BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15271_g1_i1 len=338 path=[141:0-244 385:245-268 98:269-337]

Length=338
                                                                      Score     E

ref|XP_009617097.1|  PREDICTED: glycine-rich cell wall structural...  58.2    2e-07   
ref|XP_009786424.1|  PREDICTED: glycine-rich cell wall structural...  54.7    3e-06   
ref|XP_009786423.1|  PREDICTED: glycine-rich cell wall structural...  54.7    3e-06   



>ref|XP_009617097.1| PREDICTED: glycine-rich cell wall structural protein-like [Nicotiana 
tomentosiformis]
Length=574

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = +3

Query  168  ACRASNSKH-----SLRMAG-GVRVCILSLLCFHVFVGSVVFARNVKDDDEKF  308
            +C+ +   H     SL+M G G+RV +L+LLCFHVFVGSV   RNVKD+DEKF
Sbjct  17   SCQKTEKGHAIQNYSLKMIGRGLRVGVLALLCFHVFVGSVALGRNVKDEDEKF  69



>ref|XP_009786424.1| PREDICTED: glycine-rich cell wall structural protein-like isoform 
X2 [Nicotiana sylvestris]
Length=422

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  186  SKHSLRMAG-GVRVCILSLLCFHVFVGSVVFARNVKDDDEKF  308
              +SL+M G G+RV +L+LLCFHV VGSVV ARN+K +DEKF
Sbjct  18   QNYSLKMIGRGLRVGVLALLCFHVLVGSVVLARNLKIEDEKF  59



>ref|XP_009786423.1| PREDICTED: glycine-rich cell wall structural protein-like isoform 
X1 [Nicotiana sylvestris]
Length=514

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  186  SKHSLRMAG-GVRVCILSLLCFHVFVGSVVFARNVKDDDEKF  308
              +SL+M G G+RV +L+LLCFHV VGSVV ARN+K +DEKF
Sbjct  18   QNYSLKMIGRGLRVGVLALLCFHVLVGSVVLARNLKIEDEKF  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515581551488