BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15240_g1_i1 len=1441 path=[1:0-1062 1064:1063-1440]

Length=1441
                                                                      Score     E

ref|XP_009786357.1|  PREDICTED: transcription factor bHLH30-like        331   2e-107   
ref|XP_009611307.1|  PREDICTED: transcription factor bHLH30-like        328   6e-106   
ref|XP_004243409.1|  PREDICTED: transcription factor bHLH30-like        327   1e-105   
ref|XP_006348853.1|  PREDICTED: transcription factor bHLH30-like        325   1e-104   
ref|XP_011100403.1|  PREDICTED: transcription factor bHLH30-like        311   2e-99    
emb|CDP15921.1|  unnamed protein product                                304   1e-96    
ref|XP_002280074.1|  PREDICTED: transcription factor bHLH30             267   3e-82    Vitis vinifera
ref|XP_002325576.1|  hypothetical protein POPTR_0019s11870g             243   6e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006446772.1|  hypothetical protein CICLE_v10016261mg             243   7e-73    
ref|XP_006469029.1|  PREDICTED: transcription factor bHLH30-like ...    242   2e-72    
ref|XP_006469030.1|  PREDICTED: transcription factor bHLH30-like ...    242   2e-72    
gb|KDP31789.1|  hypothetical protein JCGZ_12250                         239   3e-71    
ref|XP_006376342.1|  hypothetical protein POPTR_0013s12190g             238   4e-71    
gb|EYU41136.1|  hypothetical protein MIMGU_mgv1a026524mg                235   6e-70    
emb|CAN60803.1|  hypothetical protein VITISV_020681                     233   3e-68    Vitis vinifera
emb|CBI21967.3|  unnamed protein product                                229   3e-68    
ref|XP_004487166.1|  PREDICTED: transcription factor bHLH30-like        226   7e-67    
ref|XP_002525116.1|  conserved hypothetical protein                     226   1e-66    Ricinus communis
gb|KEH39268.1|  transcription factor bHLH107-like protein               225   2e-66    
ref|XP_003539550.2|  PREDICTED: transcription factor bHLH30-like        224   6e-66    
ref|XP_010279103.1|  PREDICTED: transcription factor bHLH30-like        224   7e-66    
ref|XP_003541890.2|  PREDICTED: transcription factor bHLH30-like        223   1e-65    
ref|XP_011038201.1|  PREDICTED: transcription factor bHLH30-like        224   2e-65    
ref|XP_003539965.1|  PREDICTED: transcription factor bHLH30-like        219   4e-64    
ref|XP_004295576.1|  PREDICTED: transcription factor bHLH30-like        221   4e-63    
gb|AFK43226.1|  unknown                                                 216   6e-63    
ref|XP_003527389.1|  PREDICTED: transcription factor bHLH30-like        216   2e-62    
ref|XP_002274955.1|  PREDICTED: transcription factor bHLH30             215   3e-62    Vitis vinifera
ref|XP_008225271.1|  PREDICTED: transcription factor bHLH30-like        215   4e-62    
ref|XP_009352784.1|  PREDICTED: transcription factor bHLH30-like        214   7e-62    
ref|XP_007212891.1|  hypothetical protein PRUPE_ppa021837mg             214   1e-61    
ref|XP_007025402.1|  Basic helix-loop-helix DNA-binding superfami...    213   1e-61    
ref|XP_009348588.1|  PREDICTED: transcription factor bHLH30-like        213   2e-61    
ref|XP_008383636.1|  PREDICTED: transcription factor bHLH30-like        212   4e-61    
ref|XP_008371455.1|  PREDICTED: transcription factor bHLH30-like        208   2e-59    
ref|XP_002273834.1|  PREDICTED: transcription factor bHLH106-like       206   5e-59    Vitis vinifera
ref|XP_011002537.1|  PREDICTED: transcription factor bHLH30-like        204   7e-59    
ref|XP_010277769.1|  PREDICTED: transcription factor bHLH30-like        206   1e-58    
ref|XP_008783898.1|  PREDICTED: transcription factor bHLH30-like        205   1e-58    
ref|XP_007132898.1|  hypothetical protein PHAVU_011G134300g             204   3e-58    
ref|XP_002305075.2|  hypothetical protein POPTR_0004s05490g             201   7e-57    Populus trichocarpa [western balsam poplar]
ref|XP_008456426.1|  PREDICTED: transcription factor bHLH30-like ...    200   1e-56    
ref|XP_011005482.1|  PREDICTED: transcription factor bHLH106-like       198   5e-56    
ref|XP_004167587.1|  PREDICTED: transcription factor bHLH30-like        197   1e-55    
ref|XP_004505503.1|  PREDICTED: transcription factor bHLH30-like        197   1e-55    
ref|XP_003607570.1|  Transcription factor bHLH30                        197   1e-55    
ref|XP_004149373.1|  PREDICTED: transcription factor bHLH30-like        197   1e-55    
ref|XP_008785804.1|  PREDICTED: transcription factor bHLH30-like        196   2e-55    
ref|XP_010915628.1|  PREDICTED: transcription factor bHLH30-like        196   2e-55    
ref|XP_008456427.1|  PREDICTED: transcription factor bHLH30-like ...    196   3e-55    
ref|XP_006449491.1|  hypothetical protein CICLE_v10016289mg             194   2e-54    
gb|KDP35868.1|  hypothetical protein JCGZ_10603                         194   3e-54    
ref|XP_011045927.1|  PREDICTED: transcription factor bHLH30-like ...    191   7e-54    
ref|XP_007048670.1|  Basic helix-loop-helix DNA-binding superfami...    193   2e-53    
ref|XP_010057079.1|  PREDICTED: transcription factor bHLH106-like       191   2e-53    
ref|XP_002522566.1|  DNA binding protein, putative                      188   1e-52    Ricinus communis
ref|XP_004163475.1|  PREDICTED: putative transcription factor bHL...    188   3e-52    
ref|XP_003529368.1|  PREDICTED: transcription factor bHLH30-like        188   4e-52    
ref|XP_011045926.1|  PREDICTED: transcription factor bHLH30-like ...    187   4e-52    
ref|XP_007153714.1|  hypothetical protein PHAVU_003G058800g             188   4e-52    
ref|XP_007025401.1|  Basic helix-loop-helix DNA-binding superfami...    189   6e-52    
ref|XP_008443115.1|  PREDICTED: putative transcription factor bHL...    187   9e-52    
ref|XP_004149053.1|  PREDICTED: putative transcription factor bHL...    186   2e-51    
ref|XP_003518882.1|  PREDICTED: transcription factor bHLH30-like        186   3e-51    
gb|KHN32341.1|  Transcription factor bHLH30                             186   3e-51    
ref|XP_010103039.1|  hypothetical protein L484_005794                   186   3e-51    
ref|XP_010052204.1|  PREDICTED: transcription factor bHLH30-like        185   4e-51    
gb|ACU22947.1|  unknown                                                 183   3e-50    Glycine max [soybeans]
gb|KEH36578.1|  transcription factor                                    181   2e-49    
ref|XP_004505138.1|  PREDICTED: transcription factor bHLH30-like        179   2e-48    
ref|XP_009624214.1|  PREDICTED: transcription factor bHLH30-like        177   2e-48    
gb|EYU43349.1|  hypothetical protein MIMGU_mgv1a012656mg                177   3e-48    
ref|XP_011086002.1|  PREDICTED: transcription factor bHLH30-like        176   5e-48    
emb|CDO96779.1|  unnamed protein product                                176   3e-47    
ref|XP_004232970.1|  PREDICTED: transcription factor bHLH30-like        174   4e-47    
gb|KDO77843.1|  hypothetical protein CISIN_1g024670mg                   172   7e-47    
gb|ACU18057.1|  unknown                                                 171   8e-47    Glycine max [soybeans]
ref|XP_006362421.1|  PREDICTED: transcription factor bHLH30-like        171   6e-46    
ref|XP_011096434.1|  PREDICTED: transcription factor bHLH30-like ...    169   2e-45    
ref|XP_011096433.1|  PREDICTED: transcription factor bHLH30-like ...    168   6e-45    
ref|XP_009778313.1|  PREDICTED: transcription factor bHLH30-like        168   7e-45    
ref|XP_009390676.1|  PREDICTED: transcription factor bHLH30-like        165   1e-43    
gb|KDP21083.1|  hypothetical protein JCGZ_21554                         164   3e-43    
ref|XP_010099375.1|  hypothetical protein L484_004801                   157   5e-41    
ref|XP_009389985.1|  PREDICTED: transcription factor bHLH30-like        155   4e-40    
ref|XP_010035845.1|  PREDICTED: transcription factor bHLH30-like        154   1e-39    
ref|XP_006852445.1|  hypothetical protein AMTR_s00021p00102740          154   2e-39    
ref|XP_003593769.1|  Transcription factor bHLH                          151   4e-39    
gb|AES90327.2|  helix loop helix DNA-binding domain protein             153   7e-39    
ref|XP_009421255.1|  PREDICTED: transcription factor bHLH30-like        152   9e-39    
ref|XP_009409628.1|  PREDICTED: transcription factor bHLH30-like        149   3e-37    
gb|KDO48321.1|  hypothetical protein CISIN_1g037071mg                   139   1e-34    
ref|XP_006448601.1|  hypothetical protein CICLE_v10018233mg             136   3e-34    
ref|XP_010253805.1|  PREDICTED: transcription factor bHLH51-like        139   7e-34    
gb|KHN08890.1|  Transcription factor bHLH106                            135   2e-33    
ref|XP_002305076.1|  hypothetical protein POPTR_0004s05490g             134   3e-33    Populus trichocarpa [western balsam poplar]
ref|XP_007218826.1|  hypothetical protein PRUPE_ppa010134mg             135   6e-33    
ref|XP_010686302.1|  PREDICTED: transcription factor bHLH30-like        135   1e-32    
ref|XP_008441476.1|  PREDICTED: transcription factor bHLH51             134   1e-32    
ref|XP_002282625.1|  PREDICTED: transcription factor bHLH106            134   1e-32    Vitis vinifera
ref|XP_008374114.1|  PREDICTED: transcription factor bHLH51-like        135   2e-32    
ref|XP_009345143.1|  PREDICTED: transcription factor bHLH51-like        135   2e-32    
ref|XP_010551310.1|  PREDICTED: transcription factor bHLH30             136   2e-32    
ref|XP_003520487.1|  PREDICTED: transcription factor bHLH106-like       133   4e-32    
gb|KHN30346.1|  Transcription factor bHLH106                            133   4e-32    
gb|AFK46671.1|  unknown                                                 132   4e-32    
ref|XP_003554115.1|  PREDICTED: transcription factor bHLH106-like       133   4e-32    
ref|XP_002316828.1|  hypothetical protein POPTR_0011s07450g             130   5e-32    Populus trichocarpa [western balsam poplar]
ref|XP_004160727.1|  PREDICTED: transcription factor bHLH51-like        132   7e-32    
ref|XP_007202577.1|  hypothetical protein PRUPE_ppa011532mg             131   9e-32    
ref|XP_007162071.1|  hypothetical protein PHAVU_001G121200g             132   1e-31    
ref|XP_006356465.1|  PREDICTED: transcription factor bHLH51-like        131   1e-31    
ref|XP_004493384.1|  PREDICTED: transcription factor bHLH106-like       131   1e-31    
ref|XP_008240669.1|  PREDICTED: transcription factor bHLH106-like       131   2e-31    
ref|XP_004235454.1|  PREDICTED: transcription factor bHLH51-like        130   2e-31    
ref|XP_008233781.1|  PREDICTED: transcription factor bHLH51             131   3e-31    
gb|ACN21649.1|  putative basic helix-loop-helix protein BHLH24          128   3e-31    Lotus japonicus
gb|ACU14122.1|  unknown                                                 130   5e-31    Glycine max [soybeans]
ref|XP_010271836.1|  PREDICTED: transcription factor bHLH106-like       129   6e-31    
gb|KHN48576.1|  Transcription factor bHLH51                             130   7e-31    
ref|XP_009350864.1|  PREDICTED: transcription factor bHLH106-like       129   8e-31    
ref|XP_004307674.1|  PREDICTED: transcription factor bHLH51-like        129   8e-31    
ref|XP_002978655.1|  hypothetical protein SELMODRAFT_56610              127   1e-30    
gb|KHG21788.1|  Transcription factor bHLH51 -like protein               129   1e-30    
ref|XP_010920800.1|  PREDICTED: transcription factor bHLH51-like        128   2e-30    
ref|XP_010908560.1|  PREDICTED: transcription factor bHLH51-like        128   2e-30    
ref|XP_004485888.1|  PREDICTED: transcription factor bHLH30-like        127   2e-30    
gb|KDP35870.1|  hypothetical protein JCGZ_10605                         125   3e-30    
ref|XP_010112839.1|  hypothetical protein L484_014686                   127   3e-30    
ref|XP_010523405.1|  PREDICTED: transcription factor bHLH30-like ...    129   5e-30    
ref|XP_003544072.1|  PREDICTED: transcription factor bHLH51             127   5e-30    
ref|XP_003624955.1|  Transcription factor bHLH106                       127   6e-30    
gb|AFK47647.1|  unknown                                                 126   6e-30    
ref|NP_001281284.1|  transcription factor bHLH106-like                  127   6e-30    
ref|XP_004297146.1|  PREDICTED: transcription factor bHLH30-like        129   6e-30    
ref|XP_010523404.1|  PREDICTED: transcription factor bHLH30-like ...    129   6e-30    
ref|XP_010105437.1|  hypothetical protein L484_009905                   127   8e-30    
ref|XP_010681418.1|  PREDICTED: transcription factor bHLH30             129   9e-30    
gb|KHN31290.1|  Transcription factor bHLH51                             127   1e-29    
ref|XP_003552298.2|  PREDICTED: transcription factor bHLH51-like        127   1e-29    
gb|KHN33180.1|  Transcription factor bHLH106                            126   1e-29    
ref|XP_007145485.1|  hypothetical protein PHAVU_007G243000g             125   1e-29    
ref|XP_003520293.2|  PREDICTED: transcription factor bHLH106-like       126   1e-29    
ref|XP_007163561.1|  hypothetical protein PHAVU_001G244500g             126   1e-29    
ref|XP_010254503.1|  PREDICTED: transcription factor bHLH30-like        125   1e-29    
ref|XP_007028307.1|  Basic helix-loop-helix DNA-binding superfami...    126   2e-29    
gb|KDP27475.1|  hypothetical protein JCGZ_20010                         125   2e-29    
ref|XP_008387438.1|  PREDICTED: transcription factor bHLH106-like       125   2e-29    
ref|XP_009369194.1|  PREDICTED: transcription factor bHLH51-like        125   3e-29    
ref|XP_009371243.1|  PREDICTED: transcription factor bHLH106-like       124   3e-29    
ref|XP_002272668.2|  PREDICTED: transcription factor bHLH51             124   4e-29    Vitis vinifera
ref|XP_002307967.2|  hypothetical protein POPTR_0006s03550g             124   5e-29    Populus trichocarpa [western balsam poplar]
ref|XP_003591832.1|  Transcription factor bHLH30                        126   6e-29    
ref|XP_007141752.1|  hypothetical protein PHAVU_008G222700g             124   6e-29    
emb|CDP13989.1|  unnamed protein product                                124   6e-29    
ref|XP_011076673.1|  PREDICTED: transcription factor bHLH51             124   7e-29    
gb|KDP44742.1|  hypothetical protein JCGZ_01242                         124   8e-29    
ref|XP_006482067.1|  PREDICTED: transcription factor bHLH106-like       123   1e-28    
ref|XP_010264587.1|  PREDICTED: transcription factor bHLH51-like        124   1e-28    
ref|XP_002322615.2|  hypothetical protein POPTR_0016s03460g             122   1e-28    Populus trichocarpa [western balsam poplar]
emb|CDP01553.1|  unnamed protein product                                122   1e-28    
emb|CBI25454.3|  unnamed protein product                                124   2e-28    
ref|XP_008369274.1|  PREDICTED: transcription factor bHLH51             123   2e-28    
ref|XP_008464948.1|  PREDICTED: transcription factor bHLH106-like       122   2e-28    
gb|ACN21650.1|  putative basic helix-loop-helix protein BHLH25          124   2e-28    Lotus japonicus
ref|XP_002517323.1|  DNA binding protein, putative                      122   2e-28    Ricinus communis
gb|EYU20034.1|  hypothetical protein MIMGU_mgv1a012796mg                122   2e-28    
gb|AES71178.2|  transcription factor                                    122   3e-28    
ref|XP_003600927.1|  Transcription factor bHLH51                        122   3e-28    
ref|XP_006430538.1|  hypothetical protein CICLE_v10012626mg             122   3e-28    
gb|KHN05853.1|  Transcription factor bHLH30                             124   3e-28    
ref|XP_003520049.1|  PREDICTED: transcription factor bHLH30-like        124   3e-28    
ref|XP_006843648.1|  hypothetical protein AMTR_s00007p00170710          121   3e-28    
ref|XP_011000409.1|  PREDICTED: transcription factor bHLH106-like       122   3e-28    
gb|KDO53621.1|  hypothetical protein CISIN_1g026479mg                   122   3e-28    
gb|EYU22625.1|  hypothetical protein MIMGU_mgv1a012168mg                122   3e-28    
gb|EMS47100.1|  Transcription factor bHLH51                             122   4e-28    
gb|KHN04774.1|  Transcription factor bHLH51                             122   4e-28    
ref|NP_001235786.1|  uncharacterized protein LOC100305722               122   5e-28    
ref|XP_003519403.2|  PREDICTED: transcription factor bHLH51-like        122   5e-28    
ref|XP_009787651.1|  PREDICTED: transcription factor bHLH51             121   6e-28    
gb|EMS46917.1|  Transcription factor bHLH51                             121   6e-28    
ref|XP_009406646.1|  PREDICTED: transcription factor bHLH30-like ...    122   6e-28    
ref|XP_009621535.1|  PREDICTED: transcription factor bHLH30             121   7e-28    
ref|XP_009406645.1|  PREDICTED: transcription factor bHLH30-like ...    122   8e-28    
ref|XP_003608130.1|  Transcription factor bHLH30                        118   8e-28    
ref|XP_009336630.1|  PREDICTED: transcription factor bHLH30             123   8e-28    
ref|XP_007008919.1|  Basic helix-loop-helix DNA-binding superfami...    121   9e-28    
ref|XP_008389318.1|  PREDICTED: transcription factor bHLH30             122   1e-27    
ref|XP_008457214.1|  PREDICTED: transcription factor bHLH30-like        121   1e-27    
ref|XP_009406644.1|  PREDICTED: transcription factor bHLH30-like ...    122   1e-27    
gb|EPS73028.1|  hypothetical protein M569_01726                         119   1e-27    
ref|XP_004500503.1|  PREDICTED: transcription factor bHLH51-like        120   1e-27    
gb|ACJ85198.1|  unknown                                                 120   1e-27    Medicago truncatula
ref|XP_008339707.1|  PREDICTED: transcription factor bHLH30-like        122   1e-27    
gb|AFK42415.1|  unknown                                                 120   1e-27    
ref|XP_011077316.1|  PREDICTED: transcription factor bHLH30             122   2e-27    
ref|XP_009409645.1|  PREDICTED: transcription factor bHLH30-like        123   2e-27    
ref|XP_008809828.1|  PREDICTED: transcription factor bHLH30-like        122   2e-27    
ref|XP_009383631.1|  PREDICTED: transcription factor bHLH30-like        122   2e-27    
ref|XP_004291761.1|  PREDICTED: transcription factor bHLH106-like       119   2e-27    
ref|XP_004141200.1|  PREDICTED: transcription factor bHLH106-like       119   2e-27    
ref|XP_011070838.1|  PREDICTED: transcription factor bHLH30             121   2e-27    
ref|XP_006362528.1|  PREDICTED: transcription factor bHLH30-like        120   3e-27    
ref|XP_010055825.1|  PREDICTED: transcription factor bHLH106            119   3e-27    
ref|XP_006836269.1|  hypothetical protein AMTR_s00101p00150740          119   3e-27    
ref|XP_003516856.1|  PREDICTED: transcription factor bHLH30-like ...    121   3e-27    
ref|XP_011075449.1|  PREDICTED: transcription factor bHLH106            119   3e-27    
ref|XP_008805006.1|  PREDICTED: transcription factor bHLH51-like        119   4e-27    
ref|XP_008792668.1|  PREDICTED: transcription factor bHLH51-like        119   4e-27    
ref|XP_004496205.1|  PREDICTED: transcription factor bHLH30-like        121   4e-27    
gb|AFK48809.1|  unknown                                                 119   5e-27    
ref|XP_009356151.1|  PREDICTED: transcription factor bHLH30             120   6e-27    
ref|XP_006826892.1|  hypothetical protein AMTR_s00010p00144270          120   6e-27    
ref|XP_002462365.1|  hypothetical protein SORBIDRAFT_02g024460          120   7e-27    Sorghum bicolor [broomcorn]
gb|KDP29359.1|  hypothetical protein JCGZ_18280                         120   7e-27    
ref|XP_002524402.1|  DNA binding protein, putative                      120   8e-27    Ricinus communis
ref|XP_010262767.1|  PREDICTED: transcription factor bHLH30-like        120   8e-27    
ref|XP_006366064.1|  PREDICTED: transcription factor bHLH30-like ...    118   1e-26    
ref|XP_011021594.1|  PREDICTED: transcription factor bHLH30-like        120   1e-26    
ref|XP_002311433.1|  basic helix-loop-helix family protein              119   1e-26    Populus trichocarpa [western balsam poplar]
emb|CDM81548.1|  unnamed protein product                                117   1e-26    
gb|EEC83619.1|  hypothetical protein OsI_29333                          119   1e-26    Oryza sativa Indica Group [Indian rice]
ref|NP_001061870.1|  Os08g0432800                                       119   1e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667787.1|  PREDICTED: uncharacterized protein LOC100279...    119   2e-26    
ref|XP_002971937.1|  hypothetical protein SELMODRAFT_412681             115   2e-26    
ref|XP_010926474.1|  PREDICTED: transcription factor bHLH30-like        119   3e-26    
ref|XP_008782353.1|  PREDICTED: transcription factor bHLH30-like        119   3e-26    
ref|XP_009761018.1|  PREDICTED: transcription factor bHLH30-like ...    117   3e-26    
ref|XP_004238969.1|  PREDICTED: transcription factor bHLH30-like        117   3e-26    
ref|XP_009407785.1|  PREDICTED: transcription factor bHLH30-like        117   4e-26    
ref|XP_004968636.1|  PREDICTED: transcription factor bHLH30-like        116   5e-26    
ref|XP_009775277.1|  PREDICTED: transcription factor bHLH30-like        115   5e-26    
ref|XP_009761017.1|  PREDICTED: transcription factor bHLH30-like ...    117   6e-26    
ref|XP_010093397.1|  hypothetical protein L484_022960                   117   6e-26    
ref|XP_010916515.1|  PREDICTED: transcription factor bHLH30-like        118   7e-26    
gb|KHF97366.1|  Transcription factor bHLH30 -like protein               117   8e-26    
gb|KFK34915.1|  hypothetical protein AALP_AA5G210100                    113   8e-26    
ref|XP_010265276.1|  PREDICTED: transcription factor bHLH30-like        117   1e-25    
gb|AGO06019.1|  bHLH transcription factor                               116   1e-25    
ref|XP_009632043.1|  PREDICTED: transcription factor bHLH51-like        114   1e-25    
gb|KHG06567.1|  Transcription factor bHLH30 -like protein               116   1e-25    
ref|XP_002311240.1|  basic helix-loop-helix family protein              115   1e-25    Populus trichocarpa [western balsam poplar]
ref|XP_007224260.1|  hypothetical protein PRUPE_ppa019406mg             116   2e-25    
ref|XP_007143790.1|  hypothetical protein PHAVU_007G101900g             116   2e-25    
ref|XP_009614307.1|  PREDICTED: transcription factor bHLH30-like        115   2e-25    
ref|XP_010031188.1|  PREDICTED: transcription factor bHLH51             114   2e-25    
gb|KEH36579.1|  transcription factor                                    111   2e-25    
ref|XP_007153337.1|  hypothetical protein PHAVU_003G026800g             116   2e-25    
ref|XP_002457128.1|  hypothetical protein SORBIDRAFT_03g001730          114   2e-25    Sorghum bicolor [broomcorn]
ref|XP_009105430.1|  PREDICTED: transcription factor bHLH30             115   4e-25    
ref|XP_002878108.1|  basic helix-loop-helix family protein              112   4e-25    
dbj|BAK08357.1|  predicted protein                                      115   4e-25    
emb|CDX95989.1|  BnaA07g27420D                                          115   4e-25    
emb|CDY33592.1|  BnaC06g29600D                                          115   4e-25    
ref|XP_010554754.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    112   5e-25    
ref|XP_004490274.1|  PREDICTED: transcription factor bHLH30-like        113   7e-25    
ref|XP_002887206.1|  basic helix-loop-helix family protein              114   8e-25    
ref|XP_006437741.1|  hypothetical protein CICLE_v10031900mg             114   9e-25    
gb|KHG04468.1|  Transcription factor bHLH51 -like protein               112   9e-25    
ref|XP_010277476.1|  PREDICTED: transcription factor bHLH30-like        112   1e-24    
ref|XP_006484404.1|  PREDICTED: transcription factor bHLH30-like ...    114   1e-24    
ref|XP_011008616.1|  PREDICTED: transcription factor bHLH30             114   1e-24    
ref|XP_002315961.1|  basic helix-loop-helix family protein              114   1e-24    Populus trichocarpa [western balsam poplar]
ref|XP_010673045.1|  PREDICTED: transcription factor bHLH106            112   1e-24    
emb|CDY23874.1|  BnaC04g01630D                                          111   1e-24    
ref|XP_003536319.1|  PREDICTED: transcription factor bHLH30 isofo...    114   1e-24    
ref|XP_010556387.1|  PREDICTED: transcription factor AIG1-like          112   1e-24    
gb|EMT18461.1|  Transcription factor bHLH51                             112   1e-24    
ref|XP_004152736.1|  PREDICTED: transcription factor AIG1-like          110   2e-24    
ref|XP_004237007.1|  PREDICTED: transcription factor bHLH30-like        112   2e-24    
ref|XP_006486295.1|  PREDICTED: transcription factor bHLH51-like ...    111   2e-24    
ref|XP_004135410.1|  PREDICTED: transcription factor bHLH30-like        113   2e-24    
emb|CDY04259.1|  BnaC06g25560D                                          113   2e-24    
ref|XP_008673531.1|  PREDICTED: transcription factor bHLH106-like...    112   2e-24    
emb|CDX79957.1|  BnaA05g01990D                                          111   2e-24    
ref|XP_008653882.1|  PREDICTED: transcription factor bHLH30-like        113   2e-24    
ref|XP_010505877.1|  PREDICTED: transcription factor bHLH106-like       111   2e-24    
ref|XP_009141971.1|  PREDICTED: transcription factor bHLH106            111   3e-24    
gb|KGN52045.1|  hypothetical protein Csa_5G608330                       113   3e-24    
ref|XP_008243163.1|  PREDICTED: transcription factor bHLH30-like        112   3e-24    
emb|CDY57584.1|  BnaC04g56860D                                          111   3e-24    
ref|XP_002457305.1|  hypothetical protein SORBIDRAFT_03g005250          110   3e-24    
ref|XP_006435771.1|  hypothetical protein CICLE_v10032356mg             111   3e-24    
ref|XP_010066748.1|  PREDICTED: transcription factor bHLH30-like        112   3e-24    
ref|NP_564944.1|  transcription factor bHLH30                           112   3e-24    
ref|XP_010999985.1|  PREDICTED: transcription factor bHLH51-like        110   3e-24    
ref|XP_009600874.1|  PREDICTED: transcription factor bHLH51-like        110   4e-24    
ref|XP_010511901.1|  PREDICTED: transcription factor bHLH30             112   4e-24    
ref|XP_009605433.1|  PREDICTED: transcription factor bHLH30-like        110   4e-24    
gb|EMS67895.1|  Transcription factor bHLH30                             112   4e-24    
ref|XP_010508757.1|  PREDICTED: transcription factor bHLH106            110   5e-24    
ref|XP_006649780.1|  PREDICTED: transcription factor bHLH30-like        112   5e-24    
ref|XP_004172447.1|  PREDICTED: transcription factor AIG1-like          109   6e-24    
ref|XP_009142723.1|  PREDICTED: transcription factor bHLH106-like       110   6e-24    
ref|XP_008446553.1|  PREDICTED: transcription factor bHLH30-like        113   6e-24    
gb|KFK36960.1|  hypothetical protein AALP_AA4G195000                    110   6e-24    
ref|NP_001049619.1|  Os03g0260600                                       112   6e-24    
ref|NP_191236.1|  putative transcription factor bHLH107                 109   7e-24    
ref|NP_001241119.1|  uncharacterized protein LOC100785826               111   7e-24    
ref|XP_004984717.1|  PREDICTED: transcription factor bHLH30-like        112   7e-24    
ref|XP_010415517.1|  PREDICTED: transcription factor bHLH30             112   7e-24    
ref|XP_006391094.1|  hypothetical protein EUTSA_v10018758mg             112   7e-24    
ref|XP_006838363.1|  hypothetical protein AMTR_s00002p00019320          109   8e-24    
emb|CBI27073.3|  unnamed protein product                                110   8e-24    
ref|XP_009105020.1|  PREDICTED: transcription factor bHLH30-like        111   9e-24    
ref|XP_006302435.1|  hypothetical protein CARUB_v10020515mg             111   9e-24    
ref|XP_011035908.1|  PREDICTED: transcription factor bHLH51-like        109   9e-24    
ref|XP_010517596.1|  PREDICTED: transcription factor bHLH106-like...    109   1e-23    
gb|EYU18611.1|  hypothetical protein MIMGU_mgv1a013667mg                108   1e-23    
ref|XP_006661325.1|  PREDICTED: transcription factor bHLH30-like        108   1e-23    
emb|CDY22504.1|  BnaC03g23140D                                          109   1e-23    
ref|XP_007046318.1|  Basic helix-loop-helix DNA-binding superfami...    110   1e-23    
ref|XP_006294851.1|  hypothetical protein CARUB_v10023903mg             109   1e-23    
ref|NP_001042409.1|  Os01g0218100                                       109   1e-23    
gb|EMT18288.1|  Transcription factor bHLH30                             112   1e-23    
ref|XP_004968277.1|  PREDICTED: transcription factor bHLH30-like ...    108   1e-23    
ref|XP_002316199.1|  basic helix-loop-helix family protein              108   2e-23    
ref|XP_002278697.1|  PREDICTED: transcription factor bHLH30             110   2e-23    
gb|KFK41315.1|  hypothetical protein AALP_AA2G114200                    110   2e-23    
ref|NP_001159035.1|  DNA binding protein                                107   2e-23    
ref|XP_010502451.1|  PREDICTED: transcription factor AIG1-like          110   2e-23    
ref|XP_003576618.1|  PREDICTED: transcription factor bHLH30-like        107   3e-23    
emb|CDX83546.1|  BnaC07g22860D                                          109   3e-23    
ref|XP_009152118.1|  PREDICTED: transcription factor AIG1               109   3e-23    
ref|XP_010542484.1|  PREDICTED: transcription factor bHLH106-like       107   3e-23    
ref|XP_002468148.1|  hypothetical protein SORBIDRAFT_01g040450          110   3e-23    
ref|XP_008444933.1|  PREDICTED: transcription factor bHLH30-like        107   3e-23    
ref|XP_002528314.1|  hypothetical protein RCOM_0838610                  108   4e-23    
emb|CDY07066.1|  BnaA04g22490D                                          107   4e-23    
emb|CDX93211.1|  BnaC04g46850D                                          107   5e-23    
ref|XP_009129036.1|  PREDICTED: transcription factor AIG1-like          108   6e-23    
ref|XP_006643781.1|  PREDICTED: transcription factor bHLH30-like        107   7e-23    
ref|XP_002862876.1|  hypothetical protein ARALYDRAFT_497265             106   8e-23    
ref|XP_008667590.1|  PREDICTED: putative HLH DNA-binding domain s...    105   8e-23    
ref|XP_006346749.1|  PREDICTED: transcription factor bHLH30-like        106   8e-23    
ref|XP_010534610.1|  PREDICTED: transcription factor bHLH51             106   9e-23    
gb|KFK35066.1|  transcription factor bhlh30                             108   1e-22    
emb|CDX99756.1|  BnaC02g35640D                                          108   1e-22    
ref|XP_010470846.1|  PREDICTED: transcription factor bHLH30-like        108   1e-22    
ref|NP_189199.1|  transcription factor BHLH32                           108   1e-22    
ref|NP_181646.1|  transcription factor bHLH106                          106   1e-22    
gb|AAL69455.1|  At2g41130/T3K9.10                                       106   1e-22    
ref|XP_010107684.1|  hypothetical protein L484_007702                   105   1e-22    
ref|XP_010528040.1|  PREDICTED: transcription factor AIG1-like          107   1e-22    
ref|XP_002879910.1|  basic helix-loop-helix family protein              106   2e-22    
ref|XP_010508894.1|  PREDICTED: transcription factor bHLH51-like        106   2e-22    
ref|XP_006294672.1|  hypothetical protein CARUB_v10023707mg             107   2e-22    
ref|XP_009773084.1|  PREDICTED: transcription factor bHLH30-like ...    105   2e-22    
ref|XP_003558309.1|  PREDICTED: transcription factor bHLH30-like        108   2e-22    
ref|XP_010505745.1|  PREDICTED: transcription factor bHLH51-like        105   2e-22    
ref|XP_002879855.1|  basic helix-loop-helix family protein              105   3e-22    
emb|CDM82164.1|  unnamed protein product                                110   3e-22    
ref|XP_006411274.1|  hypothetical protein EUTSA_v10017126mg             105   3e-22    
ref|XP_009141875.1|  PREDICTED: transcription factor bHLH51-like        105   4e-22    
ref|XP_010664396.1|  PREDICTED: transcription factor bHLH30-like ...    103   4e-22    
emb|CDP00569.1|  unnamed protein product                                106   4e-22    
emb|CDY24921.1|  BnaC03g22510D                                          104   4e-22    
ref|XP_006411379.1|  hypothetical protein EUTSA_v10017546mg             104   4e-22    
ref|XP_004957057.1|  PREDICTED: transcription factor bHLH30-like        103   5e-22    
ref|NP_001042087.1|  Os01g0159800                                       104   5e-22    
ref|XP_009402228.1|  PREDICTED: transcription factor bHLH30-like        104   5e-22    
ref|NP_181549.1|  transcription factor bHLH51                           104   5e-22    
ref|XP_010517436.1|  PREDICTED: transcription factor bHLH51             104   5e-22    
ref|XP_006395631.1|  hypothetical protein EUTSA_v10004524mg             106   5e-22    
ref|XP_010664394.1|  PREDICTED: transcription factor bHLH30-like ...    103   5e-22    
ref|XP_003578101.1|  PREDICTED: transcription factor bHLH30-like        105   6e-22    
ref|XP_008660319.1|  PREDICTED: transcription factor AIG1-like          107   6e-22    
ref|XP_006291336.1|  hypothetical protein CARUB_v10017470mg             105   1e-21    
ref|XP_002444528.1|  hypothetical protein SORBIDRAFT_07g023280          103   1e-21    
ref|XP_004956791.1|  PREDICTED: transcription factor bHLH30-like        104   1e-21    
gb|KFK36676.1|  hypothetical protein AALP_AA4G155400                    103   1e-21    
ref|XP_008775224.1|  PREDICTED: transcription factor bHLH30-like        102   1e-21    
ref|XP_004236697.1|  PREDICTED: transcription factor bHLH30-like        103   1e-21    
gb|KDP41473.1|  hypothetical protein JCGZ_15880                         103   2e-21    
ref|XP_003572226.1|  PREDICTED: transcription factor AIG1-like          104   2e-21    
ref|XP_006291776.1|  hypothetical protein CARUB_v10017947mg             102   2e-21    
dbj|BAJ99225.1|  predicted protein                                      103   3e-21    
gb|KCW68487.1|  hypothetical protein EUGRSUZ_F02138                     101   3e-21    
ref|NP_001062047.1|  Os08g0477900                                       101   3e-21    
ref|XP_008678584.1|  PREDICTED: transcription factor AIG1-like          104   3e-21    
emb|CAN74017.1|  hypothetical protein VITISV_003554                     103   4e-21    
ref|XP_010425221.1|  PREDICTED: transcription factor AIG1               103   4e-21    
ref|XP_009392028.1|  PREDICTED: transcription factor AIG1-like          100   5e-21    
ref|XP_002445543.1|  hypothetical protein SORBIDRAFT_07g021170          103   6e-21    
ref|XP_002514035.1|  DNA binding protein, putative                      101   6e-21    
ref|NP_001168590.1|  putative HLH DNA-binding domain superfamily ...    101   7e-21    
gb|AFW77177.1|  putative HLH DNA-binding domain superfamily protein     101   7e-21    
ref|XP_010064697.1|  PREDICTED: transcription factor bHLH106-like       101   8e-21    
ref|XP_010514188.1|  PREDICTED: transcription factor AIG1-like          102   8e-21    
dbj|BAD33952.1|  bHLH-like protein                                      100   8e-21    
ref|XP_009773083.1|  PREDICTED: transcription factor bHLH30-like ...    101   8e-21    
ref|XP_002875272.1|  hypothetical protein ARALYDRAFT_484332             102   8e-21    
ref|NP_001152068.1|  DNA binding protein                                101   9e-21    
ref|XP_008362031.1|  PREDICTED: transcription factor bHLH30-like        100   9e-21    
gb|EAZ09408.1|  hypothetical protein OsI_31681                          100   1e-20    
gb|EAZ45028.1|  hypothetical protein OsJ_29666                        99.8    1e-20    
ref|XP_007224658.1|  hypothetical protein PRUPE_ppa026166mg           99.8    2e-20    
ref|XP_009133422.1|  PREDICTED: transcription factor bHLH51-like        100   2e-20    
ref|XP_003565367.1|  PREDICTED: transcription factor bHLH51-like        100   2e-20    
ref|XP_003565499.1|  PREDICTED: transcription factor bHLH30-like        100   2e-20    
ref|XP_009602423.1|  PREDICTED: transcription factor bHLH106-like     99.8    2e-20    
gb|ABJ96374.1|  hypothetical protein                                  99.8    2e-20    
ref|XP_010942676.1|  PREDICTED: transcription factor bHLH30-like      99.0    2e-20    
ref|XP_009417611.1|  PREDICTED: transcription factor bHLH30-like      99.0    3e-20    
ref|XP_009344703.1|  PREDICTED: transcription factor bHLH30-like      99.4    3e-20    
ref|XP_004973698.1|  PREDICTED: transcription factor bHLH30-like      99.4    3e-20    
ref|XP_004973505.1|  PREDICTED: transcription factor bHLH30-like      99.0    6e-20    
gb|EEC83745.1|  hypothetical protein OsI_29608                          100   7e-20    
ref|XP_003572297.1|  PREDICTED: transcription factor AIG1-like        98.2    1e-19    
ref|XP_006338818.1|  PREDICTED: transcription factor bHLH51-like      97.8    1e-19    
ref|XP_006362291.1|  PREDICTED: transcription factor bHLH106-like     97.4    1e-19    
ref|XP_008664537.1|  PREDICTED: transcription factor bHLH30-like      97.4    2e-19    
gb|EPS64790.1|  hypothetical protein M569_09991                       95.9    2e-19    
ref|XP_002460360.1|  hypothetical protein SORBIDRAFT_02g026920        96.7    2e-19    
ref|XP_009618077.1|  PREDICTED: transcription factor bHLH30-like      94.7    3e-19    
ref|XP_008786854.1|  PREDICTED: transcription factor bHLH106-like     96.3    3e-19    
ref|XP_004249130.1|  PREDICTED: transcription factor bHLH106          96.7    4e-19    
ref|XP_009410434.1|  PREDICTED: putative transcription factor bHL...  96.3    4e-19    
ref|XP_010931526.1|  PREDICTED: transcription factor bHLH106-like     96.3    4e-19    
ref|XP_009413957.1|  PREDICTED: transcription factor bHLH106-like     95.9    5e-19    
gb|EYU30944.1|  hypothetical protein MIMGU_mgv1a020061mg              95.1    6e-19    
ref|XP_004240923.1|  PREDICTED: transcription factor bHLH51           95.1    7e-19    
ref|XP_010504585.1|  PREDICTED: putative transcription factor bHL...  95.5    7e-19    
ref|XP_009757856.1|  PREDICTED: transcription factor bHLH106-like     95.5    9e-19    
ref|XP_011097486.1|  PREDICTED: transcription factor bHLH30-like      94.4    1e-18    
tpg|DAA61822.1|  TPA: putative HLH DNA-binding domain superfamily...  94.7    1e-18    
ref|XP_004138418.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  94.0    1e-18    
ref|XP_006433837.1|  hypothetical protein CICLE_v10002205mg           94.7    2e-18    
ref|XP_006402950.1|  hypothetical protein EUTSA_v10006410mg           94.0    3e-18    
dbj|BAJ99740.1|  predicted protein                                    93.6    3e-18    
ref|XP_008788501.1|  PREDICTED: transcription factor bHLH106-like     92.8    6e-18    
gb|EMT07976.1|  Putative transcription factor bHLH107                 90.9    6e-18    
ref|XP_006472481.1|  PREDICTED: transcription factor bHLH30-like      93.2    6e-18    
ref|XP_008235541.1|  PREDICTED: transcription factor bHLH131-like     92.4    6e-18    
ref|NP_001150998.1|  DNA binding protein                              92.4    8e-18    
ref|XP_010427516.1|  PREDICTED: putative transcription factor bHL...  92.4    8e-18    
ref|XP_004489760.1|  PREDICTED: transcription factor bHLH131-like     92.0    9e-18    
gb|EAZ09073.1|  hypothetical protein OsI_31335                        94.4    9e-18    
dbj|BAD28357.1|  DNA binding protein-like                             94.4    1e-17    
ref|XP_010922068.1|  PREDICTED: transcription factor bHLH106-like     91.3    2e-17    
emb|CAN71125.1|  hypothetical protein VITISV_015024                   88.2    2e-17    
gb|AFW62266.1|  putative HLH DNA-binding domain superfamily protein   92.0    4e-17    
gb|EPS57585.1|  hypothetical protein M569_17232                       88.6    4e-17    
ref|XP_009345719.1|  PREDICTED: transcription factor bHLH131-like     91.3    5e-17    
ref|XP_010516280.1|  PREDICTED: putative transcription factor bHL...  90.5    5e-17    
ref|XP_008373852.1|  PREDICTED: transcription factor bHLH131-like     89.4    7e-17    
ref|XP_007206526.1|  hypothetical protein PRUPE_ppa019545mg           89.4    7e-17    
ref|XP_003613073.1|  Transcription factor bHLH131                     93.2    8e-17    
ref|XP_006655021.1|  PREDICTED: transcription factor bHLH51-like      90.1    9e-17    
gb|KHG10701.1|  Transcription factor bHLH30 -like protein             89.0    1e-16    
gb|KHN14515.1|  Transcription factor bHLH131                          88.2    1e-16    
ref|XP_010680330.1|  PREDICTED: transcription factor bHLH30-like      89.0    2e-16    
ref|XP_006573014.1|  PREDICTED: transcription factor bHLH131-like     88.2    2e-16    
gb|EMS57933.1|  Transcription factor bHLH51                           87.8    3e-16    
ref|XP_011099996.1|  PREDICTED: transcription factor bHLH30-like      87.8    3e-16    
gb|EMT17812.1|  Transcription factor bHLH51                           86.7    6e-16    
gb|EAZ43085.1|  hypothetical protein OsJ_27676                        85.9    1e-15    
ref|XP_006338133.1|  PREDICTED: putative transcription factor bHL...  85.5    2e-15    
ref|XP_006660214.1|  PREDICTED: transcription factor bHLH30-like      84.7    2e-15    
ref|XP_011016920.1|  PREDICTED: transcription factor bHLH30-like      85.5    3e-15    
gb|KHN38580.1|  Transcription factor bHLH51                           84.0    3e-15    
ref|XP_003566506.1|  PREDICTED: transcription factor bHLH30-like      84.7    3e-15    
gb|KEH36580.1|  transcription factor                                  82.0    5e-15    
ref|XP_004978282.1|  PREDICTED: transcription factor bHLH51-like      84.7    5e-15    
ref|XP_004238538.1|  PREDICTED: putative transcription factor bHL...  82.8    1e-14    
tpg|DAA49008.1|  TPA: putative HLH DNA-binding domain superfamily...  83.6    1e-14    
gb|KHN00414.1|  Transcription factor bHLH131                          82.4    1e-14    
ref|XP_006574643.1|  PREDICTED: transcription factor bHLH131-like     82.8    2e-14    
gb|EAZ11049.1|  hypothetical protein OsJ_00893                        79.7    2e-14    
ref|NP_001054739.1|  Os05g0163900                                     82.8    3e-14    
ref|XP_006484405.1|  PREDICTED: transcription factor bHLH30-like ...  83.6    3e-14    
ref|XP_003518258.1|  PREDICTED: transcription factor bHLH30-like      82.0    4e-14    
ref|XP_006660151.1|  PREDICTED: transcription factor bHLH30-like      80.9    7e-14    
tpg|DAA44489.1|  TPA: hypothetical protein ZEAMMB73_701880            79.3    2e-13    
ref|XP_002310312.2|  hypothetical protein POPTR_0007s14360g           79.0    3e-13    
ref|XP_002440667.1|  hypothetical protein SORBIDRAFT_09g004820        79.0    4e-13    
ref|XP_003615282.1|  Transcription factor AIG1                        79.0    4e-13    
ref|XP_011021839.1|  PREDICTED: transcription factor bHLH131-like     78.6    4e-13    
gb|KDO60595.1|  hypothetical protein CISIN_1g041818mg                 77.4    5e-13    
gb|EAY89324.1|  hypothetical protein OsI_10828                        80.9    5e-13    
ref|XP_009779545.1|  PREDICTED: putative transcription factor bHL...  78.2    6e-13    
ref|XP_010689462.1|  PREDICTED: transcription factor bHLH51           79.0    6e-13    
ref|XP_008440558.1|  PREDICTED: transcription factor bHLH131-like     77.8    8e-13    
gb|KDO60596.1|  hypothetical protein CISIN_1g040546mg                 77.4    1e-12    
ref|XP_004143550.1|  PREDICTED: transcription factor bHLH131-like     77.4    1e-12    
gb|EEE69691.1|  hypothetical protein OsJ_29328                        77.0    1e-12    
gb|KEH27738.1|  helix loop helix DNA-binding domain protein           77.0    1e-12    
gb|KGN48710.1|  hypothetical protein Csa_6G499060                     77.0    1e-12    
emb|CDX76011.1|  BnaA04g02750D                                        76.3    2e-12    
ref|XP_007158377.1|  hypothetical protein PHAVU_002G148000g           75.9    3e-12    
ref|XP_009139074.1|  PREDICTED: putative transcription factor bHL...  75.9    4e-12    
ref|XP_007141266.1|  hypothetical protein PHAVU_008G181500g           75.9    4e-12    
gb|EYU40857.1|  hypothetical protein MIMGU_mgv1a026819mg              73.9    4e-12    
ref|XP_004490443.1|  PREDICTED: transcription factor bHLH30-like      75.9    5e-12    
gb|KFK33352.1|  hypothetical protein AALP_AA5G002800                  75.5    5e-12    
ref|XP_008673530.1|  PREDICTED: uncharacterized protein LOC103649...  76.3    5e-12    
ref|XP_009591424.1|  PREDICTED: transcription factor bHLH30-like      75.1    6e-12    
emb|CDX90384.1|  BnaA08g16000D                                        73.9    7e-12    
ref|XP_006466570.1|  PREDICTED: uncharacterized protein LOC102609605  77.4    8e-12    



>ref|XP_009786357.1| PREDICTED: transcription factor bHLH30-like [Nicotiana sylvestris]
Length=252

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 195/254 (77%), Positives = 230/254 (91%), Gaps = 2/254 (1%)
 Frame = -2

Query  1062  MEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
             MEFFNSF G   E+YG Q ++ NGS+SSSSL+LD E+GELV+A+VRPG+KGVNPEKALIA
Sbjct  1     MEFFNSFNGH-YEDYGFQGIMTNGSTSSSSLILDNERGELVKAMVRPGEKGVNPEKALIA  59

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             L+NHSEAERRRRERINGHL TLR+LIPGTNKMDKAALL KVIS IK+LR +A+EATKG+L
Sbjct  60    LKNHSEAERRRRERINGHLGTLRNLIPGTNKMDKAALLAKVISHIKDLRVNAAEATKGVL  119

Query  702   VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
             VPTD DEV VEQQAEG  GA+YS+KASLCC+YKHEL+S+LRQALD LPLKT+RAE+ATLG
Sbjct  120   VPTDIDEVCVEQQAEGSGGATYSVKASLCCEYKHELISDLRQALDTLPLKTVRAEIATLG  179

Query  522   SRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvS  343
             +RMVS+FV+TE +EGN ++ER + L ++V QALRSVLDKFYASEEFSSR++LSSKRRRVS
Sbjct  180   NRMVSVFVITEGDEGN-TNERCQLLVTTVRQALRSVLDKFYASEEFSSRSTLSSKRRRVS  238

Query  342   FLNssassSLGDFW  301
              L+SS+SSSLGDFW
Sbjct  239   LLDSSSSSSLGDFW  252



>ref|XP_009611307.1| PREDICTED: transcription factor bHLH30-like [Nicotiana tomentosiformis]
Length=254

 Score =   328 bits (840),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 196/255 (77%), Positives = 226/255 (89%), Gaps = 2/255 (1%)
 Frame = -2

Query  1062  MEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
             MEFFNSF GF  E+YG Q ++ NGS+ SSSL+LD E+GELV+A+VR  QKGVNPEKALIA
Sbjct  1     MEFFNSFNGF-YEDYGFQGIMANGSTPSSSLILDNERGELVKAMVRQEQKGVNPEKALIA  59

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             L+NHSEAERRRRERINGHL TLR+LIPGTNKMDKAALL KVIS IK+LR +A+EATKG+L
Sbjct  60    LKNHSEAERRRRERINGHLGTLRNLIPGTNKMDKAALLAKVISHIKDLRVNAAEATKGVL  119

Query  702   VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
             VPTD DEV VEQQAEG  GA+YS+KAS+CC+YKHEL+S+LRQALD LPLKTLRAE+ATLG
Sbjct  120   VPTDIDEVCVEQQAEGSGGATYSVKASVCCEYKHELISDLRQALDTLPLKTLRAEIATLG  179

Query  522   SRMVSLFVVTENEEGNDSD-ERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrv  346
             +RMVS+FV+TE  EGN  D ER + L +SV QALRSVLDKFYASEEFSSR++LSSKRRRV
Sbjct  180   NRMVSVFVITEGNEGNIEDNERCQLLVTSVRQALRSVLDKFYASEEFSSRSTLSSKRRRV  239

Query  345   SFLNssassSLGDFW  301
             S L+SS+SSSLGDFW
Sbjct  240   SLLDSSSSSSLGDFW  254



>ref|XP_004243409.1| PREDICTED: transcription factor bHLH30-like [Solanum lycopersicum]
Length=255

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 198/255 (78%), Positives = 223/255 (87%), Gaps = 1/255 (0%)
 Frame = -2

Query  1062  MEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
             MEF +SF G +    G Q +I NG SSSSSLVLD E GELV+A+V+PG KGVNPEKALIA
Sbjct  1     MEFLSSFNGLNEVYGGFQGIIGNGLSSSSSLVLDNESGELVKAMVKPGGKGVNPEKALIA  60

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             L+NHSEAERRRRERINGHL TLR+LIPGTNKMDKAALL KVI  IKELR +A+EATKG+L
Sbjct  61    LKNHSEAERRRRERINGHLGTLRNLIPGTNKMDKAALLAKVIGHIKELRVNAAEATKGVL  120

Query  702   VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
             VPTD DEV+VEQQAEG DGA+YS+KASLCCDYKHEL+S+LRQALD LPLKTLRAE+ATLG
Sbjct  121   VPTDIDEVKVEQQAEGSDGATYSVKASLCCDYKHELISDLRQALDTLPLKTLRAEIATLG  180

Query  522   SRMVSLFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrv  346
             SRMVS+FV+TE  EGN +  ER + L +SV QALRSVLDKFYASEEFSSR++LSSKRRRV
Sbjct  181   SRMVSVFVITEGNEGNTEGTERCQLLITSVRQALRSVLDKFYASEEFSSRSTLSSKRRRV  240

Query  345   SFLNssassSLGDFW  301
             S LNSS+SSSLGDFW
Sbjct  241   SLLNSSSSSSLGDFW  255



>ref|XP_006348853.1| PREDICTED: transcription factor bHLH30-like [Solanum tuberosum]
Length=255

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 220/255 (86%), Gaps = 1/255 (0%)
 Frame = -2

Query  1062  MEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
             M+F +SF G +    G Q +I NG SSSSSLVLD E  ELV+A+V+PG KG N EKALIA
Sbjct  1     MDFLSSFNGLNEVYGGFQGIIGNGLSSSSSLVLDNESSELVKAMVKPGGKGDNQEKALIA  60

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             L+NHSEAERRRRERINGHL TLR+LIPGTNKMDKAALL KVI  IKELR +A+EATKG+L
Sbjct  61    LKNHSEAERRRRERINGHLGTLRNLIPGTNKMDKAALLAKVIGHIKELRVNAAEATKGVL  120

Query  702   VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
             VPTD DEV+VEQQ EG DGA+YS+KASLCCDYKHEL+S+LRQALD LPLKTLRAE+ATLG
Sbjct  121   VPTDIDEVKVEQQPEGSDGATYSVKASLCCDYKHELISDLRQALDTLPLKTLRAEIATLG  180

Query  522   SRMVSLFVVTENEEGNDSD-ERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrv  346
             SRMVS+FV+TE  EGN  D ER + L +SV QALRSVLDKFYASEEFSSR++LSSKRRRV
Sbjct  181   SRMVSVFVITEGNEGNIEDTERCQLLITSVRQALRSVLDKFYASEEFSSRSTLSSKRRRV  240

Query  345   SFLNssassSLGDFW  301
             SFLNSS+SSSLGDFW
Sbjct  241   SFLNSSSSSSLGDFW  255



>ref|XP_011100403.1| PREDICTED: transcription factor bHLH30-like [Sesamum indicum]
Length=262

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 189/260 (73%), Positives = 220/260 (85%), Gaps = 2/260 (1%)
 Frame = -2

Query  1074  EKKKMEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEK  895
             ++KKMEFFN+  GF     G Q +IRNGSSSSSSLVLD ++GELVRALV+PGQK  N EK
Sbjct  3     KQKKMEFFNTSDGFPANYLGFQELIRNGSSSSSSLVLDNQRGELVRALVKPGQKVANAEK  62

Query  894   ALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEAT  715
             ALIALRNHSEAERRRRERINGHL+TLRSLIPGTNKMDKAALL +VI+++KELR S +EAT
Sbjct  63    ALIALRNHSEAERRRRERINGHLATLRSLIPGTNKMDKAALLAEVINQVKELRRSVAEAT  122

Query  714   KGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEM  535
              G LVPTD DEV VEQQ +  DG ++SI+ASLCCD+KHELLSELR+AL+ALPLK +RAEM
Sbjct  123   DGTLVPTDIDEVTVEQQEDLNDGTAFSIRASLCCDFKHELLSELREALEALPLKMIRAEM  182

Query  534   ATLGSRMVSLFVVTENEEGNDSDERR--EFLASSVHQALRSVLDKFYASEEFssrtslss  361
             ATLGSRMV++FV++  +EG++ + R   + L  SVHQALRSVLDKFYASEEFSSR +LS 
Sbjct  183   ATLGSRMVNVFVISGRDEGSNVEGREGGQLLVDSVHQALRSVLDKFYASEEFSSRNALSG  242

Query  360   krrrvSFLNssassSLGDFW  301
             KRRRVSF NSS SSSLGD W
Sbjct  243   KRRRVSFFNSSNSSSLGDVW  262



>emb|CDP15921.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 184/256 (72%), Positives = 219/256 (86%), Gaps = 3/256 (1%)
 Frame = -2

Query  1062  MEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
             MEFFNSF GF  ENYG Q  ++NGS SSSSL+LD EKGELVRALVRPGQKGVN EKAL+A
Sbjct  1     MEFFNSFNGFP-ENYGYQGTVKNGSGSSSSLILDNEKGELVRALVRPGQKGVNAEKALVA  59

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             LRNHSEAERRRRERINGHL++LRSLIPGT+KMDKAALL +VI+ +KELR  A+EATKG+L
Sbjct  60    LRNHSEAERRRRERINGHLTSLRSLIPGTSKMDKAALLAEVINHVKELRKKATEATKGML  119

Query  702   VPTDTDEVRVEQ-QAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATL  526
             VPTDTDEVRVE+ QA+    ASY+I+A LCCDYKHEL S+LRQAL+ LP+KT+ AE+ATL
Sbjct  120   VPTDTDEVRVEEHQADAAGEASYTIRAFLCCDYKHELFSDLRQALETLPVKTVSAEIATL  179

Query  525   GSRMVSLFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrr  349
             GSRMV++F +T  ++ N ++ E RE L +SV QALRSVLDKFYASEEF SR +LS+KRRR
Sbjct  180   GSRMVNVFEMTGCDQQNLENSEGRELLVNSVRQALRSVLDKFYASEEFLSRNALSNKRRR  239

Query  348   vSFLNssassSLGDFW  301
             VS  ++S+SSSL +FW
Sbjct  240   VSLFDASSSSSLENFW  255



>ref|XP_002280074.1| PREDICTED: transcription factor bHLH30 [Vitis vinifera]
Length=259

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 165/259 (64%), Positives = 204/259 (79%), Gaps = 5/259 (2%)
 Frame = -2

Query  1062  MEFFNS-FAGFS---TENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEK  895
             ME F++ F GFS   +EN G   +IR GSSSSS LVLD+E+GELVRA  R G   V  EK
Sbjct  1     MEGFSTDFPGFSDGFSENSGYGAIIRGGSSSSSLLVLDSERGELVRAPARLGPNEVKAEK  60

Query  894   ALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEAT  715
             A++AL+NHSEAERRRR RIN HL+TLR +IPGT KMDKA+LLG+V+S +KEL+ SA+E +
Sbjct  61    AMVALKNHSEAERRRRGRINAHLATLRGIIPGTKKMDKASLLGEVVSHLKELKRSAAEIS  120

Query  714   KGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEM  535
             KG LVP D DEVRVEQQ  G D A YSIKASLCCDYK  +LS+LR+ALD + LKT+RAE+
Sbjct  121   KGFLVPMDIDEVRVEQQEGGLDEAPYSIKASLCCDYKPGVLSDLRRALDTVHLKTVRAEI  180

Query  534   ATLGSRMVSLFVVTENEEGNDSD-ERREFLASSVHQALRSVLDKFYASEEFssrtslssk  358
             ATLG RM ++FV+T  ++GN  D E R+  A+SVHQALRSVLDKF AS++FSSR++ S+K
Sbjct  181   ATLGGRMKNVFVMTGCKDGNLEDTETRKLHANSVHQALRSVLDKFPASQDFSSRSTSSNK  240

Query  357   rrrvSFLNssassSLGDFW  301
             R+R+S  NSS+SS  GDFW
Sbjct  241   RQRISIFNSSSSSPFGDFW  259



>ref|XP_002325576.1| hypothetical protein POPTR_0019s11870g [Populus trichocarpa]
 gb|EEE99957.1| hypothetical protein POPTR_0019s11870g [Populus trichocarpa]
Length=267

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 183/242 (76%), Gaps = 1/242 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G+Q   R G SS+SSLVLD E+GELV A VR  +KGV  E+++ AL+NHSEAE++RR 
Sbjct  26    NTGLQAKTRTGPSSTSSLVLDNERGELVEATVRMERKGVAAERSIAALKNHSEAEKKRRA  85

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RIN HL TLRSL+PGT KMDKA+LL +VI+ +KEL+  A+EA++G+L+P D DEVRVEQQ
Sbjct  86    RINAHLDTLRSLVPGTRKMDKASLLAEVIAHLKELKRQATEASEGLLMPLDIDEVRVEQQ  145

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
              +G   A Y I+AS+CCD K  +LS+LRQALDAL L  ++AE+ATL  RM ++FV++  +
Sbjct  146   EDGLLSAPYVIRASICCDCKPGILSDLRQALDALHLIIMKAEIATLEGRMKNVFVMSSCK  205

Query  483   EGNDSDER-REFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNssassSLGD  307
             EG+  D +  +FLA S+HQA RS+LDKF AS+EF  +++LS+KRRRV     S SSS GD
Sbjct  206   EGDSGDAKVHQFLAGSIHQAFRSILDKFSASQEFLLKSTLSNKRRRVDSFKPSLSSSSGD  265

Query  306   FW  301
              W
Sbjct  266   LW  267



>ref|XP_006446772.1| hypothetical protein CICLE_v10016261mg [Citrus clementina]
 gb|ESR60012.1| hypothetical protein CICLE_v10016261mg [Citrus clementina]
Length=269

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G Q   RNGSSS SSLVLD+E+GELV A V+  +KGV+ ++++ AL+NH EAER RR+
Sbjct  28    NNGFQGKSRNGSSSHSSLVLDSERGELVEANVKLQRKGVSEDRSVAALKNHIEAERNRRK  87

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RINGHL TLRSLIPG  KMDKA LL +VIS++KEL  +A+EAT+G L+PTD DEV+VEQQ
Sbjct  88    RINGHLDTLRSLIPGATKMDKATLLTEVISQLKELDKNATEATEGFLIPTDIDEVKVEQQ  147

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
              +G DGA YSIKASLCC+YK  LLS+LR+ L+AL L  ++AE+ATL  RM ++FV+   +
Sbjct  148   EDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGRMKNIFVMASCK  207

Query  483   EGN-DSDERREFLASSVHQALRSVLDKFYASEEF  385
             E N ++ E  + L SSVHQA+RSVLDKF A+EEF
Sbjct  208   ELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEF  241



>ref|XP_006469029.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Citrus 
sinensis]
 gb|KDO63337.1| hypothetical protein CISIN_1g024326mg [Citrus sinensis]
Length=269

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G Q   RNGSSS SSLVLD+E+GELV A V+  +KGV+ ++++ AL+NH EAER RR+
Sbjct  28    NNGFQGKSRNGSSSHSSLVLDSERGELVEANVKLQRKGVSEDRSVAALKNHIEAERNRRK  87

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RINGHL TLRSLIPG  KMDKA LL +VIS++KEL  +A EAT+G L+PTD DEV+VEQQ
Sbjct  88    RINGHLDTLRSLIPGATKMDKATLLTEVISQLKELDKNAMEATEGFLIPTDIDEVKVEQQ  147

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
              +G DGA YSIKASLCC+YK  LLS+LR+ L+AL L  ++AE+ATL  RM ++FV+   +
Sbjct  148   EDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGRMKNIFVMASCK  207

Query  483   EGN-DSDERREFLASSVHQALRSVLDKFYASEEF  385
             E N ++ E  + L SSVHQA+RSVLDKF A+EEF
Sbjct  208   ELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEF  241



>ref|XP_006469030.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Citrus 
sinensis]
Length=268

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G Q   RNGSSS SSLVLD+E+GELV A V+  +KGV+ ++++ AL+NH EAER RR+
Sbjct  28    NNGFQGKSRNGSSSHSSLVLDSERGELVEANVKLQRKGVSEDRSVAALKNHIEAERNRRK  87

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RINGHL TLRSLIPG  KMDKA LL +VIS++KEL  +A EAT+G L+PTD DEV+VEQQ
Sbjct  88    RINGHLDTLRSLIPGATKMDKATLLTEVISQLKELDKNAMEATEGFLIPTDIDEVKVEQQ  147

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
              +G DGA YSIKASLCC+YK  LLS+LR+ L+AL L  ++AE+ATL  RM ++FV+   +
Sbjct  148   EDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGRMKNIFVMASCK  207

Query  483   EGN-DSDERREFLASSVHQALRSVLDKFYASEEF  385
             E N ++ E  + L SSVHQA+RSVLDKF A+EEF
Sbjct  208   ELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEF  241



>gb|KDP31789.1| hypothetical protein JCGZ_12250 [Jatropha curcas]
Length=266

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 178/240 (74%), Gaps = 1/240 (0%)
 Frame = -2

Query  1017  GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERI  838
             G +   RN S SSSSLVLD+++GELV A V  G+KGV  E+++ ALRNH EAER+RR RI
Sbjct  27    GFEAKTRNESCSSSSLVLDSQRGELVEATVTVGRKGVPAERSVEALRNHCEAERKRRARI  86

Query  837   NGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAE  658
             N HL TLR+L+PG  KMDKA+LL KVIS +KEL+S+A+EA++G LVPTDTDEVRVE Q  
Sbjct  87    NSHLDTLRNLVPGAKKMDKASLLAKVISYLKELKSTAAEASEGFLVPTDTDEVRVEGQEN  146

Query  657   GCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG  478
             G DG    I+ SL CDYK  LLS+LRQAL+ L L  ++AE+ATL  RM ++FV+T  +EG
Sbjct  147   GLDGTPCIIRVSLSCDYKPGLLSDLRQALNKLQLTVMQAEIATLEDRMKNVFVMTSCKEG  206

Query  477   N-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNssassSLGDFW  301
             + ++ E R  LASSVHQA+RS LDKF AS EFS +++ S KRRRV   + S SS  GD W
Sbjct  207   HSENTEVRTILASSVHQAIRSTLDKFSASHEFSLKSTFSHKRRRVPLFDPSFSSPSGDLW  266



>ref|XP_006376342.1| hypothetical protein POPTR_0013s12190g [Populus trichocarpa]
 gb|ERP54139.1| hypothetical protein POPTR_0013s12190g [Populus trichocarpa]
Length=268

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N  +Q   RNGS S+SSLVLD E+GELV A VR  +KGV+ EK++ ALRNHSEAER+RR 
Sbjct  26    NSRLQAETRNGSRSTSSLVLDNERGELVEATVRMERKGVSAEKSIAALRNHSEAERKRRA  85

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RIN HL TLRSL+PGT+KMDKA+LL +VIS +KEL+  A+ A +G+L+P D DEVRVEQ+
Sbjct  86    RINAHLDTLRSLVPGTSKMDKASLLAEVISHLKELKIQAAGAGEGLLMPLDIDEVRVEQE  145

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
              +G   A   I+AS+CCDYK E+LS LRQALDAL L   RAE+ATL  RM+++ V++  +
Sbjct  146   EDGLCSAPCLIRASICCDYKPEILSGLRQALDALHLMITRAEIATLEGRMMNVLVMSSCK  205

Query  483   EGNDSDER-REFLASSVHQALRSVLDKFYASEEF  385
             EG   D + R+FLA SVH+A RSVL+KF AS+EF
Sbjct  206   EGLGGDSKVRQFLAGSVHKAFRSVLEKFSASQEF  239



>gb|EYU41136.1| hypothetical protein MIMGU_mgv1a026524mg [Erythranthe guttata]
Length=257

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 182/238 (76%), Gaps = 14/238 (6%)
 Frame = -2

Query  972  LVLDTEKGELVRA-LVRPGQKGV-NPEKALIALRNHSEAERRRRERINGHLSTLRSLIPG  799
            LVLD E+GELVRA +V+ G+  V N +KAL+ALRNHS AERRRRERIN HL+TLR+LIPG
Sbjct  20   LVLDNERGELVRAAVVKSGRAKVGNADKALVALRNHSLAERRRRERINAHLATLRTLIPG  79

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAE----GCDGASYSI  631
            T KMDKAALLG+V++ +KELR S  EAT G LVPT+ DEV VEQ  +     C  +S SI
Sbjct  80   TVKMDKAALLGEVVNRVKELRRSMVEATNGALVPTEVDEVIVEQHKDENPNNCKPSSVSI  139

Query  630  KASLCCDYKHELLSELRQALD-ALPLKT--LRAEMATLGSRMVSLFVVT-ENEEGNDS--  469
            +ASLCCD+ HELLS+LRQALD  LPL     RAE+AT+GSRMV++F+++ +N+  N++  
Sbjct  140  RASLCCDFTHELLSDLRQALDETLPLNANITRAEIATMGSRMVNVFLISGQNDATNNAED  199

Query  468  --DERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNssassSLGDFW  301
              D+  + L +SV QAL SVLDK+YASEEFSS   + +KRRRVS  +SS+SSSLGD W
Sbjct  200  IGDQESQLLITSVRQALLSVLDKYYASEEFSSGNIVPTKRRRVSPFDSSSSSSLGDMW  257



>emb|CAN60803.1| hypothetical protein VITISV_020681 [Vitis vinifera]
Length=323

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = -2

Query  1062  MEFFNS-FAGFS---TENYGIQRMIRNGsssssSLVLDT-EKGELVRALVRPGQKGVNPE  898
             ME F++ F GFS   +EN G   +IR GSSSSSSL++   E+GELVRA  R G   V  E
Sbjct  1     MEGFSTDFPGFSDGFSENSGYGAIIRGGSSSSSSLLVLDSERGELVRAPARLGPNEVKAE  60

Query  897   KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
             KA++AL+NHSEAERRRR RIN HL+TLR +IPGT KMDKA+LLG+V+S +KEL+  A+E 
Sbjct  61    KAMVALKNHSEAERRRRGRINAHLATLRGIIPGTKKMDKASLLGEVVSHLKELKRXAAEI  120

Query  717   TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +KG LVP D DEVRVEQQ  G D A YSIKASLCCDYK  +LS+LR+ALD + LKT+RAE
Sbjct  121   SKGFLVPMDIDEVRVEQQEGGLDEAPYSIKASLCCDYKPGVLSDLRRALDTVHLKTVRAE  180

Query  537   MATLGSRMVSLFVVTENEEGNDSD-ERREFLASSVHQALR  421
             +ATLG RM ++FV+T  ++GN  D E R+  A+SVHQALR
Sbjct  181   IATLGGRMKNVFVMTGCKDGNLEDTETRKLHANSVHQALR  220



>emb|CBI21967.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -2

Query  891  LIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATK  712
            ++AL+NHSEAERRRR RIN HL+TLR +IPGT KMDKA+LLG+V+S +KEL+ SA+E +K
Sbjct  1    MVALKNHSEAERRRRGRINAHLATLRGIIPGTKKMDKASLLGEVVSHLKELKRSAAEISK  60

Query  711  GILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMA  532
            G LVP D DEVRVEQQ  G D A YSIKASLCCDYK  +LS+LR+ALD + LKT+RAE+A
Sbjct  61   GFLVPMDIDEVRVEQQEGGLDEAPYSIKASLCCDYKPGVLSDLRRALDTVHLKTVRAEIA  120

Query  531  TLGSRMVSLFVVTENEEGNDSD-ERREFLASSVHQALRSVLDKFYASEEFssrtslsskr  355
            TLG RM ++FV+T  ++GN  D E R+  A+SVHQALRSVLDKF AS++FSSR++ S+KR
Sbjct  121  TLGGRMKNVFVMTGCKDGNLEDTETRKLHANSVHQALRSVLDKFPASQDFSSRSTSSNKR  180

Query  354  rrvSFLNssassSLGDF  304
            +R+S  NSS+SS  GDF
Sbjct  181  QRISIFNSSSSSPFGDF  197



>ref|XP_004487166.1| PREDICTED: transcription factor bHLH30-like [Cicer arietinum]
Length=246

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G Q +I +G +SSSSLVLD E+GELV A V+  +KGV+PE+++ AL+NHSEAERRRR 
Sbjct  12    NDGFQGVIGSGYASSSSLVLDRERGELVEASVKLERKGVSPERSIEALKNHSEAERRRRA  71

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ  664
             RIN HL TLR++IPG NK+DKA+LL +VI+ +KEL+ +A+EA++G+++P D DE+RVE+Q
Sbjct  72    RINAHLDTLRTVIPGANKLDKASLLAEVITHLKELKINAAEASEGLMIPKDNDEIRVEEQ  131

Query  663   AEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
               G +G  YSI+ASLCC+YK  LLS++RQALDAL L  +RAE+ATLG RM ++FV+   +
Sbjct  132   ESGLNGFPYSIRASLCCEYKPGLLSDIRQALDALHLMIIRAEIATLGGRMKNVFVIISCK  191

Query  483   EGNDSD-ERREFLASSVHQALRSVLDKFYASEEF  385
             E N  D E R FLA SVHQAL+SVLD+F  S++ 
Sbjct  192   EQNFEDVEYRRFLAGSVHQALKSVLDRFSVSQDI  225



>ref|XP_002525116.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37243.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 177/250 (71%), Gaps = 4/250 (2%)
 Frame = -2

Query  1038  GFSTE---NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
             GFS E   N   +  IRNG  S+SSLVLD+++GELV A V  G+KGV+ E++  ALRNH 
Sbjct  16    GFSDEVFMNTDFEAKIRNGLCSTSSLVLDSQRGELVEATVSVGKKGVSAERSTQALRNHC  75

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAER+RR RIN HL TLRSL+PG  KMDKA+LL +VI  +KEL+ +A+  ++G+L+P D 
Sbjct  76    EAERKRRARINAHLDTLRSLVPGAKKMDKASLLAEVIKYMKELKMTAAGVSEGLLMPMDV  135

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DEVRVE Q +  DGA   I+ SLCCDYK  LLS+LR+ALDAL L  +R+E+ATL  RM +
Sbjct  136   DEVRVEGQDDKVDGAPCMIRISLCCDYKPGLLSDLRRALDALHLIVMRSEIATLEGRMKN  195

Query  507   LFVVTENEEGND-SDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNs  331
             + V+T  +E +    E  + LA SV QA+RS+LDKF AS E S +++LS KR+RVS  + 
Sbjct  196   VLVMTSCKEAHSGCTEVHKLLACSVQQAIRSILDKFSASHELSLKSTLSHKRQRVSLFDP  255

Query  330   sassSLGDFW  301
               SSS GD W
Sbjct  256   HFSSSSGDIW  265



>gb|KEH39268.1| transcription factor bHLH107-like protein [Medicago truncatula]
Length=247

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 171/224 (76%), Gaps = 1/224 (0%)
 Frame = -2

Query  1053  FNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRN  874
              + FA     +   Q +  NG  SSSSLVLD EKGELV A V+  +KGV+PE+++ AL+N
Sbjct  3     MDDFASSRINDGCFQGVNGNGYGSSSSLVLDREKGELVEAAVKLERKGVSPERSIEALKN  62

Query  873   HSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPT  694
             HSEAERRRR RIN HL TLRS+IPG NK+DKA+LL +VI+ +KEL+++A++A++G+++P 
Sbjct  63    HSEAERRRRARINSHLDTLRSVIPGANKLDKASLLAEVITHLKELKTNAAQASEGLVIPK  122

Query  693   DTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRM  514
             D+DE+RVE Q  G +G  YSI+ASLCC+YK  LLS++R+ALDAL L  +RAE+ATLG RM
Sbjct  123   DSDEIRVESQEGGLNGLPYSIRASLCCEYKPGLLSDIRKALDALHLMIIRAEIATLGGRM  182

Query  513   VSLFVVTENEEGNDSD-ERREFLASSVHQALRSVLDKFYASEEF  385
              ++FV+   +E N  D E R+FLA SVHQALRSVLD+F  S++ 
Sbjct  183   KNVFVIISCKEQNFEDAEYRQFLAGSVHQALRSVLDRFSVSQDI  226



>ref|XP_003539550.2| PREDICTED: transcription factor bHLH30-like [Glycine max]
 gb|KHN27934.1| Transcription factor bHLH30 [Glycine soja]
Length=249

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 166/208 (80%), Gaps = 1/208 (0%)
 Frame = -2

Query  1005  MIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHL  826
             +I NG  SSSSLVLD EKGELV A V+  +KGV+PE+++ AL+NHSEAERRRR RIN HL
Sbjct  21    VIGNGYGSSSSLVLDKEKGELVEAPVKLERKGVSPERSIEALKNHSEAERRRRARINAHL  80

Query  825   STLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDG  646
              TLRS+IPG  K+DKA LLG+VI  +K+L+++A++A++G+++P D+DE+R+E+Q  G +G
Sbjct  81    DTLRSVIPGAKKLDKATLLGEVIRHLKDLKTNAAQASEGLMIPKDSDEIRIEEQEGGLNG  140

Query  645   ASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD  466
               YSI+ASLCC+YK  LL+++RQALDAL L  +RAE+ATLG RM ++FV+   +E N  D
Sbjct  141   FPYSIRASLCCEYKPGLLTDIRQALDALHLMIIRAEIATLGGRMKNVFVIINCKEQNVED  200

Query  465   -ERREFLASSVHQALRSVLDKFYASEEF  385
              E R+FLA SVHQALRSVLD+F  S++ 
Sbjct  201   AEYRQFLAGSVHQALRSVLDRFSVSQDM  228



>ref|XP_010279103.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
Length=261

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 173/228 (76%), Gaps = 3/228 (1%)
 Frame = -2

Query  1065  KMEFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALI  886
             K EF   F GFS  N G + M R+GS+SSSSLVLD+E+GELV+A  + GQK ++ EKA+ 
Sbjct  13    KTEFPKLFDGFSP-NAGFRMMGRSGSASSSSLVLDSERGELVKAPEKLGQKAISEEKAIA  71

Query  885   ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
             AL++HSEAERRRRERIN HLSTLR L+P T KMDKA+LL +VIS +KEL+ +A+EA+KG 
Sbjct  72    ALKSHSEAERRRRERINAHLSTLRKLVPCTGKMDKASLLAEVISHVKELKKNATEASKGS  131

Query  705   LVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATL  526
             ++P D DEVRVE   +GCDG S+ I ASLCCDY+ ELL+++RQ LD   LKT+RAE++TL
Sbjct  132   VIPMDVDEVRVEPHGDGCDGRSFLITASLCCDYRPELLADIRQVLDTFHLKTIRAEISTL  191

Query  525   GSRMVSLFVVTENEEG-NDSDERREFLASSVHQALRSVLDKFYASEEF  385
             GSR+ ++FV+T +EEG  D+      L SS+ QAL+SV+ K   S EF
Sbjct  192   GSRVKNVFVMTSHEEGITDNATEVCHLVSSIEQALKSVIQK-NTSPEF  238



>ref|XP_003541890.2| PREDICTED: transcription factor bHLH30-like [Glycine max]
 gb|KHN36691.1| Transcription factor bHLH30 [Glycine soja]
Length=249

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 158/197 (80%), Gaps = 1/197 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD EKGELV A V+  +KGV+PE+++ AL+NHSEAERRRR RIN HL TLRS+IPG  
Sbjct  32   LVLDKEKGELVEAPVKLERKGVSPERSIEALKNHSEAERRRRARINAHLDTLRSVIPGAK  91

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            K+DKA LLG+VI  +KEL+++A++A++G+++P D+DE+RVE+Q  G +G  YSIKASLCC
Sbjct  92   KLDKATLLGEVIRHLKELKTNATQASEGLMIPKDSDEIRVEEQEGGLNGFPYSIKASLCC  151

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLASSV  436
            +YK  LL+++RQALDAL L  +RAE+ATLG RM S+FV+   +E N  D E R+FLA SV
Sbjct  152  EYKPGLLTDIRQALDALHLMIIRAEIATLGGRMNSVFVIISCKEQNIEDPEYRQFLAGSV  211

Query  435  HQALRSVLDKFYASEEF  385
            HQALRSVLD+F  S++ 
Sbjct  212  HQALRSVLDRFSVSQDM  228



>ref|XP_011038201.1| PREDICTED: transcription factor bHLH30-like [Populus euphratica]
Length=270

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = -2

Query  1023  NYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRE  844
             N G+Q   RN S S+SSLVLD E+GELV A VR  +KGV+ EK++ ALRNHSEAER+RR 
Sbjct  26    NSGLQAETRNWSRSTSSLVLDNERGELVEATVRMERKGVSAEKSIAALRNHSEAERKRRA  85

Query  843   RINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTD--EVRVE  670
             RIN HL TLRSL+PGT+KMDKA+LL +VIS +KEL+  A+ A +G+L+P D D   V  E
Sbjct  86    RINAHLDTLRSLVPGTSKMDKASLLAEVISHLKELKIQAAGAGEGLLMPLDIDEVRVEQE  145

Query  669   QQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE  490
             ++ +G   A   I+AS+CCDYK E+LS LRQALDAL L   RAE+ATL  RM+++ VV+ 
Sbjct  146   EEEDGLCSAPCLIRASICCDYKPEILSGLRQALDALHLMITRAEIATLEGRMMNVLVVSS  205

Query  489   NEEGNDSDER-REFLASSVHQALRSVLDKFYASEEF  385
              +EG   D + R+FLA SVH+A RSVLDKF AS+EF
Sbjct  206   CKEGLGGDSKVRQFLAGSVHEAFRSVLDKFSASQEF  241



>ref|XP_003539965.1| PREDICTED: transcription factor bHLH30-like [Glycine max]
 gb|KHN09220.1| Transcription factor bHLH30 [Glycine soja]
Length=258

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 160/212 (75%), Gaps = 1/212 (0%)
 Frame = -2

Query  1017  GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERI  838
             G   +I +G  SS SLVLD E+GELV A VR  +KGV+ E+++ AL++HSEAER+RR RI
Sbjct  26    GSNGVIGSGCGSSFSLVLDRERGELVEAPVRLERKGVSTERSIEALKSHSEAERKRRARI  85

Query  837   NGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAE  658
             N HL TLRS+IPG  KMDKA+LLG+VI  +KEL+ +A++A +G+++P D DE+ VE+Q  
Sbjct  86    NAHLDTLRSVIPGAMKMDKASLLGEVIRHLKELKKNAAQACEGLMIPKDNDEISVEEQEG  145

Query  657   GCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG  478
             G +G  YSI+ASLCC+YK  LLS+++QALDAL L   RA++ATL  RM ++FV+  ++E 
Sbjct  146   GLNGFPYSIRASLCCEYKPGLLSDIKQALDALHLMITRADIATLEGRMKNVFVIISSKEQ  205

Query  477   NDSD-ERREFLASSVHQALRSVLDKFYASEEF  385
             N  D   R+FLA SVHQAL++VL++F  SE+ 
Sbjct  206   NFEDAAYRQFLAGSVHQALKAVLNRFSVSEDI  237



>ref|XP_004295576.1| PREDICTED: transcription factor bHLH30-like [Fragaria vesca subsp. 
vesca]
Length=363

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 166/226 (73%), Gaps = 7/226 (3%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGssss--sSLVLDTEKGELVRALVRPGQKGVNPEKALIA  883
              FN FA     ++G    +RNGS  +   SLVLD+EKGELV+A  R G+KGV+  KAL A
Sbjct  120   LFNPFA-----HHGSGDGLRNGSVQALPHSLVLDSEKGELVKAPARVGKKGVSEAKALAA  174

Query  882   LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
             L+NHSEAERRRRERIN HLSTLR L+P T KMDKAALL +VI ++KEL+  + E++KG L
Sbjct  175   LKNHSEAERRRRERINAHLSTLRGLVPCTEKMDKAALLAEVIRQVKELKKDSLESSKGFL  234

Query  702   VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
             +P D DEV+VE    G    + S++AS+CCDY+ ELLS+L++ALD+L LK ++AEMATLG
Sbjct  235   IPIDADEVKVEHYDSGVGDGTISLRASICCDYRPELLSDLKEALDSLHLKMVKAEMATLG  294

Query  522   SRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
             +R+ ++FV+T  +EGN+  E  + LA+S+H AL SVLDK   S E+
Sbjct  295   NRVHNVFVLTGCKEGNNDAEAYQHLANSIHHALSSVLDKASVSPEY  340



>gb|AFK43226.1| unknown [Lotus japonicus]
Length=243

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 165/208 (79%), Gaps = 1/208 (0%)
 Frame = -2

Query  1005  MIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHL  826
             +I +G +SSSSLVLD +KGELV A ++  +KGV+PE+++ ALRNHSEAERRRR RIN HL
Sbjct  15    VIGSGYASSSSLVLDRDKGELVEAPMQLERKGVSPERSIEALRNHSEAERRRRARINAHL  74

Query  825   STLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDG  646
              TLR++IPG NKMDKA+LL +VI+ +KEL+++A++A++G++ P D DE+RV +Q  G +G
Sbjct  75    DTLRTVIPGANKMDKASLLAEVITHLKELKTNAAQASEGLMTPKDNDELRVGEQEGGLNG  134

Query  645   ASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD  466
               YSI+ASLCC+Y+  LLS++RQALDAL L   RAE+ATLG R+ ++FV+   +E N  D
Sbjct  135   FPYSIRASLCCEYRPGLLSDIRQALDALHLMITRAEIATLGGRVKNVFVIISCKEQNFED  194

Query  465   -ERREFLASSVHQALRSVLDKFYASEEF  385
              E R+FLA SVHQALRSVLD+F  S++ 
Sbjct  195   AEYRQFLAGSVHQALRSVLDRFSVSQDI  222



>ref|XP_003527389.1| PREDICTED: transcription factor bHLH30-like [Glycine max]
 gb|KHN07752.1| Transcription factor bHLH30 [Glycine soja]
Length=259

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD E+GELV   VR  +KGV+ E+++ AL++HSEAER+RR RIN HL TLRS+IPG  
Sbjct  42   LVLDRERGELVEEPVRLEKKGVSTERSIEALKSHSEAERKRRARINAHLDTLRSVIPGAM  101

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA+LLG+VI  +KEL+ +A++A +G+++P D DE+ VE+Q  G +G  YSI+ASLCC
Sbjct  102  KMDKASLLGEVIRHLKELKKNAAQACEGLMIPKDNDEISVEEQEGGLNGFPYSIRASLCC  161

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLASSV  436
            +YK  LLS+++QALDAL L   RA++ATL  RM ++FV+   +E N  D   R+FLA SV
Sbjct  162  EYKPGLLSDIKQALDALHLMITRADIATLEGRMKNVFVIISCKEQNFEDAAYRQFLAVSV  221

Query  435  HQALRSVLDKFYASEEF  385
            HQAL+SVL++F  SE+ 
Sbjct  222  HQALKSVLNRFSVSEDI  238



>ref|XP_002274955.1| PREDICTED: transcription factor bHLH30 [Vitis vinifera]
Length=263

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+++GELV+A V   +K V   KA+ AL++HS+AERRRRERIN HL TLR  +P T 
Sbjct  39   LVLDSDRGELVKAPVIKVKKEVPEAKAMAALKSHSDAERRRRERINAHLDTLRGFVPCTE  98

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA LL +VI ++KEL+ +A++A+KG+L+P + DEVRVE   +  DGA +S++AS+CC
Sbjct  99   KMDKATLLAEVIQQVKELKRNATKASKGLLLPIEEDEVRVEPHDDRTDGA-FSLRASVCC  157

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERRE-FLASSV  436
            DY+ ELLS ++QALD LP+ T++AE++TLG RM ++FV T  ++GN +D +    LASSV
Sbjct  158  DYRPELLSYIKQALDTLPINTVKAEISTLGGRMKNVFVFTSCKQGNSNDSKAHMLLASSV  217

Query  435  HQALRSVLDKFYASEEF  385
            HQAL S+L K   S EF
Sbjct  218  HQALSSILYKVSTSPEF  234



>ref|XP_008225271.1| PREDICTED: transcription factor bHLH30-like [Prunus mume]
Length=265

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD EKGELV+A  R G+KGV+  KAL AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  45   LVLDGEKGELVKAPARVGKKGVSEAKALAALKNHSEAERRRRERINAHLSTLRGLVPCTE  104

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKAALL KVIS++KEL+  A E++KG L+P D DEV+VE    G    + S++AS+CC
Sbjct  105  KMDKAALLAKVISQVKELKKDALESSKGFLIPVDADEVQVEPYDTGAGDGTISVRASVCC  164

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE-NEEGNDSD-ERREFLASS  439
            +Y+ ELLS+LR+ALD+L LK ++A++ATLG+R+ ++FV T   E  ND+D +  + LASS
Sbjct  165  EYRSELLSDLREALDSLHLKMVKADIATLGNRVKNVFVFTSCKERSNDADADAFQLLASS  224

Query  438  VHQALRSVLDKFYASEEF  385
            VHQAL SVLDK  AS E+
Sbjct  225  VHQALSSVLDKASASPEY  242



>ref|XP_009352784.1| PREDICTED: transcription factor bHLH30-like [Pyrus x bretschneideri]
Length=268

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A  R G+K V   KAL+AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  46   LVLDSEKGELVKAPARVGKKEVPEAKALLALKNHSEAERRRRERINAHLSTLRGLVPCTE  105

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA LL  VIS++KEL+  A E++KG L+P D DEV++E      DG + S+KAS+CC
Sbjct  106  KMDKATLLAAVISQVKELKMDALESSKGFLIPVDADEVKIEPYVAAGDG-TISVKASVCC  164

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG-NDSD-ERREFLASS  439
            +Y+ ELLS+LR+ALD+L LK ++AE+ATLG+R+ ++FV+T ++ G NDSD E  E LASS
Sbjct  165  EYRSELLSDLREALDSLHLKMVKAEIATLGNRVKNVFVLTSSKPGSNDSDAEAYELLASS  224

Query  438  VHQALRSVLDKFYASEEF  385
            VHQ L SVLDK  AS E+
Sbjct  225  VHQVLSSVLDKASASPEY  242



>ref|XP_007212891.1| hypothetical protein PRUPE_ppa021837mg [Prunus persica]
 gb|EMJ14090.1| hypothetical protein PRUPE_ppa021837mg [Prunus persica]
Length=265

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGEL++A  R G+KGV+  KAL AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  45   LVLDSEKGELIKAPARVGKKGVSEAKALAALKNHSEAERRRRERINAHLSTLRGLVPCTE  104

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKAALL  VIS++KEL+  A E++KG L+P D DEV+VE    G    + S++AS+CC
Sbjct  105  KMDKAALLATVISQVKELKKDALESSKGFLIPVDADEVQVEPYDTGAGDGTISVRASVCC  164

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE-NEEGNDSD-ERREFLASS  439
            +Y+ ELLS+LR+ALD+L LK ++A++ATLG+R+ ++FV T   E  ND+D +  + LASS
Sbjct  165  EYRSELLSDLREALDSLHLKMVKADIATLGNRVKNVFVFTSCKERSNDADADAFQLLASS  224

Query  438  VHQALRSVLDKFYASEEF  385
            VHQAL SVLDK  AS E+
Sbjct  225  VHQALSSVLDKASASPEY  242



>ref|XP_007025402.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY28024.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=268

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 147/197 (75%), Gaps = 2/197 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A V+ G+K V+ EK + AL++HSEAE+RRRERIN HL TLR L+P   
Sbjct  50   LVLDSEKGELVKAPVKVGKKSVSEEKVIAALKSHSEAEKRRRERINAHLDTLRGLLPCRE  109

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA LLG+VI ++KEL+ +A+EA+KG LVP D DEVRVE   +  +G     KAS+CC
Sbjct  110  KMDKATLLGEVIRQVKELKKNATEASKGFLVPMDDDEVRVEPCEDEANGI-LLFKASICC  168

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLASSV  436
            DY+ ELL++LR+ALDALP+K ++AE +TLGSR+ + FV       + D  E R FLA S+
Sbjct  169  DYRPELLTDLRRALDALPIKMVKAETSTLGSRLKNDFVFAGCRTAHADEAEARRFLACSI  228

Query  435  HQALRSVLDKFYASEEF  385
            HQAL SVL+K  AS E+
Sbjct  229  HQALNSVLEKASASPEY  245



>ref|XP_009348588.1| PREDICTED: transcription factor bHLH30-like [Pyrus x bretschneideri]
Length=266

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A  R G KGV+  KAL AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  43   LVLDSEKGELVKAPARVGNKGVSEAKALAALKNHSEAERRRRERINAHLSTLRGLVPCTE  102

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKAALL  VIS++KEL+  A E++KG L+P D DEV+VE    G    + S+KAS+CC
Sbjct  103  KMDKAALLAAVISQVKELKKDALESSKGFLIPVDDDEVKVEPYVIGAGDGTISVKASVCC  162

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE-NEEGNDSD-ERREFLASS  439
            +Y+ ELLS+LR+ALD+L LK ++AE+ATLG+R+ ++FV+T   ++ ND++ E  E LASS
Sbjct  163  EYRSELLSDLREALDSLHLKMVKAEIATLGNRVKNVFVLTSFKKDSNDANTEAYELLASS  222

Query  438  VHQALRSVLDKFYASEEF  385
            VHQ L SVLDK   S E+
Sbjct  223  VHQVLSSVLDKASPSPEY  240



>ref|XP_008383636.1| PREDICTED: transcription factor bHLH30-like [Malus domestica]
Length=268

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A  R G+K +   KAL+AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  46   LVLDSEKGELVKAPARVGKKELPEAKALLALKNHSEAERRRRERINAHLSTLRGLVPCTE  105

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA LL  VIS++KEL+  A E++KG L+P D DEV++E      DG + S+KAS+CC
Sbjct  106  KMDKATLLAAVISQVKELKKDALESSKGFLIPVDADEVKIEPYVAAGDG-TISVKASVCC  164

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG-NDSD-ERREFLASS  439
            +Y+ ELLS+LR+ALD+L LK ++AE+ATLG+R+ ++FV+T ++ G NDSD E  E LASS
Sbjct  165  EYRSELLSDLREALDSLHLKIVKAEIATLGNRVKNVFVLTSSKPGSNDSDAEAYELLASS  224

Query  438  VHQALRSVLDKFYASEEF  385
            VHQ L S LDK  AS E+
Sbjct  225  VHQVLSSXLDKASASPEY  242



>ref|XP_008371455.1| PREDICTED: transcription factor bHLH30-like [Malus domestica]
Length=266

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 151/198 (76%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A  R G+KGV+  KAL AL+NHSEAERRRRERIN HLSTLR L+P T 
Sbjct  43   LVLDSEKGELVKAPARVGKKGVSEAKALAALKNHSEAERRRRERINAHLSTLRGLVPCTE  102

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKAALL  VIS++KEL+  A E++KG L+P D DEV+VE         + S+KAS+CC
Sbjct  103  KMDKAALLAAVISQVKELKKDALESSKGFLIPVDDDEVKVEPYVIXAGDGTISVKASVCC  162

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE-NEEGNDSD-ERREFLASS  439
            +Y+ E LS+LR+ALD+L LK ++AE+ATLG+R+ ++FV+T   ++ ND++ E  E LASS
Sbjct  163  EYRSEHLSDLREALDSLHLKMVKAEIATLGNRVKNVFVLTSFKKDSNDANTEAYELLASS  222

Query  438  VHQALRSVLDKFYASEEF  385
            VHQ L SVLDK   S E+
Sbjct  223  VHQVLSSVLDKASPSPEY  240



>ref|XP_002273834.1| PREDICTED: transcription factor bHLH106-like [Vitis vinifera]
Length=258

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EK ELV+A VR  +KGV+  KA+ AL+NHSEAERRRRERINGHLSTLR  +P T 
Sbjct  39   LVLDSEKRELVKAPVRAVKKGVSEAKAMAALKNHSEAERRRRERINGHLSTLRGFVPCTE  98

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGC-DGASYSIKASLC  616
            KMDKA LL +VI ++KEL+ +A+EA+KG+L+P + DEVRVE   +G  DG SY + AS+C
Sbjct  99   KMDKATLLAEVIQQVKELKKNAAEASKGLLLPMEVDEVRVEPHDDGTGDGTSYFM-ASVC  157

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVT--ENEEGNDSDERREFLAS  442
            CDY   LLS++RQALD L + T++AE+++LG RM S+F+ T  +  + NDS+  R  LAS
Sbjct  158  CDYSPRLLSDIRQALDTLNITTVKAEISSLGGRMKSMFIFTSCKKHKSNDSEAHR-LLAS  216

Query  441  SVHQALRSVLDKFYASEEF  385
            SVHQAL SVLDK   + EF
Sbjct  217  SVHQALSSVLDKVSVTAEF  235



>ref|XP_011002537.1| PREDICTED: transcription factor bHLH30-like [Populus euphratica]
Length=200

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  891  LIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATK  712
            + AL+NHSEAE++RR RIN HL TLRS++PGT KMDKA+LL +VI+ +KEL+  A+EA++
Sbjct  3    IAALKNHSEAEKKRRARINAHLDTLRSMVPGTRKMDKASLLAEVIAHLKELKRQATEASE  62

Query  711  GILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMA  532
            G+L+P D DEV+VEQQ +G   A Y I+AS+CCD K  +LS+LRQALDAL L   RAE+A
Sbjct  63   GLLMPLDIDEVKVEQQEDGLHSAPYVIRASICCDCKPGILSDLRQALDALHLIITRAEIA  122

Query  531  TLGSRMVSLFVVTENEEGNDSDER-REFLASSVHQALRSVLDKFYASEEFssrtslsskr  355
            TL  RM ++FV++  +EG+  D +  +FL  S+HQA RS+LDKF AS+EF  +++LS+KR
Sbjct  123  TLEGRMKNVFVMSSCKEGDSGDTKVHQFLGGSIHQAFRSILDKFSASQEFLLKSTLSNKR  182

Query  354  rrvSFLNssassSLGDFW  301
            RR      S SSS GD W
Sbjct  183  RRFDSFKPSLSSSSGDLW  200



>ref|XP_010277769.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
Length=263

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 169/227 (74%), Gaps = 4/227 (2%)
 Frame = -2

Query  1059  EFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIAL  880
             E+   F GFS  N G + M R GSSSSSSLVLD+EKGELV+A  R G K ++  KA+ AL
Sbjct  15    EYSRYFDGFSP-NVGFRMMGRGGSSSSSSLVLDSEKGELVKAPARLGPKAMSEAKAIAAL  73

Query  879   RNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILV  700
             ++HSEAERRRRERIN HLSTLR L+P ++KMDKA+LL +VIS +KEL+ +A+EATKG ++
Sbjct  74    KSHSEAERRRRERINAHLSTLRKLVPCSDKMDKASLLAEVISHVKELKRNATEATKGSVI  133

Query  699   PTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             P D DE+ VE   +G +G S  I ASLCCDY+ ELL+++RQALD+L LKT+RAE++TLGS
Sbjct  134   PMDNDELIVEPHGDGSEGGSVLITASLCCDYRPELLADIRQALDSLHLKTVRAEISTLGS  193

Query  519   RMVSLFVVTENEEGNDSDERREF--LASSVHQALRSVLDKFYASEEF  385
             R+ ++FV+T  EEG       E   L SS+ QAL SVL+K  +S EF
Sbjct  194   RVKNVFVMTSYEEGGVGKGNGEVCHLVSSIKQALNSVLEK-ASSPEF  239



>ref|XP_008783898.1| PREDICTED: transcription factor bHLH30-like [Phoenix dactylifera]
Length=248

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = -2

Query  1023  NYGIQRMIRNG----sssssSLVLDTEKGELVRALVRPGQKG---VNPEKALIALRNHSE  865
             +YG+ R  R      + +S++LVLD E+GELVR   R G+KG   V   +  +AL++HSE
Sbjct  8     DYGVLRGFREAPGFAAGTSATLVLDGERGELVRTPARVGKKGKGGVLDARVAMALKSHSE  67

Query  864   AERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTD  685
             AERRRR+RINGHL+TLRS+IP T+K+DKAALL +VI+ +K L+S+A E +KG  +P+D D
Sbjct  68    AERRRRQRINGHLTTLRSMIPCTDKLDKAALLAEVINHVKRLKSNAVEISKGCTLPSDVD  127

Query  684   EVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSL  505
             EVRVE + +  +G S+ IKASLCC+ + +LL+++RQ L  L LKT+RAE++TLG R+ + 
Sbjct  128   EVRVEVEGDEMNGGSFIIKASLCCEDRPDLLADIRQTLQTLQLKTIRAEISTLGGRVKNA  187

Query  504   FVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
              VV    EGN SD  +   ASSVHQAL+S+LD+  +S + 
Sbjct  188   VVVM--CEGNASDIEKNLYASSVHQALKSILDRVNSSADL  225



>ref|XP_007132898.1| hypothetical protein PHAVU_011G134300g [Phaseolus vulgaris]
 gb|ESW04892.1| hypothetical protein PHAVU_011G134300g [Phaseolus vulgaris]
Length=258

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 159/212 (75%), Gaps = 1/212 (0%)
 Frame = -2

Query  1017  GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERI  838
             G   +I +G  SS SLVLD E+GELV A V+  +KGV+ E++  AL+NHSEAERRRR RI
Sbjct  26    GSNGVIGSGCGSSFSLVLDRERGELVEAPVKLERKGVSTERSTEALKNHSEAERRRRARI  85

Query  837   NGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAE  658
             N HL TLRS+IPG  KMDKA+LLG+VI+ +KEL+ +A+EA +G+++P D DE+ VE+Q  
Sbjct  86    NAHLDTLRSVIPGAMKMDKASLLGEVITHLKELKRNAAEACEGLMIPKDNDEISVEEQEG  145

Query  657   GCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG  478
             G +G  YSI+ASLCC+YK  LLS++RQALD+L L   RA++ATL  RM ++FV+   +E 
Sbjct  146   GLNGFPYSIRASLCCEYKPGLLSDIRQALDSLHLMITRADIATLEGRMKNVFVIISCKEH  205

Query  477   NDSD-ERREFLASSVHQALRSVLDKFYASEEF  385
             N  D   R+FLA SVHQAL+SVL++F  S++ 
Sbjct  206   NFEDASYRQFLAGSVHQALKSVLNRFSVSQDI  237



>ref|XP_002305075.2| hypothetical protein POPTR_0004s05490g [Populus trichocarpa]
 gb|EEE85586.2| hypothetical protein POPTR_0004s05490g [Populus trichocarpa]
Length=264

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 152/226 (67%), Gaps = 2/226 (1%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALR  877
             + N+F  F     G   +++     S +LVLD E GELV+A  R G KG++  KAL AL+
Sbjct  16    YMNTFDPFPRSLEGFSDVLQGRPMVSQTLVLDAEMGELVKAPARVGNKGISEAKALAALK  75

Query  876   NHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVP  697
             +HSEAERRRRERIN HL TLR L+P T KMDKA LL  VIS++ EL+ +A E+ KG+L+P
Sbjct  76    SHSEAERRRRERINAHLDTLRGLVPCTEKMDKATLLAAVISQVNELKRNALESCKGLLIP  135

Query  696   TDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSR  517
             T  DEV+VE   +G    +   KAS+CCDY+ ELLS++RQA+DALPLK + AE++TLG+R
Sbjct  136   TADDEVKVETYFDGTKEGTLYFKASICCDYRPELLSDIRQAVDALPLKMVNAEISTLGNR  195

Query  516   MVSLFVVTENEEGN--DSDERREFLASSVHQALRSVLDKFYASEEF  385
             + + FV T N   N  D  E  + L  S+H AL SVL+K  AS E+
Sbjct  196   LKNEFVFTSNRNKNAVDDAEAMQHLTKSIHHALTSVLEKGSASLEY  241



>ref|XP_008456426.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Cucumis 
melo]
Length=256

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 178/250 (71%), Gaps = 7/250 (3%)
 Frame = -2

Query  1047  SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
             S+ GF   +  +    RNGS S+SSLVLD+E+ ELV A ++   KGV  E++  AL+NHS
Sbjct  9     SYDGFCASSASM----RNGSVSTSSLVLDSERDELVEAPLKLESKGVPTERSAAALKNHS  64

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAERRRR RINGHL +LRSL+PG  KMDKA LL +VIS +K L+ +A+E +   ++P + 
Sbjct  65    EAERRRRARINGHLGSLRSLVPGGKKMDKATLLAEVISHLKVLKRAAAEVSDAHIIPKEI  124

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DE+ VEQ+ +G +G  YSI+ASLCCDYK  LL +LR+AL AL L   RAE+ATL  RM +
Sbjct  125   DEITVEQE-DGFNGVPYSIRASLCCDYKPGLLPDLRRALHALDLIIQRAEIATLNGRMKN  183

Query  507   LFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNs  331
             +FV+T  +EGN ++ E R FL +SVHQA++SVL+KF   +EFS  T  + +RR   F NS
Sbjct  184   VFVLTSCKEGNIETTELRRFLETSVHQAIKSVLNKFSDPQEFSFMTFPNKRRRISLF-NS  242

Query  330   sassSLGDFW  301
             S+SSS GDFW
Sbjct  243   SSSSSRGDFW  252



>ref|XP_011005482.1| PREDICTED: transcription factor bHLH106-like [Populus euphratica]
Length=264

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 152/226 (67%), Gaps = 2/226 (1%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALR  877
             + N+F  F     G   +++     S +LVLD E GELV+A  R G KG++  KAL AL+
Sbjct  16    YMNTFDPFPRSLEGFSDVLQGRPKVSQTLVLDAEMGELVKAPARVGNKGISEAKALAALK  75

Query  876   NHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVP  697
             +HSEAERRRRERIN HL+TLR L+P T KMDKA LL  VI+++ EL+ +A EA KG+L+P
Sbjct  76    SHSEAERRRRERINAHLATLRGLVPCTEKMDKATLLAAVINQVNELKRNALEACKGLLIP  135

Query  696   TDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSR  517
             T  DEV+V+   +G    +   KAS+CCDY+ ELLS++RQA+DALPLK + AE++TLGSR
Sbjct  136   TADDEVKVDTYFDGTKEGTLYFKASICCDYRPELLSDIRQAVDALPLKMVNAEISTLGSR  195

Query  516   MVSLFVVTENEEGND--SDERREFLASSVHQALRSVLDKFYASEEF  385
             + + FV T N   N     E  + L  S+H AL SVL+K  AS E+
Sbjct  196   LKNEFVFTNNRYKNAVVDAEAMQLLTKSIHHALTSVLEKGSASLEY  241



>ref|XP_004167587.1| PREDICTED: transcription factor bHLH30-like [Cucumis sativus]
Length=252

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 177/250 (71%), Gaps = 7/250 (3%)
 Frame = -2

Query  1047  SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
             S+ GF   +  +    RNGS S+SSLVLD+E+ ELV A ++   KGV  E++  AL+NHS
Sbjct  9     SYDGFCANSASM----RNGSVSTSSLVLDSERDELVEAPLKLESKGVPAERSAAALKNHS  64

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAERRRR RIN HL  LRSL+PG  KMDKA LL +VIS +  L+ +A+E +   ++P ++
Sbjct  65    EAERRRRARINDHLGILRSLVPGGKKMDKATLLAEVISHLNVLKRAAAEVSDAHIIPEES  124

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DE+ VEQ+ +G +G  YSI+ASLCCDYK  LL +LR+AL AL L   RAE+ATL  RM +
Sbjct  125   DEITVEQE-DGFNGVPYSIRASLCCDYKPGLLPDLRRALHALDLIIQRAEIATLNGRMKN  183

Query  507   LFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNs  331
             +FV+T  +EGN ++ E R FL +SVHQA++SVL+KF   +EFS  T  + +RR   F N+
Sbjct  184   VFVLTSCKEGNIETTELRRFLETSVHQAIKSVLNKFSDPQEFSFMTFPNKRRRISLF-NA  242

Query  330   sassSLGDFW  301
             S+SSS+GDFW
Sbjct  243   SSSSSMGDFW  252



>ref|XP_004505503.1| PREDICTED: transcription factor bHLH30-like [Cicer arietinum]
Length=251

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 158/218 (72%), Gaps = 5/218 (2%)
 Frame = -2

Query  1038  GFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAE  859
             GF   N     +  +G  SS SLVLD E+ ELV A  +  +KGV+ E+++ AL+NHSEAE
Sbjct  16    GFQVNN----EVFGSGYGSSFSLVLDRERDELVEAPAKMEKKGVSNERSIEALKNHSEAE  71

Query  858   RRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEV  679
             RRRR RIN HL TLRS+IPG  KMDKA+LLG+VI  +KEL+ +A++A +G+++P D DE+
Sbjct  72    RRRRARINAHLDTLRSVIPGALKMDKASLLGEVILHLKELKRNAAQACEGLIIPKDNDEI  131

Query  678   RVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFV  499
              VE+Q  G  G  +SI+ASLCC+Y+  LLS +RQAL++L L  ++A++AT G RM ++FV
Sbjct  132   SVEEQEGGIYGFPFSIRASLCCEYQPGLLSNIRQALESLHLMIMKADIATFGGRMKNVFV  191

Query  498   VTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEE  388
             V   EE N D  E R+FLA SVHQAL+SVL++F  S++
Sbjct  192   VISCEEQNLDVAEYRQFLAGSVHQALKSVLNRFSVSQD  229



>ref|XP_003607570.1| Transcription factor bHLH30 [Medicago truncatula]
 gb|AES89767.1| transcription factor bHLH107-like protein [Medicago truncatula]
Length=256

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = -2

Query  1038  GFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNP-EKALIALRNHSEA  862
             GF   N     +I +G  SS SLVLD E+GELV   V+   KGV+  E+++ AL+NHSEA
Sbjct  20    GFEVNN----EVIGSGYGSSFSLVLDRERGELVEEPVKMEGKGVSTTERSVEALKNHSEA  75

Query  861   ERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDE  682
             ERRRR RIN HL TLR +IPG  KMDKA+LLG+V+  +KEL+ + ++A +G+++P D DE
Sbjct  76    ERRRRARINAHLDTLRCVIPGALKMDKASLLGEVVRHLKELKRNETQACEGLMIPKDNDE  135

Query  681   VRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLF  502
             + VE+Q  G +G  +SIKASLCC+Y+  LLS +RQALDAL L  ++A++AT G RM ++F
Sbjct  136   ISVEEQEGGWNGFPFSIKASLCCEYQPGLLSNIRQALDALHLIIMKADIATFGDRMKNVF  195

Query  501   VVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEE  388
             VV   EE N D+ E R+FLA SVHQAL+SVL +F  S++
Sbjct  196   VVISCEEQNFDAAEYRQFLAGSVHQALKSVLSRFSVSQD  234



>ref|XP_004149373.1| PREDICTED: transcription factor bHLH30-like [Cucumis sativus]
 gb|KGN47242.1| hypothetical protein Csa_6G227540 [Cucumis sativus]
Length=252

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 177/250 (71%), Gaps = 7/250 (3%)
 Frame = -2

Query  1047  SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
             S+ GF   +  +    RNGS S+SSLVLD+E+ ELV A ++   KGV  E++  AL+NHS
Sbjct  9     SYDGFCANSASM----RNGSVSTSSLVLDSERDELVEAPLKLESKGVPAERSAAALKNHS  64

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAERRRR RIN HL  LRSL+PG  KMDKA LL +VIS +  L+ +A+E +   ++P ++
Sbjct  65    EAERRRRARINDHLGILRSLVPGGKKMDKATLLAEVISHLNVLKRAAAEVSDAHIIPEES  124

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DE+ VEQ+ +G +G  YSI+ASLCCDYK  LL +LR+AL AL L   RAE+ATL  RM +
Sbjct  125   DEITVEQE-DGFNGVPYSIRASLCCDYKPGLLPDLRRALHALDLIIQRAEIATLNGRMKN  183

Query  507   LFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEFssrtslsskrrrvSFLNs  331
             +FV+T  +EGN ++ E R FL +SVHQA++SVL+KF   +EFS  T  + +RR   F NS
Sbjct  184   VFVLTSCKEGNIETTELRRFLETSVHQAIKSVLNKFSDPQEFSFMTFPNKRRRISLF-NS  242

Query  330   sassSLGDFW  301
             S+SSS+GDFW
Sbjct  243   SSSSSMGDFW  252



>ref|XP_008785804.1| PREDICTED: transcription factor bHLH30-like [Phoenix dactylifera]
Length=235

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 151/206 (73%), Gaps = 6/206 (3%)
 Frame = -2

Query  993  GsssssSLVLDTEKGELVRALVRPGQKG---VNPEKALIALRNHSEAERRRRERINGHLS  823
            G+ +S +LVLD E+GELVRA  R G+KG   V      +AL+ HSEAERRRR+RINGHL+
Sbjct  22   GAGASVTLVLDGERGELVRAPARVGKKGKVGVLDASVAMALKTHSEAERRRRQRINGHLA  81

Query  822  TLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGA  643
            TLRS+IPGT K+DKAALL +VI+ +K L+S+A E +KG  +P+D DEVRVE + +  +  
Sbjct  82   TLRSMIPGTEKLDKAALLAEVINHLKGLKSNAMEISKGCTIPSDVDEVRVEVE-DVMNSG  140

Query  642  SYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDE  463
            S+ IKASLCC+ + ++L+++RQAL  L LKT+R +++TLG R+ ++ V+    EGN +D 
Sbjct  141  SFIIKASLCCEDRPDILADIRQALQTLQLKTIRVDISTLGGRVKNVIVM--KCEGNANDI  198

Query  462  RREFLASSVHQALRSVLDKFYASEEF  385
             +    SSVH+AL S+LD+F +S +F
Sbjct  199  EKHLYTSSVHRALESILDRFNSSVDF  224



>ref|XP_010915628.1| PREDICTED: transcription factor bHLH30-like [Elaeis guineensis]
Length=248

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 143/199 (72%), Gaps = 5/199 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKG---VNPEKALIALRNHSEAERRRRERINGHLSTLRSLIP  802
            LVLD E+GELVR   + G+KG   V   K  +AL++HSEAERRRR+RINGHL+TLRS+IP
Sbjct  29   LVLDGERGELVRTPAQVGKKGKGGVLDAKVAMALKSHSEAERRRRQRINGHLATLRSMIP  88

Query  801  GTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKAS  622
             T+K+DKAALL +VI  +K L+SSA E  KG  +P+D DEVRVE + +  +  S+ I+AS
Sbjct  89   CTDKLDKAALLAEVIDHVKRLKSSAMEICKGCTLPSDVDEVRVEVEGDEMNSGSFIIRAS  148

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLAS  442
            LCCD + +LL+++RQ L  L LKT+RAE++TLG R+ ++ V+    EG  SD  +    S
Sbjct  149  LCCDDRPDLLTDIRQTLQTLQLKTIRAEISTLGGRVKNVVVMM--CEGTASDIEKNLYTS  206

Query  441  SVHQALRSVLDKFYASEEF  385
            SVHQAL+S+LD+  +S + 
Sbjct  207  SVHQALKSILDRVNSSVDL  225



>ref|XP_008456427.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Cucumis 
melo]
Length=251

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 160/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  1047  SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
             S+ GF   +  +    RNGS S+SSLVLD+E+ ELV A ++   KGV  E++  AL+NHS
Sbjct  9     SYDGFCASSASM----RNGSVSTSSLVLDSERDELVEAPLKLESKGVPTERSAAALKNHS  64

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAERRRR RINGHL +LRSL+PG  KMDKA LL +VIS +K L+ +A+E +   ++P + 
Sbjct  65    EAERRRRARINGHLGSLRSLVPGGKKMDKATLLAEVISHLKVLKRAAAEVSDAHIIPKEI  124

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DE+ VEQ+ +G +G  YSI+ASLCCDYK  LL +LR+AL AL L   RAE+ATL  RM +
Sbjct  125   DEITVEQE-DGFNGVPYSIRASLCCDYKPGLLPDLRRALHALDLIIQRAEIATLNGRMKN  183

Query  507   LFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASEEF  385
             +FV+T  +EGN ++ E R FL +SVHQA++SVL+KF   +EF
Sbjct  184   VFVLTSCKEGNIETTELRRFLETSVHQAIKSVLNKFSDPQEF  225



>ref|XP_006449491.1| hypothetical protein CICLE_v10016289mg [Citrus clementina]
 ref|XP_006467661.1| PREDICTED: transcription factor bHLH30-like [Citrus sinensis]
 gb|ESR62731.1| hypothetical protein CICLE_v10016289mg [Citrus clementina]
 gb|KDO77842.1| hypothetical protein CISIN_1g024670mg [Citrus sinensis]
Length=264

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 156/225 (69%), Gaps = 7/225 (3%)
 Frame = -2

Query  1044  FAGFST--ENY--GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALR  877
             F GFS   + +  G       G S   SLVLD+ +GELV+A  + G+K V+  KA++AL+
Sbjct  16    FGGFSKLYDPFLGGFNGANLRGGSIPQSLVLDSVRGELVKAPAKVGKKEVSEAKAMVALK  75

Query  876   NHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVP  697
             NHSEAERRRRERIN HL TLR L+P   KMDKA LL +VI ++KEL+++A EA+KG L+P
Sbjct  76    NHSEAERRRRERINAHLDTLRGLVPPNGKMDKATLLAEVIRQVKELKTNAIEASKGFLIP  135

Query  696   TDTDEVRVEQ-QAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             TD DEV+VE    E    A +  KAS+CC+Y+ EL+S+LRQALDALPLK L+AE++TLG 
Sbjct  136   TDADEVKVEPYNDEEAGDADFLYKASICCEYRPELMSDLRQALDALPLKMLKAEISTLGG  195

Query  519   RMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
             R+ ++ V T  +EGN   E  + LA+ V QAL SVL+K   S E+
Sbjct  196   RLKNVIVFTSCKEGN--AEASQTLANDVQQALNSVLEKASPSPEY  238



>gb|KDP35868.1| hypothetical protein JCGZ_10603 [Jatropha curcas]
Length=266

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 157/227 (69%), Gaps = 3/227 (1%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALV-RPGQKGVNPEKALIAL  880
             + N+   FS    G   ++R+GS  S +LVLD EKGELV+A V R G+K  +  K L AL
Sbjct  17    YLNTLDPFSFSLQGFNGVLRDGSMVSQALVLDNEKGELVKAPVTRVGKKVPSEAKVLAAL  76

Query  879   RNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILV  700
             ++HSEAERRRRERIN HL+TLRSL+P T KMDKA LL +VIS++KEL+  A +A+KG+L+
Sbjct  77    KSHSEAERRRRERINAHLATLRSLVPCTEKMDKATLLAEVISQVKELKKKAIDASKGLLI  136

Query  699   PTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             P D DEV+VE    G    S   KAS+CCDY+ EL+ +++QA++AL LK + AE++TLG 
Sbjct  137   PMDDDEVKVETFDNGAKDGSLCFKASICCDYRPELMYDIKQAVNALQLKMVDAEISTLGG  196

Query  519   RMVSLFVVTE--NEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
             R+ ++  +T   N+   D  E ++ L +S+HQAL SVL+K   S ++
Sbjct  197   RLKNVLFLTSCRNKNITDDTETQQILVNSIHQALNSVLEKGSISPKY  243



>ref|XP_011045927.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Populus 
euphratica]
Length=222

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 144/198 (73%), Gaps = 6/198 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD EKGEL++A  R G+ G++  KA  AL++HSEAERRRRERIN HL+TLR L+P T 
Sbjct  6    LVLDVEKGELLKAPARIGKMGISEAKAFAALKSHSEAERRRRERINAHLATLRGLVPCTE  65

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA LL  VIS++KE + +A EA KG+LVP D D+V+VE   +G    +   KAS+CC
Sbjct  66   KMDKATLLAAVISQVKEHKKNALEACKGLLVPMDDDQVKVETYFDG----TLHFKASICC  121

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERR--EFLASS  439
            DY+ ELLS+LR A+DALPLK + AE++TLGSR+ + FV+T+    N  D+    + L +S
Sbjct  122  DYRPELLSDLRNAIDALPLKMVSAEISTLGSRLKNEFVLTDRRNKNALDDAGAIQLLTNS  181

Query  438  VHQALRSVLDKFYASEEF  385
            +HQ L SVL+K  AS+E+
Sbjct  182  IHQTLTSVLEKGSASQEY  199



>ref|XP_007048670.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX92827.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=290

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 139/196 (71%), Gaps = 0/196 (0%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+E+GELV A +   +KGV  E+ + AL+NHSEAERRRR RIN H  TLR ++P   
Sbjct  39   LVLDSERGELVEATMNLPRKGVAAERNMAALKNHSEAERRRRARINAHFDTLRDILPDAK  98

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCC  613
            KMDKA+LL +VI  ++EL+ +A EA KGIL+PTDTDEV VE+Q +  DG    I+ SLCC
Sbjct  99   KMDKASLLTEVIRHMRELKKNAEEACKGILIPTDTDEVIVEKQEDELDGKPCLIRVSLCC  158

Query  612  DYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVH  433
            DYK  LLS+LRQALDAL L  ++AEMAT   RM ++F+V   +E +  D       S++ 
Sbjct  159  DYKPGLLSDLRQALDALHLIIVKAEMATWEGRMKNVFLVASCKERDSKDPAVRISTSTLD  218

Query  432  QALRSVLDKFYASEEF  385
            Q LRSVLDKF ASEEF
Sbjct  219  QTLRSVLDKFSASEEF  234



>ref|XP_010057079.1| PREDICTED: transcription factor bHLH106-like [Eucalyptus grandis]
 gb|KCW74097.1| hypothetical protein EUGRSUZ_E02743 [Eucalyptus grandis]
Length=266

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 152/220 (69%), Gaps = 7/220 (3%)
 Frame = -2

Query  1059  EFFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIAL  880
             +FFN F  F  +  GI  + R GS     LVLD++K ELV+A V   +KGV  EK + A+
Sbjct  15    DFFNVFDTFQRDFGGINGVPRGGS-----LVLDSDKSELVKAPVGVIKKGVTQEKLMAAM  69

Query  879   RNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILV  700
             ++HSEAERRRRERIN HL+TLR L+P T KMDKA LL +V+S++KEL+  A EA+KG+LV
Sbjct  70    KSHSEAERRRRERINSHLNTLRGLVPCTEKMDKATLLAEVVSQVKELKKKAIEASKGLLV  129

Query  699   PTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             P D DE+ VE   +G     +S +AS+CC+Y+ ELLSE+R+AL+ LPLK ++ E++TL  
Sbjct  130   PMDADEITVEPCGDGARDDEFSFRASICCEYRPELLSEMRRALEVLPLKIVKTEISTLEG  189

Query  519   RMVSLFVVTEN--EEGNDSDERREFLASSVHQALRSVLDK  406
             R+ + FV + +  E  N   E R+ L SSVHQAL S+ DK
Sbjct  190   RVKNAFVFSSSAEERKNFDSEARQSLMSSVHQALNSLRDK  229



>ref|XP_002522566.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF39866.1| DNA binding protein, putative [Ricinus communis]
Length=227

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALV-RPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD+EKGELV+A   + G+KGV+  KAL AL++HSEAERRRRERIN HL+TLR L+P T
Sbjct  6    LVLDSEKGELVKAPAPKVGKKGVSEAKALAALKSHSEAERRRRERINAHLATLRGLVPCT  65

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
             KMDKA LL +VIS++KELR +A EA+KG+L+P   DEV+VE    G    +   KASLC
Sbjct  66   EKMDKATLLAEVISQVKELRKNAIEASKGLLIPMPDDEVKVEAYDNGLGDGTLYFKASLC  125

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE--NEEGNDSDERREFLAS  442
            CDY+ ELLS+++QA+DAL +K L AE++TLG R+ ++  +T   N+   +  E  + L +
Sbjct  126  CDYRPELLSDIKQAIDALQMKLLDAEISTLGVRLKNVLFLTSCRNKNAVNDAEAIKLLTN  185

Query  441  SVHQALRSVLDKFYASEEF  385
            S+H+AL SVLDK   S E+
Sbjct  186  SIHEALNSVLDKGCISPEY  204



>ref|XP_004163475.1| PREDICTED: putative transcription factor bHLH107-like [Cucumis 
sativus]
Length=255

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 152/215 (71%), Gaps = 3/215 (1%)
 Frame = -2

Query  1032  STENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERR  853
             S EN+  +  +R GS  S SLVL+ EKGELV+A ++  +K V+ EKAL AL+NHSEAERR
Sbjct  17    SLENFN-RGFVRGGSILSQSLVLNGEKGELVKAPIQTSKKRVSEEKALAALKNHSEAERR  75

Query  852   RRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRV  673
             RRERIN HLSTLR L+P   K DKA LL +V+ ++KEL+  A+EA+ G+ VP DTDEV V
Sbjct  76    RRERINSHLSTLRGLVPCPLKRDKATLLAEVVRQVKELKKKAAEASNGVFVPMDTDEVNV  135

Query  672   EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVT  493
             E    G +G   S KA+LCC+Y+ ELLS+L+Q LD+L LK ++AE++TLG+R+ ++F+ T
Sbjct  136   EPYGVGANG-DMSFKATLCCEYRPELLSDLKQTLDSLHLKLVKAEISTLGNRVKNIFIFT  194

Query  492   ENEEGN-DSDERREFLASSVHQALRSVLDKFYASE  391
                  N D  E    LASSVHQA+  VL+K  + E
Sbjct  195   SAIADNGDHPEASRHLASSVHQAISFVLEKASSPE  229



>ref|XP_003529368.1| PREDICTED: transcription factor bHLH30-like [Glycine max]
Length=273

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 151/210 (72%), Gaps = 6/210 (3%)
 Frame = -2

Query  999  RNGsssssSLVLDTEKGELVR--ALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHL  826
            R G SS  SLV ++EKGELV+  A  + G+  +   KAL AL+NHSEAERRRRERIN HL
Sbjct  35   RGGLSSPHSLVFESEKGELVKCPATAKVGKSEICEAKALAALKNHSEAERRRRERINAHL  94

Query  825  STLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE-QQAEGCD  649
            +TLR L+P T KMDKA LL +VIS++KEL+ +A EA+KG L+P D DEV+VE    EG D
Sbjct  95   ATLRGLVPSTEKMDKATLLAEVISQVKELKKNAMEASKGFLIPMDADEVKVEPYDDEGGD  154

Query  648  GASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVT--ENEEGN  475
            G S S  A++CCD++ E+LS+LRQ LD+LPL  ++AE++TL  RM ++FV T  +    N
Sbjct  155  G-SMSYCATICCDFRSEILSDLRQTLDSLPLHLVKAEISTLAGRMKNVFVFTCCKGNINN  213

Query  474  DSDERREFLASSVHQALRSVLDKFYASEEF  385
               E+ + LAS+VHQAL SVLDK  A+ +F
Sbjct  214  IDIEKCQALASTVHQALCSVLDKASATLDF  243



>ref|XP_011045926.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Populus 
euphratica]
Length=223

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 144/199 (72%), Gaps = 7/199 (4%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD EKGEL++A  R G+ G++  KA  AL++HSEAERRRRERIN HL+TLR L+P T 
Sbjct  6    LVLDVEKGELLKAPARIGKMGISEAKAFAALKSHSEAERRRRERINAHLATLRGLVPCTE  65

Query  792  K-MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            K MDKA LL  VIS++KE + +A EA KG+LVP D D+V+VE   +G    +   KAS+C
Sbjct  66   KQMDKATLLAAVISQVKEHKKNALEACKGLLVPMDDDQVKVETYFDG----TLHFKASIC  121

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERR--EFLAS  442
            CDY+ ELLS+LR A+DALPLK + AE++TLGSR+ + FV+T+    N  D+    + L +
Sbjct  122  CDYRPELLSDLRNAIDALPLKMVSAEISTLGSRLKNEFVLTDRRNKNALDDAGAIQLLTN  181

Query  441  SVHQALRSVLDKFYASEEF  385
            S+HQ L SVL+K  AS+E+
Sbjct  182  SIHQTLTSVLEKGSASQEY  200



>ref|XP_007153714.1| hypothetical protein PHAVU_003G058800g [Phaseolus vulgaris]
 gb|ESW25708.1| hypothetical protein PHAVU_003G058800g [Phaseolus vulgaris]
Length=270

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 152/210 (72%), Gaps = 8/210 (4%)
 Frame = -2

Query  1005  MIRNGsssssSLVLDTEKGELVR--ALVRPGQKGVNPEKALIALRNHSEAERRRRERING  832
             +++ G SSS SLV ++EKGELV+  +  R G+  +   KAL AL+NHSEAERRRRERING
Sbjct  36    VVKGGLSSSHSLVYESEKGELVKYSSAARVGKNEICEAKALAALKNHSEAERRRRERING  95

Query  831   HLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGC  652
             HL+TLR L+P T KMDKA LL +VIS++KEL+ +A EA+KG L+P D DEV+VE     C
Sbjct  96    HLTTLRGLVPSTEKMDKATLLAEVISQVKELKKTAVEASKGFLIPMDADEVKVEP----C  151

Query  651   DGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGND  472
             DG S S  A++CCD++ E++S+LRQ LD+LPL   +AE++TL  RM ++FV T  +   +
Sbjct  152   DG-SKSYSATICCDFRPEIISDLRQTLDSLPLHLEKAEISTLAGRMKNVFVFTCCKGNIN  210

Query  471   SD-ERREFLASSVHQALRSVLDKFYASEEF  385
              D E  + LA +VHQAL SVLDK  AS EF
Sbjct  211   IDTEECQALARTVHQALSSVLDKASASLEF  240



>ref|XP_007025401.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28023.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=320

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 147/249 (59%), Gaps = 54/249 (22%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD+EKGELV+A V+ G+K V+ EK + AL++HSEAE+RRRERIN HL TLR L+P   
Sbjct  50   LVLDSEKGELVKAPVKVGKKSVSEEKVIAALKSHSEAEKRRRERINAHLDTLRGLLPCRE  109

Query  792  K----------------------------------------------------MDKAALL  769
            K                                                    MDKA LL
Sbjct  110  KRALMAKVAFSHGIVLIICCPPREKKENEAKFTERKEEDSLYVWICSMLTKLEMDKATLL  169

Query  768  GKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLS  589
            G+VI ++KEL+ +A+EA+KG LVP D DEVRVE   +  +G     KAS+CCDY+ ELL+
Sbjct  170  GEVIRQVKELKKNATEASKGFLVPMDDDEVRVEPCEDEANGILL-FKASICCDYRPELLT  228

Query  588  ELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLASSVHQALRSVL  412
            +LR+ALDALP+K ++AE +TLGSR+ + FV       + D  E R FLA S+HQAL SVL
Sbjct  229  DLRRALDALPIKMVKAETSTLGSRLKNDFVFAGCRTAHADEAEARRFLACSIHQALNSVL  288

Query  411  DKFYASEEF  385
            +K  AS E+
Sbjct  289  EKASASPEY  297



>ref|XP_008443115.1| PREDICTED: putative transcription factor bHLH107 [Cucumis melo]
Length=255

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 154/223 (69%), Gaps = 8/223 (4%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALR  877
             F +S   F   N G    +R GS  S SLVL+ E+GELV+A ++  +K V+ EKAL AL+
Sbjct  14    FLHSLDNF---NRG---FVRGGSILSQSLVLNGERGELVKAPIQASKKRVSEEKALAALK  67

Query  876   NHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVP  697
             NHSEAERRRRERIN HLSTLR L+P   K DKA LL +V+ ++KEL+  A+EA+ G+ VP
Sbjct  68    NHSEAERRRRERINSHLSTLRGLVPCPVKRDKATLLAEVVRQVKELKKKAAEASNGVFVP  127

Query  696   TDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSR  517
              DTDEV VE    G +G   S KA+LCC+Y+ ELLS+L+Q LD+L LK ++AE++TLG+R
Sbjct  128   MDTDEVNVEPCGVGANG-DMSFKATLCCEYRPELLSDLKQTLDSLHLKLVKAEISTLGNR  186

Query  516   MVSLFVVTEN-EEGNDSDERREFLASSVHQALRSVLDKFYASE  391
             M ++F+ T +  E  D  E    LASSVHQA+  VL+K  + E
Sbjct  187   MKNIFIFTCSIAENGDHPEASRRLASSVHQAISFVLEKASSPE  229



>ref|XP_004149053.1| PREDICTED: putative transcription factor bHLH107-like [Cucumis 
sativus]
 gb|KGN65644.1| hypothetical protein Csa_1G477540 [Cucumis sativus]
Length=255

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 3/215 (1%)
 Frame = -2

Query  1032  STENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERR  853
             S EN+  +  +R GS  S SLVL+ EKGELV+A ++  +K V+ EKAL AL+NHSEAERR
Sbjct  17    SLENFN-RGFVRGGSILSQSLVLNGEKGELVKAPIQASKKRVSEEKALAALKNHSEAERR  75

Query  852   RRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRV  673
             RRERIN HLSTLR L+P   K DKA LL +V+ ++KEL+  A+E + G+ VP DTDEV V
Sbjct  76    RRERINSHLSTLRGLVPCPLKRDKATLLAEVVRQVKELKKKAAEVSNGVFVPMDTDEVNV  135

Query  672   EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVT  493
             E    G +G   S KA+LCC+Y+ ELLS+L+Q LD+L LK ++AE++TLG+R+ ++F+ T
Sbjct  136   EPCGVGANG-DMSFKATLCCEYRPELLSDLKQTLDSLHLKLVKAEISTLGNRVKNIFIFT  194

Query  492   ENEEGN-DSDERREFLASSVHQALRSVLDKFYASE  391
                  N D  E    LASSVHQA+  VL+K  + E
Sbjct  195   SAIADNGDHPEASRHLASSVHQAISFVLEKASSPE  229



>ref|XP_003518882.1| PREDICTED: transcription factor bHLH30-like [Glycine max]
Length=271

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 150/202 (74%), Gaps = 7/202 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALV--RPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPG  799
            LV +++KGELV+ L   + G+  +   KAL AL+NHSEAERRRRERINGHL+TLR L+P 
Sbjct  41   LVFESDKGELVKCLAAAKVGKSEICEAKALAALKNHSEAERRRRERINGHLATLRGLVPS  100

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE--QQAEGCDGASYSIKA  625
            T KMDKA LL +VIS++KEL+ +A+E +KG L+P D DEV+VE     EG +G S S  A
Sbjct  101  TEKMDKATLLAEVISQVKELKKNAAEVSKGFLIPKDADEVKVEPYNDHEGGEG-SMSYSA  159

Query  624  SLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG-NDSD-ERREF  451
            ++CCD++ E+LS+LRQ LD+LPL  ++AE++TL  RM ++FV T  +E  N+ D E+ + 
Sbjct  160  TICCDFRPEILSDLRQTLDSLPLHLVKAEISTLAGRMKNVFVFTCCKENINNIDFEKCQA  219

Query  450  LASSVHQALRSVLDKFYASEEF  385
            LAS+VHQAL SV++K  AS +F
Sbjct  220  LASTVHQALCSVMEKASASLDF  241



>gb|KHN32341.1| Transcription factor bHLH30 [Glycine soja]
Length=272

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 150/202 (74%), Gaps = 7/202 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALV--RPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPG  799
            LV +++KGELV+ L   + G+  +   KAL AL+NHSEAERRRRERINGHL+TLR L+P 
Sbjct  42   LVFESDKGELVKCLAAAKVGKSEICEAKALAALKNHSEAERRRRERINGHLATLRGLVPS  101

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE--QQAEGCDGASYSIKA  625
            T KMDKA LL +VIS++KEL+ +A+E +KG L+P D DEV+VE     EG +G S S  A
Sbjct  102  TEKMDKATLLAEVISQVKELKKNAAEVSKGFLIPKDADEVKVEPYNDHEGGEG-SMSYSA  160

Query  624  SLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG-NDSD-ERREF  451
            ++CCD++ E+LS+LRQ LD+LPL  ++AE++TL  RM ++FV T  +E  N+ D E+ + 
Sbjct  161  TICCDFRPEILSDLRQTLDSLPLHLVKAEISTLAGRMKNVFVFTCCKENINNIDFEKCQA  220

Query  450  LASSVHQALRSVLDKFYASEEF  385
            LAS+VHQAL SV++K  AS +F
Sbjct  221  LASTVHQALCSVMEKASASLDF  242



>ref|XP_010103039.1| hypothetical protein L484_005794 [Morus notabilis]
 gb|EXB94637.1| hypothetical protein L484_005794 [Morus notabilis]
Length=261

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN  793
            LVLD +KGELV+A  R G+KG++  KAL AL+NHSEAERRRRERIN HLSTLR L+P   
Sbjct  40   LVLDGKKGELVKAPARVGKKGISEAKALAALKNHSEAERRRRERINAHLSTLRGLVPCNG  99

Query  792  KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE--QQAEGCDGASYSIKASL  619
            KMDKA LL +VI ++KEL+ +A+EA+KG+L+P D D+V VE           + + KASL
Sbjct  100  KMDKATLLAEVILQVKELKKNAAEASKGLLIPMDADQVHVEPYNNNRAVGDRTPAFKASL  159

Query  618  CCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLAS  442
            CC Y+ ELLS++RQALDALP+K +R E++TLG R+  LFV T  ++ N  D E    +A 
Sbjct  160  CCGYRPELLSDIRQALDALPVKMVRTEISTLGERLKILFVFTYCKDKNSDDAETCRNIAI  219

Query  441  SVHQALRSVLDKFYASEEF  385
            SV + L S+LDK  A  E+
Sbjct  220  SVQEILSSILDKASALAEY  238



>ref|XP_010052204.1| PREDICTED: transcription factor bHLH30-like [Eucalyptus grandis]
 gb|KCW76133.1| hypothetical protein EUGRSUZ_D00509 [Eucalyptus grandis]
Length=260

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -2

Query  972  LVLDTEKGELV-RALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD EK ELV +A  R  +K V  EKAL ALRNHSEAERRRRERIN HL+TLR L+PG 
Sbjct  39   LVLDGEKSELVIKAPNRAAKKNVPEEKALAALRNHSEAERRRRERINSHLATLRGLVPGE  98

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            +KMDKA LL  VI E+KEL+ +A EA+KG+LVP D DEV+VE   +     ++S KAS+C
Sbjct  99   DKMDKATLLAHVIEEVKELKKTALEASKGLLVPLDADEVKVEPLDDATGNGTFSFKASIC  158

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEE--GNDSDERREFLAS  442
            C Y+ ELLS+LRQA++AL LK ++AE++TL SR+ + F+    +E    +   +R+ LAS
Sbjct  159  CQYRPELLSDLRQAINALHLKIVKAEISTLESRLRNEFIFLSGKEQFSYNWSLQRQLLAS  218

Query  441  SVHQALRSVLDKFYASEEFssrtslsskrrrvSFLN  334
            S+ QAL SVL K   S E+S RT+L SKRRRVSFLN
Sbjct  219  SIRQALCSVLAKTSISSEYSPRTTLPSKRRRVSFLN  254



>gb|ACU22947.1| unknown [Glycine max]
Length=271

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 149/202 (74%), Gaps = 7/202 (3%)
 Frame = -2

Query  972  LVLDTEKGELVRALV--RPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPG  799
            LV +++KGELV+ L   + G+  +   KAL AL+NHSEAERRRRERINGHL+TLR L+P 
Sbjct  41   LVFESDKGELVKCLAAAKVGKSEICEAKALAALKNHSEAERRRRERINGHLATLRGLVPS  100

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE--QQAEGCDGASYSIKA  625
            T KMDKA LL +VIS++KEL+ +A+  +KG L+P D DEV+VE     EG +G S S  A
Sbjct  101  TEKMDKATLLAEVISQVKELKKNAAGVSKGFLIPKDADEVKVEPYNDHEGGEG-SMSYSA  159

Query  624  SLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEG-NDSD-ERREF  451
            ++CCD++ E+LS+LRQ LD+LPL  ++AE++TL  RM ++FV T  +E  N+ D E+ + 
Sbjct  160  TICCDFRPEILSDLRQTLDSLPLHLVKAEISTLAGRMKNVFVFTCCKENINNIDFEKCQA  219

Query  450  LASSVHQALRSVLDKFYASEEF  385
            LAS+VHQAL SV++K  AS +F
Sbjct  220  LASTVHQALCSVMEKASASLDF  241



>gb|KEH36578.1| transcription factor [Medicago truncatula]
Length=256

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 143/207 (69%), Gaps = 5/207 (2%)
 Frame = -2

Query  999  RNGsssssSLVLDTEKGELVRA--LVRPGQKGVNPEKALIALRNHSEAERRRRERINGHL  826
            R G  S++SLVLD+EKGELV++  ++   +K  +  K L+AL+NH EAER+RR RINGHL
Sbjct  27   RGGFVSTNSLVLDSEKGELVKSPPIINGEKKICDANKTLVALKNHREAERKRRNRINGHL  86

Query  825  STLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDG  646
            + LR+L+P + KMDKA LL +VI ++K L+ +A EA+KG  +PTD DEV+VE      +G
Sbjct  87   AKLRALVPSSPKMDKATLLAEVIRQVKHLKKNADEASKGYSIPTDDDEVKVEPYE---NG  143

Query  645  ASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD  466
             S+  KAS+ CDY+ ELLS+LRQ LD L L+ +R E++TLG R+ + FV T  +      
Sbjct  144  GSFLYKASISCDYRPELLSDLRQTLDKLQLQLVREEISTLGDRVKNEFVYTCCKVDIYDI  203

Query  465  ERREFLASSVHQALRSVLDKFYASEEF  385
            E    +AS+VHQAL SVL++   S ++
Sbjct  204  ELCPLIASNVHQALSSVLERASTSMDY  230



>ref|XP_004505138.1| PREDICTED: transcription factor bHLH30-like [Cicer arietinum]
Length=273

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 164/235 (70%), Gaps = 17/235 (7%)
 Frame = -2

Query  1062  MEFFN-SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALV--RPGQKGVNPEKA  892
             ++ FN +   F   N G+ R   NG  +S SL+L++EK ++V+  V  + G+  ++  K 
Sbjct  17    LDLFNPTLHDFGASN-GVSR---NGLPTSDSLILESEKEKVVKCPVTAKVGKDEISQAKV  72

Query  891   LIALRNHSEAERRRRERINGHLSTLRSLIPGTN-KMDKAALLGKVISEIKELRSSASEAT  715
             L A++NHSEAE+RRRERINGHL+TLR L+  TN KMDKA LLG+VIS++K+L+ +A+EA+
Sbjct  73    LAAMKNHSEAEKRRRERINGHLATLRGLVASTNQKMDKATLLGEVISQVKQLKKNATEAS  132

Query  714   KGILVPTDTDEVRVE----QQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             KG L+P +TDEV+VE    ++  GC     S  A++CCD++ E+LS+LR+ LDAL L+ +
Sbjct  133   KGYLIPMETDEVKVEPYNVEERNGC----MSYIATICCDFQPEILSDLRKTLDALQLQLV  188

Query  546   RAEMATLGSRMVSLFVVTENEEGNDSDERR-EFLASSVHQALRSVLDKFYASEEF  385
             +AEM+TL +RM ++F+ T  +  + ++ +  + +A+ VH+AL SVL+K   S EF
Sbjct  189   KAEMSTLENRMKNVFIFTCCKGDSINNVKACQSIANVVHKALGSVLEKASNSLEF  243



>ref|XP_009624214.1| PREDICTED: transcription factor bHLH30-like [Nicotiana tomentosiformis]
Length=240

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD+EKGELV+A  R G+K G +  K++ AL++HSEAERRRRERIN HL+TLR+L+P +
Sbjct  24   LVLDSEKGELVKASGRVGKKTGKSEGKSIAALKSHSEAERRRRERINAHLATLRNLVPSS  83

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            +KMDKAALL +VI ++K+L+ +AS  ++   +P D+DE+RVE  AE     +   KAS+C
Sbjct  84   DKMDKAALLAEVICQVKQLKETASHVSESFFIPLDSDEIRVETIAENAGDGTCLFKASIC  143

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLASS  439
            C+Y+ ELLS+LRQ +++L +  +++E++TLGSR+ ++FV T   +G  ++ E RE L +S
Sbjct  144  CEYRPELLSDLRQVINSLNVNLVKSEISTLGSRVKNIFVFTNVIDGGHANIEAREILLTS  203

Query  438  VHQALRSVLDKFYASEEF  385
              QA  SVLDK  A  E+
Sbjct  204  ARQAFSSVLDKVSAFPEY  221



>gb|EYU43349.1| hypothetical protein MIMGU_mgv1a012656mg [Erythranthe guttata]
Length=244

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 140/199 (70%), Gaps = 12/199 (6%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD EKGELV++ V+ G+K    E K + AL++HSEAERRRRE+IN H ++LR L+P +
Sbjct  36   LVLDGEKGELVKSSVKLGKKIEGLETKTMAALKSHSEAERRRREKINAHFTSLRGLVPDS  95

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE--QQAEGCDGASYSIKAS  622
             KMDKAALL +VIS++K+L+++A +A++G+ +P DTDEV+VE           S+ ++ S
Sbjct  96   EKMDKAALLAEVISQVKQLKTTAKQASEGLHIPMDTDEVQVEVLDNNNNAINGSFLLRVS  155

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLAS  442
            LCC+Y+ +LLSE+RQAL  L  + L +E++TLG R+ ++F+VT  EE N+         +
Sbjct  156  LCCEYRPDLLSEVRQALSILRARILESEISTLGGRVKTVFLVTTEEETNE---------N  206

Query  441  SVHQALRSVLDKFYASEEF  385
            +V  AL +VLDK  AS E+
Sbjct  207  AVRSALSNVLDKLSASAEY  225



>ref|XP_011086002.1| PREDICTED: transcription factor bHLH30-like [Sesamum indicum]
Length=239

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  999  RNGsssssSLVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLS  823
            RN      SLVLD +KGELV+A  R G+K GV   K + AL++HSEAERRRRERIN HL 
Sbjct  20   RNSMPVKHSLVLDGDKGELVKASERMGKKIGVPETKTIAALKSHSEAERRRRERINAHLV  79

Query  822  TLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE-QQAEGCDG  646
            TLR L+P   KMDKA LL +VI ++K+LR++A +A++G+ +P D DEV+VE  +  G DG
Sbjct  80   TLRGLVPNNEKMDKATLLAEVICQVKQLRAAARQASEGLHIPMDADEVQVEILEHNGGDG  139

Query  645  ASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD  466
             S  ++ASLCCDY+ +LLS++RQA++ L ++ L++E++TLG R+ ++F+VT  E  N   
Sbjct  140  -SLLLRASLCCDYRPDLLSDIRQAINDLHIQVLKSEISTLGGRVKTVFLVTTGEGDNGYA  198

Query  465  ERREFLASSVHQALRSVLDKFYASEEF  385
             + E L SSV  AL  +LDK  AS E+
Sbjct  199  AQLEVLVSSVRAALSKILDKVSASTEY  225



>emb|CDO96779.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQKGVNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD E+GELV++  R G+KG   E K + AL++HSEAERRRRERIN HL+TLR L+P  
Sbjct  47   LVLDGERGELVKSCGRVGKKGEASEAKTIAALKSHSEAERRRRERINAHLATLRGLVPPN  106

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
             KMDKA LL +VIS++K+L+ + ++ ++   +P D+DEVRVEQ  E     +++ KASLC
Sbjct  107  EKMDKATLLAEVISQVKQLQKTTTQISERFCIPLDSDEVRVEQLDEISVEGTFNFKASLC  166

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLASS  439
            CDY+  LLS+L++A+ +LPL  +R+E++TLG R++++   T +  G+  S E R+ L +S
Sbjct  167  CDYRPGLLSDLKKAIGSLPLTLMRSEISTLGGRLMNVLFFTSSRRGDIGSAEDRKQLVNS  226

Query  438  VHQALRSVLDKFYASEE  388
            VHQAL S+LDKF  S +
Sbjct  227  VHQALSSILDKFAESTD  243



>ref|XP_004232970.1| PREDICTED: transcription factor bHLH30-like [Solanum lycopersicum]
Length=240

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 141/200 (71%), Gaps = 4/200 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD+EKGELV+A  R  +K G +  K + AL++HSEAERRRR+RIN HLSTLR+L+P +
Sbjct  21   LVLDSEKGELVKASGRVEKKIGKSEGKTIAALKSHSEAERRRRQRINAHLSTLRNLVPSS  80

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            +KMDKAALL +V+ ++K+L+ +A+  ++   +P D+DE++VE  AE     +   +AS+C
Sbjct  81   DKMDKAALLAEVVRQVKQLKETATHDSERFFIPLDSDEIKVEIIAENAIDGTCLFRASVC  140

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGND---SDERREFLA  445
            C+Y+  LLS+L+Q +++L +  +++E++TLGSR+ ++F+ T +  G     + + R+   
Sbjct  141  CEYRTHLLSDLKQTINSLHVNLVKSEISTLGSRVKNVFLFTNSIHGGGGCATIQARDIFL  200

Query  444  SSVHQALRSVLDKFYASEEF  385
            SSV QA  SVLDK  A  E+
Sbjct  201  SSVRQAFSSVLDKVSAFPEY  220



>gb|KDO77843.1| hypothetical protein CISIN_1g024670mg [Citrus sinensis]
Length=194

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  891  LIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATK  712
            ++AL+NHSEAERRRRERIN HL TLR L+P   KMDKA LL +VI ++KEL+++A EA+K
Sbjct  1    MVALKNHSEAERRRRERINAHLDTLRGLVPPNGKMDKATLLAEVIRQVKELKTNAIEASK  60

Query  711  GILVPTDTDEVRVEQ-QAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEM  535
            G L+PTD DEV+VE    E    A +  KAS+CC+Y+ EL+S+LRQALDALPLK L+AE+
Sbjct  61   GFLIPTDADEVKVEPYNDEEAGDADFLYKASICCEYRPELMSDLRQALDALPLKMLKAEI  120

Query  534  ATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
            +TLG R+ ++ V T  +EGN   E  + LA+ V QAL SVL+K   S E+
Sbjct  121  STLGGRLKNVIVFTSCKEGN--AEASQTLANDVQQALNSVLEKASPSPEY  168



>gb|ACU18057.1| unknown [Glycine max]
Length=179

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  1017  GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERI  838
             G   +I +G  SS SLVLD E+GELV A VR  +KGV+ E+++ AL++HSEAER+RR RI
Sbjct  26    GSNGVIGSGCGSSFSLVLDRERGELVEAPVRLERKGVSTERSIEALKSHSEAERKRRARI  85

Query  837   NGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAE  658
             N HL TLRS+IPG  KMDKA+LLG+VI  +KEL+ +A++A +G+++P D DE+ VE+Q  
Sbjct  86    NAHLDTLRSVIPGVMKMDKASLLGEVIRHLKELKKNAAQACEGLMIPKDNDEISVEEQEG  145

Query  657   GCDGASYSIKASLCCDYKHELLSELRQALDALPL  556
             G +G  YSI+ASLCC+YK  LLS+++QALDAL L
Sbjct  146   GLNGFPYSIRASLCCEYKPGLLSDIKQALDALHL  179



>ref|XP_006362421.1| PREDICTED: transcription factor bHLH30-like [Solanum tuberosum]
Length=235

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 139/198 (70%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD+EK ELV+A  R  +K G +  K + AL++HSEAERRRR+RIN HLSTLR+L+P +
Sbjct  18   LVLDSEKSELVKASGRVEKKIGKSEGKTIAALKSHSEAERRRRQRINAHLSTLRNLVPSS  77

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            +KMDKAALL +V+ ++K L+ +A+  ++   +P D+DE++VE  AE     +   +AS+C
Sbjct  78   DKMDKAALLAEVVCQVKRLKETATNVSERFFIPLDSDEIKVEIIAENAIDGTCLYRASIC  137

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLASS  439
            C+Y+  LLS+L++ +++L +  +++E++TLGSR+ ++F+ T   +G  ++ E RE   SS
Sbjct  138  CEYRPHLLSDLKETINSLHVNLVKSEISTLGSRVKNVFLFTNLIDGGRANTEAREIFLSS  197

Query  438  VHQALRSVLDKFYASEEF  385
            V QA   +LDK  A  E+
Sbjct  198  VRQAFSCILDKVSAFPEY  215



>ref|XP_011096434.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Sesamum 
indicum]
Length=223

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLI-PG  799
            LVLD EK ELV+A  R G+K  V+  K + AL++HSEAERRRRERIN HL TLR L+ P 
Sbjct  7    LVLDDEKSELVKASERMGKKIAVSESKTMAALKSHSEAERRRRERINAHLVTLRGLLAPI  66

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASL  619
            + KMDKA LL +VISE+K+L+ +A  A++G+ VPTDT+EV+VE+  +  D  S  ++ASL
Sbjct  67   SGKMDKATLLAEVISEVKQLKKTARRASEGLHVPTDTNEVQVEKLEDKADDGSVLLRASL  126

Query  618  CCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLAS  442
            CCDY  +LLS ++QA++ LP + L+ E++TLG R+  +F++T + EGN  S    E   S
Sbjct  127  CCDYTPDLLSNVKQAINDLPWQPLKCEISTLGGRVKIVFLITASGEGNCGSTAAEELHFS  186

Query  441  SVHQALRSVLDKFYASEEF  385
            S+  AL ++LDK  AS E+
Sbjct  187  SISAALSNILDKVSASAEY  205



>ref|XP_011096433.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Sesamum 
indicum]
Length=245

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLI-PG  799
            LVLD EK ELV+A  R G+K  V+  K + AL++HSEAERRRRERIN HL TLR L+ P 
Sbjct  29   LVLDDEKSELVKASERMGKKIAVSESKTMAALKSHSEAERRRRERINAHLVTLRGLLAPI  88

Query  798  TNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASL  619
            + KMDKA LL +VISE+K+L+ +A  A++G+ VPTDT+EV+VE+  +  D  S  ++ASL
Sbjct  89   SGKMDKATLLAEVISEVKQLKKTARRASEGLHVPTDTNEVQVEKLEDKADDGSVLLRASL  148

Query  618  CCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLAS  442
            CCDY  +LLS ++QA++ LP + L+ E++TLG R+  +F++T + EGN  S    E   S
Sbjct  149  CCDYTPDLLSNVKQAINDLPWQPLKCEISTLGGRVKIVFLITASGEGNCGSTAAEELHFS  208

Query  441  SVHQALRSVLDKFYASEEF  385
            S+  AL ++LDK  AS E+
Sbjct  209  SISAALSNILDKVSASAEY  227



>ref|XP_009778313.1| PREDICTED: transcription factor bHLH30-like [Nicotiana sylvestris]
Length=240

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK-GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGT  796
            LVLD+EKGELV+A  R G+K G +  K + AL++HSEAERRRRERIN H +TLR+L+P +
Sbjct  24   LVLDSEKGELVKASGRVGKKVGKSEGKRIAALKSHSEAERRRRERINAHFATLRNLVPSS  83

Query  795  NKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLC  616
            +KMDKAALL +VI ++K+L+ +A+  ++   +P D+DE+RVE  AE     +   +AS+C
Sbjct  84   DKMDKAALLAQVICQVKQLKETATHVSESFFIPLDSDEIRVETIAENAGDGTCLFRASIC  143

Query  615  CDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSD-ERREFLASS  439
            C+Y+ ELLS+LR+ +++L +  +++E++TLGSR+ ++FV T   +G  ++ E RE L +S
Sbjct  144  CEYRPELLSDLREVINSLRVNLVKSEISTLGSRVKNIFVFTNVIDGGHANIEAREILLTS  203

Query  438  VHQALRSVLDKFYASEEF  385
              QA  SVL K  A  E+
Sbjct  204  ARQAFSSVLGKVAAFPEY  221



>ref|XP_009390676.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 10/200 (5%)
 Frame = -2

Query  972  LVLDTEKGELVRALVRPGQK----GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLI  805
            +VLD E+    RA  R G K    G+   K  +A+++HSEAERRRRERINGHL+ LRS++
Sbjct  32   MVLDQER----RAPSRLGGKRVGAGILDAKTAMAMKSHSEAERRRRERINGHLAVLRSMV  87

Query  804  PGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKA  625
            P  +KMDKAALL +VIS +K+L+ +A+E  K   VP+DTDEVRVE + +        ++A
Sbjct  88   PCDDKMDKAALLAQVISHVKKLKRNAAEINKSYTVPSDTDEVRVEVEGDMTIAGRLMVRA  147

Query  624  SLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLA  445
            SLCCD + E+L++LRQAL  L LKT+RAE++TLG RM +  V+T   EG  S+  +    
Sbjct  148  SLCCDDRPEILADLRQALSGLHLKTVRAEISTLGGRMKN--VLTMTSEGTFSNVDKHLFV  205

Query  444  SSVHQALRSVLDKFYASEEF  385
            +SVHQAL S+LD+  + E+F
Sbjct  206  ASVHQALNSILDRVKSREDF  225



>gb|KDP21083.1| hypothetical protein JCGZ_21554 [Jatropha curcas]
Length=255

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 146/229 (64%), Gaps = 18/229 (8%)
 Frame = -2

Query  1056  FFNSFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALV-RPGQKGVNPEKALIAL  880
             +FN+   FS    G   ++R+GS  S +LVLD EKGELV+A V R G+K  +  KAL AL
Sbjct  17    YFNTLDPFSFRLQGFNGVLRDGSMVSQALVLDNEKGELVKAPVTRVGKKVPSEAKALAAL  76

Query  879   RNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILV  700
             ++HSEAERRRRERIN HL+TLR L+P T K             +KEL+  A +A+KG+L+
Sbjct  77    KSHSEAERRRRERINAHLATLRGLVPCTEK-------------VKELKKKAIDASKGLLI  123

Query  699   PTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             P D DEV+VE    G +  +   KAS+CCDY+ EL+ +++QA++AL LK +  E++TLG 
Sbjct  124   PMDDDEVKVETFDNGAEDGTLCFKASICCDYRPELMYDIKQAVNALQLKMVDVEISTLGG  183

Query  519   RMVSLFVVTE----NEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
             ++ ++  +T      +   D  E ++ L +S+HQAL SVL+K   S E+
Sbjct  184   QLKNVLFLTSYRKRKKNVTDDTETQQILVNSIHQALNSVLEKGSISPEY  232



>ref|XP_010099375.1| hypothetical protein L484_004801 [Morus notabilis]
 gb|EXB78100.1| hypothetical protein L484_004801 [Morus notabilis]
Length=230

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 125/192 (65%), Gaps = 30/192 (16%)
 Frame = -2

Query  954  KGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAA  775
            +GELV A V+  +K V+ EK++ AL+NHSEAE+RRR RIN H  TLR LIPG  KMDKA+
Sbjct  50   RGELVEAPVKLERKMVSAEKSVEALKNHSEAEKRRRARINAHFDTLRGLIPGAKKMDKAS  109

Query  774  LLGKVISEIKELRSSASEATK--GILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKH  601
            LL +VIS +K+L+  A+EA++    ++P D DEV+VE                   D+K 
Sbjct  110  LLAEVISHLKDLKRKAAEASEDSDCVIPKDIDEVKVEP------------------DHK-  150

Query  600  ELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALR  421
                   QALDAL L T RAE+ATLG RM ++FV+T ++E ND   R  F A SV QALR
Sbjct  151  -------QALDALHLITKRAEIATLGCRMKNVFVMTTSKEENDEVCR--FYARSVCQALR  201

Query  420  SVLDKFYASEEF  385
            +VL+KF ASEEF
Sbjct  202  AVLEKFSASEEF  213



>ref|XP_009389985.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 133/193 (69%), Gaps = 2/193 (1%)
 Frame = -2

Query  963  DTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMD  784
            D E+ +LV A  R    G    K  +A+++H EAERRRRERINGHL+ LRS++P  +K+D
Sbjct  36   DQERSKLVGAPWRLEGGGALDAKTAMAMKSHCEAERRRRERINGHLAVLRSMVPCADKLD  95

Query  783  KAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYK  604
            KAALL +VI  +K+L+ +A E +KG  +P+DTDEVRVE Q +      + +KA LCC+ +
Sbjct  96   KAALLAEVIGHVKKLKRNAVEISKGYTIPSDTDEVRVEVQGDAMSTGGFMVKACLCCEDR  155

Query  603  HELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQAL  424
              +L++LRQ L +L L+T+RAE++TLG R+ ++FV+   +   + D R  F+A SVHQAL
Sbjct  156  PWILADLRQTLHSLHLQTIRAEISTLGGRIKNVFVMRSAKNSRNID-RHHFVA-SVHQAL  213

Query  423  RSVLDKFYASEEF  385
            +S+L++  +  +F
Sbjct  214  KSILERINSQVDF  226



>ref|XP_010035845.1| PREDICTED: transcription factor bHLH30-like [Eucalyptus grandis]
 ref|XP_010035846.1| PREDICTED: transcription factor bHLH30-like [Eucalyptus grandis]
 gb|KCW47316.1| hypothetical protein EUGRSUZ_K01103 [Eucalyptus grandis]
Length=238

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 145/211 (69%), Gaps = 4/211 (2%)
 Frame = -2

Query  1017  GIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERI  838
             GI+ + RNGSSS SSLVLD+E+GELV A V   +K    E+ + AL+NHSEAERRRR RI
Sbjct  18    GIRALQRNGSSSYSSLVLDSERGELVEASVSAKRKEPPAERNVDALKNHSEAERRRRARI  77

Query  837   NGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ-A  661
             N HL TLR L+P   KMDKAALL +V++ +++L+ +A EA +  ++PTD DE++VEQ+  
Sbjct  78    NAHLDTLRGLVPEAKKMDKAALLAEVVNHLRKLKGNAEEAMQQYVIPTDADEIKVEQERG  137

Query  660   EGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEE  481
             E  D    +IKASLCCDY+  LLS LR+ L  L L  L AE+ATL  RM S+  +T +  
Sbjct  138   EVVDLEFETIKASLCCDYRPGLLSNLRRVLVDLGLIVLSAEVATLEGRMKSIMELT-SHV  196

Query  480   GNDSDERREFLASSVHQALRSVLDKFYASEE  388
             G+ +    + L+SS+  AL S++D+F  SEE
Sbjct  197   GDKT--LCQVLSSSLRLALCSMVDQFSTSEE  225



>ref|XP_006852445.1| hypothetical protein AMTR_s00021p00102740 [Amborella trichopoda]
 gb|ERN13912.1| hypothetical protein AMTR_s00021p00102740 [Amborella trichopoda]
Length=267

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 126/197 (64%), Gaps = 11/197 (6%)
 Frame = -2

Query  1047  SFAGFSTENYGIQRMIRNGsssssSLVLDTEKGELVRALVRPGQKGVNPEKALIALRNHS  868
              F G   E +G  R          +LVLD  +GELV  + R     V   K   ALR+HS
Sbjct  31    GFGGVIGEEWGWGR--------KKALVLDGSRGELVEEVPRAV---VTEAKNAAALRSHS  79

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             +AERRRRERIN HL+TLR+LI G NKMDKA+LL +VI+ +++ +  A E +KG L+PT  
Sbjct  80    DAERRRRERINAHLNTLRALISGPNKMDKASLLAQVINHLRDSKRKADEISKGSLIPTAF  139

Query  687   DEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVS  508
             DEVRVE +A+G +     ++ SLCCD + +LL +L++ L  L LK + AE++TLG R+ +
Sbjct  140   DEVRVENEADGPNKEGVFLRVSLCCDDRPDLLIDLKRTLQNLRLKIISAEISTLGGRVKN  199

Query  507   LFVVTENEEGNDSDERR  457
             +FV+T  +E  D+++ +
Sbjct  200   VFVLTTCKENGDANKHQ  216



>ref|XP_003593769.1| Transcription factor bHLH [Medicago truncatula]
 gb|AES64020.1| transcription factor [Medicago truncatula]
 gb|AEV41579.1| bHLH658 [Medicago truncatula]
Length=216

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 110/151 (73%), Gaps = 5/151 (3%)
 Frame = -2

Query  999  RNGsssssSLVLDTEKGELVRA--LVRPGQKGVNPEKALIALRNHSEAERRRRERINGHL  826
            R G  S++SLVLD+EKGELV++  ++   +K  +  K L+AL+NH EAER+RR RINGHL
Sbjct  27   RGGFVSTNSLVLDSEKGELVKSPPIINGEKKICDANKTLVALKNHREAERKRRNRINGHL  86

Query  825  STLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDG  646
            + LR+L+P + KMDKA LL +VI ++K L+ +A EA+KG  +PTD DEV+VE      +G
Sbjct  87   AKLRALVPSSPKMDKATLLAEVIRQVKHLKKNADEASKGYSIPTDDDEVKVEPYE---NG  143

Query  645  ASYSIKASLCCDYKHELLSELRQALDALPLK  553
             S+  KAS+ CDY+ ELLS+LRQ LD L L+
Sbjct  144  GSFLYKASISCDYRPELLSDLRQTLDKLQLQ  174



>gb|AES90327.2| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=272

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 139/199 (70%), Gaps = 3/199 (2%)
 Frame = -2

Query  972  LVLDTEKGELVRALV--RPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPG  799
            LVL++EK ++V   V    G+  V+ +K L +L+NH EAERRRRERINGHL TLR L+  
Sbjct  44   LVLESEKEKVVEGPVTENVGKDEVSEDKGLASLKNHREAERRRRERINGHLGTLRGLVAS  103

Query  798  TN-KMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKAS  622
            T+ KMDKA +L +VIS++KEL+ +A EA+KG L+PT+ DEV+VE           S  A+
Sbjct  104  THQKMDKATILAEVISQVKELKKNAMEASKGFLIPTEVDEVKVEPYDIKLGYGCMSYIAT  163

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLAS  442
            +CCDY+ E+L +L++A+DAL L+ ++AEM+TL SRM ++FV T  +  + + E  + +A+
Sbjct  164  ICCDYQPEILCDLKKAIDALQLQLVKAEMSTLESRMKNMFVFTCCKGNSFNVEACQSIAN  223

Query  441  SVHQALRSVLDKFYASEEF  385
             VH+AL SVL+K   S EF
Sbjct  224  VVHKALDSVLEKASNSMEF  242



>ref|XP_009421255.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = -2

Query  969  VLDTEKGELVRALVR----PGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIP  802
            VLD E+ E V+A  R        GV   K  +AL++HSEAERRRRERIN HL+ LRS+IP
Sbjct  33   VLDLERREFVKAPSRLGGKKEGGGVVDAKTALALKSHSEAERRRRERINHHLAVLRSMIP  92

Query  801  GTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKAS  622
              +K+DKAALL +VI+ +K+L+ +A+E ++G  +P+D DEVRVE + +     S+ +KAS
Sbjct  93   CADKLDKAALLTQVINHVKKLKKNAAEISEGYTIPSDVDEVRVEVEGDATKSGSFIVKAS  152

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLAS  442
            LCC+   E+L++LRQ L +L LK +RAE++TLG R+ ++ V+T +      D  +  L +
Sbjct  153  LCCEEGPEILTDLRQTLQSLHLKIIRAEISTLGGRVKNVLVMTSDGSSRAID--KHVLMA  210

Query  441  SVHQALRSVLDKFYASEEF  385
            +VHQAL+S+LD+  +  +F
Sbjct  211  TVHQALKSILDRVNSQVDF  229



>ref|XP_009409628.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=322

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 130/179 (73%), Gaps = 3/179 (2%)
 Frame = -2

Query  921  GQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKE  742
            G  GV+  K ++AL++H EAERRRRERIN HL+TLRS++P T K+DKAALL +VI+ +KE
Sbjct  124  GGVGVSDAKGVMALKSHCEAERRRRERINRHLATLRSMVPSTEKLDKAALLAEVINHMKE  183

Query  741  LRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDAL  562
            L+++A E +K   +P+D DEVRVE +    DG ++ +KASLCC+ + EL ++LR  L +L
Sbjct  184  LKTNAVEISKCYSIPSDIDEVRVEVEDVMKDG-NFLVKASLCCEDRPELFADLRLTLQSL  242

Query  561  PLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEEF  385
             LKT+RAE++TLG R+ ++ V+T +   N+++  R+   +S+ QAL+S+LD   +  +F
Sbjct  243  QLKTVRAEISTLGGRIKNVLVMTSDRNYNNAE--RQLCMTSIRQALKSILDSVNSQADF  299



>gb|KDO48321.1| hypothetical protein CISIN_1g037071mg [Citrus sinensis]
Length=208

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -2

Query  765  KVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSE  586
            K + ++KEL  +A+EAT+G L PTD DEV+VEQQ +G DGA YSIKASLCC+YK  LLS+
Sbjct  4    KRVDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSD  63

Query  585  LRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLASSVHQALRSVLD  409
            LR+ L+AL L  ++AE+ATL   M ++FV+   +E N ++ E  + L SSVHQA+RSVLD
Sbjct  64   LRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLD  123

Query  408  KFYASEEF  385
            KF A+EEF
Sbjct  124  KFSATEEF  131



>ref|XP_006448601.1| hypothetical protein CICLE_v10018233mg, partial [Citrus clementina]
 gb|ESR61841.1| hypothetical protein CICLE_v10018233mg, partial [Citrus clementina]
Length=150

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  747  KELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALD  568
            KEL   A+EAT+G L PTD DEV+VEQQ +G DGA YSIKASLCC+YK  LLS+LR+ L+
Sbjct  1    KELDKDATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRILE  60

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGN-DSDERREFLASSVHQALRSVLDKFYASE  391
            AL L  ++AE+ATL  RM ++FV+   +E N ++ E  +   SSVHQA+RSVLDKF A+E
Sbjct  61   ALHLSIVKAEIATLEGRMKNIFVMANCKELNFENTEVCQSFVSSVHQAIRSVLDKFSATE  120

Query  390  EF  385
            EF
Sbjct  121  EF  122



>ref|XP_010253805.1| PREDICTED: transcription factor bHLH51-like [Nelumbo nucifera]
Length=272

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 116/185 (63%), Gaps = 22/185 (12%)
 Frame = -2

Query  915  KGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELR  736
            +G+  ++A  A ++HS+AE+RRRERIN HL+TLR LIP ++KMDKAALLG VI  +K+L+
Sbjct  59   EGMAEDRATAASKSHSQAEKRRRERINSHLTTLRKLIPRSDKMDKAALLGSVIDHVKDLK  118

Query  735  SSASEATKGILVPTDTDEVRV--EQQAEGCDGA----------SYSIKASLCCDYKHELL  592
              A E ++   VPTD DEV V  +Q AE               ++ IKASLCCD + EL 
Sbjct  119  RKAVEVSQLFTVPTDVDEVIVDCDQSAESTTNTSSTTTTNSKDNHFIKASLCCDDRPELF  178

Query  591  SELRQALDALPLKTLRAEMATLGSRMVS--LFVVTENEEGNDSDERREFLASSVHQALRS  418
            ++L QAL+ L L T+RAEMATLG R++S  L    + EEG           +S+ Q+L  
Sbjct  179  TDLNQALNGLRLTTVRAEMATLGGRVISVLLLCTKDCEEG--------VCLNSLKQSLNV  230

Query  417  VLDKF  403
            VL++ 
Sbjct  231  VLNRI  235



>gb|KHN08890.1| Transcription factor bHLH106 [Glycine soja]
Length=213

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 111/170 (65%), Gaps = 11/170 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  31   DRALAAMKNHKEAEKRRRERINSHLDHLRTLLPCNSKTDKASLLAKVVQRVKELKQQTSE  90

Query  720  ATKGILVPTDTDEVRV-----EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPL  556
             T+   VP++TDE+ V        A G D      KASLCC+ + +L+ +L + L++L L
Sbjct  91   ITELETVPSETDEITVLATTGGDYASGGDDGRLIFKASLCCEDRSDLIPDLIEILNSLHL  150

Query  555  KTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            KTL+AEMATLG R  ++ VV  ++E   S E   FL +S    LRS+LD+
Sbjct  151  KTLKAEMATLGGRTRNVLVVAADKE--HSIESIHFLQNS----LRSILDR  194



>ref|XP_002305076.1| hypothetical protein POPTR_0004s05490g [Populus trichocarpa]
 gb|EEE85587.1| hypothetical protein POPTR_0004s05490g [Populus trichocarpa]
Length=160

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 94/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCD  610
            MDKA LL  VIS++ EL+ +A E+ KG+L+PT  DEV+VE   +G    +   KAS+CCD
Sbjct  1    MDKATLLAAVISQVNELKRNALESCKGLLIPTADDEVKVETYFDGTKEGTLYFKASICCD  60

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN--DSDERREFLASSV  436
            Y+ ELLS++RQA+DALPLK + AE++TLG+R+ + FV T N   N  D  E  + L  S+
Sbjct  61   YRPELLSDIRQAVDALPLKMVNAEISTLGNRLKNEFVFTSNRNKNAVDDAEAMQHLTKSI  120

Query  435  HQALRSVLDKFYASEEF  385
            H AL SVL+K  AS E+
Sbjct  121  HHALTSVLEKGSASLEY  137



>ref|XP_007218826.1| hypothetical protein PRUPE_ppa010134mg [Prunus persica]
 gb|EMJ20025.1| hypothetical protein PRUPE_ppa010134mg [Prunus persica]
Length=262

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI  +K+L+  A E
Sbjct  63   DRAATASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDHVKDLKRKAME  122

Query  720  ATKGILVPTDTDEVRVEQ---QAEGCDGA----------SYSIKASLCCDYKHELLSELR  580
             +K  +VPT+ DE+ ++    QA    G+          S  I+AS+CCD + EL SEL 
Sbjct  123  VSKAFMVPTEMDEITIDSDPAQAAANSGSNNINMNKSRCSIVIRASVCCDDRPELFSELI  182

Query  579  QALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFY  400
            Q L  L L  +RA+MA++G R+ S+ V+ +     D +E      S++ Q+L+ VL K  
Sbjct  183  QVLKGLKLTAVRADMASVGGRIKSVLVLCK-----DGEEDEALCISTLKQSLKLVLSKIC  237

Query  399  AS  394
            AS
Sbjct  238  AS  239



>ref|XP_010686302.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010686303.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010686304.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010686305.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010686306.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010686307.1| PREDICTED: transcription factor bHLH30-like [Beta vulgaris subsp. 
vulgaris]
Length=254

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -2

Query  963  DTEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTN--K  790
            +T  GEL++      +K  +  K   ALR+H EAERRRRERINGHL+ LR+ +P ++  K
Sbjct  32   ETNMGELLKTPASSRKKDTSKTKNSAALRSHCEAERRRRERINGHLANLRTFLPCSDKVK  91

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE----QQAEGCDGASYSIKAS  622
            MDKA LL +VIS+IK L+  A EATK +LVPTD +EV VE       +    + Y+ +AS
Sbjct  92   MDKATLLAEVISQIKVLKKQAIEATKDLLVPTDANEVTVEPYDDGGGDDIADSLYAFRAS  151

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLAS  442
            +CC+YK EL++++RQA+  L L   +AE++TL  R+ +L +VT  +E     +  +F A 
Sbjct  152  ICCEYKPELITDIRQAISDLKLTITKAEISTLEGRVKNLLIVTGCKEDIGHGKSEKF-AK  210

Query  441  SVHQALRSVLDKFYASEEF  385
            S+  AL SVL K    EE+
Sbjct  211  SIQDALCSVLQKMSVVEEY  229



>ref|XP_008441476.1| PREDICTED: transcription factor bHLH51 [Cucumis melo]
Length=246

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 7/184 (4%)
 Frame = -2

Query  960  TEKGELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDK  781
            +   E   +   P +  +  ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDK
Sbjct  41   SSSNEFFPSFSSPSEGIIVEDRAASASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDK  100

Query  780  AALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQ-QAEGCDGASYSIKASLCCDYK  604
            AALLG  I ++K+L+  A EA+K + VPTD DEV ++    E     + +IK S+ CD +
Sbjct  101  AALLGSAIDQVKDLKRKAMEASKNMTVPTDMDEVTIDSTMVEDNSSNNIAIKVSVSCDDR  160

Query  603  HELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQAL  424
             ELL+EL Q +  L L T+RA+MA++G R+ S+ ++  N++G      +    ++V Q+L
Sbjct  161  PELLTELIQVIKGLKLTTIRADMASVGGRIKSILILC-NKDG-----EKSVCLNTVQQSL  214

Query  423  RSVL  412
            + VL
Sbjct  215  KLVL  218



>ref|XP_002282625.1| PREDICTED: transcription factor bHLH106 [Vitis vinifera]
 emb|CBI32785.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 110/171 (64%), Gaps = 6/171 (4%)
 Frame = -2

Query  921  GQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKE  742
            G   V   +AL A  NH EAE+RRRERIN HL  LRSL+P ++K DKA+LL KVI  +KE
Sbjct  53   GIADVPQSRALTASINHKEAEKRRRERINSHLDKLRSLLPCSSKTDKASLLAKVIQRVKE  112

Query  741  LRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDAL  562
            L+   SE T+   +P++TDE+ V    +  D      KASLCC+ + ELL EL + L +L
Sbjct  113  LKEQTSEITQLETLPSETDEINVILSGDYSDDGKSIFKASLCCEDRTELLPELIEILKSL  172

Query  561  PLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLD  409
             LKTL+AEMA+LG R+ ++ VV+ +  G+ SDE       S+  AL++++D
Sbjct  173  RLKTLKAEMASLGGRIRNILVVSGD--GDHSDES----VHSLRDALKTLVD  217



>ref|XP_008374114.1| PREDICTED: transcription factor bHLH51-like [Malus domestica]
Length=279

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 111/188 (59%), Gaps = 26/188 (14%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   ++A  A R+HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI  +K+L+ 
Sbjct  80   GFEEDRAASASRSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDHVKDLKR  139

Query  732  SASEATKGILVPTDTDEVRVEQQAEGCDGA---------------SYSIKASLCCDYKHE  598
             A E +K  +VPT+ DEV ++     CD A               S+ I+AS+CCD + E
Sbjct  140  KAMEVSKSFVVPTEVDEVTID-----CDPAHTVNSATSSTNKSRGSFLIRASVCCDDRPE  194

Query  597  LLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRS  418
            L SEL Q L  L L  +RA+MA++G R+ S+ V+         D       S++ Q+L+ 
Sbjct  195  LFSELIQVLKGLKLTAVRADMASVGGRIKSVLVLCSK------DGEEAVCTSTLKQSLKL  248

Query  417  VLDKFYAS  394
            VL K  AS
Sbjct  249  VLSKLAAS  256



>ref|XP_009345143.1| PREDICTED: transcription factor bHLH51-like [Pyrus x bretschneideri]
Length=275

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 111/188 (59%), Gaps = 26/188 (14%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   ++A  A R+HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI  +K+L+ 
Sbjct  76   GFEEDRAASASRSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDHVKDLKR  135

Query  732  SASEATKGILVPTDTDEVRVEQQAEGCDGA---------------SYSIKASLCCDYKHE  598
             A E +K  +VPT+ DEV ++     CD A               S+ I+AS+CCD + E
Sbjct  136  KAMEVSKSFVVPTEVDEVTID-----CDPAHTVNSATSSTNKSRGSFLIRASVCCDDRPE  190

Query  597  LLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRS  418
            L SEL Q L  L L  +RA+MA++G R+ S+ V+         D       S++ Q+L+ 
Sbjct  191  LFSELIQVLKGLKLTAVRADMASVGGRIKSVLVLCSK------DGEEAVCTSTLKQSLKL  244

Query  417  VLDKFYAS  394
            VL K  AS
Sbjct  245  VLSKLAAS  252



>ref|XP_010551310.1| PREDICTED: transcription factor bHLH30 [Tarenaya hassleriana]
Length=356

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 119/166 (72%), Gaps = 5/166 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HLS LRS++P T K DKA+LL +VI  +KELR   S+ 
Sbjct  161  KALAASKSHSEAERRRRERINNHLSKLRSILPNTTKTDKASLLAEVIHHVKELRRQTSQI  220

Query  717  TKGILVPTDTDEVRVE--QQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLR  544
             +   VPT+TDE+ V+  ++ E  DG  + IKAS+CCD + +LL +L + L  L LKTL+
Sbjct  221  AETNPVPTETDEITVDVSEEEEQQDG-KFVIKASICCDDRSDLLPDLIKTLKGLRLKTLK  279

Query  543  AEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            AE+AT+G R+ ++  VT  EE  DSDE+++ +  S+ +AL+SV+DK
Sbjct  280  AEIATVGCRVKNVLFVT-GEEACDSDEQQQCIG-SIQEALKSVMDK  323



>ref|XP_003520487.1| PREDICTED: transcription factor bHLH106-like [Glycine max]
Length=249

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 111/170 (65%), Gaps = 11/170 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  67   DRALAAMKNHKEAEKRRRERINSHLDQLRTLLPCNSKTDKASLLAKVVQRVKELKQQTSE  126

Query  720  ATKGILVPTDTDEVRV-----EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPL  556
             T+   VP++TDE+ V        A G D      KASLCC+ + +L+ +L + L++L L
Sbjct  127  ITELETVPSETDEITVLATTGGDYASGGDDGRLIFKASLCCEDRSDLIPDLIEILNSLHL  186

Query  555  KTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            KTL+AEMATLG R  ++ +V  ++E   S E   FL +S    L+S+LD+
Sbjct  187  KTLKAEMATLGGRTRNVLIVAADKE--HSIESIHFLQNS----LKSLLDR  230



>gb|KHN30346.1| Transcription factor bHLH106 [Glycine soja]
Length=242

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 111/170 (65%), Gaps = 11/170 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  60   DRALAAMKNHKEAEKRRRERINSHLDQLRTLLPCNSKTDKASLLAKVVQRVKELKQQTSE  119

Query  720  ATKGILVPTDTDEVRV-----EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPL  556
             T+   VP++TDE+ V        A G D      KASLCC+ + +L+ +L + L++L L
Sbjct  120  ITELETVPSETDEITVLATTGGDYASGGDDGRLIFKASLCCEDRSDLIPDLIEILNSLHL  179

Query  555  KTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            KTL+AEMATLG R  ++ +V  ++E   S E   FL +S    L+S+LD+
Sbjct  180  KTLKAEMATLGGRTRNVLIVAADKEH--SIESIHFLQNS----LKSLLDR  223



>gb|AFK46671.1| unknown [Medicago truncatula]
Length=213

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = -2

Query  924  PGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            P Q+    ++AL AL+NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +K
Sbjct  29   PSQQ----DRALAALKNHKEAEKRRRERINSHLDHLRTLLPCNSKTDKASLLAKVVERVK  84

Query  744  ELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSI-KASLCCDYKHELLSELRQALD  568
            EL+   S+ T+   VP++TDE+ V        G    I +ASLCC+ + +L+ +L + L 
Sbjct  85   ELKQQTSQITQLETVPSETDEITVISAGSDISGEGRLIFEASLCCEDRSDLIPDLIEILK  144

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +L LKTL+AEMATLG R  ++ VV   +E N S E   FL +S    LRS+LD+
Sbjct  145  SLHLKTLKAEMATLGGRTRNVLVVAAEKEHN-SIESIHFLQNS----LRSLLDR  193



>ref|XP_003554115.1| PREDICTED: transcription factor bHLH106-like [Glycine max]
Length=251

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 113/171 (66%), Gaps = 13/171 (8%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  69   DRALAAMKNHKEAEKRRRERINSHLDHLRTLLPCNSKTDKASLLAKVVQRVKELKQQTSE  128

Query  720  ATKGILVPTDTDEVRV------EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALP  559
             T+   VP++TDE+ V      +  + G DG     KASLCC+ + +L+ +L + L++L 
Sbjct  129  ITELETVPSETDEITVLSTTGGDYASGGGDG-RLIFKASLCCEDRSDLIPDLIEILNSLH  187

Query  558  LKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            LKTL+AEMATLG R  ++ VV  ++E   S E   FL +S    LRS+LD+
Sbjct  188  LKTLKAEMATLGGRTRNVLVVAADKE--HSIESIHFLQNS----LRSILDR  232



>ref|XP_002316828.1| hypothetical protein POPTR_0011s07450g [Populus trichocarpa]
 gb|EEE97440.1| hypothetical protein POPTR_0011s07450g [Populus trichocarpa]
Length=156

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 95/137 (69%), Gaps = 6/137 (4%)
 Frame = -2

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCD  610
            MDKA LL  VIS++KE + +A EA KG+LVP D DEV+VE   +G    +   KAS+CCD
Sbjct  1    MDKATLLAAVISQVKEHKKNALEACKGLLVPMDDDEVKVETYFDG----TLHFKASICCD  56

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERR--EFLASSV  436
            Y+ ELLS+LR A+DALPLKT+ AE++TLGSR+ + FV+T     N  D+    + L +S+
Sbjct  57   YRPELLSDLRNAIDALPLKTVSAEISTLGSRLKNEFVLTNRRNKNALDDAGAIQLLTNSI  116

Query  435  HQALRSVLDKFYASEEF  385
            HQ L SV++K  AS ++
Sbjct  117  HQTLTSVMEKGSASPKY  133



>ref|XP_004160727.1| PREDICTED: transcription factor bHLH51-like [Cucumis sativus]
 gb|KGN45796.1| hypothetical protein Csa_6G011720 [Cucumis sativus]
Length=247

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 114/181 (63%), Gaps = 7/181 (4%)
 Frame = -2

Query  951  GELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAAL  772
             E   +   P +  +  ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAAL
Sbjct  44   NEFFPSFSTPSEGIIVEDRAASASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAAL  103

Query  771  LGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQ-AEGCDGASYSIKASLCCDYKHEL  595
            LG  I ++K+L+  A EA+K + VPTD DEV ++    E     + +IK S+ CD + EL
Sbjct  104  LGSAIDQVKDLKRKAMEASKNMTVPTDMDEVTIDSTVVEDNSRNNIAIKVSVSCDDRPEL  163

Query  594  LSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSV  415
             +EL Q +  L L T+RA+MA++G R+ S+ ++  N++G  S        ++V Q+L+ V
Sbjct  164  FTELIQVIKGLKLTTIRADMASVGGRIKSILILC-NKDGEKS-----VCLNTVQQSLKLV  217

Query  414  L  412
            L
Sbjct  218  L  218



>ref|XP_007202577.1| hypothetical protein PRUPE_ppa011532mg [Prunus persica]
 gb|EMJ03776.1| hypothetical protein PRUPE_ppa011532mg [Prunus persica]
Length=207

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  30   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  89

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
             T+    P++TDE+ V    +         KASLCC+ + +LL +L + L +L LKTLRA
Sbjct  90   LTELESFPSETDEITVLSSDDYSSDGRIIFKASLCCEDRTDLLPDLIEILKSLHLKTLRA  149

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EMATLG R+ ++ +V  +++   + E   FL      AL+S+L++  ASE
Sbjct  150  EMATLGGRIRNVLIVAADKDH--TIESVHFL----QNALKSLLERSNASE  193



>ref|XP_007162071.1| hypothetical protein PHAVU_001G121200g [Phaseolus vulgaris]
 gb|ESW34065.1| hypothetical protein PHAVU_001G121200g [Phaseolus vulgaris]
Length=247

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 114/172 (66%), Gaps = 9/172 (5%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  69   DRALAAMKNHKEAEKRRRERINSHLDELRTLLPCNSKTDKASLLAKVVQRVKELKQQTSE  128

Query  720  ATKGILVPTDTDEVRVEQQA--EGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             T+   VP++TDE+ V       G DG     KASLCC+ + +L+ +L + L++L LKTL
Sbjct  129  ITELETVPSETDEITVLSTGGDYGGDG-RLVFKASLCCEDRSDLIPDLIEILNSLHLKTL  187

Query  546  RAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            +AEMATLG R  ++ VV  ++E   S E   FL +S    L+S+LD+  +S+
Sbjct  188  KAEMATLGGRTRNVLVVAADKEH--SIESINFLQNS----LKSLLDRSNSSD  233



>ref|XP_006356465.1| PREDICTED: transcription factor bHLH51-like [Solanum tuberosum]
Length=224

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A R+HSEAE+RRR+RIN  LSTLR LIP + KMDKAALLG V+  +K+L+   +E +K +
Sbjct  44   ASRSHSEAEKRRRDRINAQLSTLRKLIPTSEKMDKAALLGSVVDHVKDLKGKTAEISKVL  103

Query  705  LVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATL  526
              PTDTDEV +E   E  +     +KAS CCD + EL SEL++ +  L L+ + A++ +L
Sbjct  104  NTPTDTDEVTIEHLNEEEENKGCLLKASFCCDDRPELFSELQRGIKNLKLRVMGADITSL  163

Query  525  GSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            G R+  +F++  NE   +     +   +S+ ++LR VL +   S
Sbjct  164  GGRIKGVFMLCPNENSAN-----DVCMNSLKRSLRVVLSRIAIS  202



>ref|XP_004493384.1| PREDICTED: transcription factor bHLH106-like [Cicer arietinum]
Length=240

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = -2

Query  924  PGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            P Q+    ++AL A++NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +K
Sbjct  56   PSQQ----QRALAAMKNHKEAEKRRRERINSHLDHLRTLLPCNSKTDKASLLAKVVQRVK  111

Query  744  ELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSI-KASLCCDYKHELLSELRQALD  568
            EL+   SE TK   VP++TDE+ V        G +  I KASLCC+ + +L+ +L   L 
Sbjct  112  ELKQQTSEITKLETVPSETDEITVLSTGGDYTGDTRLIFKASLCCEDRSDLIPDLVDILK  171

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +L LKTL+AEMATLG R  ++ VV  + + + S E   FL +S    LRS++D+
Sbjct  172  SLHLKTLKAEMATLGGRTRNVLVVAADHKEH-SIESIHFLQNS----LRSLVDR  220



>ref|XP_008240669.1| PREDICTED: transcription factor bHLH106-like [Prunus mume]
Length=251

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  74   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  133

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
             T+    P++TDE+ V    +         KASLCC+ + +LL +L + L +L LKTLRA
Sbjct  134  LTELESFPSETDEITVLSSDDYSSDGRIIFKASLCCEDRTDLLPDLIEILKSLHLKTLRA  193

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EMATLG R+ ++ VV  +++   + E   FL      AL+S+L++  ASE
Sbjct  194  EMATLGGRIRNVLVVAADKD--HTIESVHFL----QNALKSLLERSNASE  237



>ref|XP_004235454.1| PREDICTED: transcription factor bHLH51-like [Solanum lycopersicum]
Length=209

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A R+HSEAE+RRR+RIN  LSTLR LIP   KMDKAALLG V+  +K+L+   +E +  +
Sbjct  32   ASRSHSEAEKRRRDRINAQLSTLRKLIPTWEKMDKAALLGSVVDHVKDLKDKTAEISNVL  91

Query  705  LVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATL  526
              PTDTDEV +E   E  D     IKAS CCD + EL SEL++ +  L L+ + A++ +L
Sbjct  92   NTPTDTDEVSIEHLNEEEDNKGCLIKASFCCDDRPELFSELQRGIKNLQLRMMEADITSL  151

Query  525  GSRMVSLFVVTENE  484
            G R+  +F+++ N+
Sbjct  152  GGRIKCVFMLSPND  165



>ref|XP_008233781.1| PREDICTED: transcription factor bHLH51 [Prunus mume]
Length=276

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 109/182 (60%), Gaps = 18/182 (10%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI  +K+L+  A E
Sbjct  77   DRAATASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDHVKDLKRKAME  136

Query  720  ATKGILVPTDTDEVRVEQQAEGCDG-------------ASYSIKASLCCDYKHELLSELR  580
             +K  +VPT+ DE+ ++                      S  I+AS+CCD + EL SEL 
Sbjct  137  VSKAFMVPTEMDEITIDSDPAQAAANSSSNNINMNKSRCSIVIRASVCCDDRPELFSELI  196

Query  579  QALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFY  400
            Q L  L L  +RA+MA++G R+ S+ V+ +     D +E      S++ Q+L+ +L K  
Sbjct  197  QVLKGLKLTAVRADMASVGGRIKSVLVLCK-----DGEEDEALCISTLKQSLKLILSKIC  251

Query  399  AS  394
            AS
Sbjct  252  AS  253



>gb|ACN21649.1| putative basic helix-loop-helix protein BHLH24 [Lotus japonicus]
Length=171

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -2

Query  882  LRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGIL  703
            +RNH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL+   SE T    
Sbjct  1    MRNHKEAEKRRRERINSHLDALRTLLPCNSKTDKASLLAKVVQRVKELKQQTSEITNLET  60

Query  702  VPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLG  523
            VP++TDE+ V       DG     KASLCC+ + +L+ +L + L +L LKTL+AEMATLG
Sbjct  61   VPSETDEISVLSSGGAGDG-RLIFKASLCCEDRSDLIPDLIEILKSLHLKTLKAEMATLG  119

Query  522  SRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
             R  ++ +V    E + S E   FL +S    LRS+LD+
Sbjct  120  GRTRNVLIVA--AEKDHSIESIHFLQNS----LRSLLDR  152



>gb|ACU14122.1| unknown [Glycine max]
Length=253

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 112/178 (63%), Gaps = 19/178 (11%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKA LLG V+  +K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDRINAQLATLRKLIPMSDKMDKATLLGSVVDHVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVE-QQAEGCDGASYS-----------IKASLCCDYKHELLSELRQ  577
             +K I VPT+TDEV ++  QA+     SY+           IKAS+CCD + EL  EL Q
Sbjct  128  VSKAITVPTETDEVTIDYHQAQ---DESYTKKVNILKENIIIKASVCCDDRPELFPELIQ  184

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
             L  L L  ++A++A++G R+ S+ V+       DS+E      S++ Q+L+S ++K 
Sbjct  185  VLKGLRLTAVKADIASVGGRIKSILVLC----SKDSEENNSVCLSTLKQSLKSAVNKI  238



>ref|XP_010271836.1| PREDICTED: transcription factor bHLH106-like [Nelumbo nucifera]
Length=236

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            +AL A RNH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KVI  +KEL+   SE 
Sbjct  62   RALAASRNHKEAEKRRRERINSHLDKLRTLLPCNSKTDKASLLAKVIQHVKELKQQTSEI  121

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +  L P++TDE+ V    +        +KASLCC+ + +LL +L + L +L LKT+RAE
Sbjct  122  PELELFPSETDEITV-FPGDFSGTGRLILKASLCCEDRSDLLPDLIETLKSLRLKTIRAE  180

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            MATLG R+ ++ VV    EG++SDE   FL      AL++++++
Sbjct  181  MATLGGRVRNVLVVA--GEGDNSDESIGFL----RDALKTLVER  218



>gb|KHN48576.1| Transcription factor bHLH51 [Glycine soja]
Length=264

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 112/178 (63%), Gaps = 19/178 (11%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKA LLG V+  +K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDRINAQLATLRKLIPMSDKMDKATLLGSVVDHVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVE-QQAEGCDGASYS-----------IKASLCCDYKHELLSELRQ  577
             +K I VPT+TDEV ++  QA+     SY+           IKAS+CCD + EL  EL Q
Sbjct  128  VSKAITVPTETDEVTIDYHQAQ---DESYTKKVNILKENIIIKASVCCDDRPELFPELIQ  184

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
             L  L L  ++A++A++G R+ S+ V+       DS+E      S++ Q+L+S ++K 
Sbjct  185  VLKGLRLTAVKADIASVGGRIKSILVLC----SKDSEENNSVCLSTLKQSLKSAVNKI  238



>ref|XP_009350864.1| PREDICTED: transcription factor bHLH106-like [Pyrus x bretschneideri]
 ref|XP_009350865.1| PREDICTED: transcription factor bHLH106-like [Pyrus x bretschneideri]
Length=240

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 110/170 (65%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  63   DRALAALKNHKEAEKRRRERINSHLHKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +    P++TDE+ V    +  +      KASLCC+ + +LL +L + L +L LKT++A
Sbjct  123  IAELETFPSETDEITVLSSNDYTNDGRIVFKASLCCEDRSDLLPDLIEILKSLHLKTIKA  182

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            E+ATLG R+ ++F+V  +++   + E   FL      AL+S+L++  +SE
Sbjct  183  EIATLGGRIRNVFIVAADKDH--TIESVNFL----QNALKSLLERSNSSE  226



>ref|XP_004307674.1| PREDICTED: transcription factor bHLH51-like [Fragaria vesca subsp. 
vesca]
Length=261

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 113/182 (62%), Gaps = 19/182 (10%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI E+K+L+  A+E
Sbjct  63   DRAASASKSHSQAEKRRRDRINAQLATLRKLIPQSDKMDKAALLGSVIDEVKDLKRRANE  122

Query  720  ATKGILVPTDTDEVRVEQ---QAEGCDGASYS----------IKASLCCDYKHELLSELR  580
             +K ++VPT+ D+V V Q     EG    S S          I+ S+CCD + EL  EL 
Sbjct  123  VSKALMVPTEFDDVTVSQCDLVHEGTPTNSTSINKNKDNSIMIRVSVCCDDQPELFRELI  182

Query  579  QALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFY  400
            Q L  L L  ++A++A+ G R+ S+FV+       DS+E      S++ QAL+ VL K  
Sbjct  183  QVLKRLKLTAMKADIASAGGRIKSIFVLC----SKDSEETVSI--SNLKQALKLVLSKIA  236

Query  399  AS  394
            AS
Sbjct  237  AS  238



>ref|XP_002978655.1| hypothetical protein SELMODRAFT_56610, partial [Selaginella moellendorffii]
 ref|XP_002984590.1| hypothetical protein SELMODRAFT_46532, partial [Selaginella moellendorffii]
 gb|EFJ14235.1| hypothetical protein SELMODRAFT_46532, partial [Selaginella moellendorffii]
 gb|EFJ20102.1| hypothetical protein SELMODRAFT_56610, partial [Selaginella moellendorffii]
Length=184

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 119/174 (68%), Gaps = 12/174 (7%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+TLR L+P T K DKA+LL +VI  +K+L+  A+E 
Sbjct  13   KALAASKSHSEAERRRRERINNHLNTLRGLLPSTTKTDKASLLAEVIEHVKDLKRQAAEI  72

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +G  VPTD DE++V+  A   DG ++ +KASLCC+ + +LLS+L +AL  L L+TL+AE
Sbjct  73   AEGGPVPTDVDELKVDTDASSSDG-NFVLKASLCCEDRPDLLSDLTKALRTLKLRTLKAE  131

Query  537  MATLGSRMVSLFVVTEN----------EEGNDSDERREFLASSVHQALRSVLDK  406
            +ATLG R+ ++ ++ ++          E  +D    R  + S V +ALR+V+++
Sbjct  132  IATLGGRVKNVILIGKDHSDEQGGAAMESSSDGTGDRPSV-SCVQEALRAVIER  184



>gb|KHG21788.1| Transcription factor bHLH51 -like protein [Gossypium arboreum]
Length=238

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 111/169 (66%), Gaps = 9/169 (5%)
 Frame = -2

Query  903  PEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSAS  724
            P+KA +A ++HSEAE+RRR+RIN  L+ LR LIP +NKMDKAALLG  I ++K+L+  A+
Sbjct  56   PDKATVASKSHSEAEKRRRDRINSQLTALRKLIPKSNKMDKAALLGSAIEQVKDLKRKAT  115

Query  723  EATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLR  544
            E  K   +P++TDEV V+      +  ++ I+ S+CCD + E+ SEL + L  L L  + 
Sbjct  116  EIGKAFAIPSETDEVSVDYNVP--EDKTF-IRVSICCDDRPEVFSELIRVLKGLRLSIVE  172

Query  543  AEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYA  397
            AE++++G R  S  ++      N+SD  RE ++S++ Q+L  V++K  A
Sbjct  173  AEISSVGGRTKSNLILC-----NESDN-REGVSSTLKQSLNIVVNKINA  215



>ref|XP_010920800.1| PREDICTED: transcription factor bHLH51-like [Elaeis guineensis]
Length=247

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 100/143 (70%), Gaps = 5/143 (3%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            AL+ HSEAE+RRRERIN HLSTLR +IP  +KMDKA+LLG+VI ++K+L+  AS+     
Sbjct  61   ALKIHSEAEKRRRERINAHLSTLRRMIPDADKMDKASLLGRVIDQVKDLKRKASDIGNCF  120

Query  705  LVPTDTDEVRVE-QQAEGCDGASYS---IKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             VP + +EV VE  Q  G  GA +    IKA++CC+ + +L ++L QA   L L+T+RA+
Sbjct  121  QVPAEVNEVTVECNQGNGHPGADHGSLYIKATICCNDRPDLFTDLTQAFHDLRLRTIRAD  180

Query  537  MATLGSRMVSLFVVTENEEGNDS  469
            + +LG R+ ++F++   +EGN S
Sbjct  181  ITSLGGRVQNVFMLY-GKEGNVS  202



>ref|XP_010908560.1| PREDICTED: transcription factor bHLH51-like [Elaeis guineensis]
Length=247

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 108/176 (61%), Gaps = 22/176 (13%)
 Frame = -2

Query  954  KGELVRALVRP--------GQKGVNP-----EKALIALRNHSEAERRRRERINGHLSTLR  814
            KG L+  L RP        GQ    P     E+AL  LR HS+AE+RRRERIN HLSTLR
Sbjct  24   KGSLL--LPRPSNSAPAFLGQGSFYPSLCEDERAL-TLRIHSQAEKRRRERINAHLSTLR  80

Query  813  SLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE------QQAEGC  652
             +IP +NKMDKA+LLG+VI  +K+L+  A +A+K   +PT+ + V VE      Q     
Sbjct  81   RMIPNSNKMDKASLLGRVIDHVKDLKRKAVDASKVSTIPTEANVVTVESHDGGYQNTFSL  140

Query  651  DGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
            D  +  IKASLCCD + +L +EL +A   L L+ +RA+M +LG R+ ++F++   +
Sbjct  141  DDDNLYIKASLCCDDRPDLFAELIEAFQRLRLRAIRADMTSLGGRIQNVFLLCRKD  196



>ref|XP_004485888.1| PREDICTED: transcription factor bHLH30-like [Cicer arietinum]
Length=221

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 117/178 (66%), Gaps = 6/178 (3%)
 Frame = -2

Query  1035  FSTENYGI---QRMIRNGsssssSLVLDTEKGELVRALVRPGQKGV-NPEKALIALRNHS  868
             F+  +YG      + R+G  S  SLVLDTE  ELV++    G+K + +  K L+AL+NH 
Sbjct  12    FNAPSYGFGASNGISRDGLVSPQSLVLDTEMRELVKSPPMVGKKKICDANKTLVALKNHR  71

Query  867   EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDT  688
             EAERRRR RI+ HL+ LR L+P + KMDKA LL +VI ++KEL+ +  E++KG L+P D 
Sbjct  72    EAERRRRNRISDHLAKLRGLVPYSAKMDKATLLAEVIKQVKELKKNTEESSKGYLIPMDN  131

Query  687   DEVRVEQQAEGCDGASYSI--KASLCCDYKHELLSELRQALDALPLKTLRAEMATLGS  520
             DEV+VE +     G + SI  KAS+CCDY+ ELLS+L+Q LD L ++   + +   GS
Sbjct  132   DEVKVEIEPYENGGLNGSIPYKASICCDYRPELLSDLKQTLDTLKVQLALSSVLDKGS  189



>gb|KDP35870.1| hypothetical protein JCGZ_10605 [Jatropha curcas]
Length=153

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 93/137 (68%), Gaps = 2/137 (1%)
 Frame = -2

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCD  610
            MDKA LL +VIS++KEL+  A +A+KG+L+P D DEV+VE    G +  S   KAS+CCD
Sbjct  1    MDKATLLAEVISQVKELKKKAIDASKGLLIPMDDDEVKVETFDNGAEDGSMCFKASICCD  60

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTE--NEEGNDSDERREFLASSV  436
            Y+ EL+ +++QA +AL LK + A+MATLG R+ ++  +T   N+      E ++ L +S+
Sbjct  61   YRPELMYDIKQAANALQLKMVDAKMATLGGRLKNVLFLTSCRNKNVTHDTETQQILVNSI  120

Query  435  HQALRSVLDKFYASEEF  385
            HQAL SVL+K   S E+
Sbjct  121  HQALNSVLEKGSISPEY  137



>ref|XP_010112839.1| hypothetical protein L484_014686 [Morus notabilis]
 gb|EXC34962.1| hypothetical protein L484_014686 [Morus notabilis]
Length=248

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 108/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LRSL+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  71   DRALAALKNHKEAEKRRRERINSHLDKLRSLLPCNSKTDKASLLAKVVQRVKELKEQTSE  130

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +   +P++TDE+ V    +         KASLCC+ + +L+ +L + L +L L TL+ 
Sbjct  131  VAELQSLPSETDEITVLSSGDYSGDGRLIFKASLCCEDRSDLIPDLIEILKSLHLTTLKV  190

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EMATLG R+ ++ +V  ++E   S E   FL      AL+S+L++  +SE
Sbjct  191  EMATLGGRIRNVLIVAADKE--HSIESVHFL----QNALKSLLERSNSSE  234



>ref|XP_010523405.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRS++P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  152  KALAASKSHSEAERRRRERINNHLAKLRSILPNTTKTDKASLLAEVIQHVKELKRQTSQI  211

Query  717  TKGILVPTDTDEVRV---EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             +   VPT+TDE+ V   E+  E      + IKAS+CCD + +LL +L + L AL LKTL
Sbjct  212  AETNPVPTETDEITVDVSEEAVEEQQDGKFVIKASICCDDRSDLLPDLIKTLKALRLKTL  271

Query  546  RAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +AE+ T+G R+ ++ +VT  EE N  DE+  +   S+ +ALR+V+DK
Sbjct  272  KAEITTVGCRVKNVLLVT-GEESNIGDEQM-YCIGSIQEALRAVMDK  316



>ref|XP_003544072.1| PREDICTED: transcription factor bHLH51 [Glycine max]
Length=264

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 111/178 (62%), Gaps = 19/178 (11%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+ IN  L+TLR LIP ++KMDKA LLG V+  +K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDSINAQLATLRKLIPMSDKMDKATLLGSVVDHVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVE-QQAEGCDGASYS-----------IKASLCCDYKHELLSELRQ  577
             +K I VPT+TDEV ++  QA+     SY+           IKAS+CCD + EL  EL Q
Sbjct  128  VSKAITVPTETDEVTIDYHQAQ---DESYTKKVNILKENIIIKASVCCDDRPELFPELIQ  184

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
             L  L L  ++A++A++G R+ S+ V+       DS+E      S++ Q+L+S ++K 
Sbjct  185  VLKGLRLTAVKADIASVGGRIKSILVLC----SKDSEENNSVCLSTLKQSLKSAVNKI  238



>ref|XP_003624955.1| Transcription factor bHLH106 [Medicago truncatula]
Length=255

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 112/179 (63%), Gaps = 15/179 (8%)
 Frame = -2

Query  924  PGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNK-----MDKAALLGKV  760
            P Q+    ++AL AL+NH EAE+RRRERIN HL  LR+L+P  +K      DKA+LL KV
Sbjct  66   PSQQ----DRALAALKNHKEAEKRRRERINSHLDHLRTLLPCNSKSLIITQDKASLLAKV  121

Query  759  ISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSI-KASLCCDYKHELLSEL  583
            +  +K+L+   S+ T+   VP++TDE+ V        G    I KASLCC+ + +L+ +L
Sbjct  122  VERVKDLKQQTSQITQLETVPSETDEITVISAGSDISGEGRLIFKASLCCEDRSDLIPDL  181

Query  582  RQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
             + L +L LKTL+AEMATLG R  ++ VV   +E N S E   FL +S    LRS+LD+
Sbjct  182  IEILKSLHLKTLKAEMATLGGRTRNVLVVAAEKEHN-SIESIHFLQNS----LRSLLDR  235



>gb|AFK47647.1| unknown [Lotus japonicus]
Length=234

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G + E+ + A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+ 
Sbjct  41   GASEERRISASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDKVKDLKR  100

Query  732  SASEATKGILVPTDTDEVRVEQ---QAEGCDGASYS-----IKASLCCDYKHELLSELRQ  577
             A E ++   VPT+ DEV ++    Q E C   +       IKAS+CCD + EL SEL Q
Sbjct  101  KAMEVSRVYTVPTEIDEVTIDYDHVQDESCTKVNKCKDNIVIKASVCCDDRPELFSELIQ  160

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYA  397
            A   L L  ++A++A++G R+ S+ V+         D       S++ Q+L+S + K   
Sbjct  161  AFKGLRLTAVKADIASVGGRIKSILVLYSK------DTAENVCLSTLKQSLKSAVTKIAG  214

Query  396  S  394
            S
Sbjct  215  S  215



>ref|NP_001281284.1| transcription factor bHLH106-like [Malus domestica]
 gb|ADL36594.1| BHLH domain class transcription factor [Malus domestica]
Length=240

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  63   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +    P++TDE+ V    +  +      KASLCC+ + +LL +L + L +L LKT++A
Sbjct  123  IAELETFPSETDEITVLSSNDYTNDGRIVFKASLCCEDRSDLLPDLIEILKSLHLKTIKA  182

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            E+ATLG R+ ++ +V  +++   + E   FL      AL+S+L++  +SE
Sbjct  183  EIATLGGRIRNVLIVAADKDH--TIESVNFL----QNALKSLLERSNSSE  226



>ref|XP_004297146.1| PREDICTED: transcription factor bHLH30-like [Fragaria vesca subsp. 
vesca]
Length=345

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  156  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSVI  215

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+  +E  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  216  AETSPVPTETDELVVDDASE--EEGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  273

Query  537  MATLGSRMVS-LFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ + LF+  E +  +  +E++++  SS+ +AL++V++K    EE
Sbjct  274  ITTLGGRVKNVLFITGEEDHSSSGEEQQQYCISSIQEALKAVMEKSGGGEE  324



>ref|XP_010523404.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Tarenaya 
hassleriana]
Length=361

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRS++P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  152  KALAASKSHSEAERRRRERINNHLAKLRSILPNTTKTDKASLLAEVIQHVKELKRQTSQI  211

Query  717  TKGILVPTDTDEVRV---EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             +   VPT+TDE+ V   E+  E      + IKAS+CCD + +LL +L + L AL LKTL
Sbjct  212  AETNPVPTETDEITVDVSEEAVEEQQDGKFVIKASICCDDRSDLLPDLIKTLKALRLKTL  271

Query  546  RAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +AE+ T+G R+ ++ +VT  EE N  DE+  +   S+ +ALR+V+DK
Sbjct  272  KAEITTVGCRVKNVLLVT-GEESNIGDEQM-YCIGSIQEALRAVMDK  316



>ref|XP_010105437.1| hypothetical protein L484_009905 [Morus notabilis]
 gb|EXC04712.1| hypothetical protein L484_009905 [Morus notabilis]
Length=259

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 115/187 (61%), Gaps = 22/187 (12%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            +KA+ A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+  A E
Sbjct  60   DKAMAASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDQVKDLKRKAVE  119

Query  720  ATKGILVPTDTDEVRVE---------------QQAEGCDGASYSIKASLCCDYKHELLSE  586
              K ++VPT+ DE+ +E               +++   D   Y I+AS+CCD + EL SE
Sbjct  120  VGKSLIVPTEVDEIIIESDLSDEDVNVMNLTNKKSSKSDNNIY-IRASVCCDDRPELFSE  178

Query  585  LRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            L Q L  L L  +RA++A++G R+ S+ ++   +   ++        +++ Q+L+ VL K
Sbjct  179  LIQVLKGLRLTPVRADVASIGGRIKSVLILCSKDHAQEA-----VSINTLKQSLKLVLSK  233

Query  405  FYASEEF  385
              ASE  
Sbjct  234  I-ASESM  239



>ref|XP_010681418.1| PREDICTED: transcription factor bHLH30 [Beta vulgaris subsp. 
vulgaris]
Length=373

 Score =   129 bits (324),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 117/177 (66%), Gaps = 8/177 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KELR   S  
Sbjct  181  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELRRQTSII  240

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +  +VPT+TDE+ V+  ++  DG  + IKASLCCD + +LL +L +AL  L LKTL+AE
Sbjct  241  AETSVVPTETDELTVDAASDDQDG-KFIIKASLCCDDRSDLLPDLIKALKTLRLKTLKAE  299

Query  537  MATLGSRMVS-LFVVTENEEGNDSD------ERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ + LFV  E    +D D      E  +   SS+ +AL++V++K    +E
Sbjct  300  ITTLGGRVKNVLFVTHEPNNSDDVDQDDHHEESPQCSVSSIQEALKAVIEKSGGGDE  356



>gb|KHN31290.1| Transcription factor bHLH51 [Glycine soja]
Length=275

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   E+A+ A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+ 
Sbjct  78   GAAEERAISASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDQVKDLKR  137

Query  732  SASEATKGILVPTDTDEVRVEQ---QAEGCDGASYS-----IKASLCCDYKHELLSELRQ  577
             A + ++   VPT+ DEV ++    Q E C   +       IKAS+CCD + EL  EL Q
Sbjct  138  KAMDVSRAFTVPTEIDEVSIDYDHVQDESCTKVNKQKDNIVIKASVCCDDRPELFPELIQ  197

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYA  397
             L  L L  ++A++A++G R+ S+ V+         D       +++ Q+L+S + K  +
Sbjct  198  VLKGLRLTAVKADIASVGGRIKSILVLCSK------DREDSVCLATLKQSLKSAVTKIAS  251

Query  396  S  394
            S
Sbjct  252  S  252



>ref|XP_003552298.2| PREDICTED: transcription factor bHLH51-like [Glycine max]
Length=275

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   E+A+ A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+ 
Sbjct  78   GAAEERAISASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDQVKDLKR  137

Query  732  SASEATKGILVPTDTDEVRVEQ---QAEGCDGA-----SYSIKASLCCDYKHELLSELRQ  577
             A + ++   VPT+ DEV ++    Q E C        +  IKAS+CCD + EL  EL Q
Sbjct  138  KAMDVSRAFTVPTEIDEVSIDYDHVQDESCTKVNKLKDNIVIKASVCCDDRPELFPELIQ  197

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYA  397
             L  L L  ++A++A++G R+ S+ V+         D       +++ Q+L+S + K  +
Sbjct  198  VLKGLRLTAVKADIASVGGRIKSILVLCSK------DREDSVCLATLKQSLKSAVTKIAS  251

Query  396  S  394
            S
Sbjct  252  S  252



>gb|KHN33180.1| Transcription factor bHLH106 [Glycine soja]
Length=246

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 102/163 (63%), Gaps = 10/163 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            +KAL ALRNH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  ++EL+   S 
Sbjct  60   DKALAALRNHKEAEKRRRERINSHLDKLRTLLPCNSKTDKASLLAKVVQRVRELKQQISS  119

Query  720  ATKGILVPTDTDEVRV------EQQAEGCD--GASYSIKASLCCDYKHELLSELRQALDA  565
             +     P++TDEV V           GCD        KASLCC+ + +L+ EL + L +
Sbjct  120  LSDSEAFPSETDEVSVLSTSGDNDDHGGCDDNDGRLIFKASLCCEDRSDLIPELIEILRS  179

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSV  436
            L LKTL+AEMATLG R  ++ VV  +++   S E  +FL +S+
Sbjct  180  LRLKTLKAEMATLGGRTRNVLVVATDKDH--SGESIQFLQNSL  220



>ref|XP_007145485.1| hypothetical protein PHAVU_007G243000g [Phaseolus vulgaris]
 gb|ESW17479.1| hypothetical protein PHAVU_007G243000g [Phaseolus vulgaris]
Length=226

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = -2

Query  930  VRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISE  751
            ++P     + +KAL ALRNH EAE+RRRERIN HL+ LR+L+P  +K DKA+LL KV+  
Sbjct  40   LQPFNAPPHQDKALAALRNHKEAEKRRRERINAHLNKLRTLLPCNSKTDKASLLAKVVER  99

Query  750  IKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSI--KASLCCDYKHELLSELRQ  577
            +KEL+   SE T+    P++ DE+ V        G    +  KASLCC+ + +L+ +L  
Sbjct  100  LKELKQQMSEITQSETFPSENDEISVLSTGGDGSGGDGRLIFKASLCCEDRSDLIPDLVG  159

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALR  421
             L +L L TLRAE+ATLG R  ++ VV  +++   S E   FL +S+H  L+
Sbjct  160  ILKSLHLTTLRAEIATLGGRTRNVLVVATDKDR--SVESIHFLQNSLHTLLQ  209



>ref|XP_003520293.2| PREDICTED: transcription factor bHLH106-like [Glycine max]
Length=253

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 102/163 (63%), Gaps = 10/163 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            +KAL ALRNH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  ++EL+   S 
Sbjct  67   DKALAALRNHKEAEKRRRERINSHLDKLRTLLPCNSKTDKASLLAKVVQRVRELKQQISS  126

Query  720  ATKGILVPTDTDEVRV------EQQAEGCD--GASYSIKASLCCDYKHELLSELRQALDA  565
             +     P++TDEV V           GCD        KASLCC+ + +L+ EL + L +
Sbjct  127  LSDSEAFPSETDEVSVLSTSGDNDDHGGCDDNDGRLIFKASLCCEDRSDLIPELIEILRS  186

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSV  436
            L LKTL+AEMATLG R  ++ VV  +++   S E  +FL +S+
Sbjct  187  LRLKTLKAEMATLGGRTRNVLVVATDKDH--SGESIQFLQNSL  227



>ref|XP_007163561.1| hypothetical protein PHAVU_001G244500g [Phaseolus vulgaris]
 ref|XP_007163562.1| hypothetical protein PHAVU_001G244500g [Phaseolus vulgaris]
 gb|ESW35555.1| hypothetical protein PHAVU_001G244500g [Phaseolus vulgaris]
 gb|ESW35556.1| hypothetical protein PHAVU_001G244500g [Phaseolus vulgaris]
Length=272

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 112/183 (61%), Gaps = 18/183 (10%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   E+A+ A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI  +K+L+ 
Sbjct  75   GAAEERAMSASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDHVKDLKR  134

Query  732  SASEATKGILVPTDTDEVRVE---QQAEGCDGA-----SYSIKASLCCDYKHELLSELRQ  577
             A + ++   VPT+ DEV ++    Q E C        +  IKAS+CCD + EL  EL Q
Sbjct  135  KAMDVSRAFTVPTEIDEVSIDCDHVQDESCTKVNKLKENIVIKASVCCDDRPELFPELIQ  194

Query  576  ALDALPLKTLRAEMATLGSRMVSLFVVT--ENEEGNDSDERREFLASSVHQALRSVLDKF  403
             L  L L  ++A++A++G R+ S+ V+   + EEG           +++ Q+L+S + K 
Sbjct  195  VLKGLRLTAVKADIASVGGRIKSILVLCSKDGEEG--------VCLTTLKQSLKSAVTKI  246

Query  402  YAS  394
             +S
Sbjct  247  ASS  249



>ref|XP_010254503.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
 ref|XP_010254504.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
 ref|XP_010254505.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
Length=235

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 24/180 (13%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELR------  736
            K + A ++HSEAERRRR+RINGHL+TLR+L+P T K DKA+LL +V+  +KEL+      
Sbjct  39   KVIAACKSHSEAERRRRQRINGHLATLRTLLPNTTKTDKASLLAEVVQHVKELKKLAAGV  98

Query  735  --------SSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELR  580
                    +S S  ++    P +TDE+ +      CD  S  IKASLCCD + +LLS+L 
Sbjct  99   ASHDGDGYNSNSNRSREWAFPGETDELTLGY----CDAESKMIKASLCCDDRPDLLSDLT  154

Query  579  QALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDS--DERREFLASSVHQALRSVLDK  406
            +AL +   +  +AEMAT+G R  S+ V+    EG+ +  DE  E L     +AL++VLDK
Sbjct  155  KALRSARGRIRKAEMATVGGRTKSVLVIQRRNEGSSTGGDEDLEML----RRALKAVLDK  210



>ref|XP_007028307.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY08809.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=294

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 110/170 (65%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL+ LRSL+P  +K DKA+LL KV+  +KEL+    E
Sbjct  118  DRALAALKNHKEAEKRRRERINSHLNRLRSLLPCNSKTDKASLLAKVVQRVKELKQQTLE  177

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
             T+    P++ DE+ V       DG     KASLCC+ + +LL EL + L +L LKTL+A
Sbjct  178  LTELEAFPSEADEITVLSCDYTIDG-RLIFKASLCCEDRSDLLPELIEILKSLHLKTLKA  236

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EMATLG R+ ++ +V  +++   S E   FL      AL+S+L++  +S+
Sbjct  237  EMATLGGRIRNVLIVAADKD--HSIESVHFL----QNALKSLLERSNSSD  280



>gb|KDP27475.1| hypothetical protein JCGZ_20010 [Jatropha curcas]
Length=239

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 107/170 (63%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LRSL+P  +K DKA+LL KV+  ++EL+   S+
Sbjct  60   DRALAALKNHKEAEKRRRERINSHLDKLRSLLPCNSKTDKASLLAKVVQRVRELKQQTSQ  119

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
                   P++TDE+ V       DG     KASLCC+ + +LL +L + L +L LKTL A
Sbjct  120  IPGLETFPSETDEITVLSGEYSGDG-QLIFKASLCCEDRSDLLPDLIEILKSLHLKTLSA  178

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EM TLG R+ ++ +V    E + S E   FL +    AL+S+L++  AS+
Sbjct  179  EMVTLGGRIRNVLIVA--AEKDHSIESVHFLQT----ALKSLLERSNASD  222



>ref|XP_008387438.1| PREDICTED: transcription factor bHLH106-like [Malus domestica]
Length=240

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 108/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  63   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +    P++TDE+ V    +         KASLCC+ + +LL +L + L +L L+T++A
Sbjct  123  IAELETFPSETDEITVLSSNDYTSDGRIVFKASLCCEDRSDLLPDLIEILKSLHLRTIKA  182

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            E+ATLG R+ ++ +V  +++   + E   FL      AL+S+L++  +SE
Sbjct  183  EIATLGGRIRNVLIVAADQDH--TIESVHFL----QNALKSLLERSNSSE  226



>ref|XP_009369194.1| PREDICTED: transcription factor bHLH51-like [Pyrus x bretschneideri]
Length=272

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 105/180 (58%), Gaps = 27/180 (15%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A ++H +AE+RRR+RI+  L+TLR L+P ++KMDKAALLG VI  +KEL+  A E ++  
Sbjct  81   ASKSHRQAEKRRRDRISAQLATLRKLVPKSDKMDKAALLGSVIDHVKELKRKAVEVSEAF  140

Query  705  LVPTDTDEVRVEQQAEGCDGA----------------SYSIKASLCCDYKHELLSELRQA  574
            +VPT+ DEV ++     CD A                ++ I AS+CCD + EL SEL Q 
Sbjct  141  IVPTEVDEVTID-----CDSAHGVTSTTTSNTNINRGNFLITASVCCDDRPELFSELIQI  195

Query  573  LDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            L  L L  LRAEMA++G R+ S+ V+         D       S++ Q+L+ VL K  AS
Sbjct  196  LKGLKLTALRAEMASVGGRIKSVLVLCSK------DGEEAVCLSTLKQSLKLVLSKLAAS  249



>ref|XP_009371243.1| PREDICTED: transcription factor bHLH106-like [Pyrus x bretschneideri]
Length=240

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 108/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  63   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVKELKQQTSE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +    P++TDE+ V    +         KASLCC+ + +LL +L + L +L L+T++A
Sbjct  123  IAELETFPSETDEITVLSSNDYTSDGRIVFKASLCCEDRSDLLPDLIEILKSLHLRTIKA  182

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            E+ATLG R+ ++ +V  +++   + E   FL      AL+S+L++  +SE
Sbjct  183  EIATLGGRIRNVLIVAADKDH--TIESVHFL----QNALKSLLERSNSSE  226



>ref|XP_002272668.2| PREDICTED: transcription factor bHLH51 [Vitis vinifera]
Length=252

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 106/177 (60%), Gaps = 14/177 (8%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            E+   A ++HS+AE+RRR+RIN  L+TLR LIP + KMDKAALLG VI  +K+L+  A E
Sbjct  59   ERTATASKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSVIDHVKDLKRQAME  118

Query  720  ATKGILVPTDTDEVRVEQQAEGC--------DGASYSIKASLCCDYKHELLSELRQALDA  565
             +    VPT+ DEV V+ + +             +  IKAS+CC+ + EL SEL +AL  
Sbjct  119  VSDVFTVPTEVDEVTVDCEFDQGLVPNNTIKTPENIFIKASVCCEDRPELFSELIRALQG  178

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            L L T+RA+MA+L  R  S+ V+   ++ N          S++ Q+L+ VL +  +S
Sbjct  179  LKLTTIRADMASLSGRTKSILVLCSKDDSN------SVCISTLKQSLKVVLSRIVSS  229



>ref|XP_002307967.2| hypothetical protein POPTR_0006s03550g [Populus trichocarpa]
 ref|XP_011040758.1| PREDICTED: transcription factor bHLH106-like [Populus euphratica]
 gb|EEE91490.2| hypothetical protein POPTR_0006s03550g [Populus trichocarpa]
Length=240

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 109/174 (63%), Gaps = 8/174 (5%)
 Frame = -2

Query  909  VNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            + PE +AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  ++EL+ 
Sbjct  59   MTPEDRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVRELKQ  118

Query  732  SASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLK  553
              SE       P++TDEV V       DG     KASLCC+ + +L+ +L + L +L LK
Sbjct  119  QTSELPGLESFPSETDEVTVLSGEYSSDG-QLIFKASLCCEDRSDLMPDLIEILKSLHLK  177

Query  552  TLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            TL+AEM TLG R+ ++ ++  +++   S E   FL      AL+S+L++  +SE
Sbjct  178  TLKAEMVTLGGRIRNVLIIAADKD--HSVESVHFL----QNALKSLLERSNSSE  225



>ref|XP_003591832.1| Transcription factor bHLH30 [Medicago truncatula]
 gb|AES62083.1| basic helix loop helix (BHLH) DNA-binding family protein [Medicago 
truncatula]
Length=338

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 114/173 (66%), Gaps = 10/173 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  154  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  213

Query  717  TKGILVPTDTDEVRVEQQAE----GCDGASYSIKASLCCDYKHELLSELRQALDALPLKT  550
             +   VPT+ DE+ V+  A+    G +G  + IKASLCCD + +LL EL + L AL L+T
Sbjct  214  AETSPVPTECDELTVDAAADDEDYGSNGNKFIIKASLCCDDRSDLLPELIKTLKALRLRT  273

Query  549  LRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            L+A++ TLG R+ ++  +T  E+ +      E+  SS+ +AL++V++K    E
Sbjct  274  LKADITTLGGRVKNVLFITGEEDDH------EYCISSIQEALKAVMEKSVGDE  320



>ref|XP_007141752.1| hypothetical protein PHAVU_008G222700g [Phaseolus vulgaris]
 gb|ESW13746.1| hypothetical protein PHAVU_008G222700g [Phaseolus vulgaris]
Length=257

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 110/171 (64%), Gaps = 17/171 (10%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG V+  +K+L+  A   +K I
Sbjct  67   ASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVVDHVKDLKRKAMCVSKAI  126

Query  705  LVPTDTDEVRVEQQAEGCDGASYS----------IKASLCCDYKHELLSELRQALDALPL  556
             VPT+TDEV+++   E  D  SY+          IKAS+CCD + E+  EL Q L  L L
Sbjct  127  TVPTETDEVKIDFH-EAKDE-SYTKVKILKENIIIKASVCCDDRPEVFPELIQVLKGLRL  184

Query  555  KTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
              ++A++A++G R+ S+ V+       DS+E    L S++ Q+L+S ++K 
Sbjct  185  TAVKADIASVGGRIKSILVLC----SKDSEENSVCL-STLKQSLKSAVNKI  230



>emb|CDP13989.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 108/176 (61%), Gaps = 15/176 (9%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            +A  A R+HSEAE+RRR+RIN  L+TLR LIP + KMDKAALLG V+  +KE++S  +E 
Sbjct  73   RAASASRSHSEAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSVVEHVKEMKSKTTEI  132

Query  717  TKGILVPTDTDEVRVEQ-QAEGCDGASYS----IKASLCCDYKHELLSELRQALDALPLK  553
            +  +++PTD DEV V+    E C   +      +KA +CCD + E  SEL +AL +L L 
Sbjct  133  SNCMMIPTDVDEVTVDYVDDEYCSSIAKDRKILLKACVCCDDRPEFFSELNRALKSLRLT  192

Query  552  TLRAEMATLGSRMVSLFV---VTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            T+ A + +LG R+ S F+   ++ + EG           +++ Q+L+ VL +  AS
Sbjct  193  TVEANVISLGGRIKSSFILCPISSSVEGG-------ICGNTLKQSLKLVLSRIAAS  241



>ref|XP_011076673.1| PREDICTED: transcription factor bHLH51 [Sesamum indicum]
Length=255

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = -2

Query  924  PGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            P  +G   ++   A R+HSEAE+RRR+RIN  L+TLR LIP + KMDKAALLG+V+  +K
Sbjct  60   PSFEGAAEDRTASASRSHSEAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGQVVDHVK  119

Query  744  ELRSSASEATKGILVPTDTDEVRVEQ-QAEGCDGASYSIKASLCCDYKHELLSELRQALD  568
            E    A EA+K   +PT+TDEV +E   A      +  + A++CCD + EL +EL  AL 
Sbjct  120  EQSERAKEASKFSTIPTETDEVIIEHMNARETAPQNIYVSATVCCDDRPELFAELNSALK  179

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +L +  ++AE+ +LG R  S FV+   + G      R    S + Q+L+  L +
Sbjct  180  SLAVTIVKAEITSLGGRTKSNFVLCAKDTGG---AERNSCTSLLQQSLKLALSR  230



>gb|KDP44742.1| hypothetical protein JCGZ_01242 [Jatropha curcas]
Length=270

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 105/167 (63%), Gaps = 9/167 (5%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            EKA    ++HS+AE+RRR+RIN  LS LR LIP ++KMDKAALLG VI  +K+L+  A+E
Sbjct  82   EKAASVSKSHSQAEKRRRDRINAQLSILRKLIPKSDKMDKAALLGSVIDHVKDLKGKATE  141

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYS----IKASLCCDYKHELLSELRQALDALPLK  553
             +K I +PT+ DEV V+   E  DG S      I+AS+CC+ + E+ SEL + L  L L 
Sbjct  142  VSKNITIPTEFDEVTVDID-ESADGNSKDKNIFIRASVCCEDRPEVFSELIRVLKGLKLS  200

Query  552  TLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVL  412
             +RA++A++G R+ ++ ++       D  E +    S++ QAL   L
Sbjct  201  IVRADIASVGGRVKNMLLLC----NKDYKEGKVVSVSTIKQALNVFL  243



>ref|XP_006482067.1| PREDICTED: transcription factor bHLH106-like [Citrus sinensis]
Length=238

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 112/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  921  GQKGVNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            G     PE +AL AL+NH EAE+RRRERIN HL+ LRS++   +K+DKA+LL +V+  ++
Sbjct  51   GLTETTPEDRALAALKNHKEAEKRRRERINSHLNKLRSILSCNSKLDKASLLARVVQRVR  110

Query  744  ELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDA  565
            EL+    E T+    P++TDE+ V   ++     +   KASLCC+ + +LL ++ + L +
Sbjct  111  ELKEQTIELTEVESFPSETDEITVLASSDYSSDGTLIFKASLCCEDRSDLLPDIIEILKS  170

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            L LKTL+AEM TLG R+ ++ ++    E + S E   FL      AL+S+L++  +S+
Sbjct  171  LHLKTLKAEMVTLGGRIRNVLIIA--AEKDHSIESVHFL----QNALKSLLERSNSSD  222



>ref|XP_010264587.1| PREDICTED: transcription factor bHLH51-like [Nelumbo nucifera]
Length=277

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 109/189 (58%), Gaps = 34/189 (18%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRRERIN HL+TLR LIP ++KMDKAALL  VI  +K+L+  A E
Sbjct  63   DRATAASKSHSQAEKRRRERINSHLTTLRKLIPRSDKMDKAALLASVIDHVKDLKRKAVE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGA-----------------------SYSIKASLCCD  610
             ++   +P D DEV V+     CD +                        + IKASL CD
Sbjct  123  ISQVFTIPKDVDEVIVD-----CDRSVEPTTTATTTTATNDDDNNNSKNGFFIKASLSCD  177

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQ  430
             + EL ++L QAL  L L T+RAEMAT+G R++++ V+         D +     SS+ Q
Sbjct  178  DRPELFTDLIQALKGLRLTTVRAEMATMGGRIINVMVLCTK------DCQEGVCLSSLKQ  231

Query  429  ALRSVLDKF  403
            +L+ VL++ 
Sbjct  232  SLKVVLNRI  240



>ref|XP_002322615.2| hypothetical protein POPTR_0016s03460g [Populus trichocarpa]
 gb|ABK93020.1| unknown [Populus trichocarpa]
 gb|EEF04376.2| hypothetical protein POPTR_0016s03460g [Populus trichocarpa]
Length=241

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 108/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+   +K DKA+LL KV+  ++EL+   SE
Sbjct  64   DRALAALKNHKEAEKRRRERINSHLDKLRGLLLCNSKTDKASLLAKVVQRVRELKQQTSE  123

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
             +     P++TDEV V       DG     KASLCC+ + +L+ EL + L +L LKTL+A
Sbjct  124  LSGLETFPSETDEVTVLSGEYSSDG-QLIFKASLCCEDRLDLMPELNEILKSLHLKTLKA  182

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            EM TLG R+ ++ ++  +++   S E   FL      AL+S+L++  +SE+
Sbjct  183  EMVTLGGRIRNVLIIAADKD--HSVESVHFL----QNALKSLLERSNSSEK  227



>emb|CDP01553.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 116/175 (66%), Gaps = 22/175 (13%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE-  721
            KA+ A ++HSEAERRRR+RINGHL+TLR+L+P T K DKA+LL +V+  I+EL+ S  E 
Sbjct  46   KAVAANKSHSEAERRRRKRINGHLATLRNLLPKTIKADKASLLAEVVRCIRELKKSTEEL  105

Query  720  -ATKG---------ILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQAL  571
             AT+G         ++ P++TDE+++       DG S +IKA+LCC+ + E++ EL++AL
Sbjct  106  SATEGDDQSNTAMKLMFPSETDELKLCYD----DGDSRTIKATLCCEDRPEMMIELKRAL  161

Query  570  DALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            +A+  K ++AEMAT+G R  ++  +  +  G +         +++ +AL+ V+D+
Sbjct  162  NAVKAKVVKAEMATVGGRTKTVLWLQASAAGEEG-------LATIRRALKVVVDR  209



>emb|CBI25454.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 106/177 (60%), Gaps = 14/177 (8%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            E+   A ++HS+AE+RRR+RIN  L+TLR LIP + KMDKAALLG VI  +K+L+  A E
Sbjct  104  ERTATASKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSVIDHVKDLKRQAME  163

Query  720  ATKGILVPTDTDEVRVEQQAEGC--------DGASYSIKASLCCDYKHELLSELRQALDA  565
             +    VPT+ DEV V+ + +             +  IKAS+CC+ + EL SEL +AL  
Sbjct  164  VSDVFTVPTEVDEVTVDCEFDQGLVPNNTIKTPENIFIKASVCCEDRPELFSELIRALQG  223

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            L L T+RA+MA+L  R  S+ V+   ++ N          S++ Q+L+ VL +  +S
Sbjct  224  LKLTTIRADMASLSGRTKSILVLCSKDDSN------SVCISTLKQSLKVVLSRIVSS  274



>ref|XP_008369274.1| PREDICTED: transcription factor bHLH51 [Malus domestica]
Length=272

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 105/180 (58%), Gaps = 27/180 (15%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A ++H +AE+RRR+RI+  L+TLR L+P ++KMDKAALLG VI  +KEL+  A E ++  
Sbjct  81   ASKSHRQAEKRRRDRISAQLATLRKLVPKSDKMDKAALLGSVIDHVKELKRKAVEVSEAF  140

Query  705  LVPTDTDEVRVEQQAEGCDGA----------------SYSIKASLCCDYKHELLSELRQA  574
            +VPT+ DEV ++     CD A                ++ I AS+CCD + EL SEL Q 
Sbjct  141  IVPTEVDEVTID-----CDPAYGVTSTTTSSTNINRGNFLITASVCCDDRPELFSELVQI  195

Query  573  LDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            L  L L  +RA+MA++G R+ S+ V+         D       S++ Q+L+ VL K  AS
Sbjct  196  LKGLKLTAVRADMASVGGRIKSVLVLCSK------DGEEAVCLSTLKQSLKLVLSKLAAS  249



>ref|XP_008464948.1| PREDICTED: transcription factor bHLH106-like [Cucumis melo]
Length=243

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = -2

Query  924  PGQKGVNP-EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEI  748
            PG    +P ++AL AL+NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +
Sbjct  60   PGVAAPSPHDRALAALKNHKEAEKRRRERINSHLDKLRTLLPCNSKTDKASLLAKVVERV  119

Query  747  KELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALD  568
            KEL++   E  +    P++TDE+ V    +  DG     KASLCC+ + +L+ +L   L+
Sbjct  120  KELKNETLEIAELESFPSETDEISVLSGEKSEDG-RLVFKASLCCEDRSDLIPDLNDILN  178

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            +L LKTLRA++ T+G R+ ++ ++  N+  + S E   FL      AL+S++++  +S
Sbjct  179  SLHLKTLRADIVTVGGRIRNVLLIAAND--HHSIESVHFL----QNALKSLIERSNSS  230



>gb|ACN21650.1| putative basic helix-loop-helix protein BHLH25 [Lotus japonicus]
Length=336

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 119/166 (72%), Gaps = 5/166 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  146  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  205

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + IKASLCC+ + +LL +L +AL AL L+TLRAE
Sbjct  206  AETSPVPTEADELTVDAADE--DG-RFVIKASLCCEDRSDLLPDLIKALKALRLRTLRAE  262

Query  537  MATLGSRMVS-LFVVTENEEGNDSDE-RREFLASSVHQALRSVLDK  406
            ++TLG R+ + LF+  ++++ +  D+ ++++  SS+ +AL++V++K
Sbjct  263  ISTLGGRVKNVLFITGDDQDSSGEDQSQQQYCISSIQEALKAVMEK  308



>ref|XP_002517323.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF45116.1| DNA binding protein, putative [Ricinus communis]
Length=237

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 107/170 (63%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+P  +K DKA+LL KV+  ++EL+   S+
Sbjct  60   DRALAALKNHKEAEKRRRERINSHLDKLRGLLPCNSKTDKASLLAKVVQRVRELKQQTSQ  119

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
                   P++TDE+ V       DG     KASLCC+ + +LL +L + L +L LKTL+A
Sbjct  120  IPGLDSFPSETDEITVLSGEYSSDG-QLIFKASLCCEDRSDLLPDLIEILKSLHLKTLKA  178

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EM TLG R+ ++ ++    E + S E   FL +    AL+S++++  +S+
Sbjct  179  EMVTLGGRIRNVLIIA--AEKDHSIESVHFLQT----ALKSLIERSNSSD  222



>gb|EYU20034.1| hypothetical protein MIMGU_mgv1a012796mg [Erythranthe guttata]
Length=239

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = -2

Query  915  KGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELR  736
            +G   E+A  A R+HSEAE+RRR+RIN  LSTLR LIP + KMDKA LLG  + +IKE  
Sbjct  50   EGSPEERAATASRSHSEAEKRRRDRINAQLSTLRKLIPMSEKMDKAVLLGHAVEQIKEQS  109

Query  735  SSASEATKGILVPTDTDEVRVEQQAEGCDGASYSI--KASLCCDYKHELLSELRQALDAL  562
              A E +K   +PT+ D+V +       D  S+ I  KA++CCD + ELLSE+  A+  L
Sbjct  110  KRAKEVSKLSTIPTENDQVTIIDDHSNTDKESHIIQMKATICCDDRPELLSEINGAIKGL  169

Query  561  PLKTLRAEMATLGSRMVSLFVVTEN  487
             L  + AE+  LG R+ S FVV  N
Sbjct  170  GLTVMEAEITGLGGRVNSSFVVCAN  194



>gb|AES71178.2| transcription factor [Medicago truncatula]
Length=262

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 113/179 (63%), Gaps = 16/179 (9%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALLG VI ++K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDRINTQLANLRKLIPKSDKMDKAALLGSVIDQVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYS----------IKASLCCDYKHELLSELRQAL  571
             ++ I VPT+ DEV ++      D  + +          IKAS+CCD + EL SEL Q L
Sbjct  128  VSRVITVPTEIDEVSIDYNHVVEDETNTNKVNKFKDNIIIKASVCCDDRPELFSELIQVL  187

Query  570  DALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
             +L L T++A++A++G R+ S+ V+       DS+E      +++ Q+L+S + K  +S
Sbjct  188  KSLRLTTVKADIASVGGRIKSILVLC----SKDSEE--NVCINTLKQSLKSAVTKIASS  240



>ref|XP_003600927.1| Transcription factor bHLH51 [Medicago truncatula]
Length=260

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 113/179 (63%), Gaps = 16/179 (9%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALLG VI ++K+L+  A +
Sbjct  66   DRAASASKSHSQAEKRRRDRINTQLANLRKLIPKSDKMDKAALLGSVIDQVKDLKRKAMD  125

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYS----------IKASLCCDYKHELLSELRQAL  571
             ++ I VPT+ DEV ++      D  + +          IKAS+CCD + EL SEL Q L
Sbjct  126  VSRVITVPTEIDEVSIDYNHVVEDETNTNKVNKFKDNIIIKASVCCDDRPELFSELIQVL  185

Query  570  DALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
             +L L T++A++A++G R+ S+ V+       DS+E      +++ Q+L+S + K  +S
Sbjct  186  KSLRLTTVKADIASVGGRIKSILVLC----SKDSEE--NVCINTLKQSLKSAVTKIASS  238



>ref|XP_006430538.1| hypothetical protein CICLE_v10012626mg [Citrus clementina]
 gb|ESR43778.1| hypothetical protein CICLE_v10012626mg [Citrus clementina]
Length=237

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 112/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  921  GQKGVNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            G     PE +AL AL+NH EAE+RRRERIN HL+ LRS++   +K+DKA+LL +V+  ++
Sbjct  51   GVTETTPEDRALAALKNHKEAEKRRRERINSHLNKLRSILSCNSKLDKASLLARVVQRVR  110

Query  744  ELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDA  565
            EL+    E T+    P++TDE+ V   ++     +   KASLCC+ + +LL ++ + L +
Sbjct  111  ELKEQTIELTEVESFPSETDEITVLASSDYSSDGTLIFKASLCCEDRSDLLPDIIEILKS  170

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            L LKTL++EM TLG R+ ++ ++    E + S E   FL      AL+S+L++  +S+
Sbjct  171  LHLKTLKSEMVTLGGRIRNVLIIA--AEKDHSIESVHFL----QNALKSLLERSNSSD  222



>gb|KHN05853.1| Transcription factor bHLH30 [Glycine soja]
Length=372

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 118/170 (69%), Gaps = 9/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI ++KEL+   S  
Sbjct  174  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQQVKELKRQTSLI  233

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT++DE+ V+   E  DG  + IKASLCC+ + +LL +L + L AL L+TLRAE
Sbjct  234  VEMSTVPTESDELTVDAIDE--DG-KFVIKASLCCEDRSDLLPDLIKTLKALRLRTLRAE  290

Query  537  MATLGSRMVSLFVVTENEEGNDSDE------RREFLASSVHQALRSVLDK  406
            + +LG R+ ++ V+T +EE N +        ++++  SS+ +AL++V++K
Sbjct  291  ITSLGGRVKNVLVITGDEEENSNTNNGEQSMQQQYCISSIQEALKAVMEK  340



>ref|XP_003520049.1| PREDICTED: transcription factor bHLH30-like [Glycine max]
Length=372

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 118/170 (69%), Gaps = 9/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI ++KEL+   S  
Sbjct  174  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQQVKELKRQTSLI  233

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT++DE+ V+   E  DG  + IKASLCC+ + +LL +L + L AL L+TLRAE
Sbjct  234  VEMSTVPTESDELTVDAIDE--DG-KFVIKASLCCEDRSDLLPDLIKTLKALRLRTLRAE  290

Query  537  MATLGSRMVSLFVVTENEEGNDSDE------RREFLASSVHQALRSVLDK  406
            + +LG R+ ++ V+T +EE N +        ++++  SS+ +AL++V++K
Sbjct  291  ITSLGGRVKNVLVITGDEEENSNTNNGEQSMQQQYCISSIQEALKAVMEK  340



>ref|XP_006843648.1| hypothetical protein AMTR_s00007p00170710 [Amborella trichopoda]
 gb|ERN05323.1| hypothetical protein AMTR_s00007p00170710 [Amborella trichopoda]
Length=220

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 114/163 (70%), Gaps = 10/163 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            +A+ + ++HSEAERRRRERINGHLSTLR L+P T+KMDKA+LL +V+  +KEL+  ASE 
Sbjct  39   QAVASQKSHSEAERRRRERINGHLSTLRQLLPCTSKMDKASLLREVVDSLKELKRKASEI  98

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYS-IKASLCCDYKHELLSELRQALDALPLKTLRA  541
            +K +  PTDTDE+RVE    G   +++  IKAS CC+ + +L+++L +AL +L L+T++A
Sbjct  99   SKDLSCPTDTDELRVELCNSGSPNSAFPLIKASFCCEDRPQLVADLIRALQSLRLRTVKA  158

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVL  412
             ++TLG R+ + F+    E  +          +++ +ALR+VL
Sbjct  159  NISTLGGRVRNDFIFMARERVS---------VTTIQEALRAVL  192



>ref|XP_011000409.1| PREDICTED: transcription factor bHLH106-like [Populus euphratica]
Length=240

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 108/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR L+   +K DKA+LL KV+  ++EL+   SE
Sbjct  63   DRALAALKNHKEAEKRRRERINSHLDKLRGLLHCNSKTDKASLLAKVVQRVRELKQQTSE  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
             +     P++TDEV V       DG     KASLCC+ + +L+ +L + L +L LKTL+A
Sbjct  123  LSGLETFPSETDEVTVLSGEYSSDG-QLIFKASLCCEDRLDLMPDLNEILKSLHLKTLKA  181

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            EM TLG R+ ++ ++  +++   S E   FL      AL+S+L++  +SE+
Sbjct  182  EMVTLGGRIRNVLIIAADKD--HSVESVHFL----QNALKSLLERSNSSEK  226



>gb|KDO53621.1| hypothetical protein CISIN_1g026479mg [Citrus sinensis]
Length=238

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 112/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  921  GQKGVNPE-KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIK  745
            G     PE +AL AL+NH EAE+RRRERIN HL+ LRS++   +K+DKA+LL +V+  ++
Sbjct  51   GLTETTPEDRALAALKNHKEAEKRRRERINSHLNKLRSILSCNSKLDKASLLARVVQRVR  110

Query  744  ELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDA  565
            EL+    E T+    P++TDE+ V   ++     +   KASLCC+ + +LL ++ + L +
Sbjct  111  ELKEQTIELTEVESFPSETDEITVLASSDYSSDGTLIFKASLCCEDRSDLLPDIIEILKS  170

Query  564  LPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            L LKTL++EM TLG R+ ++ ++    E + S E   FL      AL+S+L++  +S+
Sbjct  171  LHLKTLKSEMVTLGGRIRNVLIIA--AEKDHSIESVHFL----QNALKSLLERSNSSD  222



>gb|EYU22625.1| hypothetical protein MIMGU_mgv1a012168mg [Erythranthe guttata]
Length=259

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 117/179 (65%), Gaps = 15/179 (8%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KA+ A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  52   KAIAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  111

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+  ++  +   + +KAS+CC+ + ELL EL +AL ++ L+TLRAE
Sbjct  112  EETSPVPTETDELTVDNASDAGEDGKWIVKASICCEDRPELLPELIKALKSMRLRTLRAE  171

Query  537  MATLGSRMVS-LFVVTENEEGNDSD--------------ERREFLASSVHQALRSVLDK  406
            + TLG R+ + L++  E EE ++ D              E R++   S+ +ALR+V++K
Sbjct  172  ITTLGGRVKNVLYITAEEEEFSNYDNNDDNDDVAEENIREERDYSIRSIEEALRAVMEK  230



>gb|EMS47100.1| Transcription factor bHLH51 [Triticum urartu]
Length=272

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 107/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            AL+ HSEAERRRR RIN HL+ LR +IP T +MDKAALL +V+ ++++L+  ASEA +  
Sbjct  81   ALKVHSEAERRRRVRINAHLTALRRMIPDTKQMDKAALLARVVDQVRQLKRRASEAAQQT  140

Query  705  -LVPTDTDEVRVEQQAEGCDGASYS---IKASLCCDYKHELLSELRQALDALPLKTLRAE  538
              VP +TDEV VE    G      S   IKAS+ CD + +L++   QAL  L L+TLRAE
Sbjct  141  PAVPPETDEVSVEFCCTGDTDDDDSRLYIKASVSCDDRPDLVAGFIQALHGLRLRTLRAE  200

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            +++LG R+  +F + + EEG+          +S+ +A+R  L K  +SE
Sbjct  201  VSSLGGRVQHVFTLCKEEEGSAGCAG----LNSLKEAVRFALAKVASSE  245



>gb|KHN04774.1| Transcription factor bHLH51 [Glycine soja]
Length=265

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 107/180 (59%), Gaps = 17/180 (9%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   E+A+ A ++H +AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+ 
Sbjct  66   GAAEERAISASKSHRQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDQVKDLKR  125

Query  732  SASEATKGILVPTDTDEVRVEQ----QAEGCD------GASYSIKASLCCDYKHELLSEL  583
             A + ++   VPT+ DEV +      Q E C         +  IKAS+CCD + EL  EL
Sbjct  126  KAMDVSRAFTVPTEIDEVSIHHDHVLQDESCTEKVNKLKDNIVIKASVCCDDRPELFPEL  185

Query  582  RQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
             Q L  L L  ++A++A++G R+ S+ V+        S +      +++ Q+L+S + K 
Sbjct  186  IQVLKGLRLTAVKADIASVGGRIKSILVLC-------SKDSESVCLATLKQSLKSAITKI  238



>ref|NP_001235786.1| uncharacterized protein LOC100305722 [Glycine max]
 gb|ACU13556.1| unknown [Glycine max]
Length=265

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 107/180 (59%), Gaps = 17/180 (9%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   E+A+ A ++H +AE+RRR+RIN  L+TLR LIP ++KMDKAALLG VI ++K+L+ 
Sbjct  66   GAAEERAISASKSHRQAEKRRRDRINAQLATLRKLIPKSDKMDKAALLGSVIDQVKDLKR  125

Query  732  SASEATKGILVPTDTDEVRVEQ----QAEGCD------GASYSIKASLCCDYKHELLSEL  583
             A + ++   VPT+ DEV +      Q E C         +  IKAS+CCD + EL  EL
Sbjct  126  KAMDVSRAFTVPTEIDEVSIRHDHVLQDESCTEKVNKLKDNIVIKASVCCDDRPELFPEL  185

Query  582  RQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKF  403
             Q L  L L  ++A++A++G R+ S+ V+        S +      +++ Q+L+S + K 
Sbjct  186  IQVLKGLRLTAVKADIASVGGRIKSILVLC-------SKDSESVCLATLKQSLKSAITKI  238



>ref|XP_003519403.2| PREDICTED: transcription factor bHLH51-like [Glycine max]
Length=294

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 110/178 (62%), Gaps = 19/178 (11%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE-  721
            +A  A ++HS+AE+RRR+RIN  L+TLR LIP ++KMDKAALLG V+  +K+L+  A + 
Sbjct  97   RAASASKSHSQAEKRRRDRINAQLATLRKLIPMSDKMDKAALLGSVVDHVKDLKRKAMDV  156

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYS-----------IKASLCCDYKHELLSELRQA  574
             +K + VPT+TDEV ++         SY+           IKAS+CCD + EL  EL Q 
Sbjct  157  VSKAVTVPTETDEVTIDYHQS--QDESYTKRVNILKENIIIKASVCCDDRPELFPELIQV  214

Query  573  LDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLA-SSVHQALRSVLDKF  403
            L  L L  ++A++A++G R+ S+ V+       DSDE    +  S++ Q+L+S ++K 
Sbjct  215  LKGLRLTAVKADIASVGGRIKSILVLC----SKDSDEDNNSVCLSTLKQSLKSAVNKI  268



>ref|XP_009787651.1| PREDICTED: transcription factor bHLH51 [Nicotiana sylvestris]
Length=240

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A R+HSEAE+RRR+RIN  LSTLR LIP + KMDKAALL  V+  +K+L+  A E +K +
Sbjct  67   ASRSHSEAEKRRRDRINAQLSTLRKLIPSSEKMDKAALLRSVVEHVKDLKGRAKEISKVV  126

Query  705  LVPTDTDEVRVEQQAEGCDGASYSI--KASLCCDYKHELLSELRQALDALPLKTLRAEMA  532
              PTD DEV +E   E  + +S SI  K  LCCD + EL SEL +AL+ L L T  A + 
Sbjct  127  NTPTDIDEVIIEHLDED-ENSSNSIILKVCLCCDDRPELFSELNRALNNLKLTTEEANIT  185

Query  531  TLGSRMVSLFVV  496
            +LG R+  +FV+
Sbjct  186  SLGGRIKCVFVL  197



>gb|EMS46917.1| Transcription factor bHLH51 [Triticum urartu]
Length=253

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 106/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            AL+ HSEAERRRR RIN HL+ LR +IP T +MDKAALL +V+ +++ L+  ASEA +  
Sbjct  62   ALKVHSEAERRRRVRINAHLTALRRMIPDTKQMDKAALLARVVDQVRHLKRRASEAAQQT  121

Query  705  -LVPTDTDEVRVEQQAEGCDGASYS---IKASLCCDYKHELLSELRQALDALPLKTLRAE  538
              VP +TDEV VE    G      S   IKAS+ CD + +L++   QAL  L L+TLRAE
Sbjct  122  PAVPPETDEVSVEFCCTGDTDDDDSRLYIKASVSCDDRPDLVAGFIQALHGLRLRTLRAE  181

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            +++LG R+  +F + + EEG+          +S+ +A+R  L K  +SE
Sbjct  182  VSSLGGRVQHVFTLCKEEEGSAGCAG----LNSLKEAVRFALAKVASSE  226



>ref|XP_009406646.1| PREDICTED: transcription factor bHLH30-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=291

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERINGHL+ LRS++P T K DKA+LL +VI  +KEL+   +E 
Sbjct  104  KALAASKSHSEAERRRRERINGHLAKLRSMLPNTTKTDKASLLAEVIQHVKELKRQTTEI  163

Query  717  TKGILVPTDTDEVRVEQQAEGCD-GASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
            T+   +PT+ DE+ V+     CD    + ++ASLCC+ + +LL +L  AL AL L+ L+A
Sbjct  164  TEESPLPTEVDELTVDST---CDEDGKFIVRASLCCEDRPDLLPDLINALKALRLRVLKA  220

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            E+ T+G R+ ++  ++E +   D D +R  L +++ +AL++V+++
Sbjct  221  EITTVGGRVKNVLAISEEQNSGDDDHQR--LVTAIQEALKAVVEQ  263



>ref|XP_009621535.1| PREDICTED: transcription factor bHLH30 [Nicotiana tomentosiformis]
 ref|XP_009621536.1| PREDICTED: transcription factor bHLH30 [Nicotiana tomentosiformis]
 ref|XP_009621537.1| PREDICTED: transcription factor bHLH30 [Nicotiana tomentosiformis]
Length=265

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 116/167 (69%), Gaps = 4/167 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            K L A ++H EAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  83   KVLAASKSHIEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSQI  142

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
            T    VPT+ DE+ V+  +   +G ++ IKASLCC+ + +LL +L + L +L L+TL+AE
Sbjct  143  TDTNPVPTEMDELTVDNYSSDEEG-NFVIKASLCCEDRSDLLPDLIKTLKSLRLRTLKAE  201

Query  537  MATLGSRMVSLFVVT--ENEEGND-SDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  VT  + E+ N  +D++ ++  SS+ +AL++V++K
Sbjct  202  ITTLGGRVKNVLFVTHGDQEDSNSINDDQLQYSISSIQEALKAVIEK  248



>ref|XP_009406645.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=301

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERINGHL+ LRS++P T K DKA+LL +VI  +KEL+   +E 
Sbjct  114  KALAASKSHSEAERRRRERINGHLAKLRSMLPNTTKTDKASLLAEVIQHVKELKRQTTEI  173

Query  717  TKGILVPTDTDEVRVEQQAEGCD-GASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
            T+   +PT+ DE+ V+     CD    + ++ASLCC+ + +LL +L  AL AL L+ L+A
Sbjct  174  TEESPLPTEVDELTVDST---CDEDGKFIVRASLCCEDRPDLLPDLINALKALRLRVLKA  230

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            E+ T+G R+ ++  ++E +   D D +R  L +++ +AL++V+++
Sbjct  231  EITTVGGRVKNVLAISEEQNSGDDDHQR--LVTAIQEALKAVVEQ  273



>ref|XP_003608130.1| Transcription factor bHLH30 [Medicago truncatula]
Length=165

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCD  610
            MDKA +L +VIS++KEL+ +A EA+KG L+PT+ DEV+VE           S  A++CCD
Sbjct  1    MDKATILAEVISQVKELKKNAMEASKGFLIPTEVDEVKVEPYDIKLGYGCMSYIATICCD  60

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQ  430
            Y+ E+L +L++A+DAL L+ ++AEM+TL SRM ++FV T  +  + + E  + +A+ VH+
Sbjct  61   YQPEILCDLKKAIDALQLQLVKAEMSTLESRMKNMFVFTCCKGNSFNVEACQSIANVVHK  120

Query  429  ALRSVLDKFYASEEF  385
            AL SVL+K   S EF
Sbjct  121  ALDSVLEKASNSMEF  135



>ref|XP_009336630.1| PREDICTED: transcription factor bHLH30 [Pyrus x bretschneideri]
Length=349

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 117/170 (69%), Gaps = 8/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  150  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  209

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
            ++   VPT+TDE+ V+ +++  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  210  SETSPVPTETDELIVDDESD--EDGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  267

Query  537  MATLGSRMVS-LFVVTENEEGNDSDER-----REFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +  N   E+     +++  SS+ +AL++V++K
Sbjct  268  ITTLGGRVKNVLFITGEEDSSNSGGEQVQMPHQQYCKSSIQEALKAVMEK  317



>ref|XP_007008919.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY17729.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=258

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 110/189 (58%), Gaps = 25/189 (13%)
 Frame = -2

Query  915  KGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELR  736
            +GV  ++A +  ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALLG  I  +K+L+
Sbjct  57   EGVAEDRATVVSKSHSQAEKRRRDRINAQLAALRKLIPKSDKMDKAALLGSAIEHVKDLK  116

Query  735  SSASEATKGILVPTDTDEVRVEQQAEGCD---------------GASYSIKASLCCDYKH  601
              A+E +K   +PT+ DEV V+     CD                    I+AS+CCD + 
Sbjct  117  RKATEVSKAFTIPTEVDEVTVD-----CDLPENISPPTNPRQTKDNKIFIRASVCCDDRP  171

Query  600  ELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALR  421
            E+ +EL + L  L L T++A+++++G RM S  ++      ND  E +    S++ Q+L 
Sbjct  172  EVFAELIRVLKGLRLSTVKADISSVGGRMRSNLILC-----NDDSEDQGVSPSTLKQSLN  226

Query  420  SVLDKFYAS  394
             VL +  +S
Sbjct  227  VVLSRIASS  235



>ref|XP_008389318.1| PREDICTED: transcription factor bHLH30 [Malus domestica]
Length=357

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  158  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  217

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+ +++  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  218  AETSPVPTETDELIVDDESD--EDGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  275

Query  537  MATLGSRMVS-LFVVTENEEGNDSDER-----REFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +  N   E+     +++  SS+ +AL++V++K
Sbjct  276  ITTLGGRVKNVLFITGEEDSSNSGGEQIQMPHQQYCKSSIQEALKAVMEK  325



>ref|XP_008457214.1| PREDICTED: transcription factor bHLH30-like [Cucumis melo]
 ref|XP_008457215.1| PREDICTED: transcription factor bHLH30-like [Cucumis melo]
Length=306

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 111/169 (66%), Gaps = 6/169 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+      
Sbjct  109  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTMLI  168

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
                L+PT+ DE+ V+  A   DG  + IKAS CC+ + +LL ++ + L +L L+TL+AE
Sbjct  169  ADASLLPTEVDELSVDVDASDEDG-KFVIKASFCCEDRSDLLPQITKTLKSLHLRTLKAE  227

Query  537  MATLGSRMVS-LFVVTENEEGNDSDE----RREFLASSVHQALRSVLDK  406
            + T G R+ + LF+  +N+  ND  +    + ++  SS+ +AL+ +++K
Sbjct  228  ITTFGGRVRNVLFITADNDSSNDQQQDHNPQHQYSISSIQEALKGMMEK  276



>ref|XP_009406644.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=336

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERINGHL+ LRS++P T K DKA+LL +VI  +KEL+   +E 
Sbjct  149  KALAASKSHSEAERRRRERINGHLAKLRSMLPNTTKTDKASLLAEVIQHVKELKRQTTEI  208

Query  717  TKGILVPTDTDEVRVEQQAEGCD-GASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
            T+   +PT+ DE+ V+     CD    + ++ASLCC+ + +LL +L  AL AL L+ L+A
Sbjct  209  TEESPLPTEVDELTVDST---CDEDGKFIVRASLCCEDRPDLLPDLINALKALRLRVLKA  265

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            E+ T+G R+ ++  ++E +   D D +R  L +++ +AL++V+++
Sbjct  266  EITTVGGRVKNVLAISEEQNSGDDDHQR--LVTAIQEALKAVVEQ  308



>gb|EPS73028.1| hypothetical protein M569_01726, partial [Genlisea aurea]
Length=196

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 112/173 (65%), Gaps = 9/173 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  22   KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSQI  81

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT++DE+ VE      +G    I+AS+CC+ + +L+ +L  AL +L L+TL+AE
Sbjct  82   AETSPVPTESDELSVESAKP--NGQKPVIRASICCEDRPDLIPDLIAALKSLKLRTLKAE  139

Query  537  MATLGSRMVSLFVVTENEEGNDSDERR---EFLASSVHQALRSVLDKFYASEE  388
            +ATLG R+ ++  VT    G+D D      E    S+ +ALR V++K    +E
Sbjct  140  IATLGGRVRNVLFVT----GSDDDSGAGGGECCVGSIREALRVVMEKCCVGDE  188



>ref|XP_004500503.1| PREDICTED: transcription factor bHLH51-like [Cicer arietinum]
Length=262

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 103/162 (64%), Gaps = 12/162 (7%)
 Frame = -2

Query  948  ELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALL  769
            EL+ +   P + G   ++A  A ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALL
Sbjct  51   ELIHSWNLPIE-GTAEDRAATASKSHSQAEKRRRDRINTQLANLRKLIPKSDKMDKAALL  109

Query  768  GKVISEIKELRSSASEATKGILVPTDTDEVRVEQ---QAEGC--------DGASYSIKAS  622
            G VI  +K+L+  A + ++ I VPT+ DEV ++    + E C        D  +  IKAS
Sbjct  110  GSVIDHVKDLKRKAMDISRVITVPTEIDEVSIDYNHVEDEICTNKMNKFKDNNNIVIKAS  169

Query  621  LCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVV  496
            +CCD + EL +EL Q L  L L  ++A++A++G R+ S+ V+
Sbjct  170  VCCDDRPELFTELIQVLKGLRLTAVKADIASVGGRIKSILVL  211



>gb|ACJ85198.1| unknown [Medicago truncatula]
Length=262

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 112/179 (63%), Gaps = 16/179 (9%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALLG VI ++K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDRINTQLANLRKLIPKSDKMDKAALLGSVIDQVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVEQQ--AEGCDGA--------SYSIKASLCCDYKHELLSELRQAL  571
             ++ I  PT+ DEV ++     EG            +  IKAS+CCD + EL SEL Q L
Sbjct  128  VSRVITAPTEIDEVSIDYNHVVEGETNTNKVNKFKDNIIIKASVCCDDRPELFSELIQVL  187

Query  570  DALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
             +L L T++A++A++G R+ S+ V+       DS+E      +++ Q+L+S + K  +S
Sbjct  188  KSLRLTTVKADIASVGGRIKSILVLC----SKDSEE--NVCINTLKQSLKSAVTKIASS  240



>ref|XP_008339707.1| PREDICTED: transcription factor bHLH30-like [Malus domestica]
Length=349

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  152  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  211

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+  ++  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  212  AETSPVPTETDELLVDDASD--EDGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  269

Query  537  MATLGSRMVSLFVVTENEEGNDSD------ERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  E+ + S+      + +++  SS+ +AL++V++K
Sbjct  270  ITTLGGRVKNVLFITGEEDPSSSEGEQVQMQHQQYCKSSIQEALKAVMEK  319



>gb|AFK42415.1| unknown [Medicago truncatula]
Length=262

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 112/179 (63%), Gaps = 16/179 (9%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  A ++HS+AE+RRR+RIN  L+ LR LIP ++KMDKAALLG VI ++K+L+  A +
Sbjct  68   DRAASASKSHSQAEKRRRDRINTQLANLRKLIPKSDKMDKAALLGSVIDQVKDLKRKAMD  127

Query  720  ATKGILVPTDTDEVRVEQQ--AEGCDGA--------SYSIKASLCCDYKHELLSELRQAL  571
             ++ I  PT+ DEV ++     EG            +  IKAS+CCD + EL SEL Q L
Sbjct  128  VSRVITAPTEIDEVSIDYNHVVEGETNTNKVNKFKDNIIIKASVCCDDRPELFSELIQVL  187

Query  570  DALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
             +L L T++A++A++G R+ S+ V+       DS+E      +++ Q+L+S + K  +S
Sbjct  188  KSLRLTTVKADIASVGGRIKSILVLC----SKDSEE--NVCINTLKQSLKSAVTKIASS  240



>ref|XP_011077316.1| PREDICTED: transcription factor bHLH30 [Sesamum indicum]
Length=356

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 115/175 (66%), Gaps = 8/175 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  163  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  222

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +  LVPT+ DE+ V+  A   DG    IKAS+CC+ + +LL +L + L AL L+TL+AE
Sbjct  223  AETSLVPTEMDELTVD-NASDEDGKPV-IKASICCEDRSDLLPDLIKTLKALRLRTLKAE  280

Query  537  MATLGSRMVSLFVVTENEEGNDS------DERREFLASSVHQALRSVLDKFYASE  391
            + TLG R+ ++  +T  E+ N S       E +++  SS+ +AL++V++K    E
Sbjct  281  ITTLGGRVKNVLFITGEEDSNSSGNGDHQGEPQQYSISSIQEALKAVMEKSNGDE  335



>ref|XP_009409645.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+    E 
Sbjct  208  KALAASKSHSEAERRRRERINAHLARLRSLLPSTTKTDKASLLAEVIQHVKELKRQTLEI  267

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT+TDE+ V+  A   +   + + A+LCCD + +LL +L +AL AL L+TL+AE
Sbjct  268  AEESPLPTETDELTVD--ATNDEDGKFLVSATLCCDDRPDLLPDLIKALKALKLRTLKAE  325

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ S+ ++T  E+G+D  ++ + +A S+  AL++V+D+  +++E
Sbjct  326  ITTLGGRIKSMLLIT-GEDGSDHLQQEQSIA-SIQDALKAVMDRTSSADE  373



>ref|XP_008809828.1| PREDICTED: transcription factor bHLH30-like [Phoenix dactylifera]
Length=380

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 121/170 (71%), Gaps = 5/170 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   SE 
Sbjct  192  KALAASKSHSEAERRRRERINAHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSEI  251

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT++DE+ V+  ++  +   + +KASLCCD + +LL +L +AL AL L+TL+AE
Sbjct  252  AEDSPLPTESDELTVDASSD--EDGRFIVKASLCCDDRSDLLPDLIKALKALGLRTLKAE  309

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ ++ V+T     +D+D +++   +S+ +AL++V+++  AS+E
Sbjct  310  ITTLGGRVKNVLVITGE---DDADHQQQQSIASIQEALKAVMERTTASDE  356



>ref|XP_009383631.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=370

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+    E 
Sbjct  181  KALAASKSHSEAERRRRERINTHLARLRSLLPSTTKTDKASLLAEVIQHVKELKRQTLEM  240

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT+TDE+ V+  A   +   + ++ASLCCD + +LL +L +AL  L L+TL+AE
Sbjct  241  AEDSPLPTETDELTVD--ATNDEDGRFLVRASLCCDDRSDLLPDLIKALKVLKLRTLKAE  298

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            +ATLG R+  + V+T  E+G D  +  + +A S+  ALR+V+++  +++E
Sbjct  299  IATLGGRIKHVLVIT-GEDGADHQQPEQSVA-SIQDALRAVMERASSTDE  346



>ref|XP_004291761.1| PREDICTED: transcription factor bHLH106-like [Fragaria vesca 
subsp. vesca]
Length=246

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++A  AL NH EAE+RRRERIN HL  LRSL+P  +K DKA+LL KV+  +KEL+   SE
Sbjct  66   DRAQAALNNHKEAEKRRRERINSHLDKLRSLLPCNSKTDKASLLAKVVERVKELKQQMSE  125

Query  720  ATKGILVPTDTDEVRV--EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             T+    P++ DE+ V    + E  +      KASL C+ + ELL +L + L +L LKTL
Sbjct  126  ITELETFPSEADEITVLCSSEDEYSNNGGIIFKASLSCEDRPELLPDLIEILKSLHLKTL  185

Query  546  RAEMATLGSRMVSLFVVTENEE  481
            +AEMATLG R+ S+ +V  +++
Sbjct  186  KAEMATLGGRIRSVLIVAADKD  207



>ref|XP_004141200.1| PREDICTED: transcription factor bHLH106-like [Cucumis sativus]
 ref|XP_004158358.1| PREDICTED: transcription factor bHLH106-like [Cucumis sativus]
 gb|KGN59724.1| hypothetical protein Csa_3G841480 [Cucumis sativus]
Length=243

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 110/169 (65%), Gaps = 7/169 (4%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            ++AL AL+NH EAE+RRRERIN HL  LR+L+P  +K DKA+LL KV+  +KEL++   E
Sbjct  69   DRALAALKNHKEAEKRRRERINSHLDKLRTLLPCNSKTDKASLLAKVVERVKELKNETLE  128

Query  720  ATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
              +    P++TDE+ V    +  DG     KASLCC+ + +L+ +L   L++L LKTLRA
Sbjct  129  IAELESFPSETDEISVLSGEKSEDG-RLLFKASLCCEDRSDLIPDLNDILNSLHLKTLRA  187

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            ++ T+G R+ ++ ++  N+  + S E   FL +    AL+S++++  +S
Sbjct  188  DIVTVGGRIRNVLLIAAND--HHSVESVHFLQN----ALKSLIERSNSS  230



>ref|XP_011070838.1| PREDICTED: transcription factor bHLH30 [Sesamum indicum]
 ref|XP_011070839.1| PREDICTED: transcription factor bHLH30 [Sesamum indicum]
Length=321

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 117/170 (69%), Gaps = 7/170 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  126  KALAASKSHSEAERRRRERINNHLARLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSQL  185

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  A   DG  + +KAS+CC+ + +LL +L +AL AL LKT++AE
Sbjct  186  AETSPVPTEIDELTVDNYASDEDG-KWVLKASICCEDRPDLLPDLIKALKALRLKTVKAE  244

Query  537  MATLGSRMVSLFVVTENEEGNDS------DERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  EE ++S       E+ ++  +S+ +AL++V++K
Sbjct  245  ITTLGGRVRNVLFITGEEEYSNSWEQEQEQEQEQYSINSIQEALKAVMEK  294



>ref|XP_006362528.1| PREDICTED: transcription factor bHLH30-like [Solanum tuberosum]
Length=312

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 117/186 (63%), Gaps = 23/186 (12%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  105  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  164

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
            ++  LVPT+ DE+ V+      DG  + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  165  SETSLVPTEIDELTVDNATSDEDG-KFLIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  223

Query  537  MATLGSRMVSLFVVTENE-----------------EGNDSD-----ERREFLASSVHQAL  424
            + TLG R+ ++  +T ++                  G+D D     ++ ++  SS+ +AL
Sbjct  224  ITTLGGRVRNVLFITGDDYYCDDSNNNRDHIDPCTSGDDEDTQMMQQQPQYCISSIQEAL  283

Query  423  RSVLDK  406
            ++V++K
Sbjct  284  KAVMEK  289



>ref|XP_010055825.1| PREDICTED: transcription factor bHLH106 [Eucalyptus grandis]
 gb|KCW90027.1| hypothetical protein EUGRSUZ_A02230 [Eucalyptus grandis]
Length=255

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 107/174 (61%), Gaps = 7/174 (4%)
 Frame = -2

Query  912  GVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRS  733
            G   ++ + AL+NH EAE+RRR RIN HL  LRSL+P  +K DKA LL  V+  ++EL+ 
Sbjct  74   GAPEDRTIAALKNHKEAEKRRRARINSHLDKLRSLLPCNSKTDKATLLAMVVQRVRELKQ  133

Query  732  SASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLK  553
             AS+ T   + P+++DE+ V       DG     KASLCC+ + +LL +L + L +L LK
Sbjct  134  QASDITALDMFPSESDEISVLSSDCSSDG-KLIFKASLCCEDRSDLLPDLIEILKSLHLK  192

Query  552  TLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
              +AEMATLG R+ ++ VV  +++   S E   FL      AL+S+L++  ++E
Sbjct  193  VQKAEMATLGGRVRNVLVVAADKD--HSVESIHFL----QNALKSLLERSSSAE  240



>ref|XP_006836269.1| hypothetical protein AMTR_s00101p00150740 [Amborella trichopoda]
 gb|ERM99122.1| hypothetical protein AMTR_s00101p00150740 [Amborella trichopoda]
Length=263

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 102/176 (58%), Gaps = 5/176 (3%)
 Frame = -2

Query  918  QKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKEL  739
            +KG    KA+ ALR+HSEAE+RRRERINGH   LR L+P   K DKA+LL + I  +KEL
Sbjct  67   EKGAVDAKAMAALRSHSEAEKRRRERINGHFDKLRHLLPSNVKRDKASLLAEAIRRLKEL  126

Query  738  RSSASEATKGILVPTDTDEVRVEQQAE-----GCDGASYSIKASLCCDYKHELLSELRQA  574
            +   SE +    +P ++DEV VE   E     G       + AS  CD + +LL EL   
Sbjct  127  KLQTSEISAMGPIPDESDEVTVECSGEFPSDSGKSSGQPVVMASFSCDDRSDLLPELITT  186

Query  573  LDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            L +L LKT+RAE+ TL  RM  +  VT  + G +S +  +  A  + +AL+ V+ +
Sbjct  187  LKSLRLKTIRAEIQTLEGRMRHVLHVTCEDSGQNSLDCGDLTAGMLQEALKQVVHR  242



>ref|XP_003516856.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Glycine 
max]
 ref|XP_006573268.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Glycine 
max]
 ref|XP_006573269.1| PREDICTED: transcription factor bHLH30-like isoform X3 [Glycine 
max]
 ref|XP_006573270.1| PREDICTED: transcription factor bHLH30-like isoform X4 [Glycine 
max]
 gb|KHN24219.1| Transcription factor bHLH30 [Glycine soja]
Length=376

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  175  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  234

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT++DE+ V+   E  DG  + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  235  AETSPVPTESDELTVDAVDE--DG-KFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  291

Query  537  MATLGSRMVSLFVVTENEEGNDSDERR----------EFLASSVHQALRSVLDKFYASEE  388
            + +LG R+ ++ V+T +E+ ++S+             +F  SS+ +AL++V++K    +E
Sbjct  292  ITSLGGRVKNVLVITGDEDNSNSNTHNGEQSMQQQQQQFCISSIQEALKAVMEKSGGGDE  351



>ref|XP_011075449.1| PREDICTED: transcription factor bHLH106 [Sesamum indicum]
Length=238

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            +A  A  NH EAERRRR+RIN HL  LR+L+   +K DKA+LLGKV+  ++EL+   SE 
Sbjct  55   RAFAASENHKEAERRRRQRINAHLHKLRALLLCNSKTDKASLLGKVVERVRELKQQTSEI  114

Query  717  TK---GILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
             +     L+P+++DE+ V Q+ +  DG S  I+AS+CC+ + +L+ EL + L  L L+ L
Sbjct  115  MQLDQTTLIPSESDEIAVMQKHDSMDGKSVVIRASVCCEDRVDLIPELIEILKPLDLRPL  174

Query  546  RAEMATLGSRMVSLFVVT--ENEEGNDS  469
            RAE+ATLG R+ ++  V   EN+  +++
Sbjct  175  RAEIATLGGRIKNVIHVLGGENQTADET  202



>ref|XP_008805006.1| PREDICTED: transcription factor bHLH51-like [Phoenix dactylifera]
Length=247

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 103/174 (59%), Gaps = 19/174 (11%)
 Frame = -2

Query  954  KGELVRALVRP--------GQKGVNPEKA----LIALRNHSEAERRRRERINGHLSTLRS  811
            KG L+R   RP        GQ    P  +     I LR HS+AE+RRRERIN HLSTLR 
Sbjct  25   KGSLLRP--RPSSSAPPFLGQGSFYPSSSEDERAITLRIHSQAEKRRRERINSHLSTLRR  82

Query  810  LIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVE-----QQAEGCDG  646
            +IP   +MDKA+LLG+VI  +K+L+  A +A+   ++PT+ + V VE     Q     + 
Sbjct  83   MIPNPTRMDKASLLGRVIEHVKDLKRKAVDASTISMIPTEANVVTVESDAGYQNTFSLND  142

Query  645  ASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENE  484
             +  IKASLCCD + +L +EL +A   L L+T+R +  +LG R+ ++F++   +
Sbjct  143  DNLYIKASLCCDDRPDLFAELIEAFRRLRLRTIRVDSTSLGGRIRNVFLLCRKD  196



>ref|XP_008792668.1| PREDICTED: transcription factor bHLH51-like [Phoenix dactylifera]
Length=241

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  873  HSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGILVPT  694
            HSEAERRRRERIN HLSTLR +IP  +KMDKA+LLG VI ++K+L+  AS   KG  VPT
Sbjct  68   HSEAERRRRERINAHLSTLRRMIPDADKMDKASLLGSVIEQVKDLKRKASAIGKGFQVPT  127

Query  693  DTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRM  514
            + +EV VE + EG +G  Y I+AS+CC+ + +L ++L QA   L L+T+RA+M +LG R+
Sbjct  128  EVNEVTVECK-EG-NGHLYIIRASICCEDRPDLFTDLIQAFHGLSLRTIRADMTSLGGRV  185

Query  513  VSLFVVTENEEGN  475
             ++F++   +EGN
Sbjct  186  KNVFILYR-KEGN  197



>ref|XP_004496205.1| PREDICTED: transcription factor bHLH30-like [Cicer arietinum]
Length=361

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 113/179 (63%), Gaps = 10/179 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  165  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIEHVKELKRQTSLI  224

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   +      + IKASLCCD + +LL EL + L AL L+TL+A+
Sbjct  225  AETCPVPTECDELTVDAADQEHGNGKFVIKASLCCDDRSDLLPELIKTLKALRLRTLKAD  284

Query  537  MATLGSRMVSLFVVT------ENEEGNDSDERR----EFLASSVHQALRSVLDKFYASE  391
            + TLG R+ ++  +T       +E  N+S+E      ++  +S+ +A R V++K  A +
Sbjct  285  ITTLGGRVKNVLFITGEDDDDHDEYSNNSEEHGHQNLQYCITSIQEAFRGVMEKSLADD  343



>gb|AFK48809.1| unknown [Lotus japonicus]
Length=255

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 106/167 (63%), Gaps = 14/167 (8%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKG-  709
            A ++HS+AE+RRR+RIN  L+TLR LIP ++KMD AALLG V+  +K+L+  A + +K  
Sbjct  71   ASKSHSQAEKRRRDRINAQLATLRKLIPKSDKMDMAALLGSVVDHVKDLKRKAIDVSKAS  130

Query  708  ILVPTDTDEVRVEQQAEGCDGASY---SIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
              +PT+ DEV ++   E  D  SY   + +AS+CCD + EL  EL Q    L LK ++A+
Sbjct  131  STIPTEIDEVTIDYH-EAQDHESYIKNTFRASVCCDDRPELFPELIQVFKGLRLKAVKAD  189

Query  537  MATLGSRMVSLFVVT--ENEEGNDSDERREFLASSVHQALRSVLDKF  403
            M ++G R+ S+ V+   E+EEG+          S++ Q+L+S ++K 
Sbjct  190  MVSVGGRIKSILVLCSKESEEGS-------VCLSTLKQSLKSAVNKI  229



>ref|XP_009356151.1| PREDICTED: transcription factor bHLH30 [Pyrus x bretschneideri]
Length=351

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  154  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  213

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ ++  ++  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  214  AETSPVPTETDELLLDDASD--EDGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  271

Query  537  MATLGSRMVSLFVVTENEEGNDSD------ERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  E+ + S       + +++  SS+ +AL++V++K
Sbjct  272  ITTLGGRVKNVLFITGEEDSSSSGGEQVQMQHQQYCKSSIQEALKAVMEK  321



>ref|XP_006826892.1| hypothetical protein AMTR_s00010p00144270 [Amborella trichopoda]
 gb|ERM94129.1| hypothetical protein AMTR_s00010p00144270 [Amborella trichopoda]
Length=370

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL TLRSL+P T K DKA+LL +VI  +KEL+   +E 
Sbjct  181  KALAASKSHSEAERRRRERINTHLHTLRSLLPNTTKTDKASLLAEVIQHVKELKRQTAEI  240

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             + + +PT+TDE+ V+      +G    IKAS+CC+ + +L  ++ +AL AL L+TL+AE
Sbjct  241  AETMPIPTETDELTVDPDDSYGEG-KLVIKASICCEDRSDLFPDIIKALKALRLRTLKAE  299

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLA-SSVHQALRSVLDKFYASE  391
            + TLG R+ ++ +VT  EEG   ++     + +S+  AL++V+++  + E
Sbjct  300  ITTLGGRIKNVLLVTNEEEGEGREQDSNAPSINSIQDALKAVMERPLSEE  349



>ref|XP_002462365.1| hypothetical protein SORBIDRAFT_02g024460 [Sorghum bicolor]
 gb|EER98886.1| hypothetical protein SORBIDRAFT_02g024460 [Sorghum bicolor]
Length=353

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 112/217 (52%), Gaps = 53/217 (24%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A R+HSEAERRRR+RINGHL+ LRSL+P T K DKA+LL +V+  +KEL+   S  
Sbjct  111  KALAASRSHSEAERRRRQRINGHLARLRSLLPNTTKTDKASLLAEVLDHVKELKRQTSAM  170

Query  717  TKGI-----------------LVPTDTDEVRVEQQAEGCDGAS-YSIKASLCCDYKHELL  592
                                 L+PT+ DE+ V+    G DGA    ++ASLCC+ + +L+
Sbjct  171  MMATAAVGGDDGGAGGRAHQQLLPTEADELSVD---AGADGAGRLVVRASLCCEDRPDLI  227

Query  591  SELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGND--------------------  472
             ++ +AL AL ++  RAE+ TLG R+ SL ++T    G D                    
Sbjct  228  PDIVRALAALGMRARRAEITTLGGRVRSLLLITAGSRGADQAGDGDGDDDDEEEEDGHRP  287

Query  471  ------------SDERREFLASSVHQALRSVLDKFYA  397
                        +  RR    +SV +ALR V+D+  A
Sbjct  288  ANAPVHVDGERTASHRRHECIASVQEALRGVMDRRTA  324



>gb|KDP29359.1| hypothetical protein JCGZ_18280 [Jatropha curcas]
Length=372

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 114/171 (67%), Gaps = 8/171 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  169  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSII  228

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+      DG  + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  229  AETSPVPTEMDELTVDTSESDEDG-KFIIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  287

Query  537  MATLGSRMVSLFVVTENEEG----NDSD---ERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  E+     NDS    + +++  +S+ +AL++V++K
Sbjct  288  ITTLGGRVKNVLFITGEEDSSSNTNDSQNQHQHQQYSITSIQEALKAVMEK  338



>ref|XP_002524402.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF38013.1| DNA binding protein, putative [Ricinus communis]
Length=367

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%), Gaps = 9/170 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  167  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  226

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  227  AETSPVPTEIDELTVDASDE--DG-KFIIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  283

Query  537  MATLGSRMVSLFVVTENEEGN------DSDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  E+ +      D  ++ ++  SS+ +AL++V++K
Sbjct  284  ITTLGGRVKNVLFITGEEDSSSNSNEEDQQQQPQYSISSIQEALKAVMEK  333



>ref|XP_010262767.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
Length=350

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 117/172 (68%), Gaps = 6/172 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  161  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSQI  220

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG    IKASLCC+ + +LL EL + L AL L+T++AE
Sbjct  221  AEVSPVPTEVDELTVDASDE--DG-KLIIKASLCCEDRSDLLPELIKTLKALRLRTVKAE  277

Query  537  MATLGSRMVSLFVVTENEEGNDSD---ERREFLASSVHQALRSVLDKFYASE  391
            + TLG R+ ++  +T  EE  D++   +++++  SS+ +AL++V+++    E
Sbjct  278  ITTLGGRVKNVLFITGEEESKDNEQQQQQQQYTISSIQEALKAVMERTAGDE  329



>ref|XP_006366064.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366065.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Solanum 
tuberosum]
Length=261

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 94/139 (68%), Gaps = 7/139 (5%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE-  721
            KAL A ++HSEAER+RRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  63   KALAASKSHSEAERKRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSQI  122

Query  720  ATKGILVPTDTDEVRVEQQAEGCDG--ASYSIKASLCCDYKHELLSELRQALDALPLKTL  547
            A     +PT+ +E+ V+     C+       IKASLCC+ + +LL +L + L +L LKTL
Sbjct  123  AQTNPPIPTEINELTVDY----CNNEEGILMIKASLCCEDRSDLLHDLIKTLKSLRLKTL  178

Query  546  RAEMATLGSRMVSLFVVTE  490
            +AE+ TLG R+ S+  +T+
Sbjct  179  KAEITTLGGRVRSVLFITK  197



>ref|XP_011021594.1| PREDICTED: transcription factor bHLH30-like [Populus euphratica]
 ref|XP_011021607.1| PREDICTED: transcription factor bHLH30-like [Populus euphratica]
Length=352

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 116/171 (68%), Gaps = 10/171 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  157  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  216

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + +KASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  217  AETSPVPTEMDELTVDTADE--DG-KFVLKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  273

Query  537  MATLGSRMVS-LFVVTENEEGNDSDERR------EFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +  +DS++ +      ++  SS+ +AL+SV++K
Sbjct  274  ITTLGGRVKNVLFIAGEEDSSSDSNDHQQQQQPLQYSISSIQEALKSVMEK  324



>ref|XP_002311433.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE88800.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=352

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 116/171 (68%), Gaps = 10/171 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  157  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  216

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + +KASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  217  AETSPVPTEMDELTVDTADE--DG-KFVLKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  273

Query  537  MATLGSRMVS-LFVVTENEEGNDSDERR------EFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +  +DS++ +      ++  SS+ +AL+SV++K
Sbjct  274  ITTLGGRVKNVLFIAGEEDSSSDSNDHQQQQQPLQYSISSIQEALKSVMEK  324



>emb|CDM81548.1| unnamed protein product [Triticum aestivum]
Length=257

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 4/140 (3%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            AL+ HSEAERRRR RIN HL+ LR +IP T +MDKAALL +V+ ++K L+  A EA +  
Sbjct  66   ALKVHSEAERRRRVRINAHLTALRRMIPDTKQMDKAALLARVVDQVKHLKRRAGEAAQQT  125

Query  705  -LVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMAT  529
              VP +TDEV +E    G D +   +KAS+ CD + +L++ L QAL  L L+T+RAE+ +
Sbjct  126  PAVPPETDEVSIE-FCTGDDDSRLYMKASVSCDDRPDLVAGLIQALHGLRLRTVRAEVTS  184

Query  528  LGSRMVSLFVVT--ENEEGN  475
            LG R+  +F +   E+EEG+
Sbjct  185  LGGRVQHVFTLCKEEDEEGS  204



>gb|EEC83619.1| hypothetical protein OsI_29333 [Oryza sativa Indica Group]
Length=352

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 122/210 (58%), Gaps = 30/210 (14%)
 Frame = -2

Query  951  GELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAAL  772
            G L   L R   K +   KAL A R+HSEAERRRR+RINGHL+ LRSL+P T K DKA+L
Sbjct  106  GTLQAELGRMTAKEIMDAKALAASRSHSEAERRRRQRINGHLARLRSLLPNTTKTDKASL  165

Query  771  LGKVISEIKELRSSASEATKG------------ILVPTDTDEVRVEQQAEGCDGASYSIK  628
            L +VI  +KEL+   S   +             +L+PT+ DE+ V+  A+  +G     +
Sbjct  166  LAEVIEHVKELKRQTSAMMEDGAAGGEAAAAPVVLLPTEDDELEVDAAAD--EGGRLVAR  223

Query  627  ASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEE------GNDSD  466
            ASLCC+ + +L+  + +AL AL L+  RAE+ATLG R+ S+ ++   EE      GND D
Sbjct  224  ASLCCEDRADLIPGIARALAALRLRARRAEIATLGGRVRSVLLIAAVEEEDPDEAGNDDD  283

Query  465  ----------ERREFLASSVHQALRSVLDK  406
                       RR  L +S+H+ALR V+++
Sbjct  284  GEHGYGVAASHRRHELVASIHEALRGVMNR  313



>ref|NP_001061870.1| Os08g0432800 [Oryza sativa Japonica Group]
 dbj|BAD09830.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF23784.1| Os08g0432800 [Oryza sativa Japonica Group]
 dbj|BAG98825.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 122/210 (58%), Gaps = 30/210 (14%)
 Frame = -2

Query  951  GELVRALVRPGQKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAAL  772
            G L   L R   K +   KAL A R+HSEAERRRR+RINGHL+ LRSL+P T K DKA+L
Sbjct  99   GTLQAELGRMTAKEIMDAKALAASRSHSEAERRRRQRINGHLARLRSLLPNTTKTDKASL  158

Query  771  LGKVISEIKELRSSASEATKG------------ILVPTDTDEVRVEQQAEGCDGASYSIK  628
            L +VI  +KEL+   S   +             +L+PT+ DE+ V+  A+  +G     +
Sbjct  159  LAEVIEHVKELKRQTSAMMEDGAAGGEAAAAPVVLLPTEDDELEVDAAAD--EGGRLVAR  216

Query  627  ASLCCDYKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEE------GNDSD  466
            ASLCC+ + +L+  + +AL AL L+  RAE+ATLG R+ S+ ++   EE      GND D
Sbjct  217  ASLCCEDRADLIPGIARALAALRLRARRAEIATLGGRVRSVLLIAAVEEEDPDEAGNDDD  276

Query  465  ----------ERREFLASSVHQALRSVLDK  406
                       RR  L +S+H+ALR V+++
Sbjct  277  GEHGYGVAASHRRHELVASIHEALRGVMNR  306



>ref|XP_008667787.1| PREDICTED: uncharacterized protein LOC100279487 isoform X1 [Zea 
mays]
 tpg|DAA40054.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=348

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 114/217 (53%), Gaps = 52/217 (24%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A R+HSEAERRRR+RINGHL+ LRSL+P T K DKA+LL +V+  +KEL+   S  
Sbjct  106  KALAASRSHSEAERRRRQRINGHLARLRSLLPNTTKTDKASLLAEVLDHVKELKRQTSAM  165

Query  717  ---------------------TKGILVPTDTDEVRVEQQAEGCDGAS-YSIKASLCCDYK  604
                                  +  L+PT+ DE+ V+    G DGA    ++ASLCC+ +
Sbjct  166  MAATDADADADDEGAGRTQAQAQAQLLPTEADELCVD---AGADGAGRLVVRASLCCEDR  222

Query  603  HELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGN-----------------  475
             +L+ ++ +AL AL ++  RAE+ TLG R+ SL ++T +   +                 
Sbjct  223  PDLIPDIVRALAALQMRARRAEITTLGGRVRSLLLITADRRADVQRGGGGGGGDGDDDEE  282

Query  474  ----------DSDERREFLASSVHQALRSVLDKFYAS  394
                       +  RR    +SV +ALR V+D+  AS
Sbjct  283  EEDEEEGGERAASHRRHECIASVQEALRGVMDRRTAS  319



>ref|XP_002971937.1| hypothetical protein SELMODRAFT_412681 [Selaginella moellendorffii]
 ref|XP_002977306.1| hypothetical protein SELMODRAFT_417246 [Selaginella moellendorffii]
 gb|EFJ21310.1| hypothetical protein SELMODRAFT_417246 [Selaginella moellendorffii]
 gb|EFJ26854.1| hypothetical protein SELMODRAFT_412681 [Selaginella moellendorffii]
Length=188

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 112/170 (66%), Gaps = 5/170 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HLSTLR+L+P T K DKA+LL +VI  IKEL+   +E 
Sbjct  18   KALAASKSHSEAERRRRERINKHLSTLRTLLPNTAKTDKASLLAEVIERIKELKQQVAEI  77

Query  717  TKGILVPTDTDEVRVEQQAEGCD-GASYSIKASLCCDYKHELLSELRQALDALPLKTLRA  541
            ++   VP+D DE+ V+      D G    IKAS+CC  +  LL++L + L +L L+T++A
Sbjct  78   SQFGPVPSDADELDVDVMESPVDEGGKVLIKASICCADRPSLLTDLVRTLKSLHLRTVKA  137

Query  540  EMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASE  391
            EMAT+  R  ++FV+T  ++     E  E   + V +AL+SV+++  + E
Sbjct  138  EMATMEGRTKNVFVMTIKDDA----ELLEPTLACVEEALKSVMEEPSSKE  183



>ref|XP_010926474.1| PREDICTED: transcription factor bHLH30-like [Elaeis guineensis]
Length=365

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  918  QKGVNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKEL  739
            Q+ +   KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL
Sbjct  170  QQEIMDAKALAASKSHSEAERRRRERINAHLAKLRSLLPNTTKTDKASLLAEVIQHVKEL  229

Query  738  RSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALP  559
            +    E  +   +PT++DE+ V+  ++  +   + +KASLCCD + +LL +L +AL AL 
Sbjct  230  KRQTLEIAEESPLPTESDELTVDAGSD--EDGRFIVKASLCCDDRSDLLPDLIKALKALR  287

Query  558  LKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            L+TL+AE+ TLG R+ ++ V+T  +   D+D +++   +S+ +AL++V+++  AS+E
Sbjct  288  LRTLKAEITTLGGRVKNVLVITGED---DADHQQQQSIASIQEALKAVMERAAASDE  341



>ref|XP_008782353.1| PREDICTED: transcription factor bHLH30-like [Phoenix dactylifera]
Length=385

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+    E 
Sbjct  193  KALAASKSHSEAERRRRERINAHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTLEI  252

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT++DE+ V+  ++  +   + +KASLCCD + +LL +L +AL AL L+TL+AE
Sbjct  253  AEESPLPTESDELTVDAGSD--EDGRFIVKASLCCDDRSDLLPDLIKALKALRLRTLKAE  310

Query  537  MATLGSRMVSLFVVT-ENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ ++ V+T E++  +   ++++   +S+ +AL++V+++  AS+E
Sbjct  311  ITTLGGRVKNVLVITGEDDADHQQQQQQQQSIASIQEALKAVMERAAASDE  361



>ref|XP_009761018.1| PREDICTED: transcription factor bHLH30-like isoform X2 [Nicotiana 
sylvestris]
Length=313

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 11/175 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  116  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  175

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  176  AETNPVPTEIDELTVDNASDEFEDGKFVIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  235

Query  537  MATLGSRMVSLFVVTENEEGND-----------SDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T +   N              ++ ++  SS+ +AL++V++K
Sbjct  236  ITTLGGRVRNVLFITGDHNYNQEDDLSTSDDLDQQQQPQYSISSIQEALKAVMEK  290



>ref|XP_004238969.1| PREDICTED: transcription factor bHLH30-like [Solanum lycopersicum]
Length=317

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 115/188 (61%), Gaps = 25/188 (13%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  108  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  167

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
            ++  LVPT+ DE+ V+      DG  + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  168  SETSLVPTEIDELTVDNATSDEDG-KFIIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  226

Query  537  MATLGSRMVSLFVVTENE---------------EGNDSDER---------REFLASSVHQ  430
            + TLG R+ ++  +T ++                G+D D            ++  SS+ +
Sbjct  227  ITTLGGRVRNVLFITGDDYYCNNNNNREVDTCISGDDEDTEMMQQQQQQQPQYCISSIQE  286

Query  429  ALRSVLDK  406
            AL++V++K
Sbjct  287  ALKAVMEK  294



>ref|XP_009407785.1| PREDICTED: transcription factor bHLH30-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 109/164 (66%), Gaps = 3/164 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KA  A ++HSEAERRRRERINGHL+ LRS++P T K DKA+LL +VI  +KEL+    E 
Sbjct  144  KAFAASKSHSEAERRRRERINGHLAKLRSMLPNTTKTDKASLLAEVIQHVKELKRQTLEI  203

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT+ DE+ V+   +  D   + ++ASLCCD + +LL +L  AL  L L+ L+AE
Sbjct  204  VEESPLPTEDDELTVDSICD--DDGKFIVRASLCCDDRPDLLPDLTSALKTLKLRILKAE  261

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            + T+G R+ ++ V+TE    +  D+ +E +A ++  AL+ V+++
Sbjct  262  ITTVGGRVKNVLVITEEHNASGYDDEQELVA-AIEDALKGVVEQ  304



>ref|XP_004968636.1| PREDICTED: transcription factor bHLH30-like [Setaria italica]
Length=276

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 114/181 (63%), Gaps = 10/181 (6%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            EK  +AL++HSEAERRRRERIN HL+TLR+++P T+KM+KAALL +VI+ +K+L++SA+ 
Sbjct  74   EKVAMALKSHSEAERRRRERINAHLATLRTMVPCTDKMEKAALLAEVITHVKKLKASAAR  133

Query  720  ATKGILVPTDTDEVRVE---------QQAEGCDGASYSIKASLCCDYKHELLSELRQALD  568
                  VP D D+V VE           +    G  + +KA+L CD   ++ ++++ AL 
Sbjct  134  IRTHCAVPADADDVAVELVVPDAAPPSPSHHGAGGGFLVKATLSCDDGADVFADIKSALR  193

Query  567  ALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
             L L+ + +E+ TLG R+   F+V+    G    + R  +A SV  AL+SVLDK  ++ E
Sbjct  194  PLRLRVVGSEVTTLGGRVRFTFLVSPPPCGAPGGDVRG-VAESVRHALQSVLDKANSALE  252

Query  387  F  385
            F
Sbjct  253  F  253



>ref|XP_009775277.1| PREDICTED: transcription factor bHLH30-like [Nicotiana sylvestris]
Length=234

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A + HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  85   KALAASKGHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  144

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  145  VETNPVPTEIDELTVDNVSDEFEDGKFVIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  204

Query  537  MATLGSRMVSLFVVTENEEGNDSDE  463
            + TLG R+ ++  +T +   N  D+
Sbjct  205  ITTLGGRVRNVLFITGDHNYNQEDD  229



>ref|XP_009761017.1| PREDICTED: transcription factor bHLH30-like isoform X1 [Nicotiana 
sylvestris]
Length=354

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 11/175 (6%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  157  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  216

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  217  AETNPVPTEIDELTVDNASDEFEDGKFVIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  276

Query  537  MATLGSRMVSLFVVTENEEGND-----------SDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T +   N              ++ ++  SS+ +AL++V++K
Sbjct  277  ITTLGGRVRNVLFITGDHNYNQEDDLSTSDDLDQQQQPQYSISSIQEALKAVMEK  331



>ref|XP_010093397.1| hypothetical protein L484_022960 [Morus notabilis]
 gb|EXB53991.1| hypothetical protein L484_022960 [Morus notabilis]
Length=351

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 115/177 (65%), Gaps = 15/177 (8%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  151  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  210

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +L+ +L + L AL L+TL+AE
Sbjct  211  AETSPVPTEMDELTVDDASD--EEGRFVIKASLCCEDRSDLIPDLIKTLKALRLRTLKAE  268

Query  537  MATLGSRMVSLFVVTENEEGNDSDERR-------------EFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T +E+ +  DE +             ++  SS+ +AL++V++K
Sbjct  269  ITTLGGRVKNVLFITGDEDSSSGDEDQQGDHDHDHHNQQAQYCISSIQEALKAVIEK  325



>ref|XP_010916515.1| PREDICTED: transcription factor bHLH30-like [Elaeis guineensis]
Length=388

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   SE 
Sbjct  193  KALAASKSHSEAERRRRERINAHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSEI  252

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   +PT++DE+ V+  ++  +   + +KASLCCD + +LL +L +AL AL L+TL+AE
Sbjct  253  AEDSPLPTESDELTVDASSD--EDGRFIVKASLCCDDRSDLLPDLIKALKALRLRTLKAE  310

Query  537  MATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYASEE  388
            + TLG R+ ++ V+T  ++ +   +++    +S+ +AL++V+++  AS+E
Sbjct  311  ITTLGGRVKNVLVITGEDDADHQQQQQS--IASIQEALKAVMERTTASDE  358



>gb|KHF97366.1| Transcription factor bHLH30 -like protein [Gossypium arboreum]
Length=332

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 113/165 (68%), Gaps = 5/165 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KA+ A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+      
Sbjct  143  KAMAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTCLI  202

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+   +  DG  + IKASLCC+ + +LL +L +AL  L LKTL+AE
Sbjct  203  AETSPVPTETDELTVDTSDQ--DG-KFVIKASLCCEDRSDLLPDLIKALKDLRLKTLKAE  259

Query  537  MATLGSRMVS-LFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +E + S +  + +  S+ +AL++V++K
Sbjct  260  ITTLGGRVKNVLFITGEEQESSCSSDGGDVIG-SIQEALKAVMEK  303



>gb|KFK34915.1| hypothetical protein AALP_AA5G210100 [Arabis alpina]
Length=187

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 7/149 (5%)
 Frame = -2

Query  909  VNPEKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSS  730
            ++ +KAL ALRNH EAER+RR RIN HLS LR+L+P  +K DKA LL KV+  +KEL+  
Sbjct  41   ISQDKALAALRNHKEAERKRRARINSHLSMLRNLLPCNSKTDKATLLAKVVQRVKELKQQ  100

Query  729  ASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKT  550
              E +   L P++TDE  V       D      K   CC+ + +L+ +L + L +L +KT
Sbjct  101  TLELSNESL-PSETDEFSV----LNFDNGRTIFKVLFCCEDRPDLMQDLVETLKSLKMKT  155

Query  549  LRAEMATLGSRMVSLFVVTENEE--GNDS  469
            L A+M+T+G R  ++ +V  ++E  G+DS
Sbjct  156  LYADMSTIGGRTRNVLIVAADKEHHGDDS  184



>ref|XP_010265276.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
 ref|XP_010265277.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
 ref|XP_010265278.1| PREDICTED: transcription factor bHLH30-like [Nelumbo nucifera]
Length=341

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 113/166 (68%), Gaps = 5/166 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S+ 
Sbjct  155  KALAASKSHSEAERRRRERINTHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSQI  214

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + IKASLCC+ + +LL EL + L AL L+TL+AE
Sbjct  215  AEASPVPTEVDELTVDASDE--DG-KFIIKASLCCEDRSDLLPELIKTLKALRLRTLKAE  271

Query  537  MATLGSRMVSLFVVTENEEGN--DSDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  EE    +  + +++  S + +AL++V+++
Sbjct  272  ITTLGGRVKNVLFITGEEEPKNNEQQQNQQYSISMIQEALKAVMER  317



>gb|AGO06019.1| bHLH transcription factor [Gossypium hirsutum]
Length=332

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 113/165 (68%), Gaps = 5/165 (3%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KA+ A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+      
Sbjct  143  KAMAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTCLI  202

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+TDE+ V+   +  DG  + IKASLCC+ + +LL +L +AL  L LKTL+AE
Sbjct  203  AETSPVPTETDELTVDTSDQ--DG-KFVIKASLCCEDRSDLLPDLIKALKDLRLKTLKAE  259

Query  537  MATLGSRMVS-LFVVTENEEGNDSDERREFLASSVHQALRSVLDK  406
            + TLG R+ + LF+  E +E + S +  + +  S+ +AL++V++K
Sbjct  260  ITTLGGRVKNVLFITGEEQESSCSSDGGDVIG-SIQEALKAVMEK  303



>ref|XP_009632043.1| PREDICTED: transcription factor bHLH51-like [Nicotiana tomentosiformis]
Length=243

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = -2

Query  885  ALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI  706
            A R+HSEAE+RRR+RIN  LSTLR LIP + KMDKAALL  V+  +K+L+  A E +K +
Sbjct  66   ASRSHSEAEKRRRDRINAQLSTLRKLIPMSEKMDKAALLRSVVEHVKDLKERAKEISKVV  125

Query  705  LVPTDTDEVRVEQQAEGCDGASYSI--KASLCCDYKHELLSELRQALDALPLKTLRAEMA  532
              PTD DEV +E   E  + +S SI  K  L CD + EL SEL +AL  L L T  A + 
Sbjct  126  NTPTDIDEVIIEHLDED-ENSSNSIILKVCLSCDDRPELFSELNRALKNLKLTTEEANIT  184

Query  531  TLGSRMVSLFVV  496
            +LG R+  +FV+
Sbjct  185  SLGVRIKCVFVL  196



>gb|KHG06567.1| Transcription factor bHLH30 -like protein [Gossypium arboreum]
Length=345

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 113/173 (65%), Gaps = 7/173 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  155  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  214

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + IKASLCC+ + +LL +L + L AL LKTL+AE
Sbjct  215  AETSPVPTEIDELTVDTSEE--DG-KFVIKASLCCEDRSDLLPDLIKTLKALRLKTLKAE  271

Query  537  MATLGSRMVSLFVVTENEE----GNDSDERREFLASSVHQALRSVLDKFYASE  391
            + TLG R+ ++  +T  E+         ++ ++  SS+ +AL++V++K    E
Sbjct  272  ITTLGGRVKNVLFITGEEDSSSSAEQQQQQLQYCISSIQEALKAVMEKTSVDE  324



>ref|XP_002311240.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE88607.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=259

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KA    ++HS+AE+RRR+RIN  L  LR LIP + KMDKAALLG  I  +K+L+  A+E 
Sbjct  63   KAASNSKSHSQAEKRRRDRINAQLGILRKLIPKSEKMDKAALLGSAIDHVKDLKQKATEI  122

Query  717  TKGILVPTDTDEVRVE--------QQAEGCDGASYSIKASLCCDYKHELLSELRQALDAL  562
            ++   +PT+ DEV V+          +   D  S  I+AS+CCD + EL SEL + L  L
Sbjct  123  SRTFTIPTEVDEVTVDCDVSQATNPSSTNKDKDSTFIRASVCCDDRPELFSELIRVLRGL  182

Query  561  PLKTLRAEMATLGSRMVSLFVVTE--NEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
             L  +RA++A++G R+ S+ V+    ++EG  S        S++ Q+L  VL +  +S
Sbjct  183  RLTIVRADIASVGGRVKSILVLCNKCSKEGGVS-------ISTIKQSLNLVLSRIASS  233



>ref|XP_007224260.1| hypothetical protein PRUPE_ppa019406mg [Prunus persica]
 gb|EMJ25459.1| hypothetical protein PRUPE_ppa019406mg [Prunus persica]
Length=357

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 115/177 (65%), Gaps = 15/177 (8%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  158  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  217

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +LL +L + L AL L+TL+AE
Sbjct  218  AETSPVPTEMDELIVDDASD--EDGKFVIKASLCCEDRSDLLPDLIKTLKALRLRTLKAE  275

Query  537  MATLGSRMVSLFVVTENEEGNDS-------------DERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T  E+ + S              +++++  SS+ +AL++V++K
Sbjct  276  ITTLGGRVKNVLFITGEEDSSSSGGEQEQQHQVPHEHQQQQYCISSIEEALKAVMEK  332



>ref|XP_007143790.1| hypothetical protein PHAVU_007G101900g [Phaseolus vulgaris]
 gb|ESW15784.1| hypothetical protein PHAVU_007G101900g [Phaseolus vulgaris]
Length=338

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 115/174 (66%), Gaps = 7/174 (4%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  150  KALAASKSHSEAERRRRERINNHLAKLRSLLPSTTKTDKASLLAEVIQHVKELKRQTSLI  209

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V  +A+  DG S  IKASLCC+ + +L  EL   L AL L+TL+AE
Sbjct  210  AESSPVPTEADELTVVDEADE-DGKSV-IKASLCCEDRSDLFPELIGTLKALRLRTLKAE  267

Query  537  MATLGSRMVSLFVVTENEEGNDS-----DERREFLASSVHQALRSVLDKFYASE  391
            + TLG R+ ++  +T  EE + S     + ++++  SS+ +AL++V++K    E
Sbjct  268  ITTLGGRVKNVLFITGEEEDSSSGSEDHNHQQQYCISSIQEALKAVMEKSVGDE  321



>ref|XP_009614307.1| PREDICTED: transcription factor bHLH30-like [Nicotiana tomentosiformis]
Length=313

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 111/176 (63%), Gaps = 12/176 (7%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  115  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSLI  174

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+  ++  +   + IKASLCC+ + +LL +L + L  L LKTL+AE
Sbjct  175  AETSPVPTEIDELTVDNASDEFEDGKFVIKASLCCEDRSDLLPDLIKTLKTLRLKTLKAE  234

Query  537  MATLGSRMVSLFVVTENEEGND------------SDERREFLASSVHQALRSVLDK  406
            + TLG R+ ++  +T +   N               ++ ++  SS+ +AL++V++K
Sbjct  235  ITTLGGRVRNVLFITGDHNYNQEDDLSTSDDLDLQQQQPQYSISSIQEALKAVMEK  290



>ref|XP_010031188.1| PREDICTED: transcription factor bHLH51 [Eucalyptus grandis]
 gb|KCW50450.1| hypothetical protein EUGRSUZ_J00190 [Eucalyptus grandis]
Length=269

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -2

Query  867  EAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEATKGI-LVPTD  691
            +AE+RRR+RIN  L+TLR LIP + KMDKAALL  VI  +K+L+  ASE +K I ++P++
Sbjct  81   QAEKRRRDRINAQLATLRKLIPKSEKMDKAALLASVIDHVKDLKRKASEISKSITILPSE  140

Query  690  TDEVRV-----EQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAEMATL  526
             DEV +     E    G D  +  I+ S+CCD + ELLSEL + +  L L T++A++A++
Sbjct  141  VDEVIIDCEDPELNKGGNDSGAVLIRVSICCDDRPELLSELTRVIKGLKLTTVKADVASV  200

Query  525  GSRMVSLFVVTENEEGNDSDERREFLASSVHQALRSVLDKFYAS  394
            G R+ S+ ++  +         R    SS+ Q+L+ V+ +   S
Sbjct  201  GGRIKSVLILCGDTADGGGGGDRGACLSSLKQSLKVVVSRIACS  244



>gb|KEH36579.1| transcription factor [Medicago truncatula]
Length=158

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = -2

Query  789  MDKAALLGKVISEIKELRSSASEATKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCD  610
            MDKA LL +VI ++K L+ +A EA+KG  +PTD DEV+VE      +G S+  KAS+ CD
Sbjct  1    MDKATLLAEVIRQVKHLKKNADEASKGYSIPTDDDEVKVEPYE---NGGSFLYKASISCD  57

Query  609  YKHELLSELRQALDALPLKTLRAEMATLGSRMVSLFVVTENEEGNDSDERREFLASSVHQ  430
            Y+ ELLS+LRQ LD L L+ +R E++TLG R+ + FV T  +      E    +AS+VHQ
Sbjct  58   YRPELLSDLRQTLDKLQLQLVREEISTLGDRVKNEFVYTCCKVDIYDIELCPLIASNVHQ  117

Query  429  ALRSVLDKFYASEEF  385
            AL SVL++   S ++
Sbjct  118  ALSSVLERASTSMDY  132



>ref|XP_007153337.1| hypothetical protein PHAVU_003G026800g [Phaseolus vulgaris]
 ref|XP_007153338.1| hypothetical protein PHAVU_003G026800g [Phaseolus vulgaris]
 gb|ESW25331.1| hypothetical protein PHAVU_003G026800g [Phaseolus vulgaris]
 gb|ESW25332.1| hypothetical protein PHAVU_003G026800g [Phaseolus vulgaris]
Length=360

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 117/179 (65%), Gaps = 12/179 (7%)
 Frame = -2

Query  897  KALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASEA  718
            KAL A ++HSEAERRRRERIN HL+ LRSL+P T K DKA+LL +VI  +KEL+   S  
Sbjct  163  KALAASKSHSEAERRRRERINNHLAKLRSLLPNTTKTDKASLLAEVIQHVKELKRQTSHI  222

Query  717  TKGILVPTDTDEVRVEQQAEGCDGASYSIKASLCCDYKHELLSELRQALDALPLKTLRAE  538
             +   VPT+ DE+ V+   E  DG  + IKAS+CC+ + +LL +L + L AL L+TL+AE
Sbjct  223  AETSAVPTEADELTVDAANE--DG-KFVIKASMCCEDRSDLLPDLIKTLKALKLRTLKAE  279

Query  537  MATLGSRMVSLFVVTENEEGNDSDER---------REFLASSVHQALRSVLDKFYASEE  388
            + ++G R+ ++ V+  +E   +++E          R++  +S+ + L++V++K  A +E
Sbjct  280  ITSVGGRVKNVLVIAGDEGTPNTNEEQSMQQQQQQRQYCITSIQETLKAVMEKTAAGDE  338



>ref|XP_002457128.1| hypothetical protein SORBIDRAFT_03g001730 [Sorghum bicolor]
 gb|EES02248.1| hypothetical protein SORBIDRAFT_03g001730 [Sorghum bicolor]
Length=270

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 115/178 (65%), Gaps = 6/178 (3%)
 Frame = -2

Query  900  EKALIALRNHSEAERRRRERINGHLSTLRSLIPGTNKMDKAALLGKVISEIKELRSSASE  721
            +KA +AL+NHSEAERRRRERIN HL+TLR+++P ++KMDKAALL +VI+ +++L+++A+ 
Sbjct  70   DKAAMALKNHSEAERRRRERINAHLATLRTMVPCSDKMDKAALLAEVITHVQKLKATAAR  129

Query  720  ATKGILVPTDTDEVRVE--QQA-EGCDGASYSIKASLCCDYKHELLSELRQALDALPLKT  550
                  VP D D+V VE  Q A     G    ++A+L CD   ++ ++++QAL  L L  
Sbjct  130  IRDHCAVPADADDVAVELVQGAPPSTTGGGVLVRATLSCDDGADVFADVKQALRPLRLSV  189

Query  549  LRAEMATLGSRMVSLFVVTENEEGNDSDERRE---FLASSVHQALRSVLDKFYASEEF  385
            + +E+ TLG R+   F++  +     +    +    +  SVHQAL+SVLD+  ++ EF
Sbjct  190  VGSEVTTLGGRVRFTFLIMSSSSSCGNGSGGDVGAVVVESVHQALQSVLDRANSALEF  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3887636564718