV V K
Sbjct  225  RKLLQIS--SAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKEYVEVEK  282

Query  260  NMNHVVFIGDGPTKTKITENKN-KVDGIG-TYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             M +VVFIG+G TKTKIT NK  K  GIG T+ T TV + GE F ARDIGFEN+AG    
Sbjct  283  GMTNVVFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPTLE  342

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV+AD A+  NC IDGYQDTLYA
Sbjct  343  QAVALRVNADKAVIYNCKIDGYQDTLYA  370



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 145/210 (69%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     ++       RLL+       P++++ 
Sbjct  184  GNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSCRLLAQE----IPSWVNQ  239

Query  446  TARRLLNANA--GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A +     KP++VVA+DGSG++ +INDA+   P   +  +V+ IKAG+Y EYV
Sbjct  240  RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K+M H+VFIGDGP KT I+ +KN  DGI TY+TATVAI G++F A++IGF N+AGA 
Sbjct  300  QVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGAI  359

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            KHQAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  360  KHQAVAIRVQSDESIFFNCRFDGYQDTLYA  389



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT N LA++T ++     ++  +   RRLL+       P+++D 
Sbjct  181  GDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQE-----PSWVDG  235

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL A    +KP++VVA+DGSG++K+I++A+   P N +  +V+ IK GVY E+V V
Sbjct  236  RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  295

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             + M+ +VFIGDGP KT IT  K+  DGI TY+TATVAI G+ F A+++GF+N+AGA KH
Sbjct  296  DRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAGAAKH  355

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAV +RV +D +IF NC  DGYQDTLYA
Sbjct  356  QAVGIRVLSDQSIFYNCRFDGYQDTLYA  383



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLL------SDNDGFN---  468
            GD GEKM+  LKT+ ELTSNGLA+++ ++    +L  K  RRLL      +D   F    
Sbjct  178  GDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKSLNIKTGRRLLQAAATATDEKRFQRAK  237

Query  467  -FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKA  294
              PA+ID     L  A   ++KP+VVV+K G G++K+IN+A+   P NN+   +VI +K 
Sbjct  238  IIPAWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKE  297

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+E+V   K+M +V+ IGDGPTKT IT  +N  DG  TY TATV + G++F A+D+GF
Sbjct  298  GVYDEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQTYLTATVGVVGDYFIAKDVGF  357

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  358  ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLY  393



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 142/211 (67%), Gaps = 13/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + MK + K + ELTSN LA+IT         N+TEA   L     R+LL+  DGF  P++
Sbjct  183  QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDL-GNNARKLLNAEDGF--PSW  239

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
            +    RRL+ A  G +KPNVVVAKDGSG++KSIN+A+   P NN  P+VI IK GVY E 
Sbjct  240  VGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEK  299

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAG  99
            VVV K M HV FIGDGPTKTKIT + N   G + TY T+++ +EG++F A+++G EN+AG
Sbjct  300  VVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVEGDNFVAKNMGIENTAG  359

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
                QAVALRVSAD  +  NC IDGYQDTLY
Sbjct  360  PPGGQAVALRVSADCVVIFNCQIDGYQDTLY  390



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   214 bits (544),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 144/206 (70%), Gaps = 14/206 (7%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDNDGFNFPAFIDAT  444
            GD GEKMK LLK+AGELTSNGLA+I  ++   + L+     RRLL               
Sbjct  171  GDAGEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLL-------------VG  217

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             R+L  A   +IKPNV+VA+DGSG++K+IN+A+ + P N +  +V+ +K GVY E V   
Sbjct  218  QRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKEQVNFT  277

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K+M +V+ IGDGPTKT I+ + N +DGIGT++TATVA  G +F A+DIGFEN+AGA KHQ
Sbjct  278  KSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAGASKHQ  337

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRV +D AIF NC +DGYQDTLY
Sbjct  338  AVALRVGSDMAIFYNCRMDGYQDTLY  363



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            GD GE +K  LKTA +LT N LA++T ++     ++  +   RRLL+       P+++D 
Sbjct  181  GDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQE-----PSWVDG  235

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL A    +KP++VVA+DGSG++K+I++A+   P N +  +V+ IK GVY E+V V
Sbjct  236  RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  295

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             + M+ +VFIGDGP KT IT  K+  DGI TY+TATVAI G+ F A+++GF+N+AGA KH
Sbjct  296  DRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAGAAKH  355

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAV +RV +D +IF NC  DGYQDTLYA
Sbjct  356  QAVGIRVLSDQSIFYNCRFDGYQDTLYA  383



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 142/211 (67%), Gaps = 13/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + MK + K + ELTSN LA+IT         N+TEA   L     R+LL+  DGF  P++
Sbjct  183  QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDL-GNNARKLLNAEDGF--PSW  239

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
            +    RRL+ A  G +KPNVVVAKDGSG++KSIN+A+   P NN  P+VI IK GVY E 
Sbjct  240  VGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEK  299

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAG  99
            VVV K M HV FIGDGPTKTKIT + N   G + TY T+++ +EG++F A+++G EN+AG
Sbjct  300  VVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVEGDNFVAKNMGIENTAG  359

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
                QAVALRVSAD  +  NC IDGYQDTLY
Sbjct  360  PPGGQAVALRVSADCVVIFNCQIDGYQDTLY  390



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 148/216 (69%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK-KRRRLLSD----NDGFNFPAF  456
            GD GEKMKH L T  +LTSNGLA++T +T    +L  K  RRRLL+     ++  N P  
Sbjct  181  GDAGEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGSNAKNAPKV  240

Query  455  IDATA--RRLLNANA---GSIKPNVVVAKDGSGEFKSINDAINKAPPNN-DAPYVIKIKA  294
            I      +R L+ +     SIKP+ VVAKDGSG++++I +A+   P NN D  +VI +K 
Sbjct  241  IPTWINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKE  300

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+EYV++ K M +V+ IGDG TKTK+T +KN   G+ T+QTATV + G++F A+DIG 
Sbjct  301  GVYSEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDIGI  360

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            ENSAGA+ HQAVALRV +D +IF  C +DGYQDTLY
Sbjct  361  ENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLY  396



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 148/209 (71%), Gaps = 8/209 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDN-------DGFNFPAFI  453
            G++MK  LK + EL++N LAI++ ++ A  +LE+  +RRLL D+       D   FP + 
Sbjct  189  GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLGQRRLLQDDLPVLGHGDQI-FPTWT  247

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
            D   RRLL A A  IK ++VVAKDGSG+F +I DA++  P  +   +V+ IKAG+Y EY+
Sbjct  248  DFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKAGIYQEYI  307

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
               K+M +++ IGDG   T+I  NKN VDGI TY TATV + G++F A++IGFEN+AGA 
Sbjct  308  DFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFENNAGAI  367

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRVSAD+A+F NC++DG+QDT+Y
Sbjct  368  KHQAVALRVSADYALFYNCSMDGHQDTMY  396



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 141/212 (67%), Gaps = 7/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN-------FP  462
            G+ GEKMK  LKTA ELTSNGLA+++ ++    + +    RRL+S + G          P
Sbjct  176  GEAGEKMKGFLKTAQELTSNGLAMVSEISRLVGSPKLNSHRRLMSSSKGGQRNRNYKPVP  235

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++      LL A   S+KPNVVVAKDG+G++K+IN+A+ + P  +   +VI IK GVY 
Sbjct  236  GWMSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYIKKGVYE  295

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E V+V K M +VV IGDGPT T+I+ +K+  DG+ T +TAT A  G +F A+ IGFEN+A
Sbjct  296  ETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVTTMKTATFAALGNYFVAKGIGFENTA  355

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G  KHQAVALRV +D +IF NC +D YQDTLY
Sbjct  356  GHVKHQAVALRVQSDFSIFFNCHMDAYQDTLY  387



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 140/214 (65%), Gaps = 11/214 (5%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDG-FNFPAFIDA----  447
            G +M++LL T   ++SN LAIIT L    S L    +R+L+ D++  F     I +    
Sbjct  183  GNRMRNLLTTTMHMSSNALAIITALANTVSELSDVNKRQLVEDDEHVFGQDEVISSLIFD  242

Query  446  ------TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
                    RRLL  N   +K N +VAKDGS +FKSI+ A+ K P  N  P+VI I+ GVY
Sbjct  243  DDDDGGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVY  302

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            NEY+ V K M  VVF+GDG  KT+IT N+N +DG+ TY+TA+VAI G++F A +IGFENS
Sbjct  303  NEYIEVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASVAIHGDYFVAINIGFENS  362

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG  KHQAVA+RV AD +IF  C++DGY+DTLY 
Sbjct  363  AGPHKHQAVAIRVQADRSIFYRCSMDGYEDTLYV  396



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 143/210 (68%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     +   +   RRLLS       P+++D 
Sbjct  182  GNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQE----IPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A A     KP++VVA+DGSG++K+IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             + K+M H+VF+GDGP KT I+ +KN  DGI TY+T TVAI G+ F A++IGF N+AG  
Sbjct  298  QINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPA  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            K QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  358  KFQAVAVRVQSDESIFFNCRFDGYQDTLYA  387



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 145/205 (71%), Gaps = 9/205 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            G++G+KMK  LK + ELTSN LA++    E ++ LEA   +           P + D   
Sbjct  171  GESGQKMKDALKISMELTSNALAMVA---EISTFLEAMGMQSF------SELPDWADFNK  221

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            R+LL A+   +KP++VVAKDGSG++++IN+A+   P  ++  +V+ IK GVY E V +  
Sbjct  222  RKLLTASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEEKVQINS  281

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
            ++ H++ +GDGPTKT+IT + N +DG GTYQTATVA++G+ F A++IGFENSAGA KHQA
Sbjct  282  SLTHLMMVGDGPTKTRITGHLNFIDGTGTYQTATVAVQGDDFIAKEIGFENSAGAAKHQA  341

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRVSAD +IF NC +DGYQDTLY
Sbjct  342  VALRVSADKSIFYNCHMDGYQDTLY  366



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 143/210 (68%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     +   +   RRLLS       P+++D 
Sbjct  182  GNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQE----IPSWVDQ  237

Query  446  TARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A A     KP++VVA+DGSG++K+IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             + K+M H+VF+GDGP KT I+ +KN  DGI TY+T TVAI G+ F A++IGF N+AG  
Sbjct  298  QINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPA  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            K QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  358  KFQAVAVRVQSDESIFFNCRFDGYQDTLYA  387



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 143/219 (65%), Gaps = 16/219 (7%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL---EAKKRRRLLSDNDGF--------  471
            D GE+MK LLKT+  L+SNGLA++  +  A + L   +   RRRLLS  DG         
Sbjct  192  DAGEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRRLLS-FDGLPILGHGDL  250

Query  470  NFPAFIDATARRLLNANAGSI----KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIK  303
              P + +A  R+LL  +        KP+ VV+KDGSG +K+I +A+   P   +  +VI 
Sbjct  251  ELPEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALEHVPKYGNETFVIY  310

Query  302  IKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARD  123
            IK GVYNE V V ++M +V+ IGDG  KT+IT N N VDG  TY+TA VAI G+HF A D
Sbjct  311  IKEGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTPTYRTAAVAIHGDHFMAMD  370

Query  122  IGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            IGFENSAG +KHQAVALRVSAD AIF  C++DGYQDTLY
Sbjct  371  IGFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLY  409



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 141/212 (67%), Gaps = 7/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN-------FP  462
            G+ GEKM+  LKTA ELTSNGLA+++ ++    + +    RRL+S + G          P
Sbjct  176  GEAGEKMRGFLKTAQELTSNGLAMVSEISRLVDSPKLNSHRRLMSSSKGGQTKRNYKPVP  235

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++      LL A   S+KPNVVVAKDG+G++K+IN+A+ + P  ++  +VI IK G+Y 
Sbjct  236  GWMSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYE  295

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSA  102
            E V+V K M +VV IGDGPT T+I+ +K+  DGI T  TAT A  G +F A+ IGFEN+A
Sbjct  296  ETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFENTA  355

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G  KHQAVALRV +D +IF NC +D YQDTLY
Sbjct  356  GHVKHQAVALRVQSDFSIFFNCHMDAYQDTLY  387



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 149/232 (64%), Gaps = 26/232 (11%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNF------  465
            GDTGEKMK+LL ++G + SNGLA++ +++   S+L       RRLL +     +      
Sbjct  160  GDTGEKMKNLLHSSGMMLSNGLAMVGDISSIFSSLSLGGFTSRRLLEEEGSLAYGVDQTD  219

Query  464  ------------------PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINK  339
                              P+F+DA ARR++ AN  ++K N+VVA+DGSG+FK+I  AIN 
Sbjct  220  GEDPKTAFDGKVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINS  279

Query  338  APPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTAT  159
             P   D P+VI +KAG Y E V+ PK +N+VV IGDGP KT+I+ +KN VDG+ T+ TA 
Sbjct  280  LPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAV  339

Query  158  VAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            + + G+ F A+DIG EN+AG  KHQAVA+RVS D +IF N  ++ +QDTLYA
Sbjct  340  LGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYA  391



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGF-NFPAFID  450
            G   +KMK +L+ + ELTSNGLA++T ++    +L      RR L  + DG   FP+++D
Sbjct  189  GAAAKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVSRRLLTEEQDGIPEFPSWVD  248

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               R+LL A    IKP+VVVA+DGSG++K+I +A+N+ P  N+  +VI IK GVY E V+
Sbjct  249  EGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKTFVIYIKEGVYKEKVL  308

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V K   +V+ IGDGPTKT IT + N VDG+ T  TAT    G +F A+DI FENSAGA+K
Sbjct  309  VDKKTTNVMIIGDGPTKTVITGSLNYVDGVQTCNTATFTAIGSYFIAKDIKFENSAGAEK  368

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV +D ++  NC +D +QDTLYA
Sbjct  369  HQAVALRVQSDMSVIYNCHMDAFQDTLYA  397



>gb|KEH37213.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=565

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 142/205 (69%), Gaps = 8/205 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNG---LAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GE M  +LKT+ EL+SN    + +++++ +  +  +    RRLLSD DG   P+++    
Sbjct  181  GETMTKVLKTSMELSSNAIDMMDVVSHIIKGFNPSQYGVSRRLLSD-DGI--PSWVSDGH  237

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            R LL    G++K N VVA+DGSG+FK++ DA+   PP N AP+VI +KAGVY E V V K
Sbjct  238  RHLLAG--GNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAK  295

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
             MN+V  IGDGPTKTK T + N  DGI TY+TAT  + G +F A+DIGFEN+AG  K+QA
Sbjct  296  EMNYVTVIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTNKNQA  355

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRV+AD AIF NC +DG+QDTLY
Sbjct  356  VALRVTADQAIFHNCQMDGFQDTLY  380



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   207 bits (526),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 112/213 (53%), Positives = 147/213 (69%), Gaps = 11/213 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA---KKRRRLLSD------NDGFN  468
            G+T EKMK  L ++ ELTSN L +IT ++   ++L A    +RRRLL D      +    
Sbjct  174  GETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRRLLFDEAPVLGHGNEL  233

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
             P ++D   RRLL A    IKP++VVAKDGSG++K+IN+A+   P N +  YV+ IK G+
Sbjct  234  LPDWVDMRRRRLLAAK--EIKPDIVVAKDGSGKYKTINEALKNIPNNRNQTYVLYIKQGI  291

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            YNE V    +M +++ IGDGPTKT+IT N+N  DG  TY TAT A+ G++F A+DIGFEN
Sbjct  292  YNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFIAKDIGFEN  351

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTL  9
            SAG +KHQAVALRV+AD +IF NC IDGYQDTL
Sbjct  352  SAGPEKHQAVALRVAADKSIFYNCHIDGYQDTL  384



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 147/209 (70%), Gaps = 8/209 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDN-------DGFNFPAFI  453
            G++MK  LK + EL++N LAI++ ++ A  +LE+  +RRLL D+       D   FP + 
Sbjct  189  GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLGQRRLLQDDLPVLGHGDQI-FPTWT  247

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
            D   RRLL A A  IK ++VVAKDGSG+F +I +A++  P  +   +V+ IKAG+Y EY+
Sbjct  248  DFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKAGIYQEYI  307

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
               K+M +++ IGDG   T+I  NKN VDGI TY TATV + G++F A++IGFE +AGA 
Sbjct  308  DFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFEKNAGAI  367

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRVSAD+A+F NC++DG+QDTLY
Sbjct  368  KHQAVALRVSADYALFYNCSMDGHQDTLY  396



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 140/206 (68%), Gaps = 3/206 (1%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDATAR  438
             E M+  ++ + ++TSN LA++  L     +L      RR+LLSD     FP+++ A  R
Sbjct  181  AETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSLLRRKLLSDAGANEFPSWMPAAQR  240

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            RLL      I PNV VA+DG+G+F++I +A+ + P +N+A +VI +KAGVY E  +V K+
Sbjct  241  RLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKAGVYKERFLVDKH  300

Query  257  MNHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
            M  V  IGDGPTKTKIT N + + G I T++TATVA+ GE F    +GFEN+AG +KHQA
Sbjct  301  MTKVTMIGDGPTKTKITGNVSVIAGEISTFKTATVAVAGEWFVGIGLGFENTAGPEKHQA  360

Query  80   VALRVSADHAIFSNCAIDGYQDTLYA  3
            VALRV+AD ++F NC +DGYQDTLYA
Sbjct  361  VALRVNADRSVFYNCRMDGYQDTLYA  386



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 142/211 (67%), Gaps = 13/211 (6%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            ++M ++ KT+ ELTSN LA++T         N+T     L A   R+LLS  DG   P +
Sbjct  179  QEMINIFKTSRELTSNSLAMVTGMSTLLPNSNITGLTGVL-ASYARKLLSTEDGI--PTW  235

Query  455  IDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEY  276
            +   ARRL+ A  G +K N VVA+DGSG+FK+I DA+N  P  +  P++I IK G+Y E 
Sbjct  236  VGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEGIYKEK  295

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            V+V K M HV FIGDGPTKT IT + N ++  + T+ TAT+ I+G HFTA+ IG EN++G
Sbjct  296  VIVTKKMPHVTFIGDGPTKTVITGSLNFRIGKVKTFLTATITIQGNHFTAKSIGIENTSG  355

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             +  QAVALRVSAD+A+F NC IDGYQ+TLY
Sbjct  356  PKGGQAVALRVSADYAVFYNCQIDGYQNTLY  386



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 148/232 (64%), Gaps = 26/232 (11%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNF------  465
            GDTGEKMK+LL ++G + SNGLA++ +++   S+L        RLL +     +      
Sbjct  160  GDTGEKMKNLLHSSGMILSNGLAMVGDISSIFSSLSLGGFTSGRLLEEEGSLAYGVDQTD  219

Query  464  ------------------PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINK  339
                              P F+DA ARR++ AN  ++K N+VVA+DGSG+FK+I  AIN 
Sbjct  220  GEDLKTAFDGKVTDAAGPPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINS  279

Query  338  APPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTAT  159
             P   D P+VI +KAG Y E V+ PK +N+VV IGDGP KT+I+ +KN VDG+ T+ TA 
Sbjct  280  LPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAV  339

Query  158  VAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            + + G+ F A+DIG EN+AG  KHQAVA+RVS D +IF N  ++G+QDTLYA
Sbjct  340  LGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYA  391



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 142/212 (67%), Gaps = 15/212 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--------RRLLSDNDGFNFPAFI  453
            ++M+H+ KT  EL+SN LA++T+++       A           R+LL+  DG   P ++
Sbjct  179  QEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTEDGI--PTWV  236

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
               ARRL+ A  G +K N VVA+DGSG+FK+INDA+N  P  N  P+VI IK G+Y E V
Sbjct  237  GPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQGIYKEKV  296

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIG---TYQTATVAIEGEHFTARDIGFENSA  102
            +V + M +V FIGDG TKT IT N+N   GIG   T+QTA + +EG+HFT ++IG EN+A
Sbjct  297  MVTRKMPYVTFIGDGQTKTVITGNQNY--GIGKVKTFQTAPLIVEGDHFTMKNIGVENTA  354

Query  101  GAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G +  QAVALRVSAD+A+F +C  DGYQDTLY
Sbjct  355  GPEGGQAVALRVSADYAVFHSCQFDGYQDTLY  386



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 145/213 (68%), Gaps = 10/213 (5%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL---EAKKRRRLLSD------NDGFNF  465
            D  E+MK +L T+  L+SN LA+++ +  A + L   ++  RR L  D      +  F  
Sbjct  193  DAAEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSSHRRLLQFDAFPVIGHSEFED  252

Query  464  PAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            P + +   R+L +A   + KP+++VAKDGSG +K+I +A++  P   +  ++I IK GVY
Sbjct  253  PKWYEGGVRKLSSAPKIN-KPDIIVAKDGSGSYKTITEALDHVPKYGNETFIIYIKEGVY  311

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            NE+++V ++M  V+ IGDG  KT+IT NKN  DG  TY TATVAI+G+HF ARDIGFENS
Sbjct  312  NEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTPTYHTATVAIQGDHFMARDIGFENS  371

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            AG +KHQAVALRVSAD AIF  C++DGYQDTLY
Sbjct  372  AGPEKHQAVALRVSADEAIFYRCSMDGYQDTLY  404



>emb|CAB65291.1| pectin methyl-esterase PEF1 [Medicago truncatula]
Length=565

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 139/205 (68%), Gaps = 8/205 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNG---LAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            GE M  +LKT+ EL+SN    + +++ + +     +    RRLLSD DG   P+++    
Sbjct  181  GETMAKVLKTSMELSSNAIDMMDVVSRILKGFHPSQYGVSRRLLSD-DGI--PSWVSDGH  237

Query  440  RRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            R LL    G++K N VVA+DGSG+FK++ DA+   PP N AP+VI +KAGVY E V V K
Sbjct  238  RHLLAG--GNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAK  295

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
             MN+V  IGDGPTKTK T + N  DGI TY+TAT  + G +F A+DIGFEN+AG  K QA
Sbjct  296  EMNYVTVIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTSKFQA  355

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRV+AD AIF NC +DG+QDTL+
Sbjct  356  VALRVTADQAIFHNCQMDGFQDTLF  380



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 144/217 (66%), Gaps = 13/217 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL---EAKKRRRLLSD------NDGFNF  465
            D  E+MK++LKT+  L+SN LA+++ +  A + L   +   RR L  D      +  F  
Sbjct  193  DAAEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPSHRRLLQFDAFPVIGHSEFED  252

Query  464  PAFIDATARRLLNANAGSI----KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIK  297
            P +     R+LL  +  S     KP+++VAKDGSG +K+I +A+   P   +  ++I IK
Sbjct  253  PKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVPKYGNETFIIYIK  312

Query  296  AGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIG  117
             G+YNE+++V ++M +V+ IGDG  KT+IT NKN VDG  TY TATVAI+G+HF   DIG
Sbjct  313  EGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDGTTTYHTATVAIQGDHFMVMDIG  372

Query  116  FENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            FENSAG +KHQAVALRVSAD AIF  C++DGYQDTLY
Sbjct  373  FENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLY  409



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 148/207 (71%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA +LT NGLA+++ ++     L+      RRLLS +    +P+++  
Sbjct  185  GNAGETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLNSRRLLSSD----YPSWVGP  240

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             +R LL A    +KP++VVA+DGSG++K+IN+A++  P   ++ +V+ IKAG+Y EY+ V
Sbjct  241  RSRHLLAAT--EVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKEYIQV  298

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             ++M ++VFIGDGP KT I+ +K   DGI T++T TVAI G++F A++IGFEN+AGA KH
Sbjct  299  NRSMTNLVFIGDGPDKTIISGDKGFKDGITTFRTQTVAIIGDNFIAKNIGFENTAGAIKH  358

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QAVA+RV +D A+F NC  DGYQDTLY
Sbjct  359  QAVAVRVQSDMAVFHNCRFDGYQDTLY  385



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 143/209 (68%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAA-----STLEAKKRRRLLSDNDGFNFPAFI  453
            + G+ M  +L  + EL++N + I+  +         S+L +   R+LLS+ DG   P+++
Sbjct  184  EAGQTMAKVLNASLELSNNAMDIVNGVAGFVKGLNLSSLTSAMSRKLLSE-DGI--PSWV  240

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              + RRLL A    + PNV+VA+DGSG+FK++N+A+   P  N  P+VI +KAGVYNEYV
Sbjct  241  GQSQRRLLEA-PHDVTPNVIVAQDGSGQFKTLNEALELVPKKNKIPFVIYVKAGVYNEYV  299

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             + K+ +HV  IGDGPTKT  T NKN VDG+ TY TAT +I    F A ++GFENSAGA+
Sbjct  300  ALDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQTYNTATFSINAADFMAINVGFENSAGAE  359

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV+AD A+F NC +DG+QDTLY
Sbjct  360  KHQAVALRVTADKAVFYNCQMDGFQDTLY  388



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 139/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRL  432
            GE M+ +L ++ ELTSN LAI+ N  +  S+L     R+LL++     +P+++    RRL
Sbjct  173  GESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLPINRKLLAEG----YPSYVTPGKRRL  228

Query  431  LNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMN  252
            L  +   +KPNVVVA+DGSG+ K+I +AI++ P      ++I IK G Y E V V K+  
Sbjct  229  LATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKEKVHVNKSAT  288

Query  251  HVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVAL  72
            +V+ IGDGPTKTKIT + N VDG  T+ TATVA+ G+ F A+D+  ENSAGA+KHQAVAL
Sbjct  289  NVMLIGDGPTKTKITGSLNYVDGTRTFDTATVAVVGDGFVAKDLWIENSAGAEKHQAVAL  348

Query  71   RVSADHAIFSNCAIDGYQDTLY  6
            RV +D ++F NC IDGYQDTLY
Sbjct  349  RVQSDMSVFYNCRIDGYQDTLY  370



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 137/195 (70%), Gaps = 5/195 (3%)
 Frame = -2

Query  575  ELTSNGLAIITNLTEAASTLEAKKRRRLLSDN-----DGFNFPAFIDATARRLLNANAGS  411
            EL++N L I++ ++ A  +LE+   RRLL D+      G  FP + D   RRLL A    
Sbjct  201  ELSANLLDIVSGISSAIPSLESFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLAAPVSK  260

Query  410  IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGD  231
            IK ++VVAKDGSG+F +I +A+   P  +   +V+ IKAGVY EY+ + K M ++V IGD
Sbjct  261  IKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVIGD  320

Query  230  GPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHA  51
            G   T+I  NKN VDGI T+ TATVA+ G++F A++IGFEN+AGA KHQAVALRVSAD+A
Sbjct  321  GKENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVSADYA  380

Query  50   IFSNCAIDGYQDTLY  6
            IF NC++DG+QDTLY
Sbjct  381  IFYNCSMDGHQDTLY  395



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 142/211 (67%), Gaps = 9/211 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEA-----ASTLEAKKRRRLLSDNDGF--NFPA  459
            + G+ M  +L  + EL++N L I+  ++        S+      R+LLS+       FP 
Sbjct  154  EAGKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEETALVDGFPT  213

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            ++    RRLL A     KP+VVVA+DGSG+ K+I++A+   P  N  P+VI IKAG+YNE
Sbjct  214  WVSEGQRRLLQAV--DPKPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIYNE  271

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            Y+++ K++ +V  IGDGPTKT+IT +KN VDG+ TY TAT  +   +F A++IGFEN+AG
Sbjct  272  YIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENTAG  331

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            A+KHQAVALRV+AD A+F NC +DG+QDTLY
Sbjct  332  AEKHQAVALRVTADKAVFYNCNMDGFQDTLY  362



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 142/209 (68%), Gaps = 9/209 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLT-----EAASTLEAKKRRRLLSDNDGFNFPAFI  453
            + G+ M  +L T+ EL++N L I+  ++        S+      R+LLS+ DGF  P ++
Sbjct  182  EAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLSEVDGF--PTWV  239

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
                RRLL A     K +VVVA+DGSG+ K+I++A+   P  N  P+VI +KAGVY EY+
Sbjct  240  SEGQRRLLQA--ADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYVKAGVYQEYI  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
            ++ K++ HV  IGDGPTKT+IT +KN VDGI TY TAT  +   +F A +IGFEN+AGA+
Sbjct  298  MINKHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFGVNAANFMAMNIGFENTAGAE  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV+AD A+F NC +DG+QDTLY
Sbjct  358  KHQAVALRVTADKAVFYNCNMDGFQDTLY  386



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 140/207 (68%), Gaps = 10/207 (5%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTE-----AASTLEAKKRRRLLSDNDGFNFPAFIDA  447
            GE M   L T+ EL+SN L II  ++        + +     R+LLS NDGF  P+++  
Sbjct  190  GEIMAKALNTSLELSSNSLDIINAVSSLLKDAGENNVNVNLNRKLLS-NDGF--PSWVSE  246

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              R +L    G+ KPN VVA+DGSG+FK++++A+   P  N  P+VI +KAG+YNE V V
Sbjct  247  GQRHILME--GNFKPNAVVAQDGSGQFKTLSEALLTVPSYNAEPFVIYVKAGIYNENVNV  304

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K M HV  IGDGPTKT+ T + N VDG+ TY TAT  + G +F A+D+GFEN+AGA+KH
Sbjct  305  LKEMTHVTIIGDGPTKTRFTASLNYVDGVQTYNTATFGVNGANFMAKDVGFENTAGAEKH  364

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QAVALRV+AD A+F NC +DG+QDTLY
Sbjct  365  QAVALRVTADQAVFYNCQMDGFQDTLY  391



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 142/210 (68%), Gaps = 8/210 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G+ GE MK  LKTA ELT NGLAII+ ++     +   +   RRLLS      FP+++D 
Sbjct  182  GNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQE----FPSWVDQ  237

Query  446  TARRLLNANAGSIKP--NVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
              RRLL A A       ++VVA+DGSG++K+IN+A+   P   +  +V+ IKAG+Y EYV
Sbjct  238  RGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             + K+M H+VF+GDGP KT I+ +KN  DGI TY+T TVAI G+ F A++IGF N+AG  
Sbjct  298  QINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPA  357

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            K QAVA+RV +D +IF NC  DGYQDTLYA
Sbjct  358  KFQAVAVRVQSDESIFFNCRFDGYQDTLYA  387



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 137/195 (70%), Gaps = 5/195 (3%)
 Frame = -2

Query  575  ELTSNGLAIITNLTEAASTLEAKKRRRLLSDN-----DGFNFPAFIDATARRLLNANAGS  411
            EL++N L I++ ++ A  +LE+   RRLL D+      G  FP + D   RRLL A    
Sbjct  201  ELSANLLDIVSGISSAIPSLESFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLAAPVSK  260

Query  410  IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGD  231
            IK ++VVAKDGSG+F +I +A+   P  +   +V+ IKAGVY EY+ + K M ++V IGD
Sbjct  261  IKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVIGD  320

Query  230  GPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHA  51
            G   T+I  NKN VDGI T+ TATVA+ G++F A++IGFEN+AGA KHQAVALRVSAD+A
Sbjct  321  GRENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVSADYA  380

Query  50   IFSNCAIDGYQDTLY  6
            +F NC++DG+QDTLY
Sbjct  381  VFYNCSMDGHQDTLY  395



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 133/208 (64%), Gaps = 2/208 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDA  447
            G   +KM+ LL T+ EL SN LA++T  +     L   K   RRLL+ +DGF  P ++D 
Sbjct  211  GAEKDKMQKLLNTSKELGSNALAVVTQASAIFKALRGSKSSERRLLASDDGFVVPDWVDP  270

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
             +RR+L +      PN  VAKDG+G F +I  A++  P      YVI IK G+Y+E VVV
Sbjct  271  ESRRVLKSKESKFTPNATVAKDGTGNFTTIAAALDAIPEKFKGRYVIYIKEGIYDESVVV  330

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K M ++   GDG  K+ IT NKN VDG+ TYQTAT A+ G+ F  + +GF N+AG +KH
Sbjct  331  SKKMQNITMYGDGSQKSIITGNKNYVDGVPTYQTATFAVVGDGFLGQSLGFRNTAGPEKH  390

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D +IF NC ++GYQDTLYA
Sbjct  391  QAVALRVQSDRSIFVNCRMEGYQDTLYA  418



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 139/215 (65%), Gaps = 10/215 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN---------  468
            GD GEKM+  LKT+ ELT+NGLA++  ++     L  K  RRLL    G           
Sbjct  179  GDAGEKMREFLKTSQELTNNGLAMVDQVSTMFGALNVKSGRRLLEATAGTGAKKFQKAKV  238

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP-YVIKIKAG  291
             PA+ID     L  A   ++KP+VVVAK G G++ ++N+A+   P +N    +VI +K G
Sbjct  239  IPAWIDNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVKEG  298

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VY E+V+  K+M +V+ IGDGPTKT IT  KN  +G  T QTATV + G++F A+DIGFE
Sbjct  299  VYEEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTKTMQTATVGVVGDYFIAKDIGFE  358

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            N+AGA  HQAVALRV +D +IF NC +DGYQDTLY
Sbjct  359  NTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTLY  393



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 142/211 (67%), Gaps = 9/211 (4%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEA-----ASTLEAKKRRRLLSDNDGF--NFPA  459
            + G+ M  +L  + EL++N L I+  ++        S+      R+LLS+       FP 
Sbjct  181  EAGKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEETALVDGFPT  240

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            ++    RRLL A     KP+VVVA+DGSG+ K+I++A+   P  N  P+VI IKAG+YNE
Sbjct  241  WVSEGQRRLLQAV--DPKPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIYNE  298

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            Y+++ K++ +V  IGDGPTKT+IT +KN VDG+ TY TAT  +   +F A++IGFEN+AG
Sbjct  299  YIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENTAG  358

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            A+KHQAVALRV+AD A+F NC +DG+QDTLY
Sbjct  359  AEKHQAVALRVTADKAVFYNCNMDGFQDTLY  389



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 136/206 (66%), Gaps = 7/206 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFN-------FPAFIDAT  444
            M+  LKTA ELTSNGLA+++ ++    + +    RRL+S + G          P ++   
Sbjct  1    MRGFLKTAQELTSNGLAMVSEISRLVDSPKLNSHRRLMSSSKGGQTKRNYKPVPGWMSDR  60

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
               LL A   S+KPNVVVAKDG+G++K+IN+A+ + P  ++  +VI IK G+Y E V+V 
Sbjct  61   HLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVIVD  120

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K M +VV IGDGPT T+I+ +K+  DGI T  TAT A  G +F A+ IGFEN+AG  KHQ
Sbjct  121  KEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFENTAGHVKHQ  180

Query  83   AVALRVSADHAIFSNCAIDGYQDTLY  6
            AVALRV +D +IF NC +D YQDTLY
Sbjct  181  AVALRVQSDFSIFFNCHMDAYQDTLY  206



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK-KRRRLLSDN----DGFNFPAF  456
            GD G+KMK  L T  +LTSNGLA++T +T    +L  K  RRRLL+      +  N P  
Sbjct  181  GDAGDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGGNAKNAPKV  240

Query  455  IDATA--RRLLNANA---GSIKPNVVVAKDGSGEFKSINDAINKAPPNN-DAPYVIKIKA  294
            I      +R L+ +     SIKP+ VVAKDGSG++++I +A+   P NN D  +VI +K 
Sbjct  241  IPTWINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKE  300

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGF  114
            GVY+EYV++ K M +V+ IGDG  KTK+T +KN   G+ T+QTATV + G++F A+DIG 
Sbjct  301  GVYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDIGI  360

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            ENSAGA+ HQAVALRV +D +IF  C +DGYQDTLY
Sbjct  361  ENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLY  396



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 143/207 (69%), Gaps = 7/207 (3%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGFNFPAFIDATAR  438
            GE+MK ++KTA +LTSN LAI+T L++  ++ +     RR L + N+GF  P ++  + R
Sbjct  197  GEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIPNFNRRLLSTSNEGF--PEWVSQSKR  254

Query  437  RLLNAN--AGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            RL   +  A SI P+VVVA+DGSG   ++N+A+   P     P+VI +K G+Y E V + 
Sbjct  255  RLFTEDTPAESI-PDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYKENVNIE  313

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            KNM +V  IGDGPTK+ IT   N VDG+ T+ TATV + G  F A+++GFENSAGA+KHQ
Sbjct  314  KNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNGFVAKNMGFENSAGAEKHQ  373

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVALRV +D +IF NC +DGYQDTLYA
Sbjct  374  AVALRVESDFSIFYNCQMDGYQDTLYA  400



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 8/205 (4%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNL----TEAASTLEAKKRRRLLSDNDGFNFPAFIDATARR  435
            M ++ K + +L+SN LA++T+L    TE     E   R+ L ++ DG   P ++   ARR
Sbjct  179  MINIFKRSRQLSSNSLAMVTDLNSNATELTGAFENNARKLLSTEEDGV--PTWVGPEARR  236

Query  434  LLNANAGS-IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            L+ A  G  +K N VVA+DGSG+FK+INDA+N  P  N  P+VI IK GVY E VVV + 
Sbjct  237  LMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVVTRK  296

Query  257  MNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
            M +V FIGDGPTKT IT + N  +  + TY TA + +EGEHFTA+ IG EN+AG +  QA
Sbjct  297  MPYVTFIGDGPTKTVITGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAGPEGGQA  356

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRVS D+A+F +C IDGYQDTLY
Sbjct  357  VALRVSGDYAVFFDCQIDGYQDTLY  381



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 147/220 (67%), Gaps = 16/220 (7%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL----EAKKRRRLLSDNDGF-------  471
            D G++MK LLKT+  L+SNGLA+++ +  A + L     ++ RRR L   DG        
Sbjct  192  DAGQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRRRRLLSLDGLPILGHGD  251

Query  470  -NFPAFIDATARRLLNANAGSI----KPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVI  306
              FP + +A  R+LL  +        KP+ VVAKDGSG +K+I++A+   P   +  +VI
Sbjct  252  LEFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEALEHVPKYGNETFVI  311

Query  305  KIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTAR  126
             IK GVYNE V V ++M +V+ IGDG  KT+IT N+N VDG  TY+TATVAI G+HF A 
Sbjct  312  YIKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTPTYRTATVAIHGDHFMAM  371

Query  125  DIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            DIGF+NSAG +KHQAVALRVSAD AIF  C++DGYQDTLY
Sbjct  372  DIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLY  411



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 140/207 (68%), Gaps = 8/207 (4%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAA--STLEAKKRRRLLSDNDGFNFPAFIDATARR  435
            + M  + KT+ EL+SN LA++T ++     S L AK  R+LLS  D  + P ++   ARR
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTAKYARKLLSTED--SIPTWVGPEARR  236

Query  434  LLNANAGS---IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            L+ A  G    +K N VVA+DG+G+FK+I DA+N  P  N  P++I IK G+Y E V V 
Sbjct  237  LMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYKEKVTVT  296

Query  263  KNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
            K M HV FIGDGP KT IT + N  +  + T+ TAT+ IEG+HFTA++IG EN+AG +  
Sbjct  297  KKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNIGIENTAGPEGG  356

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QAVALRVSAD+A+F +C IDG+QDTLY
Sbjct  357  QAVALRVSADYAVFHSCQIDGHQDTLY  383



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 143/214 (67%), Gaps = 16/214 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M  + KT+ EL+SN LA++T         N+T    TL A   R+LLS  DG   P +
Sbjct  177  QDMLKIFKTSRELSSNSLAMVTDLSTILPNSNITGLTGTL-ANYARKLLSTKDGI--PTW  233

Query  455  IDATARRLLNANAG---SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            +   ARRL+ A  G    +K N VVA+DGSG+FK+I DA+N  P +N  P+VI IK G+Y
Sbjct  234  VGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIADALNAVPKDNRLPFVIHIKQGIY  293

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFEN  108
             E V+V K M +V FIGDGPTKTKIT + N  +  + T+ TATV I+GEHFTA++I  EN
Sbjct  294  KEKVIVTKKMPYVTFIGDGPTKTKITGSLNFGLGKVKTFLTATVTIDGEHFTAKNIWIEN  353

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +  QAVALRVSAD+A+F +C IDGYQDTLY
Sbjct  354  TAGPEGGQAVALRVSADYAVFYSCQIDGYQDTLY  387



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 135/205 (66%), Gaps = 3/205 (1%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAAST--LEAKKRRRLLSDNDGFNFPAFIDATARR  435
            E M   +K + ++TSN LA+I        +  + +   R+LLS      FP ++ A   R
Sbjct  180  EAMHQAIKNSTQITSNALAMINQFDNLVGSFNISSHAGRKLLSGTRANEFPWWMSAAQER  239

Query  434  LLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNM  255
             L      IKPNV VA+DG+G+FK+I++A+   P  N+  +VI +KAGVY E V+V K+M
Sbjct  240  FLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFVIYVKAGVYKEGVLVDKHM  299

Query  254  NHVVFIGDGPTKTKITENKNKVDG-IGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
             HV  IGDGPTKTKIT + + + G I T++TATVA+ GE FT   +GFEN+AG Q HQAV
Sbjct  300  THVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVAGEWFTGMGLGFENTAGPQNHQAV  359

Query  77   ALRVSADHAIFSNCAIDGYQDTLYA  3
            ALRV+AD ++F NC +DGYQDTLYA
Sbjct  360  ALRVNADRSVFYNCRMDGYQDTLYA  384



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 142/223 (64%), Gaps = 17/223 (8%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTL----EAKKRRRLLSDNDGF-----N  468
            GD GEKMK  L  + ELTSNGL + T L+    +L    +  K +R+L +  G       
Sbjct  186  GDAGEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLEEQGEAKNKEE  245

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAP--------PNNDAPY  312
             P ++D   ++LL+    ++K +VVVAKDGSG FK+I +A+ +AP           +  +
Sbjct  246  IPHWVDTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDATKVEKGTNKTF  305

Query  311  VIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFT  132
            VI IK GVY E V V  NM  V+ IGDGPTKTKIT  KN  DG   ++TATV+I G +F 
Sbjct  306  VIYIKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFVLFKTATVSIFGHNFI  365

Query  131  ARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            A+DIGFENSAGA+KHQA+AL V +D ++F NC I+GYQDTLYA
Sbjct  366  AKDIGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYA  408



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 138/204 (68%), Gaps = 7/204 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEA---KKRRRLLSDNDGFNFPAFIDATARRL  432
            M ++ K + +L+SN LA++T+L   A+ L        R+LLS  DG   P ++   ARRL
Sbjct  179  MINIFKRSRQLSSNSLAMVTDLNSNATELTGAFENNARKLLSTEDGV--PTWVGPEARRL  236

Query  431  LNANAGS-IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNM  255
            + A  G  +K N VVA+DGSG+FK+INDA+N  P  N  P+VI IK GVY E VVV + M
Sbjct  237  MGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVVTRKM  296

Query  254  NHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
             +V FIGDGPTKT I+ + N  +  + TY TA + +EGEHFTA+ IG EN+AG +  QAV
Sbjct  297  PYVTFIGDGPTKTVISGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAGPEGGQAV  356

Query  77   ALRVSADHAIFSNCAIDGYQDTLY  6
            ALRVS D+A+F +C IDGYQDTLY
Sbjct  357  ALRVSGDYAVFFDCQIDGYQDTLY  380



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 137/207 (66%), Gaps = 9/207 (4%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDN------DGFNFPAFIDA  447
            + M  +LK + ELT+N L II  L+     L       +L++N      DG   P+++  
Sbjct  185  QTMAKVLKASLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSEDGL--PSWVSQ  242

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
            + R+LL A   ++KPN VVA+DGSG+FK++ +A+   P  N  P+VI +KAG+Y EYV V
Sbjct  243  SQRKLLAAPE-NVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGIYKEYVSV  301

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K+ +HV  IGDGPTKT  T +K+  DG+ TY TAT  +   HFTA ++GFENSAGA KH
Sbjct  302  DKDRDHVTIIGDGPTKTIFTGSKSYADGVQTYNTATFGVNSAHFTALNVGFENSAGAAKH  361

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLY  6
            QAVALRV+AD A+F NC +DGYQDTLY
Sbjct  362  QAVALRVTADKALFYNCQMDGYQDTLY  388



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 135/216 (63%), Gaps = 10/216 (5%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFID---  450
            GD  EKM   +K   ELT NGLA+    ++     +    RRLL+D++        D   
Sbjct  168  GDAAEKMMEFMKLGKELTINGLALANGFSDLLLPNDHGAGRRLLADSNKMGLINKADYIG  227

Query  449  -------ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
                      RRLL A  G IKP+V VAKDGSG F +I +A+   P + +  Y+I IKAG
Sbjct  228  EHWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVPLSCNDTYIIYIKAG  287

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VY E ++V  +M  V+FIGDGP  TKIT NK+KV G  T+ TATV ++G++F A+DIGFE
Sbjct  288  VYQENIIVGTSMWSVMFIGDGPNATKITGNKSKVGGTETFWTATVGVDGDNFIAKDIGFE  347

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            NSAGA  HQAVALR S D +IF NC IDGYQDT++A
Sbjct  348  NSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFA  383



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 134/200 (67%), Gaps = 12/200 (6%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLN-  426
            M  LL +  EL+ N L+++ +  +  +      R+ L +D+         DATARRLL  
Sbjct  1    MVKLLNSTRELSINALSMLNSFGDMVAQATGLNRKLLTTDSS--------DATARRLLQI  52

Query  425  ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHV  246
            +NA   KPN  VA DGSG++K+I +A++  P  N  P++I IKAGVY EY+ +PK+M +V
Sbjct  53   SNA---KPNATVALDGSGQYKTIKEALDAVPKKNTEPFIIFIKAGVYKEYIDIPKSMTNV  109

Query  245  VFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRV  66
            V IG+GPTKTKIT NK+  DG  T+ T TV + G +F A++IGFEN+AG +K QAVALRV
Sbjct  110  VLIGEGPTKTKITGNKSVKDGPSTFHTTTVGVNGANFVAKNIGFENTAGPEKEQAVALRV  169

Query  65   SADHAIFSNCAIDGYQDTLY  6
            SAD AI  NC IDGYQDTLY
Sbjct  170  SADKAIIYNCQIDGYQDTLY  189



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 141/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR-RRLLSDNDGFN--FPAFID  450
            GD  + M   L ++  LTSN LAII  ++   ++ +     RRLLSD++G    FP+++ 
Sbjct  189  GDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLGRRLLSDDEGERGEFPSWVG  248

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               R+LL  +   IKP+V VA+DGSG++K+I  A++  P   +A +VI IK GVY E V+
Sbjct  249  NDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKEGVYKENVM  308

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            V ++M +V+  GDGPTKTKIT + N VDG  T++TAT+A+ G+ F  +++G EN+AGA K
Sbjct  309  VDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGDGFIGKNLGVENTAGAAK  368

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLY  6
            HQAVALRV +D ++F  C +DGYQDTLY
Sbjct  369  HQAVALRVQSDKSVFYLCQMDGYQDTLY  396



>ref|XP_003534837.2| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=490

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 7/207 (3%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDN----DGFNFPAFIDAT  444
            +KM   + ++ EL+SN L +   ++   +    K   RRLLS+     DGF   ++++  
Sbjct  64   QKMAMAMSSSLELSSNALDMTDTISRMLNGFRPKIFNRRLLSEEATVVDGF--LSWVNEG  121

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             RR L    GS+KPN VVA+DGSG+FK++ +A+   P NND P+VI++KAGVY E V V 
Sbjct  122  QRRFLQVALGSVKPNAVVAQDGSGQFKTLTEALKTVPANNDKPFVIQVKAGVYKEIVKVT  181

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
              M HV  IG+G TKTK T + N VDG  T ++AT A+ G +F A+DIGFEN+AG+ K Q
Sbjct  182  NTMTHVTIIGEGATKTKFTGSLNFVDGSTTLESATFAVNGANFMAKDIGFENTAGSSKQQ  241

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVAL V+AD A+F NC +DG+QDTL+A
Sbjct  242  AVALLVTADQAVFYNCQMDGFQDTLFA  268



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 138/217 (64%), Gaps = 13/217 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK----KRRRLLSDNDGFN------  468
            D  E M+ + KTA +LTSNGLAI TNL                 R  +D D         
Sbjct  191  DAAEIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIPIPFLTTSRDSTDEDSIEPVGRQL  250

Query  467  --FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKA  294
              FP ++   +RRLL    G I+ N VVAKDGSG++++I +A+   P NN+  +VI IK+
Sbjct  251  TEFPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNERRFVIYIKS  310

Query  293  GVYNEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIG  117
            GVY E V + K M HV+FIGDGPTKT +T N +   + I TY+T+TVA+ G+ F A+D+ 
Sbjct  311  GVYAENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRISTYRTSTVAVNGDWFMAKDMA  370

Query  116  FENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            FEN+AG + HQAVALRVSAD+A+F NC +DGYQDTLY
Sbjct  371  FENTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLY  407



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 140/214 (65%), Gaps = 16/214 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M  + KT+ EL+SN LA++T         NLT     L AK  R+LLS  D  + P +
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGAL-AKYARKLLSTED--SIPTW  235

Query  455  IDATARRLLNANAGS---IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            +   ARRL+ A  G    +K N VVA+DG+G+FK+I DA+N  P  N  P++I IK G+Y
Sbjct  236  VGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIY  295

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFEN  108
             E V V K M HV FIGDGP KT IT + N  +  + T+ TAT+ IEG+HFTA++IG EN
Sbjct  296  KEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNIGIEN  355

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +  QAVALRVSAD+A+F +C IDG+QDTLY
Sbjct  356  TAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLY  389



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 140/214 (65%), Gaps = 16/214 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M  + KT+ EL+SN LA++T         NLT     L AK  R+LLS  D  + P +
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGAL-AKYARKLLSTED--SIPTW  235

Query  455  IDATARRLLNANAGS---IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            +   ARRL+ A  G    +K N VVA+DG+G+FK+I DA+N  P  N  P++I IK G+Y
Sbjct  236  VGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIY  295

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFEN  108
             E V V K M HV FIGDGP KT IT + N  +  + T+ TAT+ IEG+HFTA++IG EN
Sbjct  296  KEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNIGIEN  355

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +  QAVALRVSAD+A+F +C IDG+QDTLY
Sbjct  356  TAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLY  389



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 141/209 (67%), Gaps = 3/209 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK-KRRRLLSDN--DGFNFPAFID  450
            GD  E MK  L  +  LTSN LAII  ++   ST +     RRLLS+   D   +P+++ 
Sbjct  194  GDAAESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLSRRLLSEEEADDGEYPSWVT  253

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRLL      +KP++VVA+DGSG +++I +A+   P N++  +VI IK GVY E V 
Sbjct  254  NGKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIYIKEGVYKEQVW  313

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            + K+M +V+ IGDGPTKT+IT N N +DG  T++TAT A+ GE F A+D+GFENSAG +K
Sbjct  314  LDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGEGFIAKDLGFENSAGPEK  373

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV +D +IF NC +DGYQDTLY 
Sbjct  374  HQAVALRVQSDRSIFYNCQMDGYQDTLYC  402



>ref|XP_007138937.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
 gb|ESW10931.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
Length=573

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 139/207 (67%), Gaps = 6/207 (3%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK--RRRLLSDNDGF--NFPAFIDAT  444
            G KM  +L T+ ELTSN L +I  ++     L       RRLLS +     ++P+++   
Sbjct  183  GAKMNKVLNTSLELTSNALDMIDVISGILKDLNMTSFGNRRLLSQDKVPLDDYPSWVSEG  242

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             RRLL+    S K  VVVA+DGSG+FK+I +A+   PPNN  PYVI +KAGVY E V + 
Sbjct  243  KRRLLSQGTESAK--VVVAQDGSGQFKTIKEALKTVPPNNAEPYVIYVKAGVYKENVDMS  300

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
              M HV  IGDGPTKT+ + + N  DG+ TY+TAT A+   +F A+++GFEN+AG++KHQ
Sbjct  301  MLMTHVTIIGDGPTKTRFSGSLNYDDGVQTYKTATFAVNAANFMAKNVGFENTAGSKKHQ  360

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVALRV+AD A+F NC +DG+QDTLYA
Sbjct  361  AVALRVTADQAVFVNCHMDGFQDTLYA  387



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 146/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLSDNDGF-NFPAFID  450
            GD  E M+  L ++  LTSN LAII  ++   ST+     KRR L  + +G   +P+++ 
Sbjct  193  GDAAESMREALNSSQALTSNALAIIDEISSVLSTVRVPFLKRRFLSHEEEGSGEYPSWVA  252

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVV  270
               RRLL   A  IKPN++VA+DGSG +K+I +A+   P N+++ +VI IK GVY E V 
Sbjct  253  NGKRRLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSIFVIYIKEGVYKEQVW  312

Query  269  VPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQK  90
            + K+M +V+ IGDGPTKT+IT N N +DG  T++TAT A+ G+ F A+++GFENSAGA+K
Sbjct  313  LDKSMMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGDGFIAKNLGFENSAGAEK  372

Query  89   HQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            HQAVALRV +D +IF NC +DG+QDTLY+
Sbjct  373  HQAVALRVQSDRSIFYNCQMDGFQDTLYS  401



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 132/203 (65%), Gaps = 9/203 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRL  432
            GE M   L T+ +L+SN +    ++ +A   L   KRR L  DN    +P ++    RRL
Sbjct  170  GETMARALNTSIQLSSNAI----DMVDAVYDLTNAKRRLLSLDN---GYPLWVSEGQRRL  222

Query  431  LNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMN  252
            L     ++KPNVVVA+DGSG+FK++ DAI   P NN   +VI +K GVYNE V VPK+M 
Sbjct  223  LAE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVPKDMA  280

Query  251  HVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVAL  72
             V  IGDGP KTK T + N  DG+  Y TAT  + GE+F A+DI  EN+AG +KHQAVAL
Sbjct  281  FVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQAVAL  340

Query  71   RVSADHAIFSNCAIDGYQDTLYA  3
            RV+AD AIF NC IDGYQ TL+A
Sbjct  341  RVTADKAIFYNCQIDGYQATLFA  363



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 132/203 (65%), Gaps = 9/203 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRL  432
            GE M   L T+ +L+SN +    ++ +A   L   KRR L  DN    +P ++    RRL
Sbjct  170  GETMARALNTSIQLSSNAI----DMVDAVYDLTNAKRRLLSLDN---GYPLWVSEGQRRL  222

Query  431  LNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMN  252
            L     ++KPNVVVA+DGSG+FK++ DAI   P NN   +VI +K GVYNE V VPK+M 
Sbjct  223  LAE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVPKDMA  280

Query  251  HVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVAL  72
             V  IGDGP KTK T + N  DG+  Y TAT  + GE+F A+DI  EN+AG +KHQAVAL
Sbjct  281  FVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQAVAL  340

Query  71   RVSADHAIFSNCAIDGYQDTLYA  3
            RV+AD AIF NC IDGYQ TL+A
Sbjct  341  RVTADKAIFYNCQIDGYQATLFA  363



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 136/204 (67%), Gaps = 4/204 (2%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATAR  438
            D  E M+  L ++ ELTSN LAI+TN   A  +L     R+LL++     +P++I    R
Sbjct  171  DAAESMRKALNSSAELTSNILAIVTNFDSALDSLNLGFNRKLLAEE----YPSWISPGNR  226

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            RLL  +   +KPN+ VAKDGSG+ K+I +A+ + P  ++  +VI IK GVY E V V ++
Sbjct  227  RLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIKEGVYEEQVQVNRS  286

Query  257  MNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
            + +V+ IGDG +KTKIT   N +DG  T++TATVAI G+ F  +D+  ENSAGA KHQAV
Sbjct  287  LTNVMMIGDGTSKTKITGKLNYIDGTATFKTATVAIVGDGFIGKDLWIENSAGAAKHQAV  346

Query  77   ALRVSADHAIFSNCAIDGYQDTLY  6
            ALRV +D ++F N  +DGYQDTLY
Sbjct  347  ALRVQSDKSVFYNVRMDGYQDTLY  370



>gb|KHN26532.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=645

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 7/207 (3%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKK-RRRLLSDN----DGFNFPAFIDAT  444
            +KM   + ++ EL+SN L +   ++   +    K   RRLLS+     DGF   ++++  
Sbjct  205  QKMAMAMSSSLELSSNALDMTDTISRMLNGFRPKIFNRRLLSEEATVVDGF--LSWVNEG  262

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             RR L    GS+KPN VVA+DGSG+FK++ +A+   P NND P+VI++KAGVY E V V 
Sbjct  263  QRRFLQVALGSVKPNAVVAQDGSGQFKTLTEALKTVPANNDKPFVIQVKAGVYKEIVKVT  322

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
              M HV  IG+G TKTK T + N VDG  T ++AT A+ G +F A+DIGFEN+AG+ K Q
Sbjct  323  NTMTHVTIIGEGATKTKFTGSLNFVDGSTTLESATFAVNGANFMAKDIGFENTAGSSKQQ  382

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVAL V+AD A+F NC +DG+QDTL+A
Sbjct  383  AVALLVTADQAVFYNCQMDGFQDTLFA  409



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 141/211 (67%), Gaps = 15/211 (7%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPA  459
            G+ M  +L  + EL++N L II          NL+  AS L     R+LLS+ DG   P+
Sbjct  184  GQTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASALN--NNRKLLSE-DGL--PS  238

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            ++  + R+LL A   ++KPNVVVA+DGSG+FK++ +A+   P  N  P+VI +KAG+Y E
Sbjct  239  WVSQSQRKLLAA-PQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAGIYKE  297

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
            YV +  + +HV  IGDGP KT  T +K+  DG+ TY TAT ++   HFTA ++GFENSAG
Sbjct  298  YVALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQTYNTATFSVNSAHFTAFNVGFENSAG  357

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            A KHQAVALRV+AD A+F NC ++GYQDTLY
Sbjct  358  AAKHQAVALRVTADKALFYNCEMNGYQDTLY  388



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/251 (44%), Positives = 149/251 (59%), Gaps = 46/251 (18%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA------------KKRRRLLSDND  477
            GD   K++ +L+T+ E++SNGLAI+ +L+   STL+             K  RRL  D+D
Sbjct  166  GDATVKVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATYKVHRRLFGDDD  225

Query  476  GFN------------------------------FPAFIDATARRLLNANAGS----IKPN  399
            G N                               P ++D   R+LL +   +     K N
Sbjct  226  GNNVLLSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASPMLTDDLKAKAN  285

Query  398  VVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTK  219
            VVVA+DGSG+FK+I +AI + P +    ++I IK GVYNEY+V+ K M +VVF+GDGPTK
Sbjct  286  VVVAQDGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMTNVVFVGDGPTK  345

Query  218  TKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSN  39
            T+IT NKN  DG  T++TAT+++ G+ F A+DIG ENSAGA KHQAVA R  +D +IF N
Sbjct  346  TRITNNKNYADGTKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAFRAQSDKSIFFN  405

Query  38   CAIDGYQDTLY  6
            C  DGYQDTLY
Sbjct  406  CHFDGYQDTLY  416



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   194 bits (493),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 107/214 (50%), Positives = 141/214 (66%), Gaps = 13/214 (6%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEA----------KKRRRLLSDNDGF  471
            G+T EKMK  L ++ ELTSN L +IT ++   ++L A               +L   +  
Sbjct  174  GETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILGHGNEL  233

Query  470  NFPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
              P ++D   RRLL A    IKP++VVAKDGS ++K+IN+A+   P N +  YV+ IK G
Sbjct  234  -LPDWVDMRRRRLLAAK--EIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYVLYIKQG  290

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFE  111
            VYNE V    +M +++ IGDGPTKT+IT N+N  DG  TY TAT A+ G++F A+DIGFE
Sbjct  291  VYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFVAKDIGFE  350

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTL  9
            NSAG +KHQAVALRV+AD +IF NC IDGYQDTL
Sbjct  351  NSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTL  384



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 140/218 (64%), Gaps = 18/218 (8%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--------RRLLSDNDGFNFP  462
            D  ++M+H+ KT  EL+SN LA++T+++       A           R+LLS  DG   P
Sbjct  176  DLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLSAEDGI--P  233

Query  461  AFIDATARRLLNANAGS---IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
             ++   ARRL+ A  G    +K N VVA+DGSG+FK+I +A+N  P  N  PYVI IK G
Sbjct  234  TWVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVPKGNTVPYVIHIKQG  293

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIG---TYQTATVAIEGEHFTARDI  120
            +Y E V+V + M +V FIGDG TKT IT N N   GIG   T+ TA + IEG+HFT ++I
Sbjct  294  IYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNY--GIGKVKTFLTAPLTIEGDHFTMKNI  351

Query  119  GFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            G EN+AG +  QAVALRVSAD+A+F +C  DG+QDTLY
Sbjct  352  GVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLY  389



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 128/190 (67%), Gaps = 8/190 (4%)
 Frame = -2

Query  566  SNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANAGSIKPNVVVA  387
            +N  A+   +TEA   L     R+LL   DGF  P+++    RRL+ A  G +KPNVVVA
Sbjct  7    TNANALTFWVTEATGDL-GNNARKLLYAEDGF--PSWVGPDTRRLMAAPQGGVKPNVVVA  63

Query  386  KDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKIT  207
            KDGSG++KSIN+A+   P NN  P+VI IK GVY E VVV K M HV FIGDGPTKTKIT
Sbjct  64   KDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKIT  123

Query  206  ENKNKVDGIG---TYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSADHAIFSNC  36
             + N   GIG   TY T+++ +EG++F A+++G EN+AG    QA ALRVSAD  +  NC
Sbjct  124  GSVNF--GIGKVRTYLTSSLTVEGDNFVAKNMGIENTAGPPGGQAAALRVSADCVVIFNC  181

Query  35   AIDGYQDTLY  6
             IDGYQDTLY
Sbjct  182  QIDGYQDTLY  191



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 140/215 (65%), Gaps = 16/215 (7%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKR--------RRLLSDNDGFNFP  462
            D  ++M+H+ KT  EL+SN LA++T+++       A           R+LL+  DG   P
Sbjct  176  DLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTEDGI--P  233

Query  461  AFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYN  282
             ++   ARRL+ A  G +K N VVA+DGSG+FK+I DA+N  P  N  P+VI IK G+Y 
Sbjct  234  TWVGREARRLMAA-PGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIYK  292

Query  281  EYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIG---TYQTATVAIEGEHFTARDIGFE  111
            E ++V + M +V FIGDG TKT IT N N   GIG   T+ TA + IEG+HFT ++IG E
Sbjct  293  EKIMVTRKMPYVTFIGDGQTKTVITGNLNY--GIGKVKTFLTAPLTIEGDHFTMKNIGVE  350

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            N+AG +  QAVALRVSAD+A+F +C  DG+QDTLY
Sbjct  351  NTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLY  385



>gb|EYU28291.1| hypothetical protein MIMGU_mgv1a003232mg [Erythranthe guttata]
Length=598

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 132/207 (64%), Gaps = 2/207 (1%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATA  441
            G+    M+ +LKT  EL SN LAI++ ++   S    +  R+L+S +DG  FP +++   
Sbjct  213  GEEKTSMQKMLKTFRELGSNALAIVSQVSSIFSAFGDEAHRKLVSVDDG-EFPTWVNNDL  271

Query  440  RRLLNANA-GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
            RRLL A       PNV VAKDGSG+F +I+ A+   P      YVI +K GVY+E V V 
Sbjct  272  RRLLKAGGPNKFTPNVTVAKDGSGDFTTISKALGAMPKKYSGRYVIYVKEGVYDESVTVT  331

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K M +V   GDG  K+ IT  KN VDG+ T+QTAT A  G+ F A+ +GF N+AG +KHQ
Sbjct  332  KEMENVTMYGDGSQKSIITGKKNYVDGVPTFQTATFAALGDGFMAQSLGFRNTAGPEKHQ  391

Query  83   AVALRVSADHAIFSNCAIDGYQDTLYA  3
            AVALRV AD +IF NC ++GYQDTLYA
Sbjct  392  AVALRVQADRSIFVNCRMEGYQDTLYA  418



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 144/215 (67%), Gaps = 24/215 (11%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNL---------TEAASTLEAKKRRRLLSDNDGFN  468
            GD G++M+ LL  + +++SN LA++T +         + +++     +RRRLLS+ D  +
Sbjct  173  GDAGDRMRDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSRRRRLLSEKD--D  230

Query  467  FPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
             P          LN     +KP+++VAKDGSG+FK+IN+A+ K P N++  +V+ IK G+
Sbjct  231  LPK---------LNI----MKPDLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIKEGI  277

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            Y E V +  +  +++ +GDGP KT+IT   N V+G  TYQ+ATVA+ G+ FTA D+GFEN
Sbjct  278  YEEQVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTTTYQSATVAVHGDRFTAMDVGFEN  337

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            +AG + HQAVALRVSAD A+F NC +DGYQDTLYA
Sbjct  338  AAGPEGHQAVALRVSADLAVFYNCHMDGYQDTLYA  372



>gb|EPS58111.1| pectinesterase [Genlisea aurea]
Length=374

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 131/200 (66%), Gaps = 11/200 (6%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE-AKKRRRLLSDNDGFNFPAFIDAT  444
            GD G+KM++L+KT  E++SN LAI+T +++ AS LE    RR+++SD     +       
Sbjct  185  GDVGKKMENLMKTVREMSSNCLAIVTQMSDLASQLEIGGVRRKMMSDEPPRGWR------  238

Query  443  ARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVP  264
             RRLL A+     P+ VVA DGS  F SINDAI+ AP  N  P+VI +K G+Y E VVVP
Sbjct  239  -RRLLEADR---TPDAVVALDGSARFSSINDAISAAPEMNARPFVIHVKEGLYAETVVVP  294

Query  263  KNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQ  84
            K  +++V IGDGP KT+IT N N   G+ T+ TATVA+    F ARDI  EN+AG + HQ
Sbjct  295  KKKDNIVLIGDGPEKTRITGNLNFAAGVKTFVTATVAVNARDFFARDIAVENTAGPEGHQ  354

Query  83   AVALRVSADHAIFSNCAIDG  24
            AVALRVS D A+F N  IDG
Sbjct  355  AVALRVSGDRAVFYNVHIDG  374



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 133/197 (68%), Gaps = 5/197 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K   ++ SN LA+I N+T+   A   +     R+L  D  G  +P ++ A  RRLL ++ 
Sbjct  208  KYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ PNVVVA DGSG FK++++A+ KAP  +   Y+I+IKAGVY E V VPK  ++++FI
Sbjct  267  -SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFI  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG TKT IT ++N VDG  T+ +ATVA+ GE F ARDI F+N+AG  KHQAVALRV +D
Sbjct  326  GDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNTAGPSKHQAVALRVGSD  385

Query  56   HAIFSNCAIDGYQDTLY  6
             + F NC +  YQDTLY
Sbjct  386  LSAFYNCDMLAYQDTLY  402



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 135/202 (67%), Gaps = 4/202 (2%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPAFIDATARRL  432
             E M+  L ++ E+TSN LAI+ NL     +L     R+LL++     +P+++    RRL
Sbjct  173  AESMRKALNSSAEMTSNILAIVINLDNTLDSLNLGISRKLLAEE----YPSWVSLGKRRL  228

Query  431  LNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMN  252
            L  +   +KPNV VA+DG+G+ K+INDA+ + P  ++  +VI IK GVY E V V +++ 
Sbjct  229  LQLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKEKVQVNRSLT  288

Query  251  HVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVAL  72
            +V+ +GDG  KTKIT + N +DG  T++TATVA+ G+ F  +D+  ENSAGA KHQAVAL
Sbjct  289  NVIMVGDGTNKTKITGSLNYIDGTATFKTATVAVIGDGFIGKDLWIENSAGAAKHQAVAL  348

Query  71   RVSADHAIFSNCAIDGYQDTLY  6
            RV +D ++F N  IDGYQDTLY
Sbjct  349  RVQSDKSVFYNVRIDGYQDTLY  370



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 133/212 (63%), Gaps = 9/212 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE----AKKRRRLLSDNDGFNFPAFI  453
            G    +M+ ++K   ELTSN LA+I+ +    ST E    A  RRRL++       P ++
Sbjct  209  GKMKSEMEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMATK---GVPTWM  265

Query  452  DATARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            ++  RR+L   A     KPNVVVAKDGSGEFK+IN+A+   P   D  YVI +K G+Y+E
Sbjct  266  NSNERRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDE  325

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
             VV+ K M +V   GDG  K+ I+ +KN VDG+ T+QTAT    GE F  + IGF N AG
Sbjct  326  TVVITKKMVNVTMYGDGSQKSMISGSKNFVDGVRTFQTATFVALGEGFLGQAIGFRNIAG  385

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             +KHQAVA RV AD AIF NC  +GYQDTLYA
Sbjct  386  PEKHQAVAARVQADRAIFVNCRFEGYQDTLYA  417



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE----AKKRRRLLSDNDGFNFPAFI  453
            G     ++ ++K   ELTSN LA+I+ +    ST E    A  RRRL++ N     P ++
Sbjct  208  GKMKSDIEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMTTN---GVPTWM  264

Query  452  DATARRLLNANAG--SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            D   RR+L   A     KPNVVVAKDGSGEFK+IN+A+   P   D  YVI +K G+Y+E
Sbjct  265  DRNQRRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDE  324

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
             VV+ K M +V   GDG  K+ I+ +KN VDG+ T+QTAT    GE F  + IGF N AG
Sbjct  325  TVVITKKMVNVTMYGDGSQKSMISGSKNFVDGVRTFQTATFVALGEGFLGQAIGFRNIAG  384

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             +KHQAVA RV AD AIF NC  +GYQDTLY
Sbjct  385  PEKHQAVAARVQADRAIFVNCRFEGYQDTLY  415



>ref|XP_010273980.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Nelumbo nucifera]
Length=599

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 138/223 (62%), Gaps = 20/223 (9%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--KRRRLLS-------------  486
            G +  KM+  L     LTSN LAI+  ++   STL+     +RRLL              
Sbjct  199  GKSKTKMQKTLGNTKILTSNALAIVAEVSSILSTLQLSGGNKRRLLQATSTSTSSSTSTS  258

Query  485  ---DNDGFNFPAFIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAP  315
                 DG   P ++    RR+L A + ++KPN VVAKDGSG+FK+I+DA+ K P      
Sbjct  259  TSLGEDGL--PNWMSHEDRRMLKARSVNLKPNAVVAKDGSGDFKTISDALAKIPKKYTGR  316

Query  314  YVIKIKAGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHF  135
            YVI +KAGVY+E V+V K+M +V   GDG  K+ +T +KN VDGI T+QTAT A  GE F
Sbjct  317  YVIYVKAGVYDETVIVTKDMVNVTMYGDGSMKSIVTGSKNFVDGIRTFQTATFAALGEGF  376

Query  134  TARDIGFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            TA  +GF N+AG +KHQAVALRV AD ++F NC ++GYQDTLY
Sbjct  377  TAMAMGFRNTAGPEKHQAVALRVQADRSVFINCRMEGYQDTLY  419



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 137/215 (64%), Gaps = 19/215 (9%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAFID  450
            M ++ K++ EL+SN LA+ T         N+T     L AK  R+LL   DG   P ++ 
Sbjct  179  MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGAL-AKYARKLLYTEDGI--PTWVG  235

Query  449  ATARRLLNAN------AGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
              ARRL+ A          +K NV VA+DGSG FK+I DA+   P NN  P++I IK G+
Sbjct  236  PHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGI  295

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFE  111
            Y E V V K M +V FIGDGP KTKIT N N  +  + T+ T+T+ IEGEHFTA++IG E
Sbjct  296  YKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVKTFLTSTLTIEGEHFTAKNIGIE  355

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            N+AG +  QAVALRVSAD+A+F +C IDGYQDTLY
Sbjct  356  NTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLY  390



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 136/211 (64%), Gaps = 16/211 (8%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLEAKK----RRRLLSDNDGFN-----FPAFID  450
            M   +K A +LTSN LAIIT   EA+S L   K     RRLLS  + F+     FP++  
Sbjct  204  MAEAMKMATQLTSNSLAIIT---EASSVLSILKVPGFSRRLLSKENHFSEGKGGFPSWFP  260

Query  449  ATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPP--NNDAPYVIKIKAGVYNEY  276
            A  RRLL      + PNV VAKDGSG+F++I +A++K PP    +  YVI IKAGVY+E 
Sbjct  261  AGERRLLAMQ--EMTPNVAVAKDGSGDFRTITEALSKLPPAKERNGRYVIYIKAGVYDEQ  318

Query  275  VVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGA  96
            V V K M +V   GDG  KT IT +KN +DG  T++TAT A  G+ F A+ IGF N+AGA
Sbjct  319  VTVTKEMVNVTMYGDGSRKTIITGSKNFIDGTPTFKTATFAAIGDDFMAKAIGFRNTAGA  378

Query  95   QKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             KHQAVALRV +D A+F NC +DG QDTLYA
Sbjct  379  AKHQAVALRVQSDRAVFLNCRMDGNQDTLYA  409



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 137/215 (64%), Gaps = 19/215 (9%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAFID  450
            M ++ K++ EL+SN LA+ T         N+T     L AK  R+LL   DG   P ++ 
Sbjct  179  MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGAL-AKYARKLLYTEDGI--PTWVG  235

Query  449  ATARRLLNAN------AGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
              ARRL+ A          +K NV VA+DGSG FK+I DA+   P NN  P++I IK G+
Sbjct  236  PHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGI  295

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFE  111
            Y E V V K M +V FIGDGP KTKIT N N  +  + T+ T+T+ IEGEHFTA++IG E
Sbjct  296  YKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVKTFLTSTLTIEGEHFTAKNIGIE  355

Query  110  NSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            N+AG +  QAVALRVSAD+A+F +C IDGYQDTLY
Sbjct  356  NTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLY  390



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 139/214 (65%), Gaps = 13/214 (6%)
 Frame = -2

Query  617  DTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLE----AKKRRRLLSDN---DGF--NF  465
            + G+ M  +L  + E++ N L I+   +     L     A   R+LLS+    DG    F
Sbjct  184  EAGKTMTRVLNASLEMSHNALDIVNGASALFKGLNFTSFAASNRKLLSEEPLVDGLVDGF  243

Query  464  PAFIDATARRLL-NANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
            P+++    R++L +AN    KP+VVVA DGSG+   I++A+   P NN  P+VI IKAG+
Sbjct  244  PSWVTEGQRKILEDANP---KPDVVVALDGSGQVTKIHEALKLVPKNNKKPFVIYIKAGI  300

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            Y EYV + K+M+ V  IGDGPT+T+IT NKN VDG  TY TAT      +F A++IGFEN
Sbjct  301  YQEYVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQTYNTATFGANAANFMAKNIGFEN  360

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            SAGA+KHQAVALRV+AD A+F NC +DGYQDTLY
Sbjct  361  SAGAEKHQAVALRVTADKAVFYNCHMDGYQDTLY  394



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 132/197 (67%), Gaps = 5/197 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K   ++ SN LA+I N+T+   A   +     R+L  D  G  +P ++ A  RRLL ++ 
Sbjct  208  KYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ PNVVVA DGSG FK++++A+ KAP  +   Y+I+IKAGVY E V VPK  ++++FI
Sbjct  267  -SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFI  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG TKT IT ++N VDG  T+ +ATVA  GE F ARDI F+N+AG  KHQAVALRV +D
Sbjct  326  GDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSD  385

Query  56   HAIFSNCAIDGYQDTLY  6
             + F NC +  YQDTLY
Sbjct  386  LSAFYNCDMLAYQDTLY  402



>ref|XP_007024771.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY27393.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
Length=500

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 132/198 (67%), Gaps = 5/198 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K    + SN LA+I N+T+   A   L+    R+L    +G  +P ++ A  RRLL ++ 
Sbjct  208  KYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ P+VVVA DGSG +K++++A+ KAP  +   YVIKIKAGVY E V VPK   +++F+
Sbjct  267  -SVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTNIMFL  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG T+T IT ++N VDG  T+ +ATVA+ GE F ARDI F+N+AG  KHQAVALRV AD
Sbjct  326  GDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALRVGAD  385

Query  56   HAIFSNCAIDGYQDTLYA  3
             + F  C +  YQDTLYA
Sbjct  386  LSAFYECDMLAYQDTLYA  403



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 140/214 (65%), Gaps = 16/214 (7%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNL---------TEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M+++ +T+ EL+SN LA+++++         T    TL     R+LLS  DG   P +
Sbjct  179  QDMQNIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTL-TNYARKLLSAEDGI--PTW  235

Query  455  IDATARRLLNANAGS---IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
            +   ARRLL A  G    +K N VVA+DGSG+FK+I DA+N  P  N  P+VI IK G+Y
Sbjct  236  VRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIY  295

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFEN  108
             E V+V + M +V FIGDGP KT IT + N  +  + T+ T ++ IEG+HFTA++IG EN
Sbjct  296  KEKVIVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTGSITIEGDHFTAKNIGIEN  355

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +  QAVALRVSAD+A F +C IDG+QDTLY
Sbjct  356  TAGPEGGQAVALRVSADYAAFQSCQIDGHQDTLY  389



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 135/214 (63%), Gaps = 17/214 (8%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNL--------TEAASTLEAKKRRRLLSDNDGFNFPAFIDA  447
            M ++ KT+ EL+SN LA+ T+L        T   +   AK  R+LL   DG   P ++  
Sbjct  179  MLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLTGALAKYARKLLYTEDGI--PTWVGP  236

Query  446  TARRLL------NANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
             ARRL+            +K N VV +DGSG FK+I DA+   P NN  P++I IK G+Y
Sbjct  237  HARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGIY  296

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGFEN  108
             E V V K M +V FIGDGP KTKIT N N  +  + T+ T+T+ IEGEHFTA++IG EN
Sbjct  297  KERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVKTFLTSTLTIEGEHFTAKNIGIEN  356

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +  QAVALRVSAD+A+F +C IDGYQDTLY
Sbjct  357  TAGPKGGQAVALRVSADYAVFYSCQIDGYQDTLY  390



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 133/209 (64%), Gaps = 9/209 (4%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAA-----STLEAKKRRRLLSDNDGF--NFPAFI  453
            GEKM   +  + EL+SN L +I  ++        S+L    RR L S  +     +P+++
Sbjct  186  GEKMAKAMNASLELSSNALDMINFISGLIKDLNISSLVGNNRRLLSSKEEALVDGYPSWV  245

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
                RRLL  +  SIKPN  VAKDGSG+F ++ DA+   PP N   +VI +KAGVY E V
Sbjct  246  SEGQRRLLGLS--SIKPNATVAKDGSGQFATLTDALKTVPPKNAQAFVIYVKAGVYKENV  303

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V  +M HV  IGDGP KT+ + + N  DG+ T+ +AT A+   +F A+D+GFEN+AGA+
Sbjct  304  NVGMDMTHVTVIGDGPKKTRFSGSLNYKDGVQTFNSATFAVNAANFMAKDVGFENTAGAE  363

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            KHQAVALRV+AD A+F NC +D +QDTLY
Sbjct  364  KHQAVALRVTADQAVFYNCQMDAFQDTLY  392



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 132/197 (67%), Gaps = 5/197 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K   ++ SN LA+I N+T+   A   +     R+L  D  G  +P ++ A  RRLL ++ 
Sbjct  208  KYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ PNVVVA DGSG FK++++A+ KAP  +   Y+I+IKAGVY E V VPK  ++++FI
Sbjct  267  -SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPKKKSNIMFI  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG TKT IT ++N VDG  T+ +ATVA  GE F ARDI F+N+AG  KHQAVALRV +D
Sbjct  326  GDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSD  385

Query  56   HAIFSNCAIDGYQDTLY  6
             + F NC +  YQDTLY
Sbjct  386  LSAFYNCDMLAYQDTLY  402



>ref|XP_009419138.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=557

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 8/205 (4%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLE-----AKKRRRLLSDNDGFNFPAFIDATAR  438
            MK  L TA ++TSN +AI+  L+    + +         RRLL D  G+  P++     R
Sbjct  174  MKDGLSTATKVTSNAIAIVDELSSLLKSFKIPINITMGSRRLLVDEQGY--PSWFSGHDR  231

Query  437  RLLNANA-GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPK  261
            +LL A A G + PNVVVAKDGSG+FK+INDA+N  P +    YVI +KAGVY E V+V K
Sbjct  232  KLLAAQARGQLTPNVVVAKDGSGKFKTINDAVNAMPKDYSGRYVIYVKAGVYKENVIVGK  291

Query  260  NMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQA  81
            +  +V+  GDG  KT +T +KN VDG+ T  TAT A  G+ F A+ +GF N+AGA+KHQA
Sbjct  292  DKVNVLMYGDGSRKTVVTGSKNYVDGVQTVDTATFAALGQGFIAKSMGFSNTAGAEKHQA  351

Query  80   VALRVSADHAIFSNCAIDGYQDTLY  6
            VALRV +D + F NC +D YQDTLY
Sbjct  352  VALRVQSDMSAFFNCRMDAYQDTLY  376



>gb|KDP43631.1| hypothetical protein JCGZ_16918 [Jatropha curcas]
Length=561

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 133/209 (64%), Gaps = 11/209 (5%)
 Frame = -2

Query  605  KMKHLLKTAGELTSNGLAIITNLTEAASTLEAK--------KRRRLLS-DNDGFNFPAFI  453
            +M+  +  AG+LTSN LAI+   ++  ST+  K          R+LLS D DG+  P+++
Sbjct  173  EMEEGMVDAGQLTSNALAIVDAFSDILSTMGLKVNFGGSNDTSRKLLSVDEDGY--PSWL  230

Query  452  DATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYV  273
             A+ RRLL  +  ++KPNV VA DGSG+ K++ + I K PP N  P+ I +KAG Y EY 
Sbjct  231  SASRRRLLAVDLATLKPNVTVAADGSGDVKTVTEGIAKIPPKNVDPFYIYVKAGTYKEYP  290

Query  272  VVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQ  93
             V K MN+V   GDGP KT IT + +   G  T ++AT A  GE FTA+ I FEN+AG +
Sbjct  291  TVEKKMNNVFMYGDGPLKTIITGDHSNKTGYKTMRSATFAALGEGFTAKSIAFENTAGPE  350

Query  92   KHQAVALRVSADHAIFSNCAIDGYQDTLY  6
             HQAVALRV AD A F +C +DGYQDTLY
Sbjct  351  GHQAVALRVQADMAAFFDCKMDGYQDTLY  379



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 131/197 (66%), Gaps = 5/197 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K   ++ SN LA+I N+T+   A   +     R+L  D  G  +P ++ A  RRLL ++ 
Sbjct  208  KYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ PNVVVA DGSG FK++++A+ KAP  +   Y I+IKAGVY E V VPK  + ++FI
Sbjct  267  -SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPKKKSSIMFI  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG TKT IT ++N VDG  T+ +ATVA+ GE F AR+I F+N+AG  KHQAVALRV +D
Sbjct  326  GDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQNTAGPSKHQAVALRVGSD  385

Query  56   HAIFSNCAIDGYQDTLY  6
             + F NC +  YQDTLY
Sbjct  386  LSAFYNCDMLAYQDTLY  402



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 132/198 (67%), Gaps = 5/198 (3%)
 Frame = -2

Query  587  KTAGELTSNGLAIITNLTE---AASTLEAKKRRRLLSDNDGFNFPAFIDATARRLLNANA  417
            K    + SN LA+I N+T+   A   L+    R+L    +G  +P ++ A  RRLL ++ 
Sbjct  208  KYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIAWPEWLSAGDRRLLQSS-  266

Query  416  GSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNMNHVVFI  237
             S+ P+VVVA DGSG +K++++A+ KAP  +   YVIKIKAGVY E V VPK   +++F+
Sbjct  267  -SVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTNIMFL  325

Query  236  GDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVALRVSAD  57
            GDG T+T IT ++N VDG  T+ +ATVA+ GE F ARDI F+N+AG  KHQAVALRV AD
Sbjct  326  GDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALRVGAD  385

Query  56   HAIFSNCAIDGYQDTLYA  3
             + F  C +  YQDTLYA
Sbjct  386  LSAFYECDMLAYQDTLYA  403



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 134/214 (63%), Gaps = 9/214 (4%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDGFNFPA------  459
            G    +M+  LK A ELTSN LAII+ ++   +T +     R L + +    PA      
Sbjct  197  GKLKTEMQKTLKIAKELTSNSLAIISEVSSFLTTFQIPGATRHLLEKEASGLPAVGEDGL  256

Query  458  --FIDATARRLLNANAG-SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGV  288
              +++   RR+L    G  + PNVVVAKDGSG+FK+I++A+   P      YVI IKAG+
Sbjct  257  PSWMNQEERRILKGKRGVKLTPNVVVAKDGSGKFKTISEALAALPEKYTGRYVIYIKAGI  316

Query  287  YNEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFEN  108
            Y+EY+ V K M +V   GDG  KT +T NKN VDG+ T+QTA+ A  G+ F A+ +GF N
Sbjct  317  YDEYITVTKKMVNVTMYGDGSQKTIVTGNKNFVDGVRTFQTASFAALGDGFMAQAMGFRN  376

Query  107  SAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            +AG +KHQAVA+RV +D AIF NC  +GYQDTLY
Sbjct  377  TAGPEKHQAVAIRVQSDRAIFLNCRFEGYQDTLY  410



>gb|EMT00807.1| Putative pectinesterase/pectinesterase inhibitor 28 [Aegilops 
tauschii]
Length=563

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLE-----AKKRRRLLSDNDGFNFPAFIDATAR  438
            M+ +L+ A EL+SN LAI  +L      L+        RRRLLS  +   +PA++ A  R
Sbjct  181  MQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTDSRRRLLSAEES-KYPAWMRAPER  239

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            +LL A+ G  +PN +VAKDGSG+FK+I DA+N  P ++   YVI +KAGVY E V+VPK+
Sbjct  240  KLL-ASGGLPQPNAIVAKDGSGKFKTIQDAVNSMPKDHPGRYVIYVKAGVYEEMVMVPKD  298

Query  257  MNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
              +V   GDGP ++++T +K+  DGI T +TAT +IE   F  +++GF N+AGA+KHQAV
Sbjct  299  KANVFMYGDGPKQSRVTGSKSFADGITTMKTATFSIEAAGFICKNMGFHNTAGAEKHQAV  358

Query  77   ALRVSADHAIFSNCAIDGYQDTLY  6
            ALRV  D + F NC  D +QDTLY
Sbjct  359  ALRVQGDLSAFFNCRFDAFQDTLY  382



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 140/216 (65%), Gaps = 18/216 (8%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIIT---------NLTEAASTLEAKKRRRLLSDNDGFNFPAF  456
            + M  + +T+ EL+SN LA++T         N+T     L A   R+LLS  DG   P +
Sbjct  179  QDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGAL-ANYARKLLSTEDGI--PNW  235

Query  455  IDATARRLLNANAGS-----IKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAG  291
            +   ARRL+ A  G      +K N VVA+DGSG+FK+I DA+N  P  N  P+VI IK G
Sbjct  236  VGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALNGVPKGNTVPFVIHIKQG  295

Query  290  VYNEYVVVPKNMNHVVFIGDGPTKTKITENKN-KVDGIGTYQTATVAIEGEHFTARDIGF  114
            +Y E V+V + M +V FIGDGP KT IT + N  +  + T+ TAT+ +EG+HFTA++IG 
Sbjct  296  IYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTATITVEGDHFTAKNIGI  355

Query  113  ENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            EN+AG +  QAVALRVSAD+A+F +C IDG+QDTLY
Sbjct  356  ENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLY  391



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 132/211 (63%), Gaps = 10/211 (5%)
 Frame = -2

Query  608  EKMKHLLKTAGELTSNGLAIITNLTEAAS--TLEAKKRRRLLSDNDGFNF--------PA  459
            ++++  L +   L SN LAI+ N+   AS  T+ +   RRLLSD+ G  F        P+
Sbjct  210  QELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSIHNRRLLSDDQGSEFMAMESDGFPS  269

Query  458  FIDATARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            ++ A  R LL ++  +I PN VVAKDGSG   SI DA+N AP  +   YVI IKAG+Y E
Sbjct  270  WMSAKERSLLQSSRDNIMPNAVVAKDGSGHHTSIGDAVNAAPQKSRTRYVIHIKAGIYWE  329

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
             V V K   H++FIGDG   T +  N+N  DG  TY++ATVA+ G  F ARDI FEN+AG
Sbjct  330  NVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYRSATVAVNGNGFIARDITFENTAG  389

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLY  6
            A KHQAVALRV +D + F  C+  GYQDTLY
Sbjct  390  AAKHQAVALRVGSDFSAFYRCSFQGYQDTLY  420



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 131/214 (61%), Gaps = 23/214 (11%)
 Frame = -2

Query  611  GEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAKKRRRLLSDNDG-FNFPAFIDA----  447
            G +M++LL T   ++SN LAIIT L    S L    +R+L+ D++  F     I +    
Sbjct  183  GNRMRNLLTTTMHMSSNALAIITALANTVSELSDVNKRQLVEDDEHVFGQDEVISSLIFD  242

Query  446  ------TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVY  285
                    RRLL  N   +K N +VAKDGS +FKSI+ A+ K P  N  P+VI I+ GVY
Sbjct  243  DDDDGGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVY  302

Query  284  NEYVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENS  105
            NEY+ V K M  VVF+GDG  KT+IT N+N +DG+ TY+TA+V            GFENS
Sbjct  303  NEYIEVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASV------------GFENS  350

Query  104  AGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            AG  KHQAVA+RV AD +IF  C++DGY+DTLY 
Sbjct  351  AGPHKHQAVAIRVQADRSIFYRCSMDGYEDTLYV  384



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 132/208 (63%), Gaps = 12/208 (6%)
 Frame = -2

Query  590  LKTAGELTSNGLAIITNLTEAASTLEAK----KRRRLLSDN--------DGFNFPAFIDA  447
            L+    L SN LA++ N++  AS L  +    + RRLLSD         D   FP+++ A
Sbjct  170  LRNISHLVSNSLAMVKNISAEASNLARRTVSNQNRRLLSDQSDPNFMPMDSDGFPSWMSA  229

Query  446  TARRLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVV  267
              RRLL  + G++KPN VVAKDGSG + +I +A+  AP  +   YVI IKAGVY E V +
Sbjct  230  GDRRLLQTSTGTVKPNAVVAKDGSGNYTNITEAVEAAPEKSKTRYVIHIKAGVYAENVEL  289

Query  266  PKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKH  87
             K   +++FIGDG   T +T N+N  +   T+++ATVA+ G+ F ARD+ FEN+AGA KH
Sbjct  290  HKKKTNLMFIGDGMDVTVVTGNRNVKENFTTFRSATVAVLGKGFIARDMTFENTAGAAKH  349

Query  86   QAVALRVSADHAIFSNCAIDGYQDTLYA  3
            QAVALRV +D + F  C+  GYQDTLYA
Sbjct  350  QAVALRVGSDLSAFYRCSFKGYQDTLYA  377



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 139/219 (63%), Gaps = 20/219 (9%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAI--------ITNLT--EAASTLEAKKRRRLLSDNDGF  471
            GD  E M+ LLK + ELT+NGLAI        + NL     A T      R+ LS     
Sbjct  173  GDHAETMRQLLKLSRELTTNGLAIANQIHRLFLPNLLAPPVAPTKHQLADRKPLSPRGDS  232

Query  470  NFPAFIDATARRLLN--ANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIK  297
            N+        R+LL   ++     PNVVVAKDGSG++K++ +A+ + P  ++  +VI +K
Sbjct  233  NY-------YRKLLQMASDRRYDTPNVVVAKDGSGKYKTVTEALKEVPERSNETFVIHVK  285

Query  296  AGVYNEYVVVPKNMNHVVFIGDGPTKTKITENKNKV-DGIGTYQTATVAIEGEHFTARDI  120
             GVY EYV +   M  VV +GDGPTKT+IT  K+   DG+GTY TATV I+G++F  +DI
Sbjct  286  EGVYEEYVEITSGMWSVVLVGDGPTKTRITGKKSYGGDGLGTYFTATVGIDGDNFIGKDI  345

Query  119  GFENSAGAQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
            GFEN+AGA  +QAVALRVSAD AIF NC IDGYQDTLYA
Sbjct  346  GFENTAGAIGYQAVALRVSADKAIFYNCHIDGYQDTLYA  384



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 134/204 (66%), Gaps = 7/204 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAASTLE-----AKKRRRLLSDNDGFNFPAFIDATAR  438
            M+ +L+ A EL+SN LAI  +L      L+        RRRLLS  +   +PA++ A  R
Sbjct  181  MQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTDSRRRLLSAEES-KYPAWMKAPER  239

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            +LL A+ G   PN VVAKDGSG+FK+I DA+N  P ++   YVI +KAGVY E V+VPK+
Sbjct  240  KLL-ASGGLPAPNAVVAKDGSGKFKTIQDAVNSMPKDHPGRYVIYVKAGVYEEMVMVPKD  298

Query  257  MNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
              ++   GDGP ++++T +K+  DGI T +TAT +IE   F  +++GF N+AGA+KHQAV
Sbjct  299  KVNIFMYGDGPKQSRVTGSKSFADGITTMKTATFSIEAAGFICKNMGFHNTAGAEKHQAV  358

Query  77   ALRVSADHAIFSNCAIDGYQDTLY  6
            ALRV  D + F NC  D +QDTLY
Sbjct  359  ALRVQGDLSAFFNCRFDAFQDTLY  382



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 129/204 (63%), Gaps = 6/204 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTEAAS-----TLEAKKRRRLLSDNDGFNFPAFIDATAR  438
            M  +L+ A EL+SN LAI  +L            +   RRRLLS+ D   +P ++ +  R
Sbjct  179  MHSVLRNATELSSNALAITNSLGGLLKKLDLDMFKKDSRRRLLSEQDEQGYPVWMRSPER  238

Query  437  RLLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKN  258
            +L+ A     KPN VVA+DGSG+FKSI  A++  P  N   YVI +KAG+YNE V++PK+
Sbjct  239  KLMAA-GNQPKPNAVVAQDGSGQFKSIQQAVDAMPKGNTGRYVIYVKAGLYNEMVMIPKD  297

Query  257  MNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAV  78
              ++   GDGP KT++T  K+  DGI T +TAT +IE   F  +++GF N+AGA++HQAV
Sbjct  298  KVNIFMYGDGPKKTRVTGRKSFADGITTMKTATFSIEASGFICKNMGFHNTAGAERHQAV  357

Query  77   ALRVSADHAIFSNCAIDGYQDTLY  6
            ALRV  D A F NC  D +QDTLY
Sbjct  358  ALRVQGDLAAFYNCRFDAFQDTLY  381



>ref|XP_008800480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Phoenix dactylifera]
Length=570

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 134/212 (63%), Gaps = 6/212 (3%)
 Frame = -2

Query  620  GDTGEKMKHLLKTAGELTSNGLAIITNLTEAASTLEAK-KRRRLLSDNDG----FNFPAF  456
            G+   KM+  +KT+ ELTSN LA+I  +++  + L      RRLLS ++       +P++
Sbjct  178  GELKNKMRSAMKTSKELTSNALAMIGQVSDFLTMLNIPGSSRRLLSVDEKPVMKRGYPSW  237

Query  455  IDATARRLLNANAG-SIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNE  279
            +    RRLL       ++PNV VA+DGSG+F++IN+AI+K P   D  YVI +K G+YNE
Sbjct  238  VSEGDRRLLREYLNVKLRPNVTVAQDGSGDFRTINEAIDKVPLKYDGRYVIYVKEGIYNE  297

Query  278  YVVVPKNMNHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAG  99
             V +      +   GDGP KT +T NKN VDG  T  TAT    GE F A D+GF N+AG
Sbjct  298  AVNLTSRYVGITMYGDGPKKTIVTGNKNFVDGTKTSHTATFVASGEGFMAVDMGFRNTAG  357

Query  98   AQKHQAVALRVSADHAIFSNCAIDGYQDTLYA  3
             +KHQAVALRV +D +IF NC ++GYQDTLYA
Sbjct  358  PEKHQAVALRVQSDRSIFINCRMEGYQDTLYA  389



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 130/204 (64%), Gaps = 6/204 (3%)
 Frame = -2

Query  602  MKHLLKTAGELTSNGLAIITNLTE----AASTLEAKKRRRLLSDNDGFNFPAFIDATARR  435
            ++ +L+ + E TSN LA+++ L++      + +   KRR L  + DGF  P ++    RR
Sbjct  214  LEKMLQASKEFTSNSLAMLSLLSQFQLPVTAAVSGAKRRLLAQNKDGF--PTWMSHEERR  271

Query  434  LLNANAGSIKPNVVVAKDGSGEFKSINDAINKAPPNNDAPYVIKIKAGVYNEYVVVPKNM  255
            +L  N     PNV VAKDGSG FK+I++A+   P   +  Y+I +K GVY+E V+V K M
Sbjct  272  VLKKNDEKPTPNVTVAKDGSGNFKTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKM  331

Query  254  NHVVFIGDGPTKTKITENKNKVDGIGTYQTATVAIEGEHFTARDIGFENSAGAQKHQAVA  75
             +V   GDG  K+ IT NKN  DG+ T+QTA+ A  GE F A+ +GF N+AG +KHQAVA
Sbjct  332  PNVTIYGDGSQKSIITGNKNFADGVRTFQTASFAALGEGFMAKSMGFRNTAGPEKHQAVA  391

Query  74   LRVSADHAIFSNCAIDGYQDTLYA  3
             RV AD AIF NC  +GYQDTLYA
Sbjct  392  ARVQADRAIFLNCRFEGYQDTLYA  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 814135294960