BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15287_g1_i1 len=553 path=[1:0-552]

Length=553
                                                                      Score     E

ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     189   2e-53   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                189   4e-53   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                187   1e-52   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     186   2e-52   
emb|CDO98832.1|  unnamed protein product                                186   3e-52   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    186   4e-52   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             186   4e-52   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                184   3e-51   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                184   3e-51   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                182   8e-51   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    182   2e-50   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          179   2e-49   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     178   3e-49   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     177   6e-49   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     177   8e-49   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    177   1e-48   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    176   3e-48   
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    173   4e-48   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     174   1e-47   
emb|CDO98834.1|  unnamed protein product                                173   2e-47   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         172   7e-47   
emb|CBI22967.3|  unnamed protein product                                175   1e-46   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    170   2e-46   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         169   6e-46   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     169   6e-46   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     169   7e-46   
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     169   8e-46   
ref|XP_003626199.1|  Pectinesterase                                     169   8e-46   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    169   8e-46   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    168   1e-45   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         168   2e-45   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          167   2e-45   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    166   8e-45   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    166   1e-44   
ref|XP_003591168.1|  Pectinesterase                                     166   1e-44   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             165   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    165   3e-44   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    165   3e-44   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    164   4e-44   
ref|XP_002314364.1|  putative pectinesterase family protein             164   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002516960.1|  Pectinesterase precursor, putative                 163   1e-43   Ricinus communis
emb|CDO98833.1|  unnamed protein product                                162   1e-43   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    162   2e-43   
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...    160   2e-43   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                162   2e-43   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    162   3e-43   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    160   8e-43   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     160   8e-43   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    160   9e-43   
ref|XP_002872255.1|  pectinesterase family protein                      160   9e-43   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 160   1e-42   Ricinus communis
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             160   2e-42   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    160   2e-42   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    159   3e-42   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     159   3e-42   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    159   4e-42   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    159   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    158   5e-42   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    158   5e-42   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    159   6e-42   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     158   7e-42   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    158   7e-42   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             159   8e-42   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     157   8e-42   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    158   8e-42   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   157   9e-42   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     157   9e-42   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             157   1e-41   
ref|XP_006382447.1|  pectin methylesterase family protein               157   1e-41   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    157   2e-41   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             156   2e-41   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    156   3e-41   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    156   3e-41   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    156   3e-41   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    156   3e-41   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     155   6e-41   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    157   6e-41   
emb|CBI39537.3|  unnamed protein product                                157   6e-41   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    155   6e-41   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    155   6e-41   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    155   8e-41   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    154   1e-40   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    154   1e-40   
ref|XP_003591166.1|  Pectinesterase                                     154   1e-40   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    154   1e-40   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    154   2e-40   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    153   4e-40   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     153   4e-40   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    152   7e-40   
gb|EPS70728.1|  pectinesterase                                          152   7e-40   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    152   9e-40   
ref|XP_003604119.1|  Pectinesterase                                     152   1e-39   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     152   1e-39   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    151   1e-39   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          151   1e-39   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     151   1e-39   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    151   2e-39   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     152   2e-39   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    151   2e-39   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    151   3e-39   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             150   3e-39   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    151   3e-39   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    151   3e-39   
emb|CDX99968.1|  BnaC09g03330D                                          151   4e-39   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     150   5e-39   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    150   6e-39   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     149   6e-39   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     149   6e-39   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    150   7e-39   
emb|CDY05188.1|  BnaC05g46150D                                          149   9e-39   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    149   1e-38   
ref|XP_007031044.1|  Pectinesterase, putative                           149   1e-38   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    149   1e-38   
emb|CDY68790.1|  BnaAnng28400D                                          150   1e-38   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     149   1e-38   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    149   1e-38   
gb|EPS59322.1|  pectinesterase                                          148   2e-38   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             148   2e-38   
emb|CDX74137.1|  BnaA03g29100D                                          149   2e-38   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     148   2e-38   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-38   
ref|XP_002884519.1|  pectinesterase family protein                      148   3e-38   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    149   3e-38   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    149   3e-38   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     147   4e-38   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    148   5e-38   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          147   6e-38   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             146   9e-38   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    146   1e-37   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    147   1e-37   
emb|CDY27751.1|  BnaA05g31600D                                          146   1e-37   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     146   1e-37   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    145   2e-37   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     145   3e-37   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          145   3e-37   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    144   5e-37   
gb|EPS72184.1|  pectinesterase family protein                           144   5e-37   
ref|XP_003591164.1|  Pectinesterase                                     144   7e-37   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    143   1e-36   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    142   2e-36   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    143   2e-36   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    142   2e-36   
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             142   3e-36   
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             142   3e-36   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             143   3e-36   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          142   3e-36   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    142   3e-36   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                143   4e-36   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    142   5e-36   
emb|CDP21547.1|  unnamed protein product                                142   5e-36   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    141   6e-36   
ref|XP_010489679.1|  PREDICTED: probable pectinesterase/pectinest...    137   2e-35   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             141   2e-35   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             140   2e-35   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             139   3e-35   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    139   3e-35   
dbj|BAC42986.1|  putative pectinesterase                                140   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    140   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                141   5e-35   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             137   2e-34   
gb|KHN04169.1|  Putative pectinesterase/pectinesterase inhibitor 21     136   3e-34   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    136   3e-34   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    136   4e-34   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     135   6e-34   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    135   1e-33   
emb|CDY34927.1|  BnaA01g32580D                                          134   1e-33   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 133   4e-33   
ref|XP_003604120.1|  Pectinesterase                                     133   5e-33   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          133   6e-33   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          133   6e-33   
gb|EMS65303.1|  putative pectinesterase/pectinesterase inhibitor 21     130   1e-32   
gb|EPS65387.1|  pectinesterase                                          132   1e-32   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    133   1e-32   
gb|KEH37214.1|  pectinesterase/pectinesterase inhibitor                 130   2e-32   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    131   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 130   4e-32   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             129   1e-31   
emb|CDX80613.1|  BnaC07g28310D                                          130   1e-31   
gb|EPS58111.1|  pectinesterase                                          127   1e-31   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    129   2e-31   
ref|XP_002865716.1|  pectinesterase family protein                      128   2e-31   
emb|CAB65290.2|  pectin methyl-esterase PER                             129   3e-31   Medicago truncatula
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 129   3e-31   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     128   4e-31   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    129   5e-31   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-30   
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...    125   3e-30   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    125   3e-30   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    125   4e-30   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             124   7e-30   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    124   9e-30   
emb|CDY08032.1|  BnaC03g34910D                                          122   1e-29   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          124   1e-29   Sorghum bicolor [broomcorn]
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    124   1e-29   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    123   2e-29   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             123   2e-29   
emb|CDX74078.1|  BnaA03g29690D                                          123   2e-29   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    123   2e-29   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    123   2e-29   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 123   2e-29   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    123   2e-29   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              122   4e-29   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   122   5e-29   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    122   5e-29   
gb|EPS69059.1|  hypothetical protein M569_05708                         124   5e-29   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    122   5e-29   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    121   7e-29   
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    121   8e-29   
dbj|BAC42959.2|  putative pectin methylesterase                         121   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ05229.1|  hypothetical protein OsI_27427                          121   1e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001060715.1|  Os07g0691100                                       121   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    121   1e-28   
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          121   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             121   2e-28   
ref|NP_001049858.1|  Os03g0300500                                       120   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             121   3e-28   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             121   3e-28   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             121   3e-28   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    119   3e-28   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    120   4e-28   
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    119   4e-28   
gb|AAF63815.1|  pectin methylesterase, putative                         119   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    119   5e-28   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    119   5e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40720.1|  BnaC03g34360D                                          114   7e-28   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    119   9e-28   
tpg|DAA64233.1|  TPA: pectinesterase                                    118   9e-28   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    118   9e-28   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             118   1e-27   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     118   2e-27   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    117   2e-27   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     117   2e-27   
ref|XP_006651293.1|  PREDICTED: probable pectinesterase/pectinest...    115   2e-27   
emb|CDY05295.1|  BnaC05g45080D                                          117   2e-27   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    117   2e-27   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    117   2e-27   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 117   2e-27   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    117   3e-27   
emb|CDY24663.1|  BnaA05g30620D                                          117   3e-27   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    118   4e-27   
emb|CDY33925.1|  BnaA02g30620D                                          117   4e-27   
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    117   4e-27   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     116   5e-27   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     115   8e-27   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    116   1e-26   
ref|NP_001151322.1|  pectinesterase-1 precursor                         115   1e-26   Zea mays [maize]
gb|EMS57827.1|  putative pectinesterase/pectinesterase inhibitor 21     114   2e-26   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 115   2e-26   
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          115   2e-26   Sorghum bicolor [broomcorn]
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    114   2e-26   
ref|XP_002882495.1|  pectinesterase family protein                      114   3e-26   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    114   5e-26   
dbj|BAK06954.1|  predicted protein                                      113   7e-26   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             113   1e-25   
gb|EYU40534.1|  hypothetical protein MIMGU_mgv11b016088mg               105   4e-25   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            110   6e-25   Medicago truncatula
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 110   6e-25   
gb|AEL79481.1|  pectin methylesterase-like protein                      109   1e-24   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     109   2e-24   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     106   2e-23   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     106   2e-23   
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             104   2e-22   
gb|KDP43632.1|  hypothetical protein JCGZ_16919                         101   9e-22   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                100   5e-21   
ref|XP_002275000.1|  PREDICTED: pectinesterase                        99.4    7e-21   Vitis vinifera
emb|CBI26012.3|  unnamed protein product                              99.4    8e-21   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...  99.0    1e-20   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...  99.0    2e-20   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...  98.6    2e-20   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                   98.2    2e-20   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...  95.1    3e-19   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                   94.7    4e-19   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                   94.4    4e-19   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                   94.7    4e-19   Vitis vinifera
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...  94.4    5e-19   
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1           94.4    5e-19   
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2           94.4    6e-19   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg           94.4    6e-19   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                   93.6    8e-19   
emb|CAN67129.1|  hypothetical protein VITISV_040170                   95.1    8e-19   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                   93.6    8e-19   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28   93.6    8e-19   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...  94.0    9e-19   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...  93.6    9e-19   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                   93.2    1e-18   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...  93.2    1e-18   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28   92.8    2e-18   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                   92.4    2e-18   
ref|XP_010489680.1|  PREDICTED: probable pectinesterase/pectinest...  89.7    3e-18   
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor               92.0    4e-18   
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...  92.4    4e-18   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063            91.7    4e-18   
ref|XP_002868170.1|  predicted protein                                92.0    5e-18   
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg           92.0    5e-18   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                   91.3    6e-18   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...  91.7    6e-18   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g           90.9    8e-18   
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                   90.5    1e-17   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g           90.5    1e-17   
ref|NP_001052981.1|  Os04g0458900                                     90.1    1e-17   
emb|CAH67075.1|  OSIGBa0097P08.5                                      90.1    1e-17   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                   90.1    1e-17   
gb|EAY94388.1|  hypothetical protein OsI_16156                        90.1    1e-17   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative             90.1    1e-17   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...  90.1    1e-17   
emb|CDY66111.1|  BnaAnng21510D                                        90.1    2e-17   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                   89.0    3e-17   
gb|EAY94391.1|  hypothetical protein OsI_16158                        88.6    5e-17   
gb|KFK22175.1|  hypothetical protein AALP_AAs39369U000100             88.6    7e-17   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                   87.4    1e-16   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850        87.0    1e-16   
gb|ACF79975.1|  unknown                                               87.0    2e-16   
gb|AFW59628.1|  pectinesterase                                        87.4    2e-16   
ref|NP_001145377.1|  uncharacterized protein LOC100278720             87.4    2e-16   
gb|KDP23452.1|  hypothetical protein JCGZ_23285                       82.8    3e-16   
gb|AEK07905.1|  pectin methylesterase                                 86.3    4e-16   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g           85.9    4e-16   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                   85.5    5e-16   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250        85.5    6e-16   
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                      85.5    6e-16   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...  85.1    8e-16   
ref|XP_007149847.1|  hypothetical protein PHAVU_005G103500g           84.3    9e-16   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                   84.3    1e-15   
ref|XP_010240510.1|  PREDICTED: probable pectinesterase/pectinest...  84.7    1e-15   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg           84.3    1e-15   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...  84.3    2e-15   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                   84.3    2e-15   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21   83.6    2e-15   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020        84.0    2e-15   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative             84.0    2e-15   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                   84.0    2e-15   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                   83.6    2e-15   
ref|XP_008668795.1|  PREDICTED: pectinesterase-like                   84.0    2e-15   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg              83.2    3e-15   
gb|KDP28007.1|  hypothetical protein JCGZ_19087                       82.8    5e-15   
ref|XP_011036546.1|  PREDICTED: pectinesterase 3-like                 82.0    9e-15   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...  82.0    1e-14   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                   81.6    1e-14   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310        82.0    1e-14   
gb|EMT12798.1|  Putative pectinesterase/pectinesterase inhibitor 21   81.3    1e-14   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                   81.3    1e-14   
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g           81.3    2e-14   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...  80.9    2e-14   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...  80.9    2e-14   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g           80.5    3e-14   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                   80.5    3e-14   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                   80.5    3e-14   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                       79.7    5e-14   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g           79.3    6e-14   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3        79.3    6e-14   
ref|XP_009407599.1|  PREDICTED: putative pectinesterase/pectinest...  78.6    7e-14   
ref|XP_009391197.1|  PREDICTED: pectinesterase 3                      79.3    7e-14   
ref|XP_002304256.1|  pectinesterase family protein                    79.0    9e-14   
ref|XP_006369082.1|  hypothetical protein POPTR_0001s16291g           79.0    9e-14   
gb|KDP40628.1|  hypothetical protein JCGZ_24627                       79.0    9e-14   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2        79.0    9e-14   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                   78.2    2e-13   
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300        78.6    2e-13   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                   78.2    2e-13   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                   77.8    2e-13   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...  77.8    2e-13   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                   77.8    3e-13   
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...  77.4    3e-13   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                   77.4    3e-13   
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    6e-13   
ref|XP_004488156.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    7e-13   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21   75.9    9e-13   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...  75.9    9e-13   
ref|XP_008375511.1|  PREDICTED: putative pectinesterase/pectinest...  74.3    1e-12   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...  76.3    1e-12   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21   75.5    1e-12   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g           75.5    1e-12   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...  75.5    1e-12   
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...  75.5    1e-12   
ref|XP_010687597.1|  PREDICTED: pectinesterase                        75.5    1e-12   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28   74.7    2e-12   
ref|XP_003595373.1|  Pectinesterase                                   73.9    2e-12   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                   74.7    2e-12   
gb|KDP34079.1|  hypothetical protein JCGZ_07650                       74.7    2e-12   
ref|XP_011048628.1|  PREDICTED: pectinesterase 3                      74.7    3e-12   
dbj|BAK06157.1|  predicted protein                                    75.1    3e-12   
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                      74.3    4e-12   
gb|AES65624.2|  pectinesterase/pectinesterase inhibitor               73.9    4e-12   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...  73.9    5e-12   
ref|XP_010940182.1|  PREDICTED: pectinesterase 3-like                 74.3    5e-12   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                   73.6    7e-12   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21   73.9    7e-12   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g           73.6    7e-12   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...  73.6    7e-12   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21   73.6    9e-12   
ref|XP_007138601.1|  hypothetical protein PHAVU_009G222600g           73.2    9e-12   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...  73.2    9e-12   
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                      73.2    9e-12   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g           72.4    1e-11   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   
gb|KDO37799.1|  hypothetical protein CISIN_1g046024mg                 72.8    1e-11   
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                 72.8    1e-11   
ref|XP_003535290.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g           72.8    1e-11   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                     72.4    1e-11   
ref|XP_007039038.1|  Plant invertase/pectin methylesterase inhibi...  72.8    1e-11   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...  72.4    1e-11   
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690        72.4    1e-11   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...  72.4    1e-11   
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...  72.4    1e-11   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1        72.4    2e-11   
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...  72.4    2e-11   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...  72.4    2e-11   
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...  72.4    2e-11   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                   72.0    2e-11   
gb|AFW03476.1|  pectin methylesterase 2                               71.6    2e-11   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...  72.0    2e-11   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460        72.0    2e-11   
ref|XP_007011069.1|  Root hair specific 12                            71.6    2e-11   
emb|CDX72395.1|  BnaC07g44170D                                        71.6    3e-11   
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg           71.6    3e-11   
ref|NP_001063246.1|  Os09g0433700                                     71.6    3e-11   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                        71.6    3e-11   
gb|AFB77928.1|  pectin methylesterase                                 71.2    3e-11   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1            71.2    3e-11   
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                      70.9    4e-11   
ref|XP_002324181.2|  pectinesterase family protein                    70.9    5e-11   
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...  70.9    5e-11   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                 70.9    5e-11   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28   70.9    5e-11   
ref|XP_004495868.1|  PREDICTED: probable pectinesterase/pectinest...  70.9    5e-11   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...  71.2    5e-11   
gb|AER38243.1|  PME2                                                  70.5    6e-11   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                   67.4    8e-11   
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                      70.1    8e-11   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...  70.1    9e-11   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                   69.7    1e-10   
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                  69.7    1e-10   
ref|XP_008346146.1|  PREDICTED: putative pectinesterase/pectinest...  69.7    1e-10   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative             69.3    1e-10   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg           69.3    2e-10   
gb|EAZ07185.1|  hypothetical protein OsI_29431                        69.3    2e-10   
ref|XP_003609936.1|  Pectinesterase                                   69.3    2e-10   
ref|XP_003588521.1|  Pectinesterase                                   69.3    2e-10   
ref|NP_195049.1|  putative pectinesterase/pectinesterase inhibito...  69.3    2e-10   
ref|NP_001132793.1|  pectinesterase                                   69.3    2e-10   
ref|XP_003598363.1|  Pectinesterase                                   69.3    2e-10   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...  69.3    2e-10   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...  69.3    2e-10   
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...  69.3    2e-10   
ref|XP_010273801.1|  PREDICTED: pectinesterase                        68.9    2e-10   
ref|XP_008343212.1|  PREDICTED: pectinesterase-like                   68.9    2e-10   
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                 65.9    2e-10   
ref|XP_010418644.1|  PREDICTED: putative pectinesterase/pectinest...  68.6    2e-10   
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg           65.9    2e-10   
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180        68.9    2e-10   
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                      68.6    3e-10   
dbj|BAA89480.1|  pectin methylesterase                                68.6    3e-10   
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg           68.6    3e-10   
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...  68.6    3e-10   
gb|KHN45041.1|  Putative pectinesterase/pectinesterase inhibitor 45   65.9    3e-10   
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg           68.6    3e-10   
emb|CAB58974.1|  pectin methylesterase                                68.6    3e-10   
tpg|DAA45708.1|  TPA: hypothetical protein ZEAMMB73_512323            68.2    4e-10   
gb|EAZ42935.1|  hypothetical protein OsJ_27525                        68.2    4e-10   
ref|XP_007045219.1|  Plant invertase/pectin methylesterase inhibi...  66.2    4e-10   
ref|NP_001061941.1|  Os08g0450200                                     68.2    4e-10   
ref|NP_001169525.1|  pectinesterase                                   68.2    4e-10   
ref|XP_009138175.1|  PREDICTED: putative pectinesterase/pectinest...  68.2    4e-10   
emb|CDY46125.1|  BnaA03g52430D                                        68.2    4e-10   
gb|KFK29934.1|  hypothetical protein AALP_AA7G197300                  68.2    4e-10   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...  67.8    4e-10   
gb|ACJ85773.1|  unknown                                               65.9    5e-10   
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...  67.8    5e-10   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                   65.1    5e-10   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                   65.1    5e-10   
ref|XP_006295414.1|  hypothetical protein CARUB_v10024512mg           67.8    5e-10   
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...  67.8    5e-10   
ref|XP_010029515.1|  PREDICTED: pectinesterase 3-like                 67.8    5e-10   
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                 67.8    5e-10   
emb|CDP19930.1|  unnamed protein product                              67.8    6e-10   
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                 67.0    6e-10   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24   67.4    7e-10   
ref|XP_002324773.2|  hypothetical protein POPTR_0018s05360g           66.6    7e-10   
ref|XP_008656646.1|  PREDICTED: pectinesterase-like                   67.0    8e-10   
ref|XP_007215024.1|  hypothetical protein PRUPE_ppa003307mg           67.0    8e-10   
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...  67.0    8e-10   
ref|XP_007012506.1|  Pectinesterase                                   67.0    8e-10   
ref|XP_006440385.1|  hypothetical protein CICLE_v10023344mg           64.3    8e-10   
gb|AAV91508.1|  VANGUARD 1                                            67.0    9e-10   
gb|KHN10486.1|  Putative pectinesterase/pectinesterase inhibitor 13   67.0    9e-10   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...  64.3    1e-09   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...  67.0    1e-09   
gb|KFK35692.1|  hypothetical protein AALP_AA4G024800                  66.6    1e-09   
ref|XP_010939548.1|  PREDICTED: pectinesterase-like                   67.0    1e-09   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg              67.0    1e-09   
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                   64.3    1e-09   
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg           66.6    1e-09   
gb|AFW03475.1|  pectin methylesterase 1                               66.6    1e-09   
gb|EPS69324.1|  hypothetical protein M569_05439                       66.6    1e-09   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg              66.6    1e-09   
emb|CDO97789.1|  unnamed protein product                              66.6    1e-09   
ref|XP_002865971.1|  pectinesterase family protein                    66.6    1e-09   



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 125/178 (70%), Gaps = 9/178 (5%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMG-------GSSEVTTSTKEVEAICAPTDYKETC  202
            KK+AIA VASILLVACVVAA IS T            S ++TSTK V+AIC PTDYKETC
Sbjct  4    KKLAIASVASILLVACVVAAAISFTKRNEDHSSNSTDSHLSTSTKSVQAICQPTDYKETC  63

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA-LLKEAAKDPRASDALDLCKTLL  379
            + SL+ A    NDPKELIK AF+ T+ ++S+ I  SA L+ EA KDPR  DAL  C+ LL
Sbjct  64   EKSLANAK-NINDPKELIKVAFNATINDLSNVIKNSASLIDEAKKDPRTKDALQTCQGLL  122

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + +I DL +S +    F+V+ I +Y +DLK WLS AIT QETC DAFENTTGDTGEKM
Sbjct  123  DVAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKM  180



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 127/188 (68%), Gaps = 13/188 (7%)
 Frame = +2

Query  23   MGDGDKNKK-VAIAGVASILLVACVVAATISVT--NMGGSSE--------VTTSTKEVEA  169
            MGD D NKK + + G+AS+LLVA VV  TI V+  N GG +         V+TSTK V+A
Sbjct  1    MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  170  ICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            IC+PTDYKETC++SLSGA   T DPKELI+ AF+  + NI  AI  S L K+AA D    
Sbjct  61   ICSPTDYKETCESSLSGA--NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTK  118

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            DA D+C  +L ++I DL+++ +  G+FD   + EY  DLKVWLS  IT QETC DAFENT
Sbjct  119  DAFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENT  178

Query  530  TGDTGEKM  553
            TGDT EKM
Sbjct  179  TGDTAEKM  186



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 127/188 (68%), Gaps = 13/188 (7%)
 Frame = +2

Query  23   MGDGDKNKK-VAIAGVASILLVACVVAATISVT--NMGGSSE--------VTTSTKEVEA  169
            MGD D NKK + + G+AS+LLVA VV  TI V+  N GG +         V+TSTK V+A
Sbjct  1    MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  170  ICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            IC+PTDYKETC++SL+GA   T DPKELI+ AF+  + NI  AI  S L K+AA D    
Sbjct  61   ICSPTDYKETCESSLAGA--NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTK  118

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            DA D+C  +L ++I DL+++ +  G+FD   + EY  DLKVWLS  IT QETC DAFENT
Sbjct  119  DAFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENT  178

Query  530  TGDTGEKM  553
            TGDT EKM
Sbjct  179  TGDTAEKM  186



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 124/178 (70%), Gaps = 9/178 (5%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMG-------GSSEVTTSTKEVEAICAPTDYKETC  202
            KK+AIA VASILLVACVVAA IS T            S ++TSTK V+AIC PTDYKETC
Sbjct  4    KKLAIASVASILLVACVVAAAISFTKKNEDKSSNSTDSRLSTSTKSVQAICQPTDYKETC  63

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA-LLKEAAKDPRASDALDLCKTLL  379
            + SL+ A    NDPKELIK AF+ T+ ++S  I  SA L+ EA KDPR  DAL  C+ L+
Sbjct  64   EKSLANAK-NINDPKELIKVAFNATINDLSDVIKNSASLIDEAKKDPRTKDALQTCQGLV  122

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + +I DL +S +    F+V+ I +Y +DLK WLS AIT QETC DAFENTTGDTGEKM
Sbjct  123  DVAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKM  180



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 125/186 (67%), Gaps = 11/186 (6%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVA-ATISV--------TNMGGSSEVTTSTKEVEAIC  175
            MG   K KK AI GV+SILLVA VV   T SV        T+ GGS +V+TS+K VE++C
Sbjct  1    MGSEGK-KKAAILGVSSILLVAAVVGTVTYSVGRHGTETATSGGGSDQVSTSSKSVESVC  59

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
               DYK+TC+ SLSGA   T+DP+ELIK AF   + NI+  I  S LL+ AAKDPR   A
Sbjct  60   KHVDYKQTCEQSLSGAK-NTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQA  118

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            L+ CK  LN SI DL++S E  G FD+N I +Y  DLK WLS A T QETC DAFENTTG
Sbjct  119  LETCKYALNTSIEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTG  178

Query  536  DTGEKM  553
            DTGE+M
Sbjct  179  DTGEQM  184



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 122/183 (67%), Gaps = 7/183 (4%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT---NMGGS----SEVTTSTKEVEAICAPT  184
            GD +K KK+AI  V+S+ LVA V+A T+ VT   + GGS     + TTSTK ++AIC PT
Sbjct  3    GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSWSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYKETC+ SL  A   + +PKELIK  F V M  +   I  S  L+E AKDP A+ AL+ 
Sbjct  63   DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK LL+ +IGDL  S +  G FD++ I  YA DLK+WLS A+T ++TC D F+NTTGD G
Sbjct  123  CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  545  EKM  553
            EKM
Sbjct  183  EKM  185



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 122/183 (67%), Gaps = 7/183 (4%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT---NMGGS----SEVTTSTKEVEAICAPT  184
            GD +K KK+AI  V+S+ LVA V+A T+ VT   + GGS     + TTSTK ++AIC PT
Sbjct  3    GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYKETC+ SL  A   + +PKELIK  F V M  +   I  S  L+E AKDP A+ AL+ 
Sbjct  63   DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK LL+ +IGDL  S +  G FD++ I  YA DLK+WLS A+T ++TC D F+NTTGD G
Sbjct  123  CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  545  EKM  553
            EKM
Sbjct  183  EKM  185



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 129/189 (68%), Gaps = 16/189 (8%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISV------------TNMGGSSEVTTSTKEVE  166
            MGD  K KK+A+AG+ SILLVA VVA  + +            TN GG   V+ +TK V+
Sbjct  1    MGDDSKKKKMAVAGLCSILLVAMVVAVAVGIPKKNGDETDDAPTNGGGG--VSATTKAVQ  58

Query  167  AICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRA  346
            AIC+PTDYK+TC  SLSGA   + DPKELIK AF  T+KNI  +I  S L K+AA D R 
Sbjct  59   AICSPTDYKQTCTESLSGA--NSTDPKELIKVAFEYTVKNIKESIKNSTLYKDAAADERT  116

Query  347  SDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFEN  526
              ALD+C  +LN SI DLE+S E  G+FD++ + +  +D+K WLSGAIT QETC DAFEN
Sbjct  117  KGALDVCSEVLNTSIEDLERSFEKIGEFDMSKVDDLVDDVKTWLSGAITYQETCLDAFEN  176

Query  527  TTGDTGEKM  553
            TTGDTGEKM
Sbjct  177  TTGDTGEKM  185



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 126/189 (67%), Gaps = 14/189 (7%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISV-TNMGGSS-----------EVTTSTKEVE  166
            MGD  K KK+ I G+AS+LLVA V+  T+ V  N GG++            ++T+ K V 
Sbjct  1    MGDDGKKKKILIGGLASVLLVAMVICVTVGVERNSGGNAAAPSTGGGSGGGISTANKAVH  60

Query  167  AICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRA  346
            AIC+PTDYKETC++SLSGA   T DPKELIK AF+  + NI  AI  SALLK+AA D   
Sbjct  61   AICSPTDYKETCESSLSGA--NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNST  118

Query  347  SDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFEN  526
             DALD+C  +L ++I DL+++ +  G FD   + EY  DLKVWLS  IT QETC DAFEN
Sbjct  119  KDALDICNDVLESAIDDLKRAGDKVGAFDATKVDEYVEDLKVWLSAVITYQETCIDAFEN  178

Query  527  TTGDTGEKM  553
            TTGDT EKM
Sbjct  179  TTGDTAEKM  187



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 125/189 (66%), Gaps = 14/189 (7%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS-----------EVTTSTKEVE  166
            MGD  K KK+ I G+AS+LLVA VV  T+ V  N  G +            ++T+ K V 
Sbjct  1    MGDDGKKKKILIGGLASVLLVAMVVCVTVGVQKNSAGDAAAPSTGGGSGGGISTANKAVH  60

Query  167  AICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRA  346
            AIC+PTDYKETC++SLSGA   T DPKELIK AF+  + NI  AI  SALLK+AA D   
Sbjct  61   AICSPTDYKETCESSLSGA--NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNST  118

Query  347  SDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFEN  526
             DALD+C  +L ++I DL+++ +  G FD + + EY  DLKVWLS  IT QETC DAFEN
Sbjct  119  KDALDICNDVLESAIDDLKRAGDKVGSFDASKVDEYVEDLKVWLSAVITYQETCIDAFEN  178

Query  527  TTGDTGEKM  553
            TTGDT EKM
Sbjct  179  TTGDTAEKM  187



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE-----------VTTSTKEVEAIC  175
            D    KKVA+ G +SILLVA VV   ++V +  GSS            ++TS K ++AIC
Sbjct  10   DSRGKKKVALMGFSSILLVAMVVGTVVTVNHRNGSSSSATDDAQAGGGISTSVKAIQAIC  69

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PTDYKE C  SL+ A A T+DPKEL++TAF V +  IS A+  S  L++  KDPR   A
Sbjct  70   QPTDYKEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGA  129

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            L+ C  L++ +I DL  S    G FD++ I +Y  DLK+WLSGA+T QETC D FENTTG
Sbjct  130  LENCHELMDYAIDDLRNSFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTG  189

Query  536  DTGEKM  553
            D GEKM
Sbjct  190  DAGEKM  195



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 132/182 (73%), Gaps = 14/182 (8%)
 Frame = +2

Query  47   KVAIAGVASILLVACVVAATISVTN-------------MGGSSEVTTSTKEVEAICAPTD  187
            K+AIAG+ASIL+VACVVAA +++T              +   S+++TSTK V+A+C PTD
Sbjct  4    KIAIAGLASILVVACVVAAAVTITKRNSSDSSSNSGDPVSNDSQISTSTKSVQAMCQPTD  63

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YKE C+ SL+ +A  T+DPKELIK AF  T+ +I +A+  ++L++EAAKDPR  DAL  C
Sbjct  64   YKEACEKSLA-SAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQEAAKDPRTKDALQTC  122

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            ++LLN SI DL +S +  G FD+N I +Y +DLK W+S +IT QETC DAFENTTG+TGE
Sbjct  123  ESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFENTTGETGE  182

Query  548  KM  553
            KM
Sbjct  183  KM  184



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 132/182 (73%), Gaps = 14/182 (8%)
 Frame = +2

Query  47   KVAIAGVASILLVACVVAATISVTN-------------MGGSSEVTTSTKEVEAICAPTD  187
            K+AIAG+ASIL+VACVVAA +++T              +   S+++TSTK V+A+C PTD
Sbjct  4    KIAIAGLASILVVACVVAAAVTITKRNSSDSSSSSGDPVSNDSQISTSTKSVKAMCQPTD  63

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YKE C+ SL+ +A  T+DPKELIK AF  T+ +I +A+  ++L++EAAKDPR  DAL  C
Sbjct  64   YKEACEKSLA-SAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQEAAKDPRTKDALQTC  122

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            ++LLN SI DL +S +  G FD+N I +Y +DLK W+S +IT QETC DAFENTTG+TGE
Sbjct  123  ESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFENTTGETGE  182

Query  548  KM  553
            KM
Sbjct  183  KM  184



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 122/188 (65%), Gaps = 11/188 (6%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVV----------AATISVTNMGGSSEVTTSTKEVEAI  172
            M DG KNKK A+ GV+S+ LVA VV            T S    G ++E++TSTK V+A+
Sbjct  1    MSDGGKNKKAALIGVSSLFLVAMVVAVAVGVNRKNPTTDSSGGDGATAEISTSTKAVQAL  60

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDYKETC+ +LS A   T+DP+ELIK+ FHV +  I  AI  S  LKEAA DP A  
Sbjct  61   CQPTDYKETCEKALSEAGTNTSDPRELIKSGFHVAVNEIKWAIGNSTQLKEAASDPMAKQ  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGD-FDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            ALD C  L++ +I DL  S +   D FDV  + +Y  DLK+WLSGA+T QETC D FEN 
Sbjct  121  ALDACGELMDYAIDDLVISFDRITDNFDVQKLNDYVEDLKIWLSGALTYQETCIDGFENV  180

Query  530  TGDTGEKM  553
            TGDTGEKM
Sbjct  181  TGDTGEKM  188



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 7/182 (4%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGG----SSEVTTSTKEVEAICAPTDY  190
            M D  K KK+AIAG++SILLVAC+V A +++T  G     +S+V+TSTK V+A+C PT Y
Sbjct  1    MADAGK-KKIAIAGISSILLVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQY  59

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            KETC+ SLS +A  T+DPKELIKTAF  T+  I+ +I  SA  KEAA DPR  DAL +C 
Sbjct  60   KETCEKSLS-SAKNTSDPKELIKTAFDSTINEIASSIKNSAPFKEAANDPRTKDALKVCD  118

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNIL-EYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
             +L+ SI ++++S       DV +++ +Y  DL+ WLS A+T + TC DAF NTTGDTGE
Sbjct  119  EVLDRSIEEIKRSFNKFDSSDVKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGE  178

Query  548  KM  553
            KM
Sbjct  179  KM  180



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   177 bits (448),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 11/186 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT-----------NMGGSSEVTTSTKEVEAIC  175
            DG+K K+ A+ G++S+LLVA V+A T+ V+           N  GS EV+ S K +++IC
Sbjct  6    DGEKRKRYAVIGISSVLLVAMVIAVTVGVSLNNGQSSPASSNKDGSHEVSASMKAIKSIC  65

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PTDYKE C  SLS  +  T DPK+LI+  F V MK +S A  +S +L++  KDPRAS A
Sbjct  66   QPTDYKEECINSLSSESGNTTDPKKLIQAGFKVAMKYLSEAAKKSVVLQDLEKDPRASKA  125

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            L  CK L+ NSI DL+ S +  G+FD++   +   DLK+WLS  +T QETC D F+NTTG
Sbjct  126  LGHCKQLMENSIDDLKHSVDKLGEFDISKFDQMLMDLKIWLSATVTYQETCLDGFQNTTG  185

Query  536  DTGEKM  553
            +  EKM
Sbjct  186  EAAEKM  191



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   176 bits (445),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 88/183 (48%), Positives = 120/183 (66%), Gaps = 8/183 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV--------TNMGGSSEVTTSTKEVEAICAPT  184
            D  K +++AI GV++ILLVA VVAAT+SV         +    S +++S K V+ IC PT
Sbjct  6    DSQKKRRIAIIGVSTILLVAMVVAATVSVGFGKNVEAEDASKDSHISSSVKAVQTICEPT  65

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DY++ C+ SL+  A    DP+EL+K AF++T+  IS  +S++ LL E   D R  +ALD 
Sbjct  66   DYRKECEESLTAQAGNITDPRELVKIAFNITITKISDGLSKTQLLHEVESDERTKEALDT  125

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L+N SI + ++S E   +FD+NN+      LKVWLSGAIT QETC DAFENTT + G
Sbjct  126  CKQLMNLSIDEFKRSLEKFSNFDLNNLDRVLTSLKVWLSGAITYQETCLDAFENTTTNAG  185

Query  545  EKM  553
            EKM
Sbjct  186  EKM  188



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 120/176 (68%), Gaps = 7/176 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSS-----EVTTSTKEVEAICAPTDYKETCKT  208
            KK+ IAG+ASILLVACVV   ++ T     S     E+++S+K V+A+C PT YKE C+ 
Sbjct  7    KKIVIAGIASILLVACVVGVAVTFTKKNDDSTSNGGEISSSSKSVQAMCQPTQYKEACEK  66

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL G+A  T+DPKELIKTAF  TM  IS++I  SA  KEAA DPR  +AL +C  +L+ S
Sbjct  67   SL-GSAKNTSDPKELIKTAFDNTMTEISNSIKNSAPFKEAANDPRTKNALKVCDEVLDRS  125

Query  389  IGDLEKSCEAAGDFDVNNIL-EYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I + ++S       D+N ++ EY  D++ WLS A+T +ETC DAF NTTGDTGEKM
Sbjct  126  IEEFKRSFSQIDSNDLNKLIKEYIYDVRSWLSSAVTFEETCIDAFANTTGDTGEKM  181



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 128/182 (70%), Gaps = 7/182 (4%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGG----SSEVTTSTKEVEAICAPTDY  190
            M D  K KK+AIAG+ASIL+VAC+V A +++T  G     +S+V+TSTK V+A+C PT Y
Sbjct  1    MADAGK-KKIAIAGIASILVVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQY  59

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            KETC+ SLS +A  T+DPKELIKTAF  ++  I+ +I  SA  KEAA DPR  DAL +C 
Sbjct  60   KETCEKSLS-SAKNTSDPKELIKTAFDSSVNEIASSIKNSAPFKEAANDPRTKDALKVCD  118

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNIL-EYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
             +L+ SI ++++S       D+ +++ +Y  DL+ WLS A+T + TC DAF NTTGDTGE
Sbjct  119  EVLDRSIEEIKRSFNKFDSSDLKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGE  178

Query  548  KM  553
            KM
Sbjct  179  KM  180



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 10/184 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI---------SVTNMGGSSEVTTSTKEVEAICAP  181
            D  +NKK+AI  V+SILLVA VV             S +    ++ VT+S+K ++++C  
Sbjct  5    DSSRNKKLAILSVSSILLVAAVVGVVTYGSSHKNVESPSAGADATPVTSSSKAIQSLCQH  64

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDYKETC+ SLS  A  T+DP+EL+K AF  T+ N+   I  S+LL+ AAKDPR SDALD
Sbjct  65   TDYKETCEDSLS-KAKNTSDPRELVKVAFQTTVDNLGEVIKNSSLLQNAAKDPRTSDALD  123

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
            +CK +LN +I D ++S +   DFD++ + +YA DLK WLSGAIT Q+TC DAFENTTGDT
Sbjct  124  ICKEVLNTAIDDFKRSFDKVQDFDISKLDDYAADLKTWLSGAITLQQTCLDAFENTTGDT  183

Query  542  GEKM  553
            GEKM
Sbjct  184  GEKM  187



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = +2

Query  26   GDGD---KNKKVAIAGVASILLVACVVAATISVTNMG-------GSSEVTTSTKEVEAIC  175
            G GD   K KK AI GV S LLVA V+A    + N G        S+E+TTS+K V++IC
Sbjct  5    GVGDPTGKKKKYAIFGVTSFLLVAMVIAVAYGI-NSGDHQDGSNPSAEITTSSKSVQSIC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PTDY+E C+ SL  AA  T DP +L++  F VT+  +  A+  S+ LKE AKDP A  A
Sbjct  64   QPTDYREICEKSLRKAAGNTTDPHKLVQAGFQVTIDALQQALQNSSTLKEVAKDPMAKQA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++++I DL+ S E  G FDV+ + EY  +LK+WLS  IT Q+TC D F+NTTG
Sbjct  124  LDNCKELMDDAIHDLKVSFEEVGHFDVSKMDEYLENLKIWLSATITYQQTCLDGFDNTTG  183

Query  536  DTGEKM  553
              G KM
Sbjct  184  PAGAKM  189



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 114/175 (65%), Gaps = 7/175 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCKT  208
            D    KKVA+ G +SILLVA VV      T  GG   ++TS K ++AIC PTDYKE C  
Sbjct  10   DSRGKKKVALMGFSSILLVAMVVG-----TVAGGG--ISTSVKAIQAICQPTDYKEACVN  62

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL+ A A T+DPKEL++TAF V +  IS A+  S  L++  KDPR   AL+ C  L++ +
Sbjct  63   SLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCHELMDYA  122

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I DL  S    G FD++ I +Y  DLK+WLSGA+T QETC D FENTTGD GEKM
Sbjct  123  IDDLRNSFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTGDAGEKM  177



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 13/182 (7%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSSE------------VTTSTKEVEAICAPTD  187
            KK+ I  +ASIL+VACVVAA +++T    S              V+TSTK V+AIC PTD
Sbjct  3    KKLVIGSIASILVVACVVAACVTITKKNASDPSSGGGDGASNGGVSTSTKSVKAICQPTD  62

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YKETC+ SL+ +A  T+DPKELIK AF  T+ +I +AI  + L+K+AAKDPR  +AL  C
Sbjct  63   YKETCEKSLA-SAKNTSDPKELIKVAFESTITDIKNAIKNTDLIKDAAKDPRTKEALHTC  121

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            + LL+ SI DL +S +  G FD+N I +Y +DLK W+S +IT QETC DAF+NT+GDTGE
Sbjct  122  EGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFQNTSGDTGE  181

Query  548  KM  553
            KM
Sbjct  182  KM  183



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 117/186 (63%), Gaps = 11/186 (6%)
 Frame = +2

Query  26   GDGD---KNKKVAIAGVASILLVACVVAATISVTNMG-------GSSEVTTSTKEVEAIC  175
            G GD   K KK AI GVAS LLVA V+A    + N G        S+E++TS+K V+AIC
Sbjct  5    GAGDPTGKKKKYAIFGVASFLLVAMVIAVAYGI-NSGDHQNGSNASAEISTSSKSVQAIC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PTDY+E C  SLS AA  T DP +L++  F VT+  +  A+  S+ LK+ AKDP A  A
Sbjct  64   QPTDYREICGKSLSKAAGNTTDPLKLVQAGFQVTIDALQQALQNSSTLKDVAKDPMAKQA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++++I DL+ S E    FDVN + EY  +LK WLS  IT Q+TC D F+NTTG
Sbjct  124  LDNCKELMDDAIHDLKVSFEEVEHFDVNKMDEYLANLKTWLSATITYQQTCLDGFDNTTG  183

Query  536  DTGEKM  553
              G KM
Sbjct  184  PAGAKM  189



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 126/178 (71%), Gaps = 9/178 (5%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGS--------SEVTTSTKEVEAICAPTDYKET  199
            KK+ I G+ASIL+VACVVAA +++T    S          ++TSTK V+A+C PTDYKE 
Sbjct  3    KKLVIGGIASILVVACVVAACVTITKKNASDGGDGASNGGISTSTKSVQAMCQPTDYKEA  62

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ SL+ +A  T+DPKELIK AF  T+ +I +AI  + L+K+AA DPR  +AL+ C  LL
Sbjct  63   CEKSLA-SAKNTSDPKELIKVAFESTITDIKNAIKNTDLIKDAANDPRTKEALNTCDGLL  121

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + SI DL +S +  G FD+N I +Y +DLK W+S +IT QETC DAF+NT+GDTGEKM
Sbjct  122  DVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFQNTSGDTGEKM  179



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 117/179 (65%), Gaps = 11/179 (6%)
 Frame = +2

Query  47   KVAIAGVASILLVACVVAATISVTN---------MGGSSEVTTSTKEVEAICAPTDYKET  199
            KVAI  +AS+LLVACVVAA IS T+             S+++TS K V  IC  TDYKET
Sbjct  5    KVAIGSIASLLLVACVVAAAISTTSKRNEDNSSNNNNDSQISTSAKSVNVICQQTDYKET  64

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALL-KEAAKDPRASDALDLCKTL  376
            C  SL+  A  TNDPK+L+K AF  T+ ++   I  SALL  EA+KDPR  DAL  C  L
Sbjct  65   CVKSLA-KANNTNDPKDLLKVAFGATINDLFDVIKNSALLINEASKDPRTKDALKTCGDL  123

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L+ +I D+ +S +  G FD     +YA+DLK WLS +IT QETC DAFENTTG+TGEKM
Sbjct  124  LDVAIDDVRRSFDEIGVFDATKFKDYADDLKTWLSASITYQETCLDAFENTTGETGEKM  182



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   169 bits (428),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 89/187 (48%), Positives = 116/187 (62%), Gaps = 10/187 (5%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVT--NMGGS--------SEVTTSTKEVEAI  172
            MG   + K++AI GV++ LLVA VVA T+S+   N G S        S V +S K V+ +
Sbjct  1    MGGDAQKKRIAIIGVSTFLLVAMVVAVTVSINLNNKGSSYDSKEESKSSVASSIKAVKTL  60

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            CAPTDYK+ C+ SL   +    DP+ELIK AFHVT+  I   + ++ L+ +   DPR  +
Sbjct  61   CAPTDYKKECEDSLIEHSNNITDPRELIKIAFHVTISKIGEGLEKTELMHQVENDPRTKE  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            ALD CK L+N SIG+  +S +    FD+NN+      LKVWLSGAIT QETC DAFENTT
Sbjct  121  ALDTCKQLMNLSIGEFTRSLDRFTKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTT  180

Query  533  GDTGEKM  553
             D   KM
Sbjct  181  TDASLKM  187



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   169 bits (428),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 88/185 (48%), Positives = 118/185 (64%), Gaps = 9/185 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISV---------TNMGGSSEVTTSTKEVEAICA  178
            GD  +NK++AI GV++ LLVA VVA T++V               S V+ S K V+ +CA
Sbjct  5    GDAKRNKRLAIIGVSTFLLVAMVVAVTVNVGFNNKKEPGEETSKESHVSQSVKAVKTLCA  64

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDAL  358
            PTDYK+ C+ SL   A    +PKELIK AF++T+  IS  + ++ LL+EA KD R   AL
Sbjct  65   PTDYKKECEDSLIAHAGNITEPKELIKIAFNITIAKISEGLKKTHLLQEAEKDERTKQAL  124

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
            D CK ++  SI + ++S E   +FD+N++      LKVWLSGAIT QETC DAFENTT D
Sbjct  125  DTCKQVMQLSIDEFQRSLERFSNFDLNSLDRVLTSLKVWLSGAITYQETCLDAFENTTTD  184

Query  539  TGEKM  553
             G+KM
Sbjct  185  AGKKM  189



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 115/181 (64%), Gaps = 13/181 (7%)
 Frame = +2

Query  50   VAIAGVASILLVACVVAATISVTNMGG-------------SSEVTTSTKEVEAICAPTDY  190
            +AI  V+S++LVA VVA T+ V N                + E+T+STK ++AIC PTDY
Sbjct  17   IAIISVSSLILVAMVVAVTVGVNNAPHGEEHGDDNHGSETTPEITSSTKAIQAICQPTDY  76

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            KETC+ SL   A  T DPKEL+K  F +  ++++ AI  S  LKE AKDPR + AL  C+
Sbjct  77   KETCEKSLEAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTTLKELAKDPRTNQALQNCR  136

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             LL  +I DL +S E  G F ++ + ++  DLK+WLSGA+T ++TC D FENTTGD G +
Sbjct  137  ELLEYAIDDLNQSFERIGTFQMSKLDDFVADLKIWLSGALTYEQTCLDGFENTTGDAGVR  196

Query  551  M  553
            M
Sbjct  197  M  197



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 120/185 (65%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   MGDGD---KNKKVAIAGVASILLVACVVAATISVT---NMGGSSE--VTTSTKEVEAICA  178
            MG  D   K KK AI G ++++LVA VVA T+  T     GGSS+   +TSTK ++AIC 
Sbjct  1    MGGADGSNKKKKFAIIGASALILVAMVVAVTVGGTVSRRGGGSSDGHTSTSTKAIQAICQ  60

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDAL  358
            PTDYK+TC+ SLSGAA    DPKELIK  F VTM  +   I +S  LK+ AKDP   DAL
Sbjct  61   PTDYKKTCEESLSGAAGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLKDLAKDPSTGDAL  120

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
              CK LL  +I DL  S +  G FD++ +  Y  DLKVWLS A+T ++TC D FENTTGD
Sbjct  121  QNCKELLEYAIDDLGDSFDRIGAFDMSKLDLYVEDLKVWLSAAMTYEQTCLDGFENTTGD  180

Query  539  TGEKM  553
             GEKM
Sbjct  181  AGEKM  185



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 117/190 (62%), Gaps = 13/190 (7%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISV--------TNMGGSS-----EVTTSTKEV  163
            M D   NK++AI G++SILLVA VVA TI V         ++ G S     E++ S K +
Sbjct  1    MADDANNKRLAIIGISSILLVAMVVAVTIGVGFSENGESEDITGKSHKSTGEISASMKAI  60

Query  164  EAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPR  343
            ++IC P DYK+TC+ SL  +A  T DPKELIK AF +  K I  A  +SA L+E  KDPR
Sbjct  61   KSICQPADYKKTCEKSLEKSAGNTTDPKELIKAAFKIAQKKIREAAKKSATLEELEKDPR  120

Query  344  ASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
              DAL  CK L++ SI +L+ S +   DFD+  + ++  DL+ WLS  IT + TC D FE
Sbjct  121  TRDALQSCKELMDMSISELQNSFDKVADFDITMLDDFMADLRTWLSAVITYEGTCLDGFE  180

Query  524  NTTGDTGEKM  553
            NTT D GEKM
Sbjct  181  NTTSDAGEKM  190



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 120/176 (68%), Gaps = 7/176 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSS-----EVTTSTKEVEAICAPTDYKETCKT  208
            KK+ IAG+ASILLVACVV A ++ T     S     E+++STK V+A+C PT YKETC  
Sbjct  7    KKIVIAGIASILLVACVVGAAVTFTKKNDDSTSNGGEISSSTKSVQAMCQPTQYKETCAK  66

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL G+A  T +PKELIK AF  T+  I+++I  SA  KEAA DPR  +AL +C  +L+ S
Sbjct  67   SL-GSAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFKEAANDPRTKNALKVCDEVLDRS  125

Query  389  IGDLEKSCEAAGDFDVNNIL-EYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I ++++S       D++ ++ EY  D++ WLS A+T +ETC DAF NTTGDTGEKM
Sbjct  126  IEEIKRSFSKIDSNDLDKLIKEYIYDVRSWLSSAVTLEETCIDAFANTTGDTGEKM  181



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   166 bits (420),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 89/184 (48%), Positives = 115/184 (63%), Gaps = 10/184 (5%)
 Frame = +2

Query  32   GDKNKKVAIAGVASILLVACVVAATISVT--NMGGSS--------EVTTSTKEVEAICAP  181
            GD  K+  I GV++ LLVA VVA T++V   N G SS         V +S K V+ +CAP
Sbjct  3    GDAQKRNVIIGVSTFLLVAMVVAVTVNVNFNNKGSSSDSKEESKSHVASSMKAVKTLCAP  62

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDYK+ C+ +L   A+   DP+ELIK AFHVT+  I   + ++ L+ E   DP   +ALD
Sbjct  63   TDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQLMHEVENDPITKEALD  122

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             CK L+N SIG+  +S +    FD+NN+      LKVWLSGAIT QETC DAFENTT D 
Sbjct  123  TCKQLMNLSIGEFTRSLDKFAKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTTTDA  182

Query  542  GEKM  553
            G+KM
Sbjct  183  GQKM  186



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 122/188 (65%), Gaps = 11/188 (6%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATI-----SVTNMGG-----SSEVTTSTKEVEAI  172
            M D  KNKK A+ GV+S+ LVA VVA  +     S    GG     ++E++TSTK V+A+
Sbjct  1    MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAEISTSTKAVKAL  60

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDY+ETC+ +LS A   T+DP+ELIK  F+V +  I  AI  S  LKEAA DP A  
Sbjct  61   CQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPMAKQ  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGD-FDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            ALD C  L++ +I DL  S +   D FD+  + +Y  DLKVWLSGA+T QETC D FEN 
Sbjct  121  ALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGFENV  180

Query  530  TGDTGEKM  553
            TGDTGEKM
Sbjct  181  TGDTGEKM  188



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 118/183 (64%), Gaps = 9/183 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMG--------GSSEVTTSTKEVEAICAPT  184
            D  K +++ I GV++ LLVA VVA T+ V N G        G++ + ++ K V++ C PT
Sbjct  5    DTQKRRRIVIIGVSTFLLVAMVVAVTVGV-NFGANDSKDNNGNTHMASTVKAVKSFCHPT  63

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+ C+ ++   A  T D +ELIK AF+VT+  IS  I ++ LL E  K+PRA  ALD 
Sbjct  64   DYKKECEENVIANAGNTTDSRELIKIAFNVTVTKISDGIKKTNLLHEVEKEPRAKMALDT  123

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L++ SIG+ ++S E   +FD+NN+     +LKVWLSGAIT QETC D FENTT D  
Sbjct  124  CKQLMDLSIGEFDRSIEGIKNFDLNNLENILVNLKVWLSGAITYQETCLDGFENTTSDAS  183

Query  545  EKM  553
            +KM
Sbjct  184  KKM  186



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 118/182 (65%), Gaps = 12/182 (7%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV-------TNMGGSS-----EVTTSTKEVEAI  172
            D  + +++AI GV+S+LLVA VVA T+ V         + GSS     +V+ S K V+AI
Sbjct  6    DSKRKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDGLNGSSHKSTSQVSASVKAVKAI  65

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDY++TC+ SL  AA  T DPKELIK AF +  K I+ A  +S LL+E +KDPR   
Sbjct  66   CQPTDYRKTCEESLQKAAGNTTDPKELIKIAFKIAEKQINEASEKSKLLEELSKDPRTRG  125

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL  CK L+N S+G+L++S +   DFD++ + +   D+K WLS +IT QETC D FENTT
Sbjct  126  ALQSCKELMNMSVGELKQSLDKVTDFDLSELEKMMADVKTWLSASITYQETCLDGFENTT  185

Query  533  GD  538
             D
Sbjct  186  TD  187



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 122/191 (64%), Gaps = 14/191 (7%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATI-----SVTNMGG--------SSEVTTSTKEV  163
            M D  KNKK A+ GV+S+ LVA VVA  +     S    GG        ++E++TSTK V
Sbjct  1    MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAATAEISTSTKAV  60

Query  164  EAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPR  343
            +A+C PTDY+ETC+ +LS A   T+DP+ELIK  F+V +  I  AI  S  LKEAA DP 
Sbjct  61   KALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPM  120

Query  344  ASDALDLCKTLLNNSIGDLEKSCEAAGD-FDVNNILEYANDLKVWLSGAITQQETCRDAF  520
            A  ALD C  L++ +I DL  S +   D FD+  + +Y  DLKVWLSGA+T QETC D F
Sbjct  121  AKQALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGF  180

Query  521  ENTTGDTGEKM  553
            EN TGDTGEKM
Sbjct  181  ENVTGDTGEKM  191



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISV---------TNMGGSSEVTTSTKEVEAICAPTDY  190
            K  ++ I G+++ LLVA VVA T+SV         TN    + + ++ K V++ C PTDY
Sbjct  8    KRTRIVIIGMSTFLLVAMVVAVTVSVDINTRNDDSTNNNDKTRIASTIKSVKSFCQPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+ C+ +L   A  T +P+ELIK AF+VT+K I   I ++ LL E  K+PRA  ALD CK
Sbjct  68   KKECEENLIEIAGNTTEPRELIKLAFNVTIKKIGDGIKKTNLLHEVEKEPRAKLALDTCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ SIG+ E+S E    FD+NN+      LKVWLSGAIT QETC D F+NTT D  +K
Sbjct  128  QLMDLSIGEFERSLEGIKTFDLNNLENILVSLKVWLSGAITYQETCLDGFQNTTSDASKK  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   164 bits (415),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 12/180 (7%)
 Frame = +2

Query  50   VAIAGVASILLVACVVAATISVTNM------------GGSSEVTTSTKEVEAICAPTDYK  193
            +AI  V+S++LVA VVA T+ + N               + E+++STK ++AIC PTDYK
Sbjct  17   IAIISVSSLILVAMVVAVTVGINNAPYEEHGEGDQGSKTTPEISSSTKAIQAICQPTDYK  76

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
            ETC+ SL   A  T DPKEL+K  F +  ++++ AI  S  L+E +KDPR + AL  C+ 
Sbjct  77   ETCEKSLMAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTTLQELSKDPRTNQALQNCRE  136

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            LL  +I DL +S E  G F ++ + E+  DLK+WLSGA+T ++TC D FENTTGD G +M
Sbjct  137  LLEYAIDDLNESFERIGTFQMSKLDEFVADLKIWLSGALTYEQTCLDGFENTTGDAGTRM  196



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSS--------EVTTSTKEVEAICAPTDYKET  199
            KK AI GV+SI+LVA VVA  + +    G S        +++T++K ++AIC PTDY+ET
Sbjct  13   KKFAIIGVSSIILVAMVVAVAVGIGGSPGDSKQESSPKGQISTTSKSIKAICQPTDYRET  72

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ SLS AA  T DP +L++  F VT++ + +AI+RS  LKE AKDP AS ALD C+ L+
Sbjct  73   CEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALDNCRELM  132

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +++I +LE S +    F  +   EY N+LKVWLS  IT Q TC D FENTTG  GEKM
Sbjct  133  DDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFENTTGSAGEKM  190



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 11/183 (6%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTN-----------MGGSSEVTTSTKEVEAICAPT  184
            + KK A+ GV+SI+LVA VVA  + V +            G S +++TSTK ++AIC PT
Sbjct  16   RKKKFAVIGVSSIILVAMVVAVAVGVNDGKEKGGESSPLSGSSGQLSTSTKSIQAICQPT  75

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+TC+ SL+ AA  T+DP +L++  F V +  +  AI  S  LKE AKDP A  ALD 
Sbjct  76   DYKQTCEDSLNKAAGNTSDPHKLVQAGFQVAIDALKVAIENSTTLKEVAKDPMAKQALDN  135

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L+N +I DL+ S +  GDFD++ + EY  +LK+WLS  IT Q+TC D F+NTTG  G
Sbjct  136  CKELMNTAISDLKTSFQQVGDFDISKLDEYVANLKIWLSATITYQQTCLDGFDNTTGPAG  195

Query  545  EKM  553
            +KM
Sbjct  196  QKM  198



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 120/177 (68%), Gaps = 9/177 (5%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETC  202
            MG   K KK AI GV+SILLVA VV    +VT     S V+TS+K VE++C   DYK+TC
Sbjct  1    MGSEGK-KKAAILGVSSILLVAAVVG---TVT----YSVVSTSSKSVESVCKHVDYKQTC  52

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLN  382
            + SLSGA   T+DP+ELIK AF   + NI+  I  S LL+ AAKDPR   AL+ CK  LN
Sbjct  53   EQSLSGAK-NTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQALETCKYALN  111

Query  383  NSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             SI DL++S E  G FD+N I +Y  DLK WLS A T QETC DAFENTTGDTGE+M
Sbjct  112  TSIEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTGDTGEQM  168



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSS--------EVTTSTKEVEAICAPTDYKET  199
            KK AI GV+SI+LVA VVA  + +    G S        +++T++K ++AIC PTDY+ET
Sbjct  13   KKFAIIGVSSIILVAMVVAVAVGIGGSHGDSKQESSPKGQISTTSKSIKAICQPTDYRET  72

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ SLS AA  T DP +L++  F VT++ + +AI+RS  LKE AKDP AS ALD C+ L+
Sbjct  73   CEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALDNCRELM  132

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +++I +LE S +    F  +   EY N+LKVWLS  IT Q TC D F+NTTG  GEKM
Sbjct  133  DDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFDNTTGSAGEKM  190



>ref|XP_003557034.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=402

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K KK+AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKELIK  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 106/165 (64%), Gaps = 9/165 (5%)
 Frame = +2

Query  80   LVACVVAATISVTNMGGSSE-------VTTSTKEVEAICAPTDYKETCKTSLSGAAAKTN  238
            +V CV          GG +        V+TSTK V AIC PTDYKETC++SL+GA   T 
Sbjct  1    MVICVTVGVSGRNKSGGDAAASSSNGGVSTSTKAVHAICTPTDYKETCESSLAGA--NTT  58

Query  239  DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEA  418
            DPKELIK AF+  + NI+ AI  S L+K+AA D    DALD+C  +L +++ DL ++ + 
Sbjct  59   DPKELIKVAFNAAVNNIADAIKNSTLMKDAAADNSTKDALDVCNDVLESAVDDLRRAGDK  118

Query  419  AGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             G+FD   + EY  DLKVWLS  IT QETC DAFENTTGDT EKM
Sbjct  119  VGEFDATKMDEYVEDLKVWLSAVITYQETCIDAFENTTGDTAEKM  163



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 121/184 (66%), Gaps = 10/184 (5%)
 Frame = +2

Query  32   GDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE----------VTTSTKEVEAICAP  181
            G + KK+AI G ++++LVA VVA  +        S+          V+T+TK ++AIC P
Sbjct  11   GQRKKKIAIIGTSALILVAMVVAVAVGFNRSESDSQSAAPTSPPPSVSTTTKAIQAICQP  70

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDY+ETC+ SL+ AA  T+DPKELIK AF+V + +IS AI  S+ LKE AKD R + AL 
Sbjct  71   TDYRETCENSLTSAAGNTSDPKELIKAAFNVAIDHISAAIRNSSTLKELAKDSRTNQALS  130

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             C  LL  +I DL++S +  G F+   + EY +DLK+WLSGAIT ++TC D FENTTG+ 
Sbjct  131  NCDELLKYAIDDLKESFDRIGPFEYEKLDEYVDDLKIWLSGAITYEQTCLDGFENTTGEA  190

Query  542  GEKM  553
            G +M
Sbjct  191  GLRM  194



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 119/182 (65%), Gaps = 9/182 (5%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVT--NMGGSSE-------VTTSTKEVEAICAPTD  187
            +K KK AI GV+S++LVA VVA T+ VT  N GG          VTTSTK ++AIC PTD
Sbjct  6    NKKKKFAIIGVSSVILVAMVVAVTVGVTAKNKGGGGHKNSDGGHVTTSTKAIKAICQPTD  65

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YKETC+ SL  AA  + +PK+LIK  F+VTM  +   I  S  L+E AKD   + AL+ C
Sbjct  66   YKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQALENC  125

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K LL  +I D+  S +  G FD++ I +YA DLKVWLS AIT Q+TC D F+NT GD GE
Sbjct  126  KELLEYAIDDITTSFQKLGPFDISKIDDYAEDLKVWLSAAITYQQTCLDGFQNTKGDAGE  185

Query  548  KM  553
            KM
Sbjct  186  KM  187



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 113/174 (65%), Gaps = 9/174 (5%)
 Frame = +2

Query  32   GDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCKTS  211
            GDK KK+A+A ++SILLVA V+        +      T S K   A+C   DYK TC+ S
Sbjct  2    GDKMKKIAMASLSSILLVAMVLP-------LATGDSPTNSNKAAHALCTSVDYKITCEKS  54

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LSGA   ++DP+ELIK AF+  + +I  AI  S L K+AA D R   AL++C+ +L+ SI
Sbjct  55   LSGA--NSSDPQELIKVAFNHAITDIQEAIKNSTLYKQAALDHRTKGALEVCEEVLDTSI  112

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL +S +  G+ D+  + +Y  D+KVWLSGAIT  ETC DAF+NTTGDTGEKM
Sbjct  113  DDLRRSFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKM  166



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 120/186 (65%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K K++AI GV+++LLVA VVA T+ V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKRIAIIGVSALLLVAMVVAITVGVNLNENGSNNDTEDNKKNHVVSSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+YK+ C+ SL   A  T DPKELIK  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYKKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            L+ CK L++ SIG+L +S +  G+F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LETCKQLMDLSIGELTRSLDGIGEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKE  196
            D  + K+  I  ++S+LL++ VVA TI V+    + GG  E+TTS K ++ +CAPTDYKE
Sbjct  8    DAKRKKRYVIISISSVLLISMVVAVTIGVSVNKSDNGGEGEITTSVKAIKDVCAPTDYKE  67

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTL  376
            TC+ +L   A  T+DP EL+KTAF+ TMK IS    +S  + E  KDPR   ALD CK L
Sbjct  68   TCEDTLRKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRTKMALDQCKEL  127

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ +IG+L KS E  G F+ + + E    L++WLS  I+ ++TC D F+ T G+ GE +
Sbjct  128  MDYAIGELSKSFEELGRFEFHKVDEALIKLRIWLSATISHEQTCLDGFQGTQGNAGETI  186



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 113/188 (60%), Gaps = 13/188 (7%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV-TNMGGSSE------------VTTSTKEVEA  169
            D  + K++AI GV+S LLVA VVA T+S+  N  G SE            V+ S K ++ 
Sbjct  6    DSKRKKRLAIIGVSSFLLVAMVVAVTVSIGFNNDGESEDDINGKNHKSKEVSASMKAIKT  65

Query  170  ICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            +C PT YK+TC+ SL+ +A  T DPKELIK AF +  K I  A  +S  L E  KDPR  
Sbjct  66   LCQPTYYKQTCERSLAKSAGNTTDPKELIKIAFKLAEKQIDSASKKSLTLLELEKDPRTR  125

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
             AL+ CK L+  SI +L  S E   DFD + + E   D+K WLS AIT +ETC DAFENT
Sbjct  126  GALNSCKELMTMSINELRSSLEKVADFDFSQLDELMADIKTWLSAAITYEETCLDAFENT  185

Query  530  TGDTGEKM  553
            T + GEKM
Sbjct  186  TTNAGEKM  193



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   160 bits (404),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 84/187 (45%), Positives = 118/187 (63%), Gaps = 10/187 (5%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISV--TNMGGS--------SEVTTSTKEVEAI  172
            MG   + K++ I GV++ LLVA VVA T+SV   N G S        S V +S K V+ +
Sbjct  1    MGGDAQKKRIVIIGVSTFLLVAMVVAVTVSVGLNNKGASEDETEARKSHVASSMKAVKTL  60

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            CAPTDY++ C+ SL+  A    DP+ELIK AF++T+  IS  + ++ LL +   DPR  +
Sbjct  61   CAPTDYQKECEDSLNENAGNITDPRELIKLAFNITITRISDGLGKTQLLHDVESDPRTKE  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            ALD CK L++ SI +  +S +    F++N++      LKVWLSGA+T QETC DAF+NTT
Sbjct  121  ALDTCKQLMHLSIEEFNRSLQRFNKFELNSLDRILTSLKVWLSGAVTYQETCLDAFDNTT  180

Query  533  GDTGEKM  553
             D G+KM
Sbjct  181  TDAGKKM  187



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K KK+AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKELIK  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   159 bits (402),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS------EVTTSTKEVEAICAPTDY  190
            D  K KK+AI G +SI LVA V+A   SV++    S      E+++S K ++AIC PTDY
Sbjct  9    DRGKKKKLAIIGFSSIFLVAMVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDY  68

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+ C  SL+  A  T DPK+L++ AF   M+++S A   S LL+E  KDPRAS AL  C+
Sbjct  69   KDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCE  128

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L+N +I DL+KS    GDFD + +     D+K+WLS  IT QETC D FENTTGD GEK
Sbjct  129  DLVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEK  188

Query  551  M  553
            M
Sbjct  189  M  189



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K KK+AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKELIK  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 119/182 (65%), Gaps = 9/182 (5%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISV---TNMGGSSE------VTTSTKEVEAICAPTD  187
            +K KK AI GV+S++LVA VVA T+ V     +GG  +      VTTSTK ++AIC PTD
Sbjct  6    NKKKKFAIIGVSSVILVAMVVAVTVGVTTKNKVGGGHKNSDGGHVTTSTKAIKAICQPTD  65

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YKETC+ SL  AA  + +PK+LIK  F+VTM  +   I  S  L+E AKD   + AL+ C
Sbjct  66   YKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQALENC  125

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K LL  +I DL  S +  G FD++ I +YA DLKVWLS AIT Q+TC D F+NT GD G+
Sbjct  126  KELLEYAIDDLTTSFQKLGPFDISKIDDYAEDLKVWLSAAITYQQTCLDGFQNTKGDAGD  185

Query  548  KM  553
            KM
Sbjct  186  KM  187



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKE  196
            D  + K+  I  ++S+LL++ VVA TI V+    +  G  E+TTS K ++ +CAPTDYKE
Sbjct  9    DAKRKKRYVIISISSVLLISMVVAVTIGVSVNKSDNAGDEEITTSVKAIKDVCAPTDYKE  68

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTL  376
            TC+ +L   A  T+DP EL+KTAF+ TMK IS    +S  + E  KDPRA  ALD CK L
Sbjct  69   TCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRAKMALDQCKEL  128

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ +IG+L KS E  G F+ + + E    L++WLS  I+ ++TC D F+ T G+ GE +
Sbjct  129  MDYAIGELSKSFEELGKFEFHKVDEALVKLRIWLSATISHEQTCLDGFQGTQGNAGETI  187



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K K++AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKELIK  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K K++AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  9    GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  68

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKEL+K  F++T+  I   +  + +L E  ++PRA  A
Sbjct  69   HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  128

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGAIT Q+TC D FENTT 
Sbjct  129  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAITYQDTCLDGFENTTS  188

Query  536  DTGEKM  553
            D G+KM
Sbjct  189  DAGKKM  194



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 114/184 (62%), Gaps = 9/184 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT---------NMGGSSEVTTSTKEVEAICAP  181
            D  K K+  I  ++S+LL++ VVA T+ V+           GG+ E+T S K ++ +CAP
Sbjct  8    DSKKRKRYVIISISSVLLISMVVAVTVGVSMNKSDNADKKTGGNGEITASVKAIKEVCAP  67

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDYK+TC+ +L+  A  T DP EL+KTAF VTMK I+ A  +S  L E  KDPR   ALD
Sbjct  68   TDYKKTCEETLTKNAKNTTDPMELVKTAFDVTMKQIAEAAKKSQTLVELQKDPRTKMALD  127

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             C+ L+N +I +L+ S E  G F+ + + E   +L++WLS AI+ + TC + FE T G+ 
Sbjct  128  QCRELMNYAIDELKSSFEELGKFEFHKLDEALINLRIWLSAAISHETTCLEGFEQTQGNA  187

Query  542  GEKM  553
            GE M
Sbjct  188  GETM  191



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = +2

Query  110  SVTNMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNI  289
            S +N GGS   T STK V++ICAPTDYKETC++SLS   A + +P ELIK AF  T+KNI
Sbjct  37   SASNDGGSIS-TGSTKAVQSICAPTDYKETCESSLS--HANSTNPNELIKAAFDFTVKNI  93

Query  290  SHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLK  469
               I+ S L KEAA D     AL++C+ +L+ +I DL++S ++  +FD+ N  EY  +LK
Sbjct  94   GDIITNSPLFKEAANDDGTKQALEICQEVLDTAIDDLKRSFDSVDEFDITNASEYVENLK  153

Query  470  VWLSGAITQQETCRDAFENTTGDTGEKM  553
             WLS  IT QETC DAFENTTGDTGEKM
Sbjct  154  TWLSAVITNQETCIDAFENTTGDTGEKM  181



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 110/183 (60%), Gaps = 6/183 (3%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPT  184
            M    K KK+AI  V+S++LV  VVA    VT        G + EV+ S K +EA+C P 
Sbjct  1    MASEGKKKKLAIVAVSSLILVVAVVAVVAGVTMSKGDSKQGETKEVSASMKAIEAMCQPA  60

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYKE+C  SL  A     DPKELIK  F+V MK IS A  +S  LKE AKDPR S AL  
Sbjct  61   DYKESCVKSLETAGPNVTDPKELIKAGFNVAMKKISEAAEKSVTLKELAKDPRTSQALQN  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L+  +I DL+ S +  G  D++ + ++  DLK WL  +IT QETC D FENTT D G
Sbjct  121  CKELMEYAIDDLQSSFDKLGGLDMSKVDDFLADLKTWLGASITYQETCLDGFENTTSDAG  180

Query  545  EKM  553
            EKM
Sbjct  181  EKM  183



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   159 bits (401),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 82/177 (46%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI--SVTNMGGSSEVTTSTKEVEAICAPTDYKETC  202
            D  + K+  I  V+S+LL++ VVA TI  SV    G  E+TTS K ++ +CAPTDYK+TC
Sbjct  9    DAKRRKRYIIISVSSVLLISMVVAVTIGVSVNKNEGEEEITTSVKAIKEVCAPTDYKKTC  68

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLN  382
            + +L   A  T+DP EL+KTAF+VTMK IS    +S  + E  KDPRA  ALD CK L++
Sbjct  69   EDTLRKDAQNTSDPLELVKTAFNVTMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMD  128

Query  383  NSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             +IG+L  S E  G F+ + I E    L++WLS  I+ +ETC + F+ T GD GE +
Sbjct  129  YAIGELSNSFEELGKFEFHKIDEALVKLRLWLSATISHEETCLEGFQGTQGDAGETI  185



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V++ICAPTDYKETC++SLS   A T DPKEL+K AF  T KNI   I  S+L +EA
Sbjct  39   STKAVQSICAPTDYKETCESSLS--HANTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEA  96

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            AKD     AL++C+ +L+ +I DL++S +  G+FD     EY  DLK WLS  IT  ETC
Sbjct  97   AKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVITNHETC  156

Query  509  RDAFENTTGDTGEKM  553
             DAFENTTGDTGEKM
Sbjct  157  IDAFENTTGDTGEKM  171



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 119/186 (64%), Gaps = 10/186 (5%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGGSS---------EVTTSTKEVEAIC  175
            G+  K K++AI GV+++LLVA VVA TI V  N  GS+          V +S K V+ +C
Sbjct  4    GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PT+Y++ C+ SL   A  T DPKEL+K  F++T+  I   +  + +L E  ++PRA  A
Sbjct  64   HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD CK L++ SIG+L +S +   +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT 
Sbjct  124  LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  536  DTGEKM  553
            D G+KM
Sbjct  184  DAGKKM  189



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   157 bits (398),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 82/188 (44%), Positives = 117/188 (62%), Gaps = 12/188 (6%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGG---------SSEVTTSTKEVEAIC  175
            GD  K +++AI GV+S+LLVA V+A T+    N  G          + V+++ + V+ IC
Sbjct  5    GDAQKGRRIAIIGVSSLLLVAMVIAVTVGANRNQNGFDDDIENNRKNHVSSTMRAVQTIC  64

Query  176  APTDYKETCKTSLSGAAAKTN--DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
             PTDYK+ C  +L+  A   N  DPKELIK AF+VTMK I   I  + L+ E  KDPR+ 
Sbjct  65   QPTDYKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKATDLMHEVEKDPRSK  124

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            DA+D CK L++ SIG+  ++ +    FD+ +I     +LKVWL+GA+T  +TC D F+NT
Sbjct  125  DAIDTCKQLMDLSIGEFARAMDGIDQFDLKDIDRILMNLKVWLNGAVTYMDTCVDGFQNT  184

Query  530  TGDTGEKM  553
            T D G+KM
Sbjct  185  TTDAGKKM  192



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V++ICAPTDYKETC++SLS A   T DPKEL+K AF  T KNI   I  S+L +EA
Sbjct  39   STKAVQSICAPTDYKETCESSLSDA--NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEA  96

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            AKD     AL++C+ +L+ +I DL++S +  G+FD     EY  DLK WLS  IT  ETC
Sbjct  97   AKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVITNHETC  156

Query  509  RDAFENTTGDTGEKM  553
             DAFENTTGDTGEKM
Sbjct  157  IDAFENTTGDTGEKM  171



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 115/181 (64%), Gaps = 5/181 (3%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-----NMGGSSEVTTSTKEVEAICAPTDY  190
            G+    KK+AI GV++++LVA VVA T+ VT        G  + +TSTK +++IC PTDY
Sbjct  4    GEVQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +LS  A+   DPKEL+K  F V +  +   I  S  LKE AKDPRA+ AL  CK
Sbjct  64   KKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPRANQALQNCK  123

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             LL  +I DL  S +  G FD   +  Y  DLKVWLS A+T ++TC D FENTTGD GEK
Sbjct  124  ELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAGEK  183

Query  551  M  553
            M
Sbjct  184  M  184



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 119/187 (64%), Gaps = 12/187 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV------------TNMGGSSEVTTSTKEVEAI  172
            D ++ +++A+ G++S LLVA VVA ++ V            +N   +++V+ S K V+AI
Sbjct  6    DSNRKRRIAVIGISSFLLVAMVVAVSVGVGLGNDGNEDLNDSNHKSTNQVSASMKAVKAI  65

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDY++TC+ +L  AA  T DP+ELIK AF +  K+++ A  +S +L+E +KDPR   
Sbjct  66   CQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHVNEASKKSKVLEELSKDPRTRG  125

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL  C+ L+  S+ +L++S     DFD+  I +   D+K WLS +IT QETC D F+NTT
Sbjct  126  ALQSCRELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITYQETCLDGFQNTT  185

Query  533  GDTGEKM  553
             + G++M
Sbjct  186  TNAGKEM  192



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   157 bits (396),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 82/175 (47%), Positives = 116/175 (66%), Gaps = 7/175 (4%)
 Frame = +2

Query  50   VAIAGVASILLVACVVAATISVT----NMGGSSE---VTTSTKEVEAICAPTDYKETCKT  208
            +AI G ++ +L+  VV A I V+    + GGSS+    TT++K +++IC PTDYKE C++
Sbjct  25   LAIIGGSAAILLCMVVGAVIGVSRYNSSKGGSSDSRGFTTTSKAIKSICQPTDYKEICES  84

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL+ AA   +DPK L++ AF+VT+  I  A   S++L+  AKDPR SDALD CK LL+ +
Sbjct  85   SLTKAAGNASDPKVLVEAAFNVTISYIRDAFDHSSVLQATAKDPRTSDALDDCKKLLDYA  144

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I +L  S    G  D+N++ +  +DLK+WLS A+T QETC D FEN TGD  E M
Sbjct  145  IDELRNSFTKFGQLDMNHVDDVIDDLKIWLSAAVTYQETCLDGFENITGDAAESM  199



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 110/185 (59%), Gaps = 12/185 (6%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVT--------NMGGSSEVTTSTKEVEAICA  178
            M    K KK+A+  V S++ VA +VA  + VT        N G SS    S K +E IC 
Sbjct  1    MAADSKKKKIALIIVFSVIGVAMIVAVAVGVTCSRKSAKQNKGTSS----SKKAIETICQ  56

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDAL  358
             T YKETC++SL  AA  T+DPKELIKT F V    +   I  S  LK+ AKDP AS AL
Sbjct  57   TTSYKETCQSSLEKAAGDTSDPKELIKTGFQVAADKLDEVIKNSNTLKDLAKDPMASQAL  116

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
            D+CK +L+ +  DL  + +  G FD + + EY  DLKVWLS A+  Q+TC DAFE T G+
Sbjct  117  DVCKEMLDTAAEDLLGAVDKMGPFDASKMNEYVEDLKVWLSAAVNHQQTCLDAFEGTKGE  176

Query  539  TGEKM  553
             GEKM
Sbjct  177  AGEKM  181



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 117/183 (64%), Gaps = 12/183 (7%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTNM--GGS----------SEVTTSTKEVEAICAPT  184
            NK++AI   +S++LVA VVA T+ V      GS           ++ TS K ++AIC PT
Sbjct  8    NKRIAIISASSLILVAMVVAVTVGVNQHPTAGSDGTKTVSNDDEQIQTSMKAIKAICQPT  67

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYKETC  SLS AA  T DPK+L+K AF +  K I  A++RS +LKE  KDPRAS AL  
Sbjct  68   DYKETCIKSLSSAAGNTTDPKDLVKIAFKIATKQIKEAVNRSVVLKELEKDPRASKALAN  127

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ L++ +I +L  S +  G  D+++I +   +LK+WLS ++T QETC D F+NTTG+ G
Sbjct  128  CRELMDYAIDELNSSFDELGSIDIDDIDDALENLKIWLSASLTYQETCLDGFQNTTGNAG  187

Query  545  EKM  553
            E M
Sbjct  188  ESM  190



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (65%), Gaps = 10/182 (5%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTN----------MGGSSEVTTSTKEVEAICAPTD  187
            K KK+AI G ++++L+  VV A + V++            G   + T++K +++IC PTD
Sbjct  19   KKKKLAIIGGSAVILLCMVVGAVVGVSHHNSSSDGGSSNSGGGRLVTTSKAIKSICQPTD  78

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YK+ C++SL+ AA  T+DPK L++ AF+VT+  I  A + S++L+ AAKDPR SDALD C
Sbjct  79   YKDICESSLTHAAGNTSDPKALVEAAFNVTIDYIRDAFNHSSVLQAAAKDPRTSDALDDC  138

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K LL+ ++ +L  S    G  +++ I E  +DLK+WLS A+T QETC D FEN +GD  E
Sbjct  139  KELLDYAVDELRNSFTKFGQLEISKIDEIIDDLKIWLSAAVTYQETCLDGFENISGDAAE  198

Query  548  KM  553
             M
Sbjct  199  SM  200



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 12/182 (7%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV-------TNMGGSS-----EVTTSTKEVEAI  172
            D  + +++AI GV+S+LLVA VVA T+ V        ++ GSS     +V+ S K V+AI
Sbjct  6    DSKRKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDDLNGSSHKSTSQVSASVKAVKAI  65

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDY++TC+ SL  AA  T +PKELIK AF +  K I+ A  +S LL+E +KD R   
Sbjct  66   CQPTDYRKTCEESLQKAAGNTTNPKELIKIAFKIAEKQINEASEKSKLLEELSKDARTRG  125

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL  CK L+N S G+L++S     DFD++ +     D+K WLS +IT QETC D FENTT
Sbjct  126  ALQSCKELMNMSAGELKQSLNKVTDFDLSELETLMADVKTWLSASITYQETCLDGFENTT  185

Query  533  GD  538
             D
Sbjct  186  TD  187



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   156 bits (394),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 12/188 (6%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-NMGG---------SSEVTTSTKEVEAIC  175
            GD +K +++AI GV+++LLVA VVA T+    N  G          + + ++ K V+ IC
Sbjct  4    GDANKGRRIAIIGVSTLLLVAMVVAVTVGANRNQNGYDDDIEDNQRNHIASTMKAVQTIC  63

Query  176  APTDYKETCKTSLSGAAAKTN--DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
             PT+YK+ C+ +L   A   N  DPKELIK AF+VTM+ IS  I  + L+ E  KDPR+ 
Sbjct  64   HPTEYKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKETDLMHEVEKDPRSK  123

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
            DALD CK L++ SIG+  +S +    FD+ ++ +   +LKVWL+GA+T  +TC D F+NT
Sbjct  124  DALDTCKQLMDLSIGEFTRSLDGFSQFDLQDMDKILMNLKVWLNGAVTYMDTCVDGFDNT  183

Query  530  TGDTGEKM  553
            T + G KM
Sbjct  184  TTEAGAKM  191



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 122/181 (67%), Gaps = 5/181 (3%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISV--TNMGGSSE---VTTSTKEVEAICAPTDY  190
            G+ ++ K++AI GV+++LLVA VVA T+ V  +  G ++E   + +S K V+ +C PT+Y
Sbjct  4    GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+ C+ SL   A  T DPKELIK  F++T+  I   + ++ LL E  +DPRA  ALD CK
Sbjct  64   KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ SI +L +S +  G+FD+ NI +   +LKVWLSGA+T Q+TC D FENTT D G+K
Sbjct  124  QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  551  M  553
            M
Sbjct  184  M  184



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   157 bits (398),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKE  196
            D  + K+  I  ++S+LL++ VVA TI V+    + GG  E+TTS K ++ +CAPTDYK+
Sbjct  9    DAKRKKRYVIISISSVLLISMVVAVTIGVSVNKNDNGGDEEITTSVKAIKDVCAPTDYKK  68

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTL  376
            TC+ +L   A  T+DP EL+KTAF+ TMK I+    +S  + E  KDPR   ALD CK L
Sbjct  69   TCEDTLRKDAQNTSDPLELVKTAFNATMKQITEVAKKSQTMIELQKDPRTKMALDQCKEL  128

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ +IG+L KS E  G F+ + + E    L+VWLS  I+ ++TC D F+ T GD GE +
Sbjct  129  MDYAIGELSKSFEELGRFEFHKVDEALVKLRVWLSATISHEQTCLDGFQGTQGDAGETI  187



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   157 bits (396),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS------EVTTSTKEVEAICAPTDY  190
            D  K KK+AI G +SI LVA V+A   SV++    S      E+++S K ++AIC PTDY
Sbjct  9    DRGKKKKLAIIGFSSIFLVAMVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDY  68

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+ C  SL+  A  T DPK+L++ AF   M+++S A   S LL+E  KDPRAS AL  C+
Sbjct  69   KDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCE  128

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L+N +I DL+KS    GDFD + +     D+K+WLS  IT QETC D FENTTGD GEK
Sbjct  129  DLVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEK  188

Query  551  M  553
            M
Sbjct  189  M  189



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 119/187 (64%), Gaps = 12/187 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISV------------TNMGGSSEVTTSTKEVEAI  172
            D ++ +++A+ G++S LLVA VVA ++ V            ++   +++V+ S K V+AI
Sbjct  6    DSNRKRRIAVIGISSFLLVAMVVAVSVGVGLGNNGNEDLNDSSHKSTNQVSASMKAVKAI  65

Query  173  CAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            C PTDY++TC+ +L  AA  T DP+ELIK AF +  K+++ A  +S +L+E +KDPR   
Sbjct  66   CQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHLNEASKKSKVLEELSKDPRTRG  125

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL  CK L+  S+ +L++S     DFD+  I +   D+K WLS +IT QETC D F+NTT
Sbjct  126  ALQSCKELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITYQETCLDGFQNTT  185

Query  533  GDTGEKM  553
             + G++M
Sbjct  186  TNAGKEM  192



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 122/181 (67%), Gaps = 5/181 (3%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISV--TNMGGSSE---VTTSTKEVEAICAPTDY  190
            G+ ++ K++AI GV+++LLVA VVA T+ V  +  G ++E   + +S K V+ +C PT+Y
Sbjct  4    GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+ C+ SL   A  T DPKELIK  F++T+  I   + ++ LL E  +DPRA  ALD CK
Sbjct  64   KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ SI +L +S +  G+FD+ NI +   +LKVWLSGA+T Q+TC D FENTT D G+K
Sbjct  124  QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  551  M  553
            M
Sbjct  184  M  184



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 5/178 (3%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVT-----NMGGSSEVTTSTKEVEAICAPTDYKET  199
            +K KK+AI GV++++LVA VVA T+ VT        G  + +TSTK +++IC PTDYK+T
Sbjct  8    NKRKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDYKKT  67

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ +LS  A+   DPKEL+K  F V +  +   I  S  LKE AKDP ++ AL  CK LL
Sbjct  68   CEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSSNQALQNCKELL  127

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
              +I DL  S +  G FD   +  Y  DLKVWLS A+T ++TC D FENTTGD GEKM
Sbjct  128  EYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAGEKM  185



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTNMGGSS---EVTTSTKEVEAICAPTDYKETCKTS  211
            N KVA+  +++I+LVA V    ++V+N    S   +++TS K V+  C PTDYKETC+ +
Sbjct  3    NNKVAVLSISAIVLVAVVATVAVTVSNRRSQSADPQLSTSVKNVQDFCRPTDYKETCENT  62

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LS  A    DPKEL+  AF++T+K+I+ AI  S +L EAAKDP  S+AL+ C+ LL+ +I
Sbjct  63   LSSVAGPDADPKELLNLAFNITVKHINDAIDHSTVLSEAAKDPSTSEALENCRELLDYAI  122

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL +S +  GDF V N+ ++ +DLK+WLS  IT QETC D FE TT + GE M
Sbjct  123  DDLRRSVDRLGDFSVANLDKFLDDLKIWLSATITYQETCVDGFEGTTTNAGESM  176



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 113/174 (65%), Gaps = 3/174 (2%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTNM---GGSSEVTTSTKEVEAICAPTDYKETCKTS  211
            N KVA   V++I+LVA V    ++++N+      ++ ++S K ++  C PTDY+ETC+++
Sbjct  3    NMKVAALSVSAIVLVAIVATVAVTISNLDSEPAKTQFSSSQKNIKDFCNPTDYQETCEST  62

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LS AA  + DPKEL+  AF +T+  I  A + S +L EAAK+PR SDAL+ C+ LL+ +I
Sbjct  63   LSAAAGNSTDPKELVNLAFQITIDQIKEAFNHSTVLSEAAKNPRTSDALENCRELLDYAI  122

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL  S +    F +  + ++ +DLKVW+S +IT QETC D FENTT +  E M
Sbjct  123  DDLRSSIDQLEGFSLIKLDKFLDDLKVWISASITYQETCLDGFENTTTNAAESM  176



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 113/192 (59%), Gaps = 16/192 (8%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGG--------------SSEVTTSTKEV  163
            GD  K +++AI GV+++LLVA VVA TIS+                    + V ++ K V
Sbjct  4    GDAQKGRRIAIIGVSTLLLVAMVVAVTISINQNQNDVKDDFKDDLADNKKNHVASTLKAV  63

Query  164  EAICAPTDYKETCKTSL--SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKD  337
            + IC PT YK+ C  SL     A    DPKELIK AF+VT+  I   +  + +  E  KD
Sbjct  64   QTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKD  123

Query  338  PRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDA  517
            PR+ DALD CK L++ SIG+  +S +   +FD+ ++ +   +LKVWL+GA+T  +TC D 
Sbjct  124  PRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDG  183

Query  518  FENTTGDTGEKM  553
            FENTTGD  +KM
Sbjct  184  FENTTGDASKKM  195



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (62%), Gaps = 12/189 (6%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNM---GGS--------SEVTTSTKEVE  166
            MG DG   +++AI GV++I LVA VVA  + V      GGS        S++ +S K V+
Sbjct  1    MGEDGQSKRRIAIIGVSTIFLVAMVVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVK  60

Query  167  AICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRA  346
             +C PTDY++ C+ SL   A  T DP+ELIK AF +T+K + + + ++  + E   DPR+
Sbjct  61   TLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPRS  120

Query  347  SDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFEN  526
              AL+ CK L+N SI + ++S E  G FD+NN+    N L+VWLSGAIT QETC D F+N
Sbjct  121  KMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQETCLDGFKN  180

Query  527  TTGDTGEKM  553
            TT   G KM
Sbjct  181  TTNKAGNKM  189



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVT-----NMGGSSEVTTSTKEVEAICAPTDYKETCKT  208
            KK+AI GV++++LVA VVA T+ VT        G  + +TSTK +++IC PTDYK+TC+ 
Sbjct  11   KKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDYKKTCED  70

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            +LS  A+   DPKEL+K  F V +  +   I  S  LKE AKDP A+ AL  CK LL  +
Sbjct  71   NLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSANQALQNCKELLEYA  130

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I DL  S +  G FD   +  Y  DLKVWLS A+T ++TC D FENTTGD GEKM
Sbjct  131  IDDLGDSFDKLGPFDFTKLDAYVGDLKVWLSAAMTYEQTCLDGFENTTGDAGEKM  185



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 94/137 (69%), Gaps = 0/137 (0%)
 Frame = +2

Query  143  TTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLK  322
            +TS K +++IC PTDY+ETC  SLS A   + DPK+LI+T F V +  +  AI  S ++K
Sbjct  59   STSMKSIQSICEPTDYRETCVKSLSAAGGNSTDPKDLIRTGFQVAINQVKAAIENSTVVK  118

Query  323  EAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQE  502
            + AKDPR+  AL+ C+ LL  SI DL+ S E  G FDV+N+ +Y  DL VWLSGAIT QE
Sbjct  119  DLAKDPRSKQALETCQHLLEYSIDDLQSSFERLGAFDVSNLDKYMADLHVWLSGAITFQE  178

Query  503  TCRDAFENTTGDTGEKM  553
            +C D FENTTG   +KM
Sbjct  179  SCLDGFENTTGAAAKKM  195



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 95/143 (66%), Gaps = 2/143 (1%)
 Frame = +2

Query  125  GGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAIS  304
            GG S    STK V++ICAPTDYKETC++SLS   A T +PKELI+ AF  T+KNI   + 
Sbjct  41   GGGSISAGSTKAVQSICAPTDYKETCESSLS--HANTTNPKELIQAAFDFTVKNIGDIVK  98

Query  305  RSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSG  484
             S L KEAA D     AL +C+ +L+ +I DL +S +  G+ D     EY  DLK WLS 
Sbjct  99   NSPLFKEAANDDDTKQALQICQEVLDVAIDDLTRSFDKVGELDAAKATEYVEDLKTWLSA  158

Query  485  AITQQETCRDAFENTTGDTGEKM  553
             +T QETC DAFENTTGDTGEKM
Sbjct  159  VVTNQETCMDAFENTTGDTGEKM  181



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 117/187 (63%), Gaps = 12/187 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI-SVTNMGG---------SSEVTTSTKEVEAICA  178
            D +K +++AI GV+++LLVA VVA T+ +  +  G          + + ++ K V+ IC 
Sbjct  5    DTNKGRRIAIIGVSTLLLVAMVVAVTVGTYGDQNGYDDNIEDTRKNHIASTMKAVQTICH  64

Query  179  PTDYKETCKTSLSGAAAKTN--DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            PTDYK+ C+ +L   A   N  DPKELIK AF+VTMK I   I  + LL E  KDPR+ D
Sbjct  65   PTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKETDLLHEVEKDPRSKD  124

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            ALD CK L++ SI +  +S +   +FD+ +I +   +LKVWL+GA+T  +TC D FENTT
Sbjct  125  ALDTCKQLMDLSIEEFTRSLDGINEFDLKDIDKILMNLKVWLNGAVTYIDTCLDGFENTT  184

Query  533  GDTGEKM  553
             + G KM
Sbjct  185  SEAGTKM  191



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  152  TKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAA  331
            TK V+AIC+PTDYK+TC+ SL+GA   T DPKELIK AF  T+K +  AI  S L K+AA
Sbjct  48   TKAVQAICSPTDYKQTCEESLAGA--NTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAA  105

Query  332  KDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCR  511
             DPR   AL +C+ +L+N I DL++S +   DF+VN + EY +D+K WLSGAI  +E C 
Sbjct  106  ADPRTKGALKVCEEVLDNCIDDLQRSFDQVNDFNVNQMDEYIDDIKTWLSGAIANKEACI  165

Query  512  DAFENTTGDTGEKM  553
            DA +NTTGDT EKM
Sbjct  166  DAVQNTTGDTAEKM  179



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----------NMGGSSEVTTSTKEVEAICA  178
            D    K+ AI GV+S+LLVA VVA T+ V               S E+++S K ++AIC 
Sbjct  7    DSQNKKRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKAICQ  66

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDAL  358
            PTDYK+ C  SL      ++DPKEL++  F   MK I  A ++S  L +  KDPRAS AL
Sbjct  67   PTDYKQECVASLKATGNNSSDPKELVQAGFKAAMKLIQAAANKSVALNQLEKDPRASKAL  126

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
              CK L++ +I +L+ S    G+FD++ + E   D+++WLS  IT QETC D F NTTG+
Sbjct  127  AGCKELMDFAIDELKYSMNKLGEFDISKLDEMLIDIRIWLSATITYQETCLDGFANTTGN  186

Query  539  TGEKM  553
              EKM
Sbjct  187  AAEKM  191



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   152 bits (384),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 80/192 (42%), Positives = 113/192 (59%), Gaps = 16/192 (8%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE--------------VTTSTKEV  163
            GD  K  ++AI GV+++LLVA VVA TIS+       +              V ++ K V
Sbjct  4    GDAQKGSRIAIIGVSTLLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNYVASTLKAV  63

Query  164  EAICAPTDYKETCKTSL--SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKD  337
            + IC PT YK+ C  SL     A    DPKELIK AF+VT+  I   +  + + +E  KD
Sbjct  64   QTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFREIEKD  123

Query  338  PRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDA  517
            PR+ DALD CK L++ SIG+  +S +   +FD+ ++ +   +LKVWL+GA+T  +TC D 
Sbjct  124  PRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDG  183

Query  518  FENTTGDTGEKM  553
            FENTTGD  +KM
Sbjct  184  FENTTGDASKKM  195



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G S    STK V+++CAPTDYK+TC+ SLS   A T DPKELIK AF  T KNI   I  
Sbjct  33   GESVSAGSTKAVQSVCAPTDYKDTCEQSLS--HANTTDPKELIKAAFEFTEKNIGDVIKN  90

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            S L KEAA D     AL +C+ +L+ +I DL++S +  G+FD     EY  DLK WLS  
Sbjct  91   SPLFKEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAV  150

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT  ETC DAFENTTGDTGEKM
Sbjct  151  ITNHETCIDAFENTTGDTGEKM  172



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 104/176 (59%), Gaps = 4/176 (2%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            K KK+AI  V  +LLVA +VA T+ V          ++V    K +E IC  T YKETC+
Sbjct  7    KKKKIAIIAVLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQATTYKETCQ  66

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
            +SL      T DPK+LIK  F V    ++  I  S  LKE AKDP AS AL +CK LL  
Sbjct  67   SSLEKETGDTTDPKDLIKAEFQVAADKVNEVIKNSNTLKEYAKDPMASQALGVCKELLET  126

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ DL  + +  G FDV+ I +Y  DLKVWLS A+  Q TC DAFE+T G+ GEKM
Sbjct  127  AVEDLLGAVDKMGPFDVSKISDYLADLKVWLSAAVNHQATCLDAFEDTKGEAGEKM  182



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 114/175 (65%), Gaps = 11/175 (6%)
 Frame = +2

Query  32   GDKNKKVAIAGVASILLVACVVA-ATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCKT  208
            G K KK+A+A ++S+LLVA V+  AT  +         T S K  +A+C   DYK TC+ 
Sbjct  2    GAKMKKIAMASLSSVLLVAMVLPLATGDIP--------TISNKAAQALCTSVDYKITCEK  53

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SLS A   +++P+ELIK AF+  + +I  AI  S L K+AA D R   AL++C+ +L+ S
Sbjct  54   SLSDA--HSSNPQELIKVAFNHAITDIQEAIKNSTLYKQAATDHRTKGALEVCEEVLDTS  111

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I DL +S +  G+ D+  + +Y  D+KVWLSGAIT  ETC DAF+NTTGDTGEKM
Sbjct  112  IDDLRRSFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKM  166



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V+ +CAPTDYK+TC+ SLS A   T DPKELIK AF  T KNI   I  S L KEA
Sbjct  40   STKAVQNVCAPTDYKDTCEQSLSNA--NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            A D     AL +C+ +L+ +I DL++S +  G+FD +   EY  DLK WLS  IT  ETC
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDASKANEYLEDLKTWLSAVITNHETC  157

Query  509  RDAFENTTGDTGEKM  553
             DAFENTTGDTGEKM
Sbjct  158  IDAFENTTGDTGEKM  172



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 13/188 (7%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI----SVTNMGGSSE---------VTTSTKEVEA  169
            D +K K++A+   +S++LVA VVA  +    + ++  G  E         + +S K ++A
Sbjct  9    DAEKKKRIAVISASSLILVAMVVAVAVGVNHNTSDASGDGESVSKDSGGDIQSSMKAIKA  68

Query  170  ICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            IC PTDYKETC  SLS AA  T DPKEL++  F V MK+I  A+S+S  LKE  KDPRA 
Sbjct  69   ICQPTDYKETCVQSLSSAAGNTTDPKELVRVGFQVAMKHIREALSQSETLKEVEKDPRAK  128

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
             AL  C+ L++ +I DL+ S +  G FD++ +     DLKVWL+   T Q TC D FENT
Sbjct  129  QALLSCQELMDYAIDDLKNSFDKLGAFDISKVDNILADLKVWLTSVNTYQVTCTDGFENT  188

Query  530  TGDTGEKM  553
            TGD GE+M
Sbjct  189  TGDAGERM  196



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 111/180 (62%), Gaps = 3/180 (2%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNM---GGSSEVTTSTKEVEAICAPTDYK  193
            M   ++ + V I  V S++LVA VVA  I++          +VTTS K +E+IC  T Y+
Sbjct  1    MAGNNRKRNVTIISVCSLILVAMVVAVAITMKGKDSDNNGQDVTTSQKAIESICQTTRYQ  60

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
             TC  SL  +A  ++DPKELI+ +F VTM+ I  AI  S +L++  KDPRA  AL+ C+ 
Sbjct  61   HTCVESLESSAEGSSDPKELIQKSFQVTMEKIKEAIENSTMLQKLEKDPRAKLALENCQK  120

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L   ++ DL ++      F+ N++  +  DLK+WLSGAIT QETC D FE TTG+T EKM
Sbjct  121  LAWQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEKTTGETEEKM  180



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   151 bits (381),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 80/188 (43%), Positives = 111/188 (59%), Gaps = 10/188 (5%)
 Frame = +2

Query  20   KMGDGDKNKKVAIAGVASILLVACVVAATISVT----------NMGGSSEVTTSTKEVEA  169
            K  D    K+ AI GV+S+LLVA VVA T+ V               S E+++S K ++A
Sbjct  4    KDDDSQNKKRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKA  63

Query  170  ICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            IC PTDYK+ C  SL      ++DP+EL++  F   MK I  A ++S  LK+  KDPR S
Sbjct  64   ICQPTDYKQECIASLKATGNNSSDPQELVQAGFKAAMKLIQAAANKSVDLKQLEKDPRTS  123

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENT  529
             AL  CK L++ +I +L+ S    G+FD+  + E   D+++WLS  IT QETC D F+NT
Sbjct  124  KALAGCKELMDFAIDELKYSMNKLGEFDITKLDEMLIDIRIWLSATITYQETCLDGFQNT  183

Query  530  TGDTGEKM  553
            TG+  EKM
Sbjct  184  TGNAAEKM  191



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 3/178 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT---NMGGSSEVTTSTKEVEAICAPTDYKET  199
            D  + ++  +  ++S+LLV+ VVA TI V+   + G   E+T S K ++ +CAPTDYK+T
Sbjct  9    DSKRKRRYVVISISSVLLVSMVVAVTIGVSVNSDNGTKEEITASVKAIKDVCAPTDYKKT  68

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ +L   A  T+DP EL++TAF+ TMK IS+   +S  + E  KDPR   ALD C  L+
Sbjct  69   CEDTLRKDAKDTSDPLELVRTAFNATMKQISNVAKKSLTMIELQKDPRTKMALDQCTELM  128

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + +IG+L KS +  G F+++ + +    LKVWLS  I+ ++TC D F+ T GD GE M
Sbjct  129  DFAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISHEQTCLDGFQGTQGDAGETM  186



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 113/181 (62%), Gaps = 5/181 (3%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-----NMGGSSEVTTSTKEVEAICAPTDY  190
            G+    KK+AI GV++++LVA VVA T+ VT        G  + +TSTK +++IC PTDY
Sbjct  4    GEVQNKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +LS  A+   DPKEL+K  F V +  +   I  S  LKE AKD RA+ AL  CK
Sbjct  64   KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKELAKDSRANQALQNCK  123

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             LL  +I DL  S +  G FD   +  Y  DLKVWLS A+T ++TC D F+NTTGD G K
Sbjct  124  ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  183

Query  551  M  553
            M
Sbjct  184  M  184



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT-NMG-----GSSEVTTSTKEVEAICAPTDY  190
            D  + K+  +  ++S+LL++ VVA T+ V+ N G     G+ E+T+S K V+ +CAPTDY
Sbjct  8    DSKRKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L      T+DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   ++++WLS AI+ +ETC + F++T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT-NMG-----GSSEVTTSTKEVEAICAPTDY  190
            D  + K+  +  ++S+LL++ VVA T+ V+ N G     G+ E+T+S K V+ +CAPTDY
Sbjct  8    DSKRKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L      T+DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   ++++WLS AI+ +ETC + F++T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 3/178 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT---NMGGSSEVTTSTKEVEAICAPTDYKET  199
            D  + ++  +  ++S+LLV+ VVA TI V+   + G   E+T S K ++ +CAPTDYK+T
Sbjct  9    DSKRKRRYVVISISSVLLVSMVVAVTIGVSFNNDNGTKEEITASVKAIKDVCAPTDYKKT  68

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ +L   A  T+DP EL++TAF+ TMK IS+   +S  + E  KDPR   ALD C  L+
Sbjct  69   CEDTLRKDAKDTSDPLELVRTAFNATMKQISNVGKKSLTMIELQKDPRTKMALDQCTELM  128

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + +IG+L KS +  G F+++ + +    LKVWLS  I+ ++TC D F+ T GD GE M
Sbjct  129  DYAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISHEQTCLDGFQGTQGDAGETM  186



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V++ICAPTDYK+TC+  LS   A T +P+ELIK AF  T+KNI   +  S L KEA
Sbjct  50   STKAVQSICAPTDYKDTCEKGLS--HANTTNPQELIKAAFEFTVKNIGDVVKNSPLFKEA  107

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            + D    +AL++C+ +L  +I DL+ S ++  +FDV N  EY  DLK WLS  IT QETC
Sbjct  108  SHDKSTKEALEICQLVLEIAIDDLKMSFDSVDEFDVTNASEYVEDLKTWLSAVITNQETC  167

Query  509  RDAFENTTGDTGEKM  553
             DAF+NTTGDTGEKM
Sbjct  168  IDAFDNTTGDTGEKM  182



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 114/182 (63%), Gaps = 7/182 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSE---VTTSTKEVEAICAPTD  187
            D  + K + I  ++S+LL++ VVA T+ VT    +  G+SE   +T S K V+ +CAPTD
Sbjct  8    DSKRKKSMVIISISSVLLISMVVAVTVGVTLNKSDSNGNSEDTEITPSVKAVKDVCAPTD  67

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YK+TC+ +L      T DP EL+KTAF +TM  I+ A  +S  ++E  KDPR   ALD C
Sbjct  68   YKKTCEDTLIKNGKNTTDPVELVKTAFRITMNQITDAAKKSQTMRELQKDPRTRMALDQC  127

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE
Sbjct  128  KELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGE  187

Query  548  KM  553
             M
Sbjct  188  TM  189



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V+ ICAPTDY++TC+ SLS A   T DPKELIK AF  T KNI   I  S L KEA
Sbjct  40   STKAVQNICAPTDYQDTCEQSLSNA--NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            A D     AL +C+ +L+ +I DL++S +  G+FD     EY  DLK WLS  IT  ETC
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVITNHETC  157

Query  509  RDAFENTTGDTGEKM  553
             DAFENTTGDTGEKM
Sbjct  158  IDAFENTTGDTGEKM  172



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            STK V+ ICAPTDY++TC+ SLS A   T DPKELIK AF  T KNI   I  S L KEA
Sbjct  40   STKAVQNICAPTDYQDTCEQSLSNA--NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            A D     AL +C+ +L+ +I DL++S +  G+FD     EY  DLK WLS  IT  ETC
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVITNHETC  157

Query  509  RDAFENTTGDTGEKM  553
             DAFENTTGDTGEKM
Sbjct  158  IDAFENTTGDTGEKM  172



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 115/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + K+  +  ++S+LL++ VVA T+ V+      +  G+ E+T+S K V+ +CAPTDY
Sbjct  8    DSKRKKRFIVITISSVLLISMVVAVTVGVSLNKSGDDSDGNGEITSSVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L      T+DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDTLIKNGNNTSDPVELVKTAFRATMKQITDAAKKSQTMMELQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   ++++WLS AI+ +ETC + F++T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 8/183 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT---NMG-----GSSEVTTSTKEVEAICAPT  184
            D  + K+ A+  ++S+LL++ VVA T+ V    N G     G+ ++T S K V+ ICAPT
Sbjct  8    DSKRKKRYAVISISSVLLISMVVAVTVGVNLSKNDGKGDSEGNGQITASVKAVKDICAPT  67

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+TC+ SL      T DP EL+KTAF VTMK I+ A  +S  + +  KDPR   ALD 
Sbjct  68   DYKKTCEDSLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQ  127

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L++ ++G+L  S E  G  + + + E   +L++WLS AI+ +ETC + F+ T G+ G
Sbjct  128  CKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAG  187

Query  545  EKM  553
            E M
Sbjct  188  ETM  190



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 102/167 (61%), Gaps = 4/167 (2%)
 Frame = +2

Query  65   VASILLVACVVAATISVTNMGGSSE----VTTSTKEVEAICAPTDYKETCKTSLSGAAAK  232
            V S++ VA +VA  + VT    S++      +S K +E IC  T YKETC++SL  AA  
Sbjct  15   VFSVMGVAMIVAVAVGVTCSRKSAKQNKGTASSKKAIETICQTTSYKETCQSSLEKAAGD  74

Query  233  TNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSC  412
            T+DPKELIK  F V    +   I  S  LK+ AKDP AS ALD+CK +L+ S  DL  + 
Sbjct  75   TSDPKELIKAGFQVAADKLDEVIQNSNTLKDLAKDPMASQALDVCKEMLDTSTEDLLAAV  134

Query  413  EAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +  G FD + + EY  DLKVWLS A+  Q+TC DAFE T G+ GEKM
Sbjct  135  DKMGPFDASKMNEYVEDLKVWLSAAVNHQQTCLDAFEGTKGEAGEKM  181



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   149 bits (376),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 79/186 (42%), Positives = 108/186 (58%), Gaps = 11/186 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTS-----------TKEVEAIC  175
            DG + K++AI  V S LLVA VVA T+ V+    SS+  TS            K ++++C
Sbjct  6    DGQRKKRIAIIAVCSFLLVAMVVAVTVGVSINDTSSDDGTSNSSKSSQVSASVKAIKSVC  65

Query  176  APTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             PTD+++TC+  L   A  T D KEL++ AF   MK+ S A+  S  L++  KDPR   A
Sbjct  66   QPTDFRKTCEEQLRAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEKDPRTKKA  125

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LD+CK L+  SI +L+KS +     D+N       DLK+WLS  IT Q+TC D F+NTT 
Sbjct  126  LDVCKQLMTYSIKELKKSLDQIDKLDINKFDRMLADLKIWLSATITNQQTCLDGFKNTTS  185

Query  536  DTGEKM  553
              GEKM
Sbjct  186  KAGEKM  191



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 107/178 (60%), Gaps = 10/178 (6%)
 Frame = +2

Query  50   VAIAGVASILLVACVVAATI-----SVTNMGG-----SSEVTTSTKEVEAICAPTDYKET  199
            +AI  V+S +LV    A T      SV++        +SEV+ S K +E IC PTDYKE 
Sbjct  13   IAIIVVSSFILVVIGAAVTFGMYTASVSSQASKASEKTSEVSASIKAIEGICQPTDYKEA  72

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C  SL  A A T DPKELIK +F   MK+I+ A  +S +LKE  K PRA  AL  CK L+
Sbjct  73   CVRSLREAGANTADPKELIKASFKAAMKHIAEAAKKSTVLKELEKTPRAQQALSNCKKLM  132

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
              +I DLE+S +  G+ + + + +   DLKVWLS  +T Q+TC D F+NTTG+ G KM
Sbjct  133  GFAINDLERSFDKLGELEFSKLDDALADLKVWLSAVVTYQDTCLDGFQNTTGNAGHKM  190



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKE  196
            D  + ++ A+  ++S+LLV+ VVA TI V     + G   E+T S K ++ +CAPTDYK+
Sbjct  9    DSKRKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKK  68

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTL  376
            TC+ +L   A  T+DP EL++ AF+VTMK I++   +S  + E  KDPR   ALD CK L
Sbjct  69   TCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKEL  128

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ +IG+L  S    G F+ + + E    +KVWLS  IT ++TC D F+ T GD GE +
Sbjct  129  MDYAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITHEQTCIDGFKGTKGDAGETI  187



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   149 bits (375),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = +2

Query  92   VVAATISVT--NMGGSS--------EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTND  241
            VVA T++V   N G SS         V +S K V+ +CAPTDYK+ C+ +L   A+   D
Sbjct  2    VVAVTVNVNFNNKGSSSDSKEESKSHVASSMKAVKTLCAPTDYKKECEDNLIEHASNITD  61

Query  242  PKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAA  421
            P+ELIK AFHVT+  I   + ++ L+ E   DP   +ALD CK L+N SIG+  +S +  
Sbjct  62   PRELIKIAFHVTISKIGEGLEKTQLMHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKF  121

Query  422  GDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
              FD+NN+      LKVWLSGAIT QETC DAFENTT D G+KM
Sbjct  122  AKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTTTDAGQKM  165



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKE  196
            D  + ++ A+  ++S+LLV+ VVA TI V     + G   E+T S K ++ +CAPTDYK+
Sbjct  9    DSKRKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKK  68

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTL  376
            TC+ +L   A  T+DP EL++ AF+VTMK I++   +S  + E  KDPR   ALD CK L
Sbjct  69   TCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKEL  128

Query  377  LNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ +IG+L  S    G F+ + + E    +KVWLS  IT ++TC D F+ T GD GE +
Sbjct  129  MDYAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITHEQTCIDGFKGTKGDAGETI  187



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 99/145 (68%), Gaps = 2/145 (1%)
 Frame = +2

Query  119  NMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHA  298
            N  G+   +TS K V+A+C+PT Y+ETC+ +L  A A T+DPKELI+  F V +  I  A
Sbjct  23   NESGAPATSTSNKAVQAVCSPTSYRETCEQTL--AKANTSDPKELIRYGFGVAVDGIGEA  80

Query  299  ISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWL  478
            + +SALLK+AA D    DA  +C+ +L+ ++ DL+KS +  G+F+   + +Y  DL+ WL
Sbjct  81   LKKSALLKQAAADQSTKDAFYVCEDVLDLAVYDLQKSIDRIGEFNPQKLNDYVEDLRTWL  140

Query  479  SGAITQQETCRDAFENTTGDTGEKM  553
            SG +T Q TC DAFENTTGDTGEKM
Sbjct  141  SGVVTTQTTCIDAFENTTGDTGEKM  165



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 112/181 (62%), Gaps = 5/181 (3%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVT-----NMGGSSEVTTSTKEVEAICAPTDY  190
            G+    KK+AI GV++++LVA VVA T+ VT        G  + +TSTK +++IC PTDY
Sbjct  7    GEAQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHQGKSGGEQTSTSTKAIQSICQPTDY  66

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +LS  A+   DPKEL+K  F V +  +   I  S  LK  AKD RA+ AL  CK
Sbjct  67   KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKALAKDSRANQALQNCK  126

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             LL  +I DL  S +  G FD   +  Y  DLKVWLS A+T ++TC D F+NTTGD G K
Sbjct  127  ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  186

Query  551  M  553
            M
Sbjct  187  M  187



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + ++  I  ++S+LL++ VVA T+ V+      N    +++T+S K V+ +CAPTD+
Sbjct  8    DSKRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDF  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ SL+     T DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + FE T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTN---MGGSSEVTTSTKEVEAICAPTDYKETCKTS  211
            NKKV I G+ASIL+VACVVAA +++T       S +VTTSTK VE++C PT YK+TC+ +
Sbjct  3    NKKVVIGGIASILVVACVVAACVTLTKNDETSSSGQVTTSTKSVESMCQPTPYKQTCEKT  62

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LS +A   +DPK+ IK AF  T+ +I +AI  + L+ +AA DP+  DAL  C+ L + +I
Sbjct  63   LS-SAKNASDPKDFIKVAFEATVTDIKNAIMNTDLIMQAASDPKTKDALHACEELFDLAI  121

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL  S      FD++ I +  +DLK WLS  +  +ETC DAFE T GDTGEKM
Sbjct  122  EDLRTSVSKLDSFDLSKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKM  175



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + ++  I  ++S+LL++ VVA T+ V+      N    +++T+S K V+ +CAPTD+
Sbjct  8    DSKRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDF  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ SL+     T DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + FE T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT---NMG---GSSEVTTSTKEVEAICAPTDY  190
            +  + ++  +  ++S+LL++ VVA T+ V+   N G   G  E+T S K V+ +CAPTDY
Sbjct  8    EAKRKRRYVVITISSVLLISMVVAVTVGVSLNKNDGDSEGKGEITASVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            ++TC+ +L      T DP EL+KTAF VTMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   RKTCEDTLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 109/179 (61%), Gaps = 6/179 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMG------GSSEVTTSTKEVEAICAPTDY  190
            D  K K+  +  V+S+LL++ VVA TI V             E+T S K ++ +CAPTDY
Sbjct  9    DSKKKKRYVVISVSSVLLISMVVAVTIGVNVNNNDNGGDSDGEITASVKAIKDVCAPTDY  68

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L   A  T+DP EL+KTAF+ TMK IS    +S  + +  KDPR   ALD CK
Sbjct  69   KKTCEDTLKKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIDLQKDPRTKMALDQCK  128

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
             L++ ++G+L KS E  G F++N + E    LK+WLS  I+ ++TC + F+ T GD GE
Sbjct  129  ELMDYAVGELSKSFEELGKFELNKVDEALVKLKIWLSATISHEQTCLEGFQGTQGDAGE  187



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + ++  I  ++S+LL++ VVA T+ V+      N    +++T+S K V+ +CAPTD+
Sbjct  8    DSKRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDF  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ SL+     T DP EL+KTAF  TMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + FE T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTNMGGSS---EVTTSTKEVEAICAPTDYKETCKTS  211
            NKKV I G+ASIL+VACVVAA +++T    +S   +VTTSTK VEA+C PT YK+TC+ +
Sbjct  3    NKKVVIGGIASILVVACVVAACVTLTQKDETSSTGQVTTSTKSVEAMCQPTPYKQTCEKT  62

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LS +A    DPK+ IK AF  T+ +I +AI  + L+ +AA DP+  DAL  C+ L + +I
Sbjct  63   LS-SAKNVTDPKDFIKVAFEATVTDIKNAIMNTDLIMKAASDPKTKDALHACEELFDLAI  121

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL  S      FD+  I +  +DLK WLS  +  +ETC DAFE T GDTGEKM
Sbjct  122  EDLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKM  175



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   148 bits (373),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 71/141 (50%), Positives = 96/141 (68%), Gaps = 2/141 (1%)
 Frame = +2

Query  131  SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRS  310
            + E++TSTK ++AIC PTDY+ETC+ SLS  +A T DPKELIK  F   +  I   I+ S
Sbjct  163  TGEISTSTKAIKAICQPTDYRETCEKSLS--SANTTDPKELIKIGFQAAISEIKKVIANS  220

Query  311  ALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
            + +KE AKDP A  AL+ C  L++ +I DL+ S    G+FD + + EY  +LK+WL GAI
Sbjct  221  STVKEVAKDPMARQALENCHELMDYAIDDLKNSFNQLGEFDFSKLDEYIENLKIWLGGAI  280

Query  491  TQQETCRDAFENTTGDTGEKM  553
            T Q+TC D F NTTG+ G+KM
Sbjct  281  TYQQTCLDGFMNTTGEAGKKM  301



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 110/180 (61%), Gaps = 3/180 (2%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNM---GGSSEVTTSTKEVEAICAPTDYK  193
            M   ++ + VAI  V S++LVA +VA  I++          + TTS K +E+IC  T Y+
Sbjct  1    MAGNNRKRNVAIISVCSLILVAMIVAVAITMKGKDSDNNGQDATTSQKTIESICQTTRYQ  60

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
             TC  SL  +A  ++DPK+LI+ +F V +K I  AI  S +L++  KDPRA  AL+ C+ 
Sbjct  61   HTCVESLESSAEGSSDPKDLIQKSFQVAIKKIKEAIENSTMLQKLEKDPRAKLALENCQK  120

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L   ++ DL ++      F+ N++  +  DLK+WLSGAIT QETC D FE TTG+T EKM
Sbjct  121  LAWQAVNDLNRTHTKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEKTTGETEEKM  180



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSE--VTTSTKEVEAICAPTDY  190
            D  + K++ +  ++S+LL+  VVA T+  +     + G SE  +  S K V+ +CAPTDY
Sbjct  8    DSKRKKRLVLISISSVLLITLVVALTVGFSLKKGEVNGDSEGQINASVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L      T DP EL+KTAF VTMK I+ A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDTLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHKLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 8/183 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSE----VTTSTKEVEAICAPT  184
            D  + K+  I  ++S+LL++ VVA T+ V     +  G SE    +T S K V+ ICAPT
Sbjct  8    DSKRKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPT  67

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+TC+ SL      T DP EL+KTAF VTMK I+ A  +S  + +  KDPR   ALD 
Sbjct  68   DYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQ  127

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L++ ++G+L  S E  G  + + + E   +L++WLS AI+ +ETC + F+ T G+ G
Sbjct  128  CKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAG  187

Query  545  EKM  553
            E M
Sbjct  188  ETM  190



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 8/183 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT--------NMGGSSEVTTSTKEVEAICAPT  184
            D  K K+  I  ++S+LL++ VVA T+ V+          GG+ +VT S K ++ +CAPT
Sbjct  9    DAKKRKRYVIITISSVLLISMVVAVTVGVSLNKEDNGDGEGGNGQVTASVKAIKEVCAPT  68

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+TC+ +L   A  T+DP EL+KTAF VTMK I+ A ++S  L E  KDPR   ALD 
Sbjct  69   DYKKTCEDTLRKNANNTSDPLELVKTAFEVTMKQIAEAAAKSKTLIEIQKDPRTKMALDQ  128

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L++ +  +L+ S +  G F+ + + E   +L++WLS AI+ + TC + FE T G+ G
Sbjct  129  CKELMDYAFDELKSSFDELGKFEFHKLDEALINLRIWLSAAISHETTCLEGFEQTQGNAG  188

Query  545  EKM  553
            E M
Sbjct  189  ETM  191



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 8/183 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT----NMGGSSE----VTTSTKEVEAICAPT  184
            D  + K+  I  ++S+LL++ VVA T+ V     +  G SE    +T S K V+ ICAPT
Sbjct  8    DSKRKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPT  67

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DYK+TC+ SL      T DP EL+KTAF VTMK I+ A  +S  + +  KDPR   ALD 
Sbjct  68   DYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQ  127

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            CK L++ ++G+L  S E  G  + + + E   +L++WLS AI+ +ETC + F+ T G+ G
Sbjct  128  CKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAG  187

Query  545  EKM  553
            E M
Sbjct  188  ETM  190



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 101/162 (62%), Gaps = 9/162 (6%)
 Frame = +2

Query  95   VAATISVTNM-GGS--------SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPK  247
            VA  ++  N+ GGS        S++ +S K V+ +C PTDY++ C+ SL   A  T DP+
Sbjct  5    VAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPR  64

Query  248  ELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGD  427
            ELIK AF +T+K + + + ++  + E   DPR+  AL+ CK L+N SI + ++S E  G 
Sbjct  65   ELIKIAFKITIKKMGNGLKKTDFMHEVENDPRSKMALETCKQLMNLSIDEFKRSLERMGK  124

Query  428  FDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            FD+NN+    N L+VWLSGAIT QETC D F+NTT   G KM
Sbjct  125  FDLNNLDNILNSLRVWLSGAITYQETCLDGFKNTTNKAGNKM  166



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   145 bits (366),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 80/185 (43%), Positives = 117/185 (63%), Gaps = 10/185 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI--SVTNMGGS--------SEVTTSTKEVEAICA  178
            +G K +++ I GV++I LVA VVA  +  ++   GGS        S V +S K V+ +C 
Sbjct  5    NGQKKRRIVIIGVSAIFLVAVVVAVAVGVNLNIKGGSNDDAQDNKSHVASSVKAVKTLCK  64

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDAL  358
            PTDY + C+ SLS  A  T DP+ELIK AF++T+K I + + ++ ++ +   DP +  AL
Sbjct  65   PTDYPKECEKSLSAEAGNTTDPRELIKIAFNITIKKIGNGLKKTDIMHKVENDPISKMAL  124

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
            D CK L++ SI + ++S E  G FD+NN+    N L+VWLSGAIT Q+TC D F+NTT +
Sbjct  125  DTCKQLMDLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQDTCLDGFKNTTNE  184

Query  539  TGEKM  553
             G KM
Sbjct  185  AGNKM  189



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +2

Query  41   NKKVAIAGVASILLVACVVAATISVTN---MGGSSEVTTSTKEVEAICAPTDYKETCKTS  211
            NKKV I G+ASIL+VACVVAA +++T       S +VTTSTK V+A+C PT YK+TC+ +
Sbjct  3    NKKVVIGGIASILVVACVVAACVTLTKNDETSSSGQVTTSTKSVKAMCQPTPYKQTCEKT  62

Query  212  LSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSI  391
            LS +A   ++PK+ IK AF  T+ +I +AI  + L+ +AA DP+  DAL  C+ L + +I
Sbjct  63   LS-SAKNASEPKDFIKVAFEATVTDIRNAIMNTDLIMQAASDPKTKDALHACEELFDLAI  121

Query  392  GDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             DL  S      FD+  I +  +DLK WLS  +  +ETC DAFE T GDTGEKM
Sbjct  122  EDLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKM  175



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G +++   TK +++IC PT YK+ C+++L+ +   TNDPKEL+KTAF V  + ++ A+ +
Sbjct  41   GENKIAAGTKAIQSICQPTRYKQACESTLTNSGGNTNDPKELVKTAFRVAKEEVAKALEK  100

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            S  ++ A  DPRA++ +++C+ ++  +I DLE++ E+ G F ++NI ++  DL+VW+ GA
Sbjct  101  SKTIQAAKDDPRAAEGIEICREVVGYAINDLERTVESVGAFSMDNIDDFLEDLRVWIGGA  160

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QE C + FEN+T D G KM
Sbjct  161  ITYQEVCFEGFENSTSDAGTKM  182



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 111/181 (61%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  K ++ A+  ++S+LL++ +VA TIS+       +   + E+  S K V+ +CAPTDY
Sbjct  8    DSKKKRRYAVILISSVLLISMIVAVTISLNKNEANGDSKSNGELAASVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ +L      T DP EL+KTAF VTMK I+ A  +S  + +  KDPR   ALD CK
Sbjct  68   KKTCEDTLLKNGHNTTDPMELVKTAFSVTMKQITDAAKKSQTMMDLQKDPRTRMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G  GE 
Sbjct  128  ELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGKAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            +TK V+AIC+PTDYK+TC+ SL+GA   + DPK LIK AF  T+K I  AI  S L +EA
Sbjct  48   TTKSVQAICSPTDYKQTCEESLAGA--NSTDPKYLIKLAFQNTVKGIRSAILNSTLYREA  105

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            A DP    AL +C+ +L+NS+ DL++S +    FDVN + EY +D+K WLSGAI  +E C
Sbjct  106  AADPNTKGALQVCEEVLDNSVDDLQRSFDQVEAFDVNRMDEYIDDIKTWLSGAIANKEAC  165

Query  509  RDAFENTTGDTGEKM  553
             DA   T+GDT EKM
Sbjct  166  IDAVNGTSGDTAEKM  180



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = +2

Query  23   MGDGDKN--KKVAIAGVASILLVACVVAATISVTNM---------GGSSEVTTSTKEVEA  169
            M D D    ++ AI GV+++LLVA ++   +   N             + V ++ K +  
Sbjct  1    MADSDAQIARRSAIIGVSTLLLVAMIIVVMVGARNKYSFKDDIEDNKKNHVASTMKAIRT  60

Query  170  ICAPTDYKETCKTSLSGAAAKTN--DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPR  343
            IC PTDYK+ C+ SL   A   N  DPKELIK AF+VT+K I   +  + +L E  KDPR
Sbjct  61   ICQPTDYKKECEESLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKETDMLCELEKDPR  120

Query  344  ASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            + DALD CK L++ SI +  +S +  G  ++ NI     +LKVWL+GA+T  +TC D FE
Sbjct  121  SKDALDTCKQLMDLSIDEFTRSLDGIGKLNIQNIENILMNLKVWLNGAVTYMDTCLDGFE  180

Query  524  NTTGDTGEKM  553
            NTT + G+KM
Sbjct  181  NTTSEAGKKM  190



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +2

Query  149  STKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEA  328
            S K +EAIC PT YKETC++SL   A  T DPKEL+K  F V    ++  I  S  LK+ 
Sbjct  45   SKKAIEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDL  104

Query  329  AKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETC  508
            AKDP AS ALD+CK LLN ++ DL  + +  G F+++ + +Y  DLKVWLS A+  Q TC
Sbjct  105  AKDPMASQALDICKELLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATC  164

Query  509  RDAFENTTGDTGEKM  553
             DAF++T G+ G+KM
Sbjct  165  VDAFKDTKGEAGDKM  179



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 115/184 (63%), Gaps = 7/184 (4%)
 Frame = +2

Query  23   MGDGD---KNKKVAIAGVASILLVACVVAATISVT--NMGGSSE--VTTSTKEVEAICAP  181
            MG  D   K KK+AI  V++++LVA VVA  + VT  + GG+ E    T++K +E +C P
Sbjct  1    MGGNDRHGKKKKIAIISVSALILVAMVVAVAVGVTKSHKGGNDEKKPATTSKAIETVCQP  60

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDYKETC+ +LS  A    DPKEL+K  F + ++ +   I+ S  LKE AKD   + AL 
Sbjct  61   TDYKETCQNALSEKAGNVTDPKELVKIGFQIAIEKLQEVINNSDTLKEIAKDNLGNQALQ  120

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             C+ L+  SI DL++S +  G F+V  + EY  DLKVWLS ++  ++TC D F+NT G+ 
Sbjct  121  NCRELIEYSIDDLKRSADKIGPFEVTKLKEYVEDLKVWLSASLQYEQTCLDGFDNTPGEA  180

Query  542  GEKM  553
            G KM
Sbjct  181  GAKM  184



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 109/187 (58%), Gaps = 19/187 (10%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISV------------TNMGGSSEVTTSTKEVEAICAPTD  187
            +++AI  V+   LV+ VVA T+                 G S + + STK ++AIC PTD
Sbjct  13   RRIAIIVVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSIDKSASTKAIKAICQPTD  72

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YK+ C +SL+ AA  T DP +LIK  F  TMK I  A  +S LL++  KDPR S ALD C
Sbjct  73   YKQECLSSLTSAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQKLEKDPRTSMALDTC  132

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYAN---DLKVWLSGAITQQETCRDAFENTTG-  535
            K L+  ++ +L +S    G  D+ N  +Y     DLKVWLS +IT QE+C DAFENTT  
Sbjct  133  KELMELAVDELRQSFNRVG--DIENFSKYKTFIMDLKVWLSASITYQESCLDAFENTTSS  190

Query  536  -DTGEKM  553
             D G++M
Sbjct  191  TDAGQEM  197



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 98/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  65   VASILLVACVVAATISVT----NMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAK  232
            V  +LLVA +VA T+ V          ++V    K +E IC PT YKETC++SL   A  
Sbjct  16   VLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQPTTYKETCQSSLEKEAGD  75

Query  233  TNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSC  412
            T DPK+LIK  F V    ++  I  S  LKE AKDP  S AL +CK LL  ++ DL  + 
Sbjct  76   TTDPKDLIKAGFKVAADKVNEVIKNSNTLKEHAKDPMTSQALGVCKELLETAVEDLLGAV  135

Query  413  EAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +  G FD + I +Y  DLKVWLS A+  Q TC DAF++T G+ GEKM
Sbjct  136  DKMGPFDASKIDDYLADLKVWLSAAVNHQATCLDAFKDTKGEAGEKM  182



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   142 bits (358),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 76/182 (42%), Positives = 105/182 (58%), Gaps = 7/182 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS-------EVTTSTKEVEAICAPTD  187
            DG   +++A+ GV++I LVA VVA   SV     S+        V +S K V  +C PT 
Sbjct  5    DGGSKRRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTY  64

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            Y++ C+ SL   A  T D +ELIK  F++TMK I     +   +  A ++PRA  AL  C
Sbjct  65   YQKECEKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATC  124

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K L+N S+G+ +++ E  G FD++N+      LKVWLSGAIT QETC D F NTT   G 
Sbjct  125  KQLMNLSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGN  184

Query  548  KM  553
            +M
Sbjct  185  RM  186



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   142 bits (357),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 76/182 (42%), Positives = 105/182 (58%), Gaps = 7/182 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS-------EVTTSTKEVEAICAPTD  187
            DG   +++A+ GV++I LVA VVA   SV     S+        V +S K V  +C PT 
Sbjct  5    DGGSKRRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTY  64

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            Y++ C+ SL   A  T D +ELIK  F++TMK I     +   +  A ++PRA  AL  C
Sbjct  65   YQKECEKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATC  124

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K L+N S+G+ +++ E  G FD++N+      LKVWLSGAIT QETC D F NTT   G 
Sbjct  125  KQLMNLSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGN  184

Query  548  KM  553
            +M
Sbjct  185  RM  186



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT--NMGGSSEVTTSTKEVEAICAPTDYKETC  202
            D  + +   I  ++S +L++ +VA T+SV   + GG+ E+TTS K ++ +CAPTDYK+TC
Sbjct  9    DSKRKRSYVIISISSAVLISMIVAVTVSVNKNDNGGNEEITTSVKAIKDVCAPTDYKKTC  68

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLN  382
            + +L   A   +DP EL+KTAF+ TMK IS+   +S  + +  KDPR   ALD CK L++
Sbjct  69   EDTLRKDAKNISDPLELVKTAFNATMKQISNVAKKSQTMIDLQKDPRTKMALDQCKELMD  128

Query  383  NSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT--GEKM  553
             +I +L KS +  G F+++ + E    LK+WLS  I+ ++TC D F+ T G+   GE M
Sbjct  129  YAIVELTKSFDEIGSFELHKMDEALIKLKIWLSATISHEQTCLDGFQGTQGNNNAGETM  187



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 117/184 (64%), Gaps = 9/184 (5%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGS--------SEVTTSTKEVEAICAPT  184
            DG K K++AI GV+SI+LVA VVA  + V++  GS        + V  S K ++ IC PT
Sbjct  17   DGQKKKRLAIIGVSSIILVAMVVAVAVGVSHHSGSGSSESGSDNHVQDSMKAIKTICQPT  76

Query  185  DYKETCKTSL-SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            DYKE C +SL S A + T DPKEL+K +F V ++ +     +SALLKE  KDP    AL 
Sbjct  77   DYKEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKEVEKDPGTRQALS  136

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
            +C  +++ +I +L+ S +  G FD++N+ E   +++ WLS AIT QETC DAFENTT   
Sbjct  137  ICDEIMDYAIDELKNSIDQVGGFDLSNMEEIIENIRSWLSAAITYQETCVDAFENTTSKA  196

Query  542  GEKM  553
            GE+M
Sbjct  197  GEQM  200



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   142 bits (357),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 85/187 (45%), Positives = 117/187 (63%), Gaps = 12/187 (6%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATI-SVTNMGG---------SSEVTTSTKEVEAICA  178
            D +K +++AI GV+++LLVA VVA T+ +  N  G          + V ++ K V+ IC 
Sbjct  5    DTNKGRRIAIIGVSTVLLVAMVVAVTVGTYRNQNGYDDNIEDTKKNHVASTMKAVQTICH  64

Query  179  PTDYKETCKTSLSGAAAKTN--DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASD  352
            PTDYK+ C+ +L   A   N  DPKELIK AF+VTMK I   I  + LL E  KDPR+ D
Sbjct  65   PTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKETDLLHEVEKDPRSKD  124

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            ALD CK L++ SI +  +S +   +FD+ NI +   +LKVWL+GA+T  +TC D FENTT
Sbjct  125  ALDTCKQLMDLSIDEFTRSLDGINEFDLQNIDKILMNLKVWLNGAVTYMDTCLDGFENTT  184

Query  533  GDTGEKM  553
             + G KM
Sbjct  185  SEAGTKM  191



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   143 bits (360),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 79/180 (44%), Positives = 110/180 (61%), Gaps = 4/180 (2%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISV---TNMGGSSEVTTSTKEVEAICAPTDYK  193
            M D  K KK+AI  V S+LLVA VVA   +     N  G  +V+ S K ++ +C  TDY+
Sbjct  1    MADNPK-KKIAIVSVCSLLLVAMVVALFTTRHGNGNTDGEQDVSASQKSIQTLCQNTDYQ  59

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
            ETC  SL+ + + ++DPKELI+ AF   +K I  A + S +  E  KDPR  +AL+ C+ 
Sbjct  60   ETCVNSLTSSGSNSSDPKELIEIAFQAAIKQIRDAANNSTVFHEVEKDPRGKEALESCRE  119

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L + +I DL++S +   +FD+ ++     DLK+WLSGAIT QETC D FE   GD  EKM
Sbjct  120  LADRAINDLQRSFDKFNNFDITDVENILADLKIWLSGAITYQETCIDGFEEVPGDATEKM  179



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 110/183 (60%), Gaps = 7/183 (4%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTN-------MGGSSEVTTSTKEVEAICAPT  184
            G GD+ K+  + GV+S+LLVA V A  + +T+        G + +++++ + VE IC  T
Sbjct  11   GGGDQRKRFTLLGVSSVLLVAMVGAVAVGLTSKGDTNSEQGQNGQISSTQRNVEIICEST  70

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
             Y+ETC  SL  A+ +T+D KELIK AF+ T + +   I  + L  E AKD     A+++
Sbjct  71   QYQETCHKSLDKASNETSDMKELIKAAFNATAEELIKQIHNTTLYDELAKDNMTKQAMNI  130

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C  +L+ ++  + +S +    +D N + EYA DLKVWL+G ++ Q+TC D FENTT   G
Sbjct  131  CNEVLDYAVDGIHRSIDTMDKYDFNKLSEYAYDLKVWLTGTLSHQQTCLDGFENTTTKAG  190

Query  545  EKM  553
            E M
Sbjct  191  EIM  193



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   142 bits (358),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 83/178 (47%), Positives = 107/178 (60%), Gaps = 4/178 (2%)
 Frame = +2

Query  32   GDKNKKVAIAGVASILLVACVVAATISVTNMGGSS----EVTTSTKEVEAICAPTDYKET  199
            G   KK AI G+AS++LVA VVA T+   N    +     V+ S K ++ IC PTDYKET
Sbjct  3    GQAKKKFAILGIASLVLVAMVVAVTLGTQNSDTDNYNHQAVSDSQKAIQTICEPTDYKET  62

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C  +L   A  + DPKELI+ AF  T   I+ A   S +L+E  KDPR   AL+ CK L 
Sbjct  63   CIKTLQAEAGNSTDPKELIQAAFKATTNYINEAAKNSTVLQELQKDPRTKLALENCKELA  122

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + ++ DLE+S      FD +NI +   D+KVWLSGA+T Q+TC D FE   GD GEKM
Sbjct  123  HQAVEDLERSFAKFQTFDFSNIDDMLADIKVWLSGALTYQQTCLDGFEGAEGDAGEKM  180



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = +2

Query  134  SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA  313
            +E++TS K ++  C PTDY+ TC++SLS  A  T DPKEL+  AF VT+ ++  A + S 
Sbjct  37   TELSTSNKNIKDFCRPTDYQATCESSLSAVAGNTTDPKELVNLAFQVTIDHMKEAFNHST  96

Query  314  LLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAIT  493
            +L EAAKD R SDAL+ C+ LL+ +I DL+ S +    F +  + ++ +DLKVW+S +IT
Sbjct  97   VLSEAAKDSRTSDALENCRELLDYAIYDLKSSIDRLDGFSLTKLDKFLDDLKVWISASIT  156

Query  494  QQETCRDAFENTTGDTGEKM  553
             QETC D FENTT D  E M
Sbjct  157  YQETCLDGFENTTTDAAESM  176



>ref|XP_010489679.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=353

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = +2

Query  92   VVAATISVT-NMGG-----SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKEL  253
            VVA T+ V+ N GG     + E+T+S K V+ +CAPTDYK+TC+ +L      T+DP EL
Sbjct  2    VVAVTVGVSLNKGGDDSDGNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIEL  61

Query  254  IKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFD  433
            +KTAF  TMK I+ A  +S  + E  KDPR   ALD CK L++ ++G+L  S E  G F+
Sbjct  62   VKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFE  121

Query  434  VNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             + + E   ++++WLS AI+ +ETC + F++T G+ GE M
Sbjct  122  FHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGETM  161



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + ++     ++S+LL++ VVA TI V+      +     E+T S K V+ +CAPTDY
Sbjct  8    DSKRKRRFVAITISSVLLISMVVAVTIGVSLNKNDADSEDKGEITASVKAVKDVCAPTDY  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            ++TC+ +L      T DP EL+KTAF  TMK I+    +S  + E  KDPR   ALD C 
Sbjct  68   RKTCEDTLIQNGQNTTDPMELVKTAFSATMKQITDVAKKSQTMMELQKDPRTRMALDQCT  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L++ ++G+L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE 
Sbjct  128  ELMDYALGELSSSFEELGKFEFHKLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGET  187

Query  551  M  553
            M
Sbjct  188  M  188



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = +2

Query  161  VEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDP  340
            +EAIC PT YKETC++SL   A  T DPKEL+K  F V    ++  I  S  LK+ AKDP
Sbjct  51   IEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKDP  110

Query  341  RASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
             AS ALD+CK +LN ++ DL  + +  G F+++ + +Y  DLKVWLS A+  Q TC DAF
Sbjct  111  MASQALDVCKEMLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATCVDAF  170

Query  521  ENTTGDTGEKM  553
            ++T G+ G+KM
Sbjct  171  KDTKGEAGDKM  181



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 107/187 (57%), Gaps = 19/187 (10%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISV------------TNMGGSSEVTTSTKEVEAICAPTD  187
            +++AI  V+   LV+ VVA T+                 G S++ + STK ++AIC PTD
Sbjct  13   RRIAIIAVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSTDKSASTKAIKAICQPTD  72

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            YK+ C +SL+ AA  T DP +LIK  F   MK I  A  +S LL++  KD R S ALD C
Sbjct  73   YKQECLSSLTSAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQKLEKDHRTSMALDTC  132

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYAN---DLKVWLSGAITQQETCRDAFENTTG-  535
            K L+  ++ +L +S    G  D  N  +Y     DLKVWLS +IT QE+C DAFENTT  
Sbjct  133  KELMELAVDELNQSFNRLG--DTENFYKYKTFIMDLKVWLSASITYQESCLDAFENTTSS  190

Query  536  -DTGEKM  553
             D GE+M
Sbjct  191  NDAGEEM  197



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +2

Query  134  SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA  313
            +E+TT++K + AIC PTDY E C++SL+  A    DPK+L++ +F   M ++  A + S+
Sbjct  56   AELTTTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAFNHSS  115

Query  314  LLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAIT  493
            +L+EAAKDPR S+AL+ CK LL+ +I DL+ S    G  D+  + +  +DLKVWLS  IT
Sbjct  116  VLQEAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDVVDDLKVWLSATIT  175

Query  494  QQETCRDAFENTTGDTGEKM  553
             Q+TC D F+NTTGD  + M
Sbjct  176  YQQTCLDGFDNTTGDAADNM  195



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDYKET  199
            + ++  +  ++S+LL++ VVA T+ V+      +  G +EV  S K V+ +CAPTDY++T
Sbjct  11   RKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRKT  70

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ +L      T DP EL+KTAF+VTMK I+ A  +S  + E  KD R   ALD CK L+
Sbjct  71   CEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKELM  130

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + ++ +L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE M
Sbjct  131  DYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETM  188



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDYKET  199
            + ++  +  ++S+LL++ VVA T+ V+      +  G +EV  S K V+ +CAPTDY++T
Sbjct  11   RKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRKT  70

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C+ +L      T DP EL+KTAF+VTMK I+ A  +S  + E  KD R   ALD CK L+
Sbjct  71   CEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKELM  130

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + ++ +L  S E  G F+ + + E   +L++WLS AI+ +ETC + F+ T G+ GE M
Sbjct  131  DYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETM  188



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 110/183 (60%), Gaps = 15/183 (8%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVTNMGGS--------SEVTTSTKEVEAICAPT  184
            D  K KK+AI  V S++LVA VVA  I     GG+         +V++S K + +IC  T
Sbjct  2    DQRKKKKIAIVSVCSLILVAMVVALVI-----GGTENEEEDTVPDVSSSQKAISSICETT  56

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            DY++TC  SL+G    + +PK+LI+ AF   +  I+ A   S+ L+    DP A  AL +
Sbjct  57   DYQQTCMNSLAGH--NSTNPKDLIEVAFQAAVNYINQAAENSSTLQHLETDPMAKSALQV  114

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ L N +I DL++S     +FD+ N+ +   DLK+WLSGAIT QETC D FE+  G++G
Sbjct  115  CQDLANRAINDLQRSFAKFSNFDIINVDDILLDLKIWLSGAITHQETCLDGFEDVPGESG  174

Query  545  EKM  553
            +KM
Sbjct  175  QKM  177



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   137 bits (345),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 73/190 (38%), Positives = 118/190 (62%), Gaps = 13/190 (7%)
 Frame = +2

Query  23   MGDGDKNK-KVAIAGVASILLVACV--VAATISVTNMGGSSE----------VTTSTKEV  163
            M + ++NK K  I GV+++  +A V  V   I++ + G + +          V ++ K V
Sbjct  1    MSERNENKGKRIIIGVSALFFMAIVGVVIFGINLIDNGSNGDKENIDNKKNHVASTVKAV  60

Query  164  EAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPR  343
            +++C PT+Y++ C+ SL   A  T DP+EL+K AF++T+  I   +  + LL +  K+PR
Sbjct  61   QSLCHPTNYEKECEESLIAGAGNTTDPRELVKIAFNITITKIGDKLKETNLLHDVEKEPR  120

Query  344  ASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            A  ALD CK L++ SIG+L +S +   +F++ NI +   ++KVWLSGAIT Q+TC D F+
Sbjct  121  AKMALDTCKQLMDLSIGELSRSIDGISEFELINIEKILMNIKVWLSGAITYQDTCLDGFD  180

Query  524  NTTGDTGEKM  553
            NTT + G+KM
Sbjct  181  NTTSEAGQKM  190



>gb|KHN04169.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=494

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = +2

Query  92   VVAATISVT-NMGGSS---------EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTND  241
            VVA TI V  N  GS+          V +S K V+ +C PT+Y++ C+ SL   A  T D
Sbjct  2    VVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTD  61

Query  242  PKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAA  421
            PKELIK  F++T+  I   +  + +L E  ++PRA  ALD CK L++ SIG+L +S +  
Sbjct  62   PKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  121

Query  422  GDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT D G+KM
Sbjct  122  NEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKKM  165



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=559

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTNMGGSSE---VTTSTKEVEAICAPTDYKETCKT  208
            K KK+AI GV++I+LVA VVA  + VT   G  E     TS+K +EA+C PTD+K+TCKT
Sbjct  9    KKKKIAIIGVSAIILVAMVVAVAVGVTKSKGHKEDNTPATSSKAIEAVCQPTDFKDTCKT  68

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            +L+  A    DPKELIK A  +    +   +  S  + E  KDP    AL  CK L+  S
Sbjct  69   TLAANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHEVVKDPLGDQALQNCKELIQYS  128

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            I D++K+    G FDV+ +  Y  +L+ WLS +++ ++TC D F +  GD G+KM
Sbjct  129  INDIKKAFGNMGPFDVSKVKNYVKELENWLSASVSYEQTCLDGFNSVKGDAGDKM  183



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 114/182 (63%), Gaps = 12/182 (7%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTNMGGSSE----------VTTSTKEVEAICAPTD  187
            K ++VA+ GV S++L+A VVA T+ +   G +            + TS+K V +IC   +
Sbjct  13   KKERVAVLGVFSVMLLAMVVAVTVGIKGTGHTDTSYEEEEDDDGLATSSKAVRSICQMVE  72

Query  188  YKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLC  367
            Y+  C+ +L  A A T +PK+L++T F+  M+ +  A++ S+ +K A  D R + AL+ C
Sbjct  73   YQRACERTL--AHAHTTNPKKLVQTTFNAAMEKLEGALTNSSTIKAAKDDRRNAGALETC  130

Query  368  KTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGE  547
            K ++  +I DL++S +    FD++   E+  ++++WLSGA+T QETC +AF+NTTGD GE
Sbjct  131  KQVVEYAITDLKRSIDQMDHFDMHKKEEHVENMRIWLSGAMTSQETCIEAFQNTTGDAGE  190

Query  548  KM  553
            KM
Sbjct  191  KM  192



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   135 bits (341),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = +2

Query  92   VVAATISVT-NMGGSS---------EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTND  241
            VVA TI V  N  GS+          V +S K V+ +C PT+Y++ C+ SL   A  T D
Sbjct  2    VVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTD  61

Query  242  PKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAA  421
            PKEL+K  F++T+  I   +  + +L E  ++PRA  ALD CK L++ SIG+L +S +  
Sbjct  62   PKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  121

Query  422  GDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             +F++ N+ +   +LKVWLSGA+T Q+TC D FENTT D G+KM
Sbjct  122  NEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKKM  165



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 108/168 (64%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVA-ATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            DGDK KK  IAGV S LLV  VV+ A I+  N    +E+  +TK V+ +CAPTDYKETC 
Sbjct  4    DGDKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNENEIRQNTKAVKTVCAPTDYKETCL  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+ K+ +P  LIK +F+VT+K+I   + +++  +  +A K P A DA +LC+ ++
Sbjct  64   KSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            N++I DL+K  +      V+ I  +  DL+VW+SG+I  Q+TC D FE
Sbjct  124  NDAIADLKKCVDH--KVSVDEIERFIKDLRVWISGSIAFQQTCIDTFE  169



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 108/168 (64%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVA-ATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            DGDK KK  IAGV S LLV  VV+ A I+  N    +E+  +TK V+ +CAPTDYKETC 
Sbjct  4    DGDKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNENEIRQNTKAVKTVCAPTDYKETCL  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+ K+ +P  LIK +F+VT+K+I   + +++  +  +A K P A DA +LC+ ++
Sbjct  64   KSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            N++I DL+K  +      V+ I  +  DL+VW+SG+I  Q+TC D FE
Sbjct  124  NDAIADLKKCVDH--KVSVDEIERFIKDLRVWISGSIAFQQTCIDTFE  169



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 100/176 (57%), Gaps = 16/176 (9%)
 Frame = +2

Query  74   ILLVACVVAATISVTNMGG--------------SSEVTTSTKEVEAICAPTDYKETCKTS  211
            +LLVA VVA TIS+                    + V ++ K V+ IC PT YK+ C  S
Sbjct  2    LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  212  L--SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
            L     A    DPKELIK AF+VT+  I   +  + +  E  KD R+ DALD CK L++ 
Sbjct  62   LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            SIG+  +S +   +FD+ ++ +   +LKVWL+GA+T  +TC D FENTTGD  +KM
Sbjct  122  SIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDGFENTTGDASKKM  177



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 100/176 (57%), Gaps = 16/176 (9%)
 Frame = +2

Query  74   ILLVACVVAATISVTNMGG--------------SSEVTTSTKEVEAICAPTDYKETCKTS  211
            +LLVA VVA TIS+                    + V ++ K V+ IC PT YK+ C  S
Sbjct  2    LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  212  L--SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
            L     A    DPKELIK AF+VT+  I   +  + +  E  KD R+ DALD CK L++ 
Sbjct  62   LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            SIG+  +S +   +FD+ ++ +   +LKVWL+GA+T  +TC D FENTTGD  +KM
Sbjct  122  SIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDGFENTTGDASKKM  177



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 3/180 (2%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE---VTTSTKEVEAICAPTDYK  193
            M   ++ +   I GV S++LVA VVA  +++      +E   VT++ K +E+IC  T Y+
Sbjct  1    MAGNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAQDVTSTKKAIESICQTTQYQ  60

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
             TC  SL      ++DPKELI+ +F VT+K I  AI  S  +++  KDPRA  AL+ C+ 
Sbjct  61   TTCVESLESTGECSSDPKELIQKSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCEK  120

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L   ++ DL ++      F+ N++  +  DLK+WLSGAIT QE+C D FE+TTG+ GEKM
Sbjct  121  LALQAVNDLNRTHLKFESFEFNDLSHWIADLKIWLSGAITYQESCLDGFEDTTGEAGEKM  180



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 107/194 (55%), Gaps = 22/194 (11%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------------NMGGSSEVTTSTKEVEAI  172
            D    K+V I  V++ LLVA VVA T+               N G S +   S K ++AI
Sbjct  8    DRRSRKRVVIISVSAFLLVAMVVAVTVGFAMEKSFYNSPYSGNKGRSHDKPASMKAIKAI  67

Query  173  CAPTDYKETCKTSLSGAAAKTN-DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            C PTDYK+ C  SLS A+  T  DP +LI   F V MK +  A  +S  L++  KDPR S
Sbjct  68   CQPTDYKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLRKLEKDPRTS  127

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDFD----VNNILEYANDLKVWLSGAITQQETCRDA  517
            +ALD C+ L+  ++G+L +S    G  D     N++L    DLKVWLS  IT QE+C DA
Sbjct  128  NALDTCEELMELALGELRQSLVRLGFIDDLTKFNDMLM---DLKVWLSATITYQESCLDA  184

Query  518  FENTTG--DTGEKM  553
            FENTT   D  E+M
Sbjct  185  FENTTSSTDAAEEM  198



>gb|EMS65303.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=360

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 84/139 (60%), Gaps = 0/139 (0%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E+TTS K V+A C P DYKETC+T L+        P EL K  F VT + I  AIS SA 
Sbjct  74   ELTTSVKSVKAFCQPMDYKETCETELTKVGGNATSPTELAKAIFEVTSEKIRKAISESAT  133

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L+E   DPR S AL+ CK LL  +I DL+ + +  G F++ +  + A DLK WLS A+T 
Sbjct  134  LEELKSDPRTSGALENCKELLEYAIEDLKTTFDRLGGFEMTDFNKAAADLKTWLSAALTY  193

Query  497  QETCRDAFENTTGDTGEKM  553
            QETC D F NTT D   KM
Sbjct  194  QETCLDGFANTTTDAAAKM  212



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 107/179 (60%), Gaps = 10/179 (6%)
 Frame = +2

Query  47   KVAIAGVASILLVACVVAATIS---VTNMGGSSEVTTSTKE---VEAICAPTDYKETCKT  208
            KVA+A V+S+LLVA VVA   +       GG  +V  S K    ++ +C+ TDYK+ C  
Sbjct  1    KVAVAAVSSLLLVAMVVALMYNGRGDDAGGGGVDVAASQKAMVTIDTLCSSTDYKKACVD  60

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            +L  +   T+DPKEL++ AF  TM  I+ A   S++L+E  +DPR  +A+D C  L   +
Sbjct  61   TLRDSGNSTSDPKELMEIAFRATMDRIAAAGRNSSVLREVQRDPRGREAVDACAELAERA  120

Query  389  IGDL----EKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + DL    EK  +   +FD+ N  E   DLK+WLSGA+T QETC D FE  +GD G++M
Sbjct  121  VADLNRTFEKFSKEFSEFDLTNADEVVGDLKIWLSGAVTYQETCLDGFEGVSGDAGDRM  179



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 3/180 (2%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE---VTTSTKEVEAICAPTDYK  193
            M   ++ +   I GV S++LVA VVA  +++      +E   VT++ K +E+IC  T Y+
Sbjct  1    MAGNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAKDVTSTKKAIESICQTTQYQ  60

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
             TC  SL      ++DPK+LI+ +F VT+K I  AI  S  +++  KDPRA  AL+ C+ 
Sbjct  61   TTCVESLEATGECSSDPKDLIQMSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCEM  120

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L   ++ DL ++      F+ N++  +  DLK+WLSGAIT QETC D FE+TTG+ GEKM
Sbjct  121  LALQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEDTTGEAGEKM  180



>gb|KEH37214.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=376

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 104/173 (60%), Gaps = 5/173 (3%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVT---NMGGSSEVTTSTKEVEAICAPTDYKETCKTSL  214
            KK A+ GV+ ILLVA V A  +S+T   +   +++++ S K V+ +C  T+YKETC  SL
Sbjct  14   KKYALLGVSCILLVAMVGAVAVSLTKGDDKEQTAQISNSQKNVDMLCQSTEYKETCHKSL  73

Query  215  SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIG  394
              A+  + D KELIK AF  T + +   I+ SAL +E  KD     A+++C  +L+ ++ 
Sbjct  74   ENAS--STDTKELIKAAFSATAEELRKHINNSALYQELGKDSMTKQAMEICNEVLDYAVD  131

Query  395  DLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             + KS      FD + + EYA D+KVWL+G ++ Q+TC D F NTT   GE M
Sbjct  132  GIHKSVGTLDQFDFHKLSEYAFDIKVWLTGTLSHQQTCLDGFVNTTTKAGETM  184



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 10/187 (5%)
 Frame = +2

Query  23   MG-DGD-KNKKVAIAGVASILLVACVVAATISVTNMGGSSE------VTTSTKEVEAICA  178
            MG DG+ K KK  IAGV + LLV  VVA  I+ +     SE      + T+T  VEA+CA
Sbjct  1    MGVDGELKKKKCIIAGVITALLVLMVVAVGITTSRNTSHSEKIVPVQIKTATTAVEAVCA  60

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASD  352
            PTDYKETC  SL  A+  +  P +LIK  F+VT+++I  +I +++  L  +AA D     
Sbjct  61   PTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIEDSIKKASVELTAKAANDKDTKG  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL+LC+ L+N++  DL+K  +    F +  I ++  DL+VWLSG+I  Q+TC D FE T 
Sbjct  121  ALELCEKLMNDATDDLKKCLDNFDGFSIPQIEDFVEDLRVWLSGSIAYQQTCMDTFEETN  180

Query  533  GDTGEKM  553
                + M
Sbjct  181  SKLSQDM  187



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 7/175 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMG-----GSSEVTTSTKEVEAICAPTDYKETCKT  208
            KK AI GV+SILL+A V A  + V + G     G +++T S K V+ +C  T+YK+TC+ 
Sbjct  15   KKFAILGVSSILLIAMVAAVAVGVNDAGQVESEGDNQITKSQKNVKVLCGTTEYKQTCEK  74

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL+    K  D KELIK AF+ T + +   I  S L KE A +     A+D+CK +L  +
Sbjct  75   SLAKTGNK--DMKELIKQAFNATAEELVKQIHNSTLYKELATNDMTKQAMDICKEVLGYA  132

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + D+ +S  +   FD+N I E A DLKVWLSG +  Q+TC D FENTT   G+ M
Sbjct  133  VDDVHQSIHSLDKFDLNKIDEIAYDLKVWLSGTLANQQTCLDGFENTTTHAGQTM  187



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 10/187 (5%)
 Frame = +2

Query  23   MG-DGD-KNKKVAIAGVASILLVACVVAATISVT-NMGGSS-----EVTTSTKEVEAICA  178
            MG DG+ K KK  IAG+ + LLV  V+A  I ++ N  GS      ++ T+TK V+ +CA
Sbjct  1    MGIDGELKKKKCIIAGIITALLVVMVIAVAIIMSRNTIGSETIAGVQIKTTTKAVQEVCA  60

Query  179  PTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASD  352
            PTDYKETC  SL  A+  +  P ELIK  F++T+++I  +I +++  L  +AAKD    D
Sbjct  61   PTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSIKKASEELKAKAAKDNETKD  120

Query  353  ALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTT  532
            AL+LC++L+ ++  DL+K  +    F + +I +   DL+VWLSG+I  Q+TC D F+   
Sbjct  121  ALELCESLMTDATDDLKKCLDNFDGFSITHIEDLVEDLRVWLSGSIAYQQTCMDTFDEIN  180

Query  533  GDTGEKM  553
             +  + M
Sbjct  181  SNLSQDM  187



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 96/156 (62%), Gaps = 2/156 (1%)
 Frame = +2

Query  92   VVAATISVTNM--GGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTA  265
            +++  ++V N   G   E+T S K ++ +CAPTDYK+TC+ +L   A  T+DP EL++  
Sbjct  18   MISIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAG  77

Query  266  FHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNI  445
            F+VTMK I++   +S  + E  KDPR   ALD CK L++ +IG+L  S    G F+ + +
Sbjct  78   FNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFHKV  137

Query  446  LEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             E    +KVWLS  I+ Q+TC D F+ T GD GE +
Sbjct  138  DEVLIKVKVWLSATISHQQTCIDGFKGTKGDAGETI  173



>gb|EPS58111.1| pectinesterase [Genlisea aurea]
Length=374

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +2

Query  161  VEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDP  340
            V A+C+ T Y+ETC+TSLS     T DPKEL+K A  V ++ +   ++ S LL+ AA+D 
Sbjct  63   VRAVCSSTSYRETCETSLS--QVNTTDPKELLKYAMEVALRGVGDLLANSTLLRRAAEDA  120

Query  341  RASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
               DAL +C+ + + ++ ++ +S E  G+ +++ + EYA D++ WLS  +T QETC DAF
Sbjct  121  ATRDALYVCEDVFDLAVDEMRRSLEKVGELELSKMSEYAGDVRTWLSAVVTNQETCIDAF  180

Query  521  ENTTGDTGEKM  553
            +NTTGD G+KM
Sbjct  181  QNTTGDVGKKM  191



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 113/186 (61%), Gaps = 12/186 (6%)
 Frame = +2

Query  29   DG-DKNKKVAIAGVASILLVACVVAATISVTNMGGS--------SEVTTSTKE-VEAICA  178
            DG ++ ++ A+ G++SILLVA V A  +++ N GG+        S V T+ +  VE IC 
Sbjct  5    DGKEQKRRFAVLGISSILLVAMVAAVAVTI-NRGGNKGEEGDDESRVQTAQRNNVEMICN  63

Query  179  PTDYKETCKTSLSGAAAKTN-DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDA  355
             T+YKETCK SL  A++  N D KELIK AF+ +   + + I  S L KE AKD     A
Sbjct  64   STEYKETCKKSLEKASSDENADTKELIKAAFNASAVELLNHIKNSTLYKELAKDNMTRQA  123

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            +D+CK + + +I  ++KS E    F+   + EY  DLKVWL+G+++ Q+TC D FENT  
Sbjct  124  MDICKEVFDYAIDGVQKSIETLDKFEFIKLSEYVYDLKVWLTGSLSHQQTCLDGFENTNT  183

Query  536  DTGEKM  553
              GEKM
Sbjct  184  KAGEKM  189



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 108/181 (60%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVA-ATISVTNMGGSS------EVTTSTKEVEAICAPTDYKE  196
            K KK  IAGV + LLV  VVA A I+  N   +S      ++ T+T  VEA+CAPTDYKE
Sbjct  8    KKKKCIIAGVITALLVIMVVAVAIITSRNTSHNSDKIAPVQIKTTTNAVEAVCAPTDYKE  67

Query  197  TCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR-SALLK-EAAKDPRASDALDLCK  370
            TC  SL  A+  +  P +LIK  F+VT+++I   I + SA LK +AA D     AL+LC+
Sbjct  68   TCVNSLMKASPDSTQPLDLIKLGFNVTIRSIKDGIKKASAELKAKAANDNETKGALELCE  127

Query  371  TLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEK  550
             L+N++  DL+K  +    F +  I ++  DL+VWLSG+I  Q+TC D FE    +  + 
Sbjct  128  KLMNDATDDLKKCLDNFDGFSITQIEDFVEDLRVWLSGSIAYQQTCMDTFEEIKSNLSQD  187

Query  551  M  553
            M
Sbjct  188  M  188



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 104/176 (59%), Gaps = 10/176 (6%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            G  D++K+ A+ GV+SILLVA V  AT++    G           V+ +C  T Y++TC 
Sbjct  8    GGHDQSKRFALVGVSSILLVAMV--ATVADAQQG--------QPNVQILCESTQYQQTCH  57

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
             SL+ A A+T   K+LIK AF  T + +   I+ S+L++E  +D     A+++C  +L+ 
Sbjct  58   QSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEVLDY  117

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++  + KS  A   FD+N I EY+ DLKVWL+G ++ Q+TC D F NTT   GE M
Sbjct  118  AVDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETM  173



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 104/176 (59%), Gaps = 10/176 (6%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            G  D++K+ A+ GV+SILLVA V  AT++    G           V+ +C  T Y++TC 
Sbjct  8    GGHDQSKRFALVGVSSILLVAMV--ATVADAQQG--------QPNVQILCESTQYQQTCH  57

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
             SL+ A A+T   K+LIK AF  T + +   I+ S+L++E  +D     A+++C  +L+ 
Sbjct  58   QSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEVLDY  117

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++  + KS  A   FD+N I EY+ DLKVWL+G ++ Q+TC D F NTT   GE M
Sbjct  118  AVDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETM  173



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 104/184 (57%), Gaps = 12/184 (7%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVTNMGG-----------SSEVTTSTKEVEAICAP  181
            +KNK VA+  ++ ++L+A +VA  ++V+++             S    TS K ++ +C P
Sbjct  2    EKNK-VALVSLSFVILLAGLVAVAVTVSHLNSNASSINNPPTESPRPNTSIKAIQTVCQP  60

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALD  361
            TDYK+ C+ +LS  +  T D  EL+  AF  +MK ++    RS LLKE +KDP +++AL 
Sbjct  61   TDYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLKEVSKDPASTEALQ  120

Query  362  LCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             C+ LL  ++ DL+KS    G+   N   +   DLKVWLS AIT Q+TC D FE      
Sbjct  121  TCRELLEYAMDDLKKSIVQLGNVHKNLYEQAVEDLKVWLSAAITYQDTCVDGFEGINTSA  180

Query  542  GEKM  553
             E M
Sbjct  181  AETM  184



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 72/176 (41%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVTNMGGSSEV---TTSTKEVEAICAPTDYKETCK  205
            +  KK+ I  V S LLVA VVA  I+V       EV   ++S K + ++C  TDY+E C 
Sbjct  3    ESKKKITIVAVCSCLLVAMVVA-LIAVGLQDEDKEVQDVSSSKKAITSLCETTDYQEACV  61

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNN  385
             SL+ +   + +PK+LI   F   +  I  A   S +L E   DPRA  AL+ C+ L + 
Sbjct  62   ESLNASGTNSTNPKDLIDAIFQSAIDYIKEASKNSTVLLELQTDPRAKAALENCQELADR  121

Query  386  SIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            ++ DLE+S ++  +FD+ N+ +   +LK+WLSGAIT QETC D FE   G+ GEKM
Sbjct  122  AVHDLERSFQSFNNFDITNMDDLLLELKIWLSGAITHQETCLDGFEGVPGEAGEKM  177



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 9/186 (5%)
 Frame = +2

Query  23   MGDGD-KNKKVAIAGVASILLVACVVAATISVTN------MGGSSEVTTSTKEVEAICAP  181
            MG GD K KK  IAG  S LLV  VV+  ++ +         G S++ T+TK V+A+C P
Sbjct  1    MGLGDDKKKKCMIAGGISALLVVMVVSVAVATSKNTSGPIKHGDSQIKTTTKAVQAVCEP  60

Query  182  TDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDA  355
            TDYKETC  SL  A+  +  P +LI+  F++T+ +I   I ++A  L   A KDP    A
Sbjct  61   TDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKKAAHELKARAEKDPETKGA  120

Query  356  LDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTG  535
            LDLC+ L+ ++I DL+K  +    F++N   E+  DL+VWLSG+I  Q+TC D FE    
Sbjct  121  LDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVEDLRVWLSGSIAFQQTCMDTFEEIKS  180

Query  536  DTGEKM  553
            D  ++M
Sbjct  181  DLAQEM  186



>ref|XP_009134931.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=577

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            D DK +K  +AG V+++LL+  V  A I+  N    +++  +TK V+A+CAPTDYKE C 
Sbjct  4    DEDKKQKCLVAGSVSAVLLIMVVSVAVITSKNSPNENQIRQATKAVKAVCAPTDYKEICL  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL--LKEAAKDPRASDALDLCKTLL  379
             S+  A+  + +P ELIK A +VT+++I+  + ++++    +  +DP A DA +LC+ L+
Sbjct  64   KSIMDASPNSTEPLELIKLAINVTIESINQGLKKASIDVKPKTDEDPEAKDAFELCEKLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             ++I DL+K C   G F    I+ +  DL+VWLSGAI  Q+TC D+F+    +T
Sbjct  124  FDAIDDLKK-CLNRG-FSAAQIVGFVEDLRVWLSGAIAFQQTCIDSFKEIKSNT  175



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 110/185 (59%), Gaps = 9/185 (5%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTN------MGGSSEVTTSTKEVEAICAPT  184
            +GD DK KK  IAG  S LLV  VV+  ++ +         G S++ T+TK V+A+C PT
Sbjct  3    LGD-DKKKKCMIAGGISALLVVMVVSVAVATSKNTSGPIKHGDSQIKTTTKAVQAVCEPT  61

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDAL  358
            DYKETC  SL  A+  +  P +LI+  F++T+ +I   I ++A  L   A KDP    AL
Sbjct  62   DYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKKAAHELKARAEKDPETKGAL  121

Query  359  DLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGD  538
            DLC+ L+ ++I DL+K  +    F++N   E+  DL+VWLSG+I  Q+TC D FE    D
Sbjct  122  DLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVEDLRVWLSGSIAFQQTCMDTFEEIKSD  181

Query  539  TGEKM  553
              ++M
Sbjct  182  LAQEM  186



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   125 bits (313),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 0/141 (0%)
 Frame = +2

Query  131  SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRS  310
            + +  TS K ++A+C PTDYK+ C+ +LS  +  T+DP EL+  AF+ +MK ++ A  +S
Sbjct  42   TGQPNTSIKAIKAVCEPTDYKDACEKTLSSMSHNTSDPMELVNVAFNASMKYVTDAFDKS  101

Query  311  ALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
             LLK+ +KDP +++AL  C  LL  +  DL+KS E  G    N   +   DLKVWLS AI
Sbjct  102  ELLKDVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQTNRYEQAVEDLKVWLSAAI  161

Query  491  TQQETCRDAFENTTGDTGEKM  553
            T Q+TC D FE       E M
Sbjct  162  TYQDTCVDGFEGINTSAAEAM  182



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 110/168 (65%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            D DK KK  IAG V+S+L++  V  A ++  N    +E+  +TK V+A+CAPTD+KETC 
Sbjct  4    DDDKKKKCIIAGSVSSLLVIMVVSVAVVTSKNSPNENEIRKNTKAVKAVCAPTDFKETCV  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+ K+ +P +LIK  F+VT+K+I+ A+ +++  +  +A K P A  A +LC+ L+
Sbjct  64   NSLMNASPKSTEPLDLIKLGFNVTIKSINEALQKASRDVKAKADKAPEAKGAFELCEKLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
             ++I DL+K C   G F V  I  +  DL+VWLSG+I  QETC D+FE
Sbjct  124  TDAIDDLQK-CVDHG-FSVAKIDGFVEDLRVWLSGSIAFQETCMDSFE  169



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS---EVTTSTKEVEAICAPTDY  190
            MG DGDK KK  IAG  S LLV  VV+  +  +     +   ++  +TK V+A+CAPTD+
Sbjct  1    MGFDGDKKKKCIIAGSVSGLLVIMVVSVAVVTSRHSPKADENQIKKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC  SL  A+ K+ +P +LIK +F VT+K+I+  + +++  +  +A+KDP A  A +L
Sbjct  61   KETCVNSLMNASPKSTEPMDLIKLSFDVTIKSINEGLKKASGDVKAKASKDPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ ++ ++I DL+K C   G F V+ I  +  DL+VWLSG+I  Q+TC D+FE    +  
Sbjct  121  CEKVMVDAIEDLKK-CMDHG-FSVDKIDAFVEDLRVWLSGSIAFQQTCMDSFEEIKSNLM  178

Query  545  EKM  553
            ++M
Sbjct  179  QEM  181



>emb|CDY08032.1| BnaC03g34910D [Brassica napus]
Length=375

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            D DK +K  +AG V+++L++     A I+  N    +++  +TK V+A+CAPTDYK+ C 
Sbjct  4    DEDKKQKCLVAGSVSAVLVIMVASVAVITSKNSPNDNQIRQTTKAVKAVCAPTDYKDICL  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL--LKEAAKDPRASDALDLCKTLL  379
             S+  A+  + +P ELIK A +VT+++I+  + ++++    +  +DP A DA +LC+ L+
Sbjct  64   KSIMDASPNSTEPLELIKLAINVTIESINQGLKKASIDVKPKTDEDPEAKDAFELCEKLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             ++I DL+K C   G F    I+ +  DL+VWLSGAI  Q+TC D+F+    +T
Sbjct  124  FDAIDDLKK-CVNRG-FSATQIVGFVEDLRVWLSGAIAFQQTCIDSFKEIKSNT  175



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E++TS K +++ C P DY+ETC+ +L  AA     P +L K  F VT   I  A+  SA+
Sbjct  38   EMSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESAV  97

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L E   DPR   ALD C+ LL+ +I DL+ + +  G F++ N     +DL+ WLS A+T 
Sbjct  98   LNELKNDPRTKGALDNCRELLDYAIDDLKTTFDRLGGFEMTNFKSAVDDLRTWLSSALTY  157

Query  497  QETCRDAFENTTGDTGEKM  553
            QETC D FENTT     KM
Sbjct  158  QETCLDGFENTTTAAAGKM  176



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS-----EVTTSTKEVEAICAPTDY  190
            G  DK K +   GV+++L+V  V  A ++  N  G +     ++ T+TK V+A+CA TDY
Sbjct  4    GSDDKKKCIIAGGVSALLIVMVVSVAVVTSKNADGPNKLADIQIKTTTKAVKAVCAITDY  63

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC  S   A+  +  P +LI+  F +T+K+I   I ++A  L ++AAKDP A  ALDL
Sbjct  64   KETCINSFMSASPNSTQPLDLIRLGFDLTIKSIHEGIKKAADELKEKAAKDPEAKRALDL  123

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C  L+ +S  DL K  +    F+++ I E+  DL+VWLSG++  Q+TC D F+    D  
Sbjct  124  CHELMIDSTDDLSKCFDKFDGFNLSEIEEFVEDLRVWLSGSMAFQQTCIDTFDEVKSDLA  183

Query  545  EKM  553
            + M
Sbjct  184  QDM  186



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 8/183 (4%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS---EVTTSTKEVEAICAPTDY  190
            MG DGDK KK  IAG  S LLV  VV+  +  +     +   ++  +TK V+A+CAPTD+
Sbjct  1    MGFDGDKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKADENQIKKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC  SL  A+ K+ +P +LIK  F VT+K+I+  + +++  +  +A+KDP A  A +L
Sbjct  61   KETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKAKASKDPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ ++ ++I DL+K C   G F V+ I  +  DL VWLSG+I  Q+TC D+FE    D  
Sbjct  121  CEKVMVDAIEDLKK-CMDHG-FSVDKIDSFVEDLLVWLSGSIAFQQTCMDSFEEIKSDLM  178

Query  545  EKM  553
            ++M
Sbjct  179  QEM  181



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 110/173 (64%), Gaps = 8/173 (5%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE---VTTSTKEVEAICAPTDY  190
            MG DGDK KK  IAG  S LLV  VV+  +  +     +E   +  +TK V+A+CAPTD+
Sbjct  1    MGFDGDKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKAEENQIKKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC  SL  A+ K+ +P +LIK  F VT+K+I+  + +++  +  +A KDP A  A +L
Sbjct  61   KETCVNSLMSASPKSAEPLDLIKLGFDVTIKSINEGLKKASGDIKAKAGKDPDAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            C+ L+ ++I DL+K C   G F V+ +  +  DL+VWLSG+I  Q+TC D+FE
Sbjct  121  CEKLMVDAIEDLKK-CMDHG-FSVDRVEVFVEDLRVWLSGSIAFQQTCMDSFE  171



>emb|CDX74078.1| BnaA03g29690D [Brassica napus]
Length=577

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            D DK ++  +AG V+++LL+  V  A I+  N    +++  +TK V+A+CAPTDYK+ C 
Sbjct  4    DEDKKQRCLVAGSVSAVLLIMVVSVAVITSKNSPNENQIRQTTKAVKAVCAPTDYKDICL  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL--LKEAAKDPRASDALDLCKTLL  379
             S+  A+  + +P ELIK A +VT+++I+  + ++++    +  +DP A DA +LC+ L+
Sbjct  64   KSIMDASPNSTEPLELIKLAINVTIESINQGLKKASIDVKPKTDEDPEAKDAFELCEKLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDT  541
             ++I DL+K C   G F    I+ +  DL+VWLSGAI  Q+TC D+F+    +T
Sbjct  124  FDAIDDLKK-CLNRG-FSAAQIVGFVEDLRVWLSGAIAFQQTCIDSFKEIKSNT  175



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 114/183 (62%), Gaps = 8/183 (4%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGSS---EVTTSTKEVEAICAPTDY  190
            MG DGDK KK  IAG  S LLV  VV+  +  +     +   ++  +TK V+A+C PTD+
Sbjct  1    MGFDGDKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKADENQIKKTTKAVQAVCEPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC  SL  A+ K+ +P +LIK  F VT+K+I+  + +++  +  +A+KDP A  A +L
Sbjct  61   KETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKAKASKDPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ ++ ++I DL+K C   G F V+ I  +  DL+VWLSG+I  Q+TC D+FE    D  
Sbjct  121  CEKVMVDAIEDLKK-CMDHG-FSVDKIDAFVEDLRVWLSGSIAFQQTCMDSFEEIKSDLM  178

Query  545  EKM  553
            ++M
Sbjct  179  QEM  181



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E++TS K +++ C P DYKETC+ +L   A     P +L K  F VT   I  A   SA+
Sbjct  36   EMSTSVKSIKSFCQPVDYKETCERALEATAGNATSPTDLAKVIFKVTSDRIEKAARESAV  95

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L +   DPR S AL  CK LL+ +I DL+ + +  G F++ N     +DLK WLS A+T 
Sbjct  96   LNDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMTNFKAAVDDLKTWLSSALTY  155

Query  497  QETCRDAFENTTGDTGEKM  553
            QETC D FENTT D   KM
Sbjct  156  QETCLDGFENTTTDAAAKM  174



>gb|KHN03341.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=554

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 101/172 (59%), Gaps = 15/172 (9%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCKTSLS  217
            K +K+AI  V+S+LL              GG S +  S + V+ IC   +YKETC  SL+
Sbjct  12   KKRKLAILSVSSLLL-------------EGGDS-IVKSQRNVQVICESAEYKETCHKSLA  57

Query  218  GAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGD  397
              A++T+D KELI TAF+ T + I+  I  S L  E A D     A+D+CK +L  ++ D
Sbjct  58   -KASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMNKQAMDICKEVLGYAVDD  116

Query  398  LEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + +S     +F++N + +YA DLKVW++G +  Q+TC D FENTT + G+ M
Sbjct  117  MHQSVRKLEEFELNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTTNEAGKTM  168



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 107/180 (59%), Gaps = 7/180 (4%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVTNM-------GGSSEVTTSTKEVEAICAPTDYK  193
            +K KK A+ G++SILLVA V A  + V+         GG +++ TS K V+ IC   +YK
Sbjct  10   EKKKKYAVVGLSSILLVAMVAAVAVGVSTTDEISGESGGDNQLATSQKNVKVICDSAEYK  69

Query  194  ETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKT  373
            +TC+ SL+  +++T D K L+  AF+ T + +   I  S L  E A D     A+D+CK 
Sbjct  70   QTCEKSLANVSSETTDMKTLVIAAFNATAEELLSKIHNSTLYNELATDNMTKQAMDICKE  129

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +L  ++ D+ +S      F+++ I EYA D+K+W++G ++ Q TC D FENTT + G+ M
Sbjct  130  VLGYAVDDIHQSIHTLDRFELSKIDEYAYDIKIWIAGTLSHQRTCLDGFENTTTEAGQTM  189



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   122 bits (307),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 61/139 (44%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E++TS K +++ C P DY+ETC+ +L  AA     P EL K  F VT   I+ A+  SAL
Sbjct  38   EMSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPTELAKAIFKVTSDRIAKAVRESAL  97

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L E   D R S AL  C  LL+ +I DL  + +  G F++ N     +DL+ WLS A+T 
Sbjct  98   LNELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFEMTNFKSAVDDLRTWLSSALTY  157

Query  497  QETCRDAFENTTGDTGEKM  553
            QETC D FENTT     KM
Sbjct  158  QETCLDGFENTTTPAAGKM  176



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   122 bits (307),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 66/142 (46%), Positives = 88/142 (62%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  51   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  110

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  111  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDRQARYKMGPMINNLKTWLSST  170

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D FENTTG+ G KM
Sbjct  171  ITYQETCLDGFENTTGEAGVKM  192



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 104/191 (54%), Gaps = 16/191 (8%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------------NMGGSSEVTTSTKEVEAI  172
            D    K++ I  +++ LL+A V+A                  + G S + + S K ++ I
Sbjct  8    DRRSKKRIVIISLSAFLLMAMVMAVAAGFIMEKGFYNSPVSGSKGSSHDKSASMKAIKTI  67

Query  173  CAPTDYKETCKTSLSGAAAKTN-DPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRAS  349
            C PTDYK+ C  SLS A+  T  DP ELI+  F V MK ++ A  +S  L++  KDPR S
Sbjct  68   CQPTDYKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFLRKLEKDPRTS  127

Query  350  DALDLCKTLLNNSIGDLEKSCEAAGDF-DVNNILEYANDLKVWLSGAITQQETCRDAFEN  526
            +ALD C+ L++ ++ +L +S    G   D     E   DLKVWLS  IT QE+C DAFEN
Sbjct  128  NALDACEELMDLALSELRQSLVRLGYIDDFTKFNEMLVDLKVWLSATITYQESCLDAFEN  187

Query  527  TTG--DTGEKM  553
            TT   D  E+M
Sbjct  188  TTSSTDAAEEM  198



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   124 bits (312),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 68/177 (38%), Positives = 108/177 (61%), Gaps = 8/177 (5%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVTNMGGSSE----VTTSTKEVEAICAPTDYKETC  202
            D+ +K+ I   +S++LVA  V   ++ T  GG+ E    V+ S + + +IC  TDY++TC
Sbjct  3    DRKRKMGIIAASSVVLVAMAVILVVACT--GGNDEKPPDVSASQRAIMSICDTTDYQQTC  60

Query  203  KTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLN  382
              SL+G    ++DPK LI+ A   ++ +I  A+  S  + +A K PR   AL+ C+ L N
Sbjct  61   LDSLAGH--NSSDPKALIEVAIQSSINHIEEAVKNSTAIHDAEKTPRGRLALETCRELAN  118

Query  383  NSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             ++ DL++S     DFD+ ++ +   +LK+WLSGAITQ ETC D+FE+  GD G +M
Sbjct  119  RAVDDLDRSFGTFDDFDITSVADVPLELKIWLSGAITQLETCLDSFEDVPGDAGNRM  175



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 6/178 (3%)
 Frame = +2

Query  35   DKNKKVAIAGVASILLVACVVAATISVTNMG-----GSSEVTTSTKEVEAICAPTDYKET  199
            +K KK+A+  V+SILLVA VVAA + + +       G   +  S +  + IC   +YKET
Sbjct  10   EKKKKIAVLSVSSILLVAMVVAAAVGIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKET  69

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLL  379
            C  SL+ A+  T+D KELI TAF+ T + I++ I  S L  E A D     A D+CK +L
Sbjct  70   CHKSLAKASG-TSDLKELIITAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVL  128

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
              ++ D+ +S      FD+N + +YA DLKVW++G +  Q+TC D FENT+ + G+ M
Sbjct  129  GYAVDDIRRSVHTLEKFDLNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTSSEAGKTM  186



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = +2

Query  53   AIAGVASILLVACVVAATISVT---NMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGA  223
            AI G+ ++ L+A VVA  + VT   N     E+++S K V+A+C PT+YKETC+ SL  A
Sbjct  5    AIIGICAVFLLAMVVAVVVGVTHIKNKNDGEEISSSNKAVQALCQPTNYKETCQKSL--A  62

Query  224  AAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLE  403
            ++ ++D KELI+T F   +  I + +  S  ++E  KD     AL +C+ +L+ +I D +
Sbjct  63   SSNSSDVKELIRTGFQAGLVEIKNVLGHSVTVQELTKDENNKAALGVCQEVLDLAIDDFQ  122

Query  404  KSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            KS +  G++D++ I +Y  +LK WLSGA T Q+TC D+F  ++ ++ +KM
Sbjct  123  KSFDMLGEYDMSKIGKYLLELKTWLSGAFTSQQTCIDSFAQSSNESSQKM  172



>ref|XP_004298145.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=576

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 100/198 (51%), Gaps = 21/198 (11%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNM--------------------GGSSEV  142
            MG     K++ I  V+S+LLVA V+   + V                        G    
Sbjct  1    MGVPGGKKRITIIAVSSVLLVAMVICGVVGVIQYKKQEQRGGGGGGGDEDGDTNSGDKNA  60

Query  143  TTSTKEVEAICAPTDYKETCKTSLSG-AAAKTNDPKELIKTAFHVTMKNISHAISRSALL  319
            + ++K + AIC PT+YK+ C+ SL   A     DP++L +    V +  +   +  S LL
Sbjct  61   SHTSKTIVAICEPTNYKQECEKSLENEATGDKKDPQDLARVGIQVAISKLDEVLKNSTLL  120

Query  320  KEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQ  499
            K   KDP   +AL +C+ LLN S+ DL+ S       ++  + +YA D++VWLSGA+  Q
Sbjct  121  KNKGKDPMTQEALSICRQLLNASMYDLKISYNKMCALNMEKVDQYAEDVRVWLSGAVNHQ  180

Query  500  ETCRDAFENTTGDTGEKM  553
            ETC D  +NTT D G++M
Sbjct  181  ETCVDVCQNTTADLGKQM  198



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 109/172 (63%), Gaps = 8/172 (5%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGG---SSEVTTSTKEVEAICAPTDY  190
            MG DGDK KK  +AG  S  LV  VV+  +  +        + +  +TK V+A+CAPTD+
Sbjct  1    MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            K+TC  SL GA+  ++DP +LIK  F VT+K+I+ ++ +++  +  EA K+P A  A +L
Sbjct  61   KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAEADKNPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
            C+ L+ ++I DL+K C   G F V+ I  +  DL+VWLSG+I  Q+TC D+F
Sbjct  121  CEKLMIDAIDDLKK-CMDHG-FSVDQIEVFVEDLRVWLSGSIAFQQTCMDSF  170



>gb|EAZ05229.1| hypothetical protein OsI_27427 [Oryza sativa Indica Group]
Length=570

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = +2

Query  110  SVTNMGGS---SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAK-TNDPKELIKTAFHVT  277
            S  N GG     E++TS K V+A C PTDY++TC+  L  AA    + P +L K  F VT
Sbjct  25   SFKNGGGGKEDGELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVT  84

Query  278  MKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA  457
             + IS AIS S+ L+E   D R S AL  CK LL  ++ DL+ S E  G F++ N  +  
Sbjct  85   SEKISKAISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  458  NDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +DL+ WLS A+T Q TC D F NTT D  +KM
Sbjct  145  DDLRTWLSAALTYQGTCLDGFLNTTTDAADKM  176



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = +2

Query  110  SVTNMGGS---SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAK-TNDPKELIKTAFHVT  277
            S  N GG     E++TS K V+A C PTDY++TC+  L  AA    + P +L K  F VT
Sbjct  25   SFKNGGGGKEDGELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVT  84

Query  278  MKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA  457
             + IS AIS S+ L+E   D R S AL  CK LL  ++ DL+ S E  G F++ N  +  
Sbjct  85   SEKISKAISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  458  NDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +DL+ WLS A+T Q TC D F NTT D  +KM
Sbjct  145  DDLRTWLSAALTYQGTCLDGFLNTTTDAADKM  176



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 103/178 (58%), Gaps = 8/178 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGGSSE------VTTSTKEVEAICAPTDYKETCK  205
            KK  IAG+ + LLVA V+   I  T    + +      +T +TK + A+CAPTDYKETC 
Sbjct  10   KKSIIAGILTALLVAMVIVVAIIKTQNSSNPDKTTTVHITATTKAIRAVCAPTDYKETCV  69

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+  +  P ELIK  F++T+++I  ++ +++  L  +AA D     ALDLC+ L+
Sbjct  70   NSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGELKAKAANDNETKGALDLCEKLM  129

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
             ++  DLEK       F + +I ++  DL+VWLSG+I  Q+TC D FE    +  + M
Sbjct  130  TDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSIAYQQTCMDTFEEINSNLSQDM  187



>gb|EAZ41174.1| hypothetical protein OsJ_25671 [Oryza sativa Japonica Group]
Length=570

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = +2

Query  110  SVTNMGGS---SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAK-TNDPKELIKTAFHVT  277
            S  N GG     E++TS K V+A C PTDY++TC+  L  AA    + P +L K  F VT
Sbjct  25   SFKNGGGGKEDGELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVT  84

Query  278  MKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA  457
             + IS AIS S+ L+E   D R S AL  CK LL  ++ DL+ S E  G F++ N  +  
Sbjct  85   SEKISKAISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  458  NDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            +DL+ WLS A+T Q TC D F NTT D  +KM
Sbjct  145  DDLRTWLSAALTYQGTCLDGFLNTTTDAADKM  176



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   121 bits (304),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  55   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D F NTTG+ G KM
Sbjct  175  ITYQETCLDGFANTTGEAGVKM  196



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E++TS K +++ C P DY+ETC+T+L   A    +P +L K  F  T + I  A+  SA+
Sbjct  38   ELSTSVKSIKSFCQPVDYRETCETTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESAV  97

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L +   DPR SDAL  C+ LL+ +I DL+ + +  G F  +N     +D+K WLS A+T 
Sbjct  98   LNDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAVDDVKTWLSSALTY  157

Query  497  QETCRDAFENTTG-DTGEKM  553
            QETC D FEN+T  +  EKM
Sbjct  158  QETCLDGFENSTSTEASEKM  177



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   121 bits (303),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  55   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D F NTTG+ G KM
Sbjct  175  ITYQETCLDGFANTTGEAGVKM  196



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   121 bits (303),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  55   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D F NTTG+ G KM
Sbjct  175  ITYQETCLDGFANTTGEAGVKM  196



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   121 bits (303),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  55   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D F NTTG+ G KM
Sbjct  175  ITYQETCLDGFANTTGEAGVKM  196



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (61%), Gaps = 1/143 (1%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G  E++TS K +++ C P DY+ETC+++L  +A   ++P +L K  F  T + I  A+  
Sbjct  35   GDGELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSEKIEQAVRE  94

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            S +L +   D R S AL  CK LL+ +I DL+ + +  G F+++N     +DLK WLS A
Sbjct  95   STVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDDLKTWLSSA  154

Query  488  ITQQETCRDAFEN-TTGDTGEKM  553
            +T QETC D FEN T+ D  EKM
Sbjct  155  LTYQETCLDGFENATSTDASEKM  177



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   120 bits (300),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            +V+ S K ++ +C PTDY++ C  SL   +  T DPKELI+ AF V  K+++ A  RS  
Sbjct  55   QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYA---NDLKVWLSGA  487
            LK+  KDPRAS AL+ C  L++ +I DL++S E  G  D     +     N+LK WLS  
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            IT QETC D F NTTG+ G KM
Sbjct  175  ITYQETCLDGFANTTGEAGVKM  196



>ref|XP_006658993.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=567

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 0/139 (0%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSAL  316
            E++ S K V+A C PTDY++TC+  L+ AAA  + P +L K  F VT + IS AIS SA 
Sbjct  40   ELSMSVKSVKAFCQPTDYQQTCEAELTQAAANGSSPTDLAKAIFAVTSEKISKAISESAT  99

Query  317  LKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQ  496
            L+E   D R S AL  CK LL  ++ DL+ S +  G F + +  +  +DL+ WLS A+T 
Sbjct  100  LEELRNDQRTSGALQNCKELLEYAVEDLKTSFDKLGGFGMTDFNKAVDDLRTWLSAALTY  159

Query  497  QETCRDAFENTTGDTGEKM  553
            Q+TC D F NTT D   KM
Sbjct  160  QDTCLDGFLNTTTDAAAKM  178



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 109/172 (63%), Gaps = 8/172 (5%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGS---SEVTTSTKEVEAICAPTDY  190
            MG DGDK KK  +AG  S  LV  VV+  +  +        + +  +TK V+A+CAPTD+
Sbjct  1    MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            K+TC  SL GA+  ++DP +LIK  F VT+K+I+ ++ +++  +  +A K+P A  A +L
Sbjct  61   KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
            C+ L+ ++I DL+K C   G F V+ I  +  DL+VWLSG+I  Q+TC D+F
Sbjct  121  CEKLMIDAIDDLKK-CMDHG-FSVDQIEVFVEDLRVWLSGSIAFQQTCMDSF  170



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 98/172 (57%), Gaps = 6/172 (3%)
 Frame = +2

Query  53   AIAGVASILLVACVVAATISVTNMGGS-----SEVTTSTKEVEAICAPTDYKETCKTSLS  217
            AI G AS +LV  VVAA   V+  GGS      E++TS K +++ C P DYKE C+++L 
Sbjct  6    AIIG-ASTILVVAVVAAVCVVSFKGGSDDKSDQELSTSVKSIKSFCEPVDYKEACESTLE  64

Query  218  GAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGD  397
              A       EL K  F  T + I  A+  S++L E   D R + AL+ CK LLN ++ D
Sbjct  65   KTAGNATSTTELAKAIFKATSERIEQAVRESSVLNELKHDQRTAGALNNCKELLNYAMDD  124

Query  398  LEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L+ + E  G F++ N     +DLK WLS A+T QETC D FENTT D   KM
Sbjct  125  LKTTFEQLGGFEMTNFKHALDDLKTWLSSALTYQETCVDGFENTTTDAAAKM  176



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 109/172 (63%), Gaps = 8/172 (5%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNMGGS---SEVTTSTKEVEAICAPTDY  190
            MG DGDK KK  +AG  S  LV  VV+  +  +        + +  +TK V+A+CAPTD+
Sbjct  1    MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            K+TC  SL GA+  ++DP +LIK  F VT+K+I+ ++ +++  +  +A K+P A  A +L
Sbjct  61   KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFEL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
            C+ L+ ++I DL+K C   G F V+ I  +  DL+VWLSG+I  Q+TC D+F
Sbjct  121  CEKLMIDAIDDLKK-CMDHG-FSVDQIEVFVEDLRVWLSGSIAFQQTCMDSF  170



>emb|CDY40720.1| BnaC03g34360D [Brassica napus]
Length=193

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 86/140 (61%), Gaps = 6/140 (4%)
 Frame = +2

Query  29   DGDKNKKVAIAGVASILLVACVVAATISVT------NMGGSSEVTTSTKEVEAICAPTDY  190
            D  + K+  I  ++S+LL++ VVA T+ V+      N    +++T+S K V+ +CAPTD+
Sbjct  8    DSKRKKRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDF  67

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCK  370
            K+TC+ SL+     T DP EL+KTAF  TM+ IS A  +S  + E  KDPR   ALD CK
Sbjct  68   KKTCEDSLNKNGNNTTDPIELVKTAFSATMRQISAAAKKSQTIMELQKDPRTKMALDQCK  127

Query  371  TLLNNSIGDLEKSCEAAGDF  430
             L++ ++G+L  S E  GD 
Sbjct  128  ELMDYALGELSNSFEELGDL  147



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 87/142 (61%), Gaps = 1/142 (1%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G   +  S + V+ IC   +YKETC  SL+  A++T+D KELI TAF+ T + I+  I  
Sbjct  47   GGDSIVKSQRNVQVICESAEYKETCHKSLA-KASETSDLKELIITAFNATAEEIAKQIKN  105

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            S L  E A D     A+D+CK +L  ++ D+ +S     +F++N + +YA DLKVW++G 
Sbjct  106  STLYHELATDDMNKQAMDICKEVLGYAVDDMHQSVRKLEEFELNKLNDYAYDLKVWIAGT  165

Query  488  ITQQETCRDAFENTTGDTGEKM  553
            +  Q+TC D FENTT + G+ M
Sbjct  166  LAHQQTCLDGFENTTNEAGKTM  187



>tpg|DAA64233.1| TPA: pectinesterase [Zea mays]
Length=566

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G   ++ S K V+A C P DYKETC+  LS AA   + P +L K  F VT   I  AIS 
Sbjct  35   GDENLSMSVKSVKAFCQPADYKETCEAELSKAAGNASSPSDLAKVIFKVTSDKIHKAISE  94

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            SA L+E   DPR S AL  CK +L  +I +L+ S +  G F++ N  +  +DLK WLS A
Sbjct  95   SATLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKLGGFEMTNFNKAVDDLKTWLSAA  154

Query  488  ITQQETCRDAFENTT  532
            +T Q+TC D F N T
Sbjct  155  LTYQDTCLDGFANAT  169



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 112/183 (61%), Gaps = 8/183 (4%)
 Frame = +2

Query  23   MG-DGDKNKKVAIAGVASILLVACVVAATISVTNM---GGSSEVTTSTKEVEAICAPTDY  190
            MG DG+K KK  IAG  S LLV  VV+  +  +     G  +E+  +TK V+A+CAPTDY
Sbjct  1    MGFDGEKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKGDENEIRKTTKAVQAVCAPTDY  60

Query  191  KETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDL  364
            KETC   +  A  ++ +P +LIK +F+VT+++I  ++ +++  +   A+K+P A  A  L
Sbjct  61   KETCFDRMMNAEPESTEPLDLIKLSFNVTIQSIHESLQKASEDVKARASKNPAAKGAFQL  120

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTG  544
            C+ ++ ++I DL KS +    F +  I  Y  DL+VWLSG+I  Q+TC D+FE    +  
Sbjct  121  CEHVMLDAIDDLRKSFDRG--FSLARIEGYVEDLRVWLSGSIAFQQTCIDSFEEIKSNLL  178

Query  545  EKM  553
            ++M
Sbjct  179  QEM  181



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 107/178 (60%), Gaps = 2/178 (1%)
 Frame = +2

Query  26   GDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            GD  K K +    ++++L+V  V  A I   +   S ++ T+TK V+A+C+PTD+K+TC 
Sbjct  5    GDNKKKKGIIAGAISALLVVMVVSVAVIVSKDCKASDKIKTTTKAVQAVCSPTDFKDTCV  64

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+  + +P +LIK +F VT+++I   I RS+  L  +AAKD     AL+LC+ L+
Sbjct  65   NSLMEASPNSTEPLDLIKLSFDVTIRSIKDGIKRSSTELKAKAAKDEETKGALELCENLM  124

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            N++  DL+K  +    F +  I ++  DL+VWLSG+I  Q+TC D FE    +  + M
Sbjct  125  NDATDDLKKCFDNFDGFSITQIEDFVEDLRVWLSGSIAYQQTCMDTFEEVKSNLAQDM  182



>ref|XP_003559753.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=575

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAA-KTNDPKELIKTAFHVTMKNISHAISRSA  313
            +++TS K V+A C P DYKETC+  LS  +  K   P EL K  F  T   I+ A++ SA
Sbjct  41   QLSTSVKSVKAFCQPMDYKETCEAELSKMSGDKPTSPTELAKAIFEATSAKINKAVAESA  100

Query  314  LLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAIT  493
             L+E   D R S AL  CK LL  ++ DL+ S +  G F++ +  +  +DLK WLS A+T
Sbjct  101  TLEELKNDKRTSGALQNCKELLEYAVEDLKTSFDKLGGFEMTDFNKAVDDLKTWLSAALT  160

Query  494  QQETCRDAFENTTGDTGEKM  553
             QETC D F NTTGD   KM
Sbjct  161  YQETCLDGFLNTTGDASAKM  180



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 95/147 (65%), Gaps = 2/147 (1%)
 Frame = +2

Query  113  VTNMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNIS  292
            + N     E+++S K V+A+C PT+YKETC+ SL  A++ ++D KELI+T F   +  I 
Sbjct  12   IKNKNDGEEISSSNKAVQALCQPTNYKETCQKSL--ASSNSSDVKELIRTGFQAGLVEIK  69

Query  293  HAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKV  472
            + ++ S  ++E  KD     AL +C+ +L+ +I D +KS +  G++D++ I +Y  +LK 
Sbjct  70   NVLAHSVTVQELIKDKNNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKT  129

Query  473  WLSGAITQQETCRDAFENTTGDTGEKM  553
            WLSGA T Q+TC D+F  ++ ++ +KM
Sbjct  130  WLSGAFTSQQTCIDSFAQSSNESSQKM  156



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMGG---SSEVTTSTKEVEAICAPTDYKETCKTSL  214
            KKV I G+AS+L+VACVVAA +++T       S+EV TSTK VE++C PT YK+TC+ +L
Sbjct  3    KKVVIGGIASVLVVACVVAACLTLTKHDSDTSSNEVATSTKSVESMCQPTPYKQTCEKTL  62

Query  215  SGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIG  394
            S AA   +DPK+ IK AF  T+ +I +AI     +K+AA DP   DAL  C+ L + ++ 
Sbjct  63   S-AAKNVSDPKDYIKVAFEATVTDIKNAIMNIEPIKKAASDPYTKDALHACEELFDLAVE  121

Query  395  DLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAF  520
            DL  S     +FD + I +  +DLK WLS  +  +ETC D F
Sbjct  122  DLRGSVAKIENFDFSKIKDVVDDLKTWLSAVVAYEETCLDGF  163



>ref|XP_006651293.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like, 
partial [Oryza brachyantha]
Length=307

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = +2

Query  119  NMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHA  298
            N  G  E++TS K +++ C P DY+ETC+++L  +A   ++P +L K  F  T + I  A
Sbjct  32   NDKGDGELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSEKIEQA  91

Query  299  ISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWL  478
               + +L +   D R S AL  CK LL+ +I DL+ + +  G F+++N     +DLK WL
Sbjct  92   GRGATVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDDLKTWL  151

Query  479  SGAITQQETCRDAFEN-TTGDTGEKM  553
            S A+T QETC D FEN T+ D  EKM
Sbjct  152  SSALTYQETCLDGFENATSTDASEKM  177



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            DGDK KK  IAG V+ +L++  V  A ++  +    +++ T+TK V A+CAPTD+KE C 
Sbjct  4    DGDKKKKCLIAGSVSGLLVIMVVSVAVVTSKHTPNENQIRTTTKAVRAVCAPTDFKEACV  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+  + +P ELIK +F+ T+K+I+  + +++  +  +A KDP A  A  LC+ L+
Sbjct  64   KSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASEDVKPKADKDPGAKGAFQLCERLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
             ++I DL+K  +   +F V  I  +  DL+VWLSG+I  Q+TC D FE
Sbjct  124  IDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSIAFQQTCIDTFE  169



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 95/147 (65%), Gaps = 2/147 (1%)
 Frame = +2

Query  113  VTNMGGSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNIS  292
            + N     E+++S K V+A+C PT+YKETC+ SL  A++ ++D KELI+T F   +  I 
Sbjct  28   IKNKNDGEEISSSNKAVQALCQPTNYKETCQKSL--ASSNSSDVKELIRTGFQAGLVEIK  85

Query  293  HAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKV  472
            + ++ S  ++E  KD     AL +C+ +L+ +I D +KS +  G++D++ I +Y  +LK 
Sbjct  86   NVLAHSVTVQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKT  145

Query  473  WLSGAITQQETCRDAFENTTGDTGEKM  553
            WLSGA T Q+TC D+F  ++ ++ +KM
Sbjct  146  WLSGAFTSQQTCIDSFAQSSNESSQKM  172



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            DGDK KK  IAG V+ +L++  V  A ++  +    +++ T+TK V A+CAPTD+KE C 
Sbjct  4    DGDKKKKCLIAGSVSGLLVIMVVSVAVVTSKHTPNENQIRTTTKAVRAVCAPTDFKEACV  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+  + +P ELIK +F+ T+K+I+  + +++  +  +A KDP A  A  LC+ L+
Sbjct  64   KSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASEDVKPKADKDPGAKGAFQLCERLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
             ++I DL+K  +   +F V  I  +  DL+VWLSG+I  Q+TC D FE
Sbjct  124  IDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSIAFQQTCIDTFE  169



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 98/175 (56%), Gaps = 7/175 (4%)
 Frame = +2

Query  44   KKVAIAGVASILLVACVVAATISVTNMG-----GSSEVTTSTKEVEAICAPTDYKETCKT  208
            KK AI GV+SILL+A V A  + V + G     G +++  S K V+ +C  T YK+TC+ 
Sbjct  15   KKFAILGVSSILLIAMVAAVAVGVKDGGQVESEGGNQIVKSQKIVQVLCGTTGYKQTCEK  74

Query  209  SLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNS  388
            SL  A     D KELIK  F  T + +S  I  S L KE A +     A+D+CK +L  +
Sbjct  75   SL--AKTGKTDMKELIKAVFKATAEELSKQIHNSKLYKELATNDMTKQAMDICKEVLGYA  132

Query  389  IGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            + D+ +S  +   FD+  I E A DLKVWLSG +  Q+TC   FENTT    + M
Sbjct  133  VDDVHQSIHSLDKFDIRKIDEIAYDLKVWLSGTLANQQTCLYGFENTTTHAEQTM  187



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 104/173 (60%), Gaps = 6/173 (3%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE------VTTSTKEVEAICAPT  184
             G  +K KK  +AG  + LLV  VVA  +       + +      +  ++K VEA+CAPT
Sbjct  3    FGKDNKKKKCIVAGAVTGLLVIMVVAVAVIANQHAHACKKIPDVNIKMTSKAVEAVCAPT  62

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            D+KETC  S   A+  + +P +LIK +F++T++ I   + +S++  +A  D     +L+L
Sbjct  63   DFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSVELKAKADHETKGSLEL  122

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            C+TL+N++I DL K  +    F V+ I ++  DL+VWLSG+I+ Q+TC DAFE
Sbjct  123  CETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISYQQTCMDAFE  175



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = +2

Query  29   DGDKNKKVAIAG-VASILLVACVVAATISVTNMGGSSEVTTSTKEVEAICAPTDYKETCK  205
            DGDK KK  IAG V+ +L++  V  A ++  +    +++ T+TK V A+CAPTD+KE C 
Sbjct  4    DGDKKKKCLIAGSVSGLLVIMVVSVAVVTSKHTPNENQIRTTTKAVRAVCAPTDFKEACV  63

Query  206  TSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKTLL  379
             SL  A+  + +P ELIK +F+ T+K+I+    +++  +  +A KDP A  A  LC+ L+
Sbjct  64   KSLMDASPNSTEPLELIKLSFNATIKSINDNFKKASEDVKPKADKDPGAKGAFQLCERLM  123

Query  380  NNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
             ++I DL+K  +   +F V  I  +  DL+VWLSG+I  Q+TC D FE
Sbjct  124  IDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSIAFQQTCIDTFE  169



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 4/144 (3%)
 Frame = +2

Query  113  VTNMGGS--SEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKN  286
            VTN G     ++  S+K V+AIC PTDYK+ C  SL  A  KT+DPKEL++ AF   M  
Sbjct  26   VTNWGNKLDQKLAASSKAVQAICNPTDYKDACVKSL--ATVKTDDPKELVRAAFASAMAE  83

Query  287  ISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDL  466
            +    S S +LK    DP+ + A+  CK L  ++I D ++S +  G  D N +     +L
Sbjct  84   LKEIASNSTILKVLEMDPKTAQAVKDCKELFQDAIDDFQRSFDEIGKLDWNQVNSVLENL  143

Query  467  KVWLSGAITQQETCRDAFENTTGD  538
            K+W+S   T QETC D FENTTGD
Sbjct  144  KIWISATRTYQETCLDGFENTTGD  167



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 103/173 (60%), Gaps = 6/173 (3%)
 Frame = +2

Query  23   MGDGDKNKKVAIAGVASILLVACVVAATISVTNMGGSSE------VTTSTKEVEAICAPT  184
             G  +K KK  +AG  + LLV  VVA  +       + +      +  + K VEA+CAPT
Sbjct  3    FGKDNKKKKCIVAGAVTGLLVIMVVAVAVIANQHAHACKKMPDVNIKMTNKAVEAVCAPT  62

Query  185  DYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSALLKEAAKDPRASDALDL  364
            D+KETC  S   A+  + +P +LIK +F++T++ I   + +S++  +A  D     +L+L
Sbjct  63   DFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSVELKAKADHETKGSLEL  122

Query  365  CKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFE  523
            C+TL+N++I DL K  +    F V+ I ++  DL+VWLSG+I+ Q+TC DAFE
Sbjct  123  CETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISYQQTCMDAFE  175



>ref|XP_004958780.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=565

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 78/135 (58%), Gaps = 0/135 (0%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G   ++ S K V+A C PTDY++TC+  LS AA   + P EL K  F VT   I  AIS 
Sbjct  36   GDDNLSMSVKSVKAFCQPTDYQQTCEAELSKAAGNASSPTELAKVIFGVTSDKIHKAISE  95

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            SA L E   D R S AL  CK +L  +I DL+ S +  G F++ N  +  +DLK WLS A
Sbjct  96   SATLTELKNDKRTSGALQNCKEMLEYAIDDLKSSFDKLGGFEMTNFKKAVDDLKTWLSAA  155

Query  488  ITQQETCRDAFENTT  532
            +T Q+TC D F N T
Sbjct  156  LTYQDTCLDGFMNAT  170



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = +2

Query  131  SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRS  310
            S+ +  S K +  +C  T Y++TC  SLS A   ++D K+LI+T+F   M+ + + I +S
Sbjct  35   SNNINPSQKAIVDLCQNTYYQQTCINSLSKATI-SSDTKDLIRTSFRTAMEELGNVIKQS  93

Query  311  ALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
            A L+EA+K+P  ++A   C+ LLN+SI DL+K+ E     D++N+    +D+K WL+GA+
Sbjct  94   ATLQEASKNPETAEAYRTCQKLLNDSILDLQKTLERTESVDISNLNLLIDDIKTWLTGAL  153

Query  491  TQQETCRDAFENTTGDTGEKM  553
            T QETC D FE+  GD  EKM
Sbjct  154  TYQETCLDCFEDAEGDAAEKM  174



>gb|EMT00224.1| Putative pectinesterase/pectinesterase inhibitor 21 [Aegilops 
tauschii]
Length=543

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 80/141 (57%), Gaps = 0/141 (0%)
 Frame = +2

Query  131  SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRS  310
            S+E+TTS K +++ C P DYK  C+ +L   A       EL K  F  T + I  A+  S
Sbjct  35   STELTTSMKSIKSFCQPVDYKAACEKTLGETAGNATTTTELAKAIFKATSERIEKAVQES  94

Query  311  ALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
            +LL E   DPR S AL  CK +L+ +I DL+ + +  G F++ N     +DLK WL+ A+
Sbjct  95   SLLNELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQLGGFEMTNFKHAMDDLKTWLTSAL  154

Query  491  TQQETCRDAFENTTGDTGEKM  553
            T QETC D F NTT D   KM
Sbjct  155  TYQETCIDGFANTTTDASAKM  175



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 69/180 (38%), Positives = 93/180 (52%), Gaps = 10/180 (6%)
 Frame = +2

Query  38   KNKKVAIAGVASILLVACVVAATISVTNMGGSSEVTTSTKE------VEAICAPTDYKET  199
            K K   I GV+S L+V   +   +  +  GG      +  +      V  IC+ TDYKET
Sbjct  19   KKKYAVIVGVSSFLVVTMFIGTAVMSSGSGGHERAIKAGNKLVVKTAVNVICSSTDYKET  78

Query  200  CKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA--LLKEAAKDPRASDALDLCKT  373
            C  SL     ++ DP+ LIK+AF   +K+I   I+++A  L   A  D R  +AL+ C  
Sbjct  79   CVASLE--TVRSPDPRNLIKSAFEFAIKSIQKGINQAAIDLRMRAKSDRRTREALENCVE  136

Query  374  LLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            L+ NS+ DL KS E    F    + + A DL VWLSGAIT Q+TC D FE    D  E M
Sbjct  137  LMENSVEDLRKSNEKFAGFAFTRLRDIAEDLGVWLSGAITYQQTCIDGFEGIDSDAAEIM  196



>ref|NP_001151322.1| pectinesterase-1 precursor [Zea mays]
 gb|ACG42376.1| pectinesterase-1 precursor [Zea mays]
Length=567

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 78/135 (58%), Gaps = 0/135 (0%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G   ++ S K V+A C P DYKETC+  LS AA   + P +L K  F VT   I  AIS 
Sbjct  35   GDENLSMSVKSVKAFCQPADYKETCEAELSKAAGNASSPSDLAKVIFKVTSDKIHKAISE  94

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            SA L+E   DPR S AL  CK +L  +I +L+ S +    F++ N  +  +DLK WLS A
Sbjct  95   SATLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKLXGFEMTNFNKAVDDLKTWLSAA  154

Query  488  ITQQETCRDAFENTT  532
            +T Q+TC D F N T
Sbjct  155  LTYQDTCLDGFANAT  169



>gb|EMS57827.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=481

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 0/141 (0%)
 Frame = +2

Query  131  SSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRS  310
            S+E+ TS K +++ C P DYK  C+ +L   A       EL K  F  T + I  A+  S
Sbjct  35   STELATSVKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVQES  94

Query  311  ALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
            +LL E   DPR S AL  CK +L+ +I DL+ + +  G F++ N     +DLK WL+ A+
Sbjct  95   SLLNELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQLGGFEMTNFKHAMDDLKTWLTSAL  154

Query  491  TQQETCRDAFENTTGDTGEKM  553
            T QETC D F NTT D   KM
Sbjct  155  TYQETCLDGFANTTTDASAKM  175



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 91/159 (57%), Gaps = 6/159 (4%)
 Frame = +2

Query  92   VVAATISVTNMG-----GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELI  256
            VVAA + + +       G   +  S +  + IC   +YKETC  SL+ A+  T+D KELI
Sbjct  2    VVAAAVRIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKETCHKSLAKASG-TSDLKELI  60

Query  257  KTAFHVTMKNISHAISRSALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDV  436
             TAF+ T + I++ I  S L  E A D     A D+CK +L  ++ D+ +S      FD+
Sbjct  61   ITAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVLGYAVDDIRRSVHTLEKFDL  120

Query  437  NNILEYANDLKVWLSGAITQQETCRDAFENTTGDTGEKM  553
            N + +YA DLKVW++G +  Q+TC D FENT+ + G+ M
Sbjct  121  NKLNDYAYDLKVWIAGTLAHQQTCLDGFENTSSEAGKTM  159



>ref|XP_002461260.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
 gb|EER97781.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
Length=571

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +2

Query  128  GSSEVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISR  307
            G   ++ S K V+A C PTDYK+TC+  LS AA   + P +L K  F VT   I  AIS 
Sbjct  36   GDENMSMSVKSVKAFCQPTDYKQTCEAELSKAAGNASTPSDLAKVIFGVTSDKIHKAISE  95

Query  308  SALLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGA  487
            S  LKE   D R S AL  C  LL  +I DL+ S +  G F++ N  +  +DLK WLS A
Sbjct  96   SETLKELKNDQRTSGALKDCNELLEYAIDDLKSSFDKLGGFEMTNFKKAVDDLKTWLSAA  155

Query  488  ITQQETCRDAFENTT  532
            +T Q+TC D F N T
Sbjct  156  LTYQDTCLDGFMNAT  170



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 86/141 (61%), Gaps = 2/141 (1%)
 Frame = +2

Query  137  EVTTSTKEVEAICAPTDYKETCKTSLSGAAAKTNDPKELIKTAFHVTMKNISHAISRSA-  313
            ++  +TK + A+CAPTDYKETC  SL  A+  +  P ELIK  F++T+++I  ++ +++ 
Sbjct  47   QIKATTKAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  314  -LLKEAAKDPRASDALDLCKTLLNNSIGDLEKSCEAAGDFDVNNILEYANDLKVWLSGAI  490
             L  +AA D     ALDLC+ L+ ++  DLEK       F + +I ++  DL+VWLSG+I
Sbjct  107  ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSI  166

Query  491  TQQETCRDAFENTTGDTGEKM  553
              Q+TC D FE    +  + M
Sbjct  167  AYQQTCMDTFEEINSNLSQDM  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571442019030