BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15235_g2_i1 len=905 path=[1157:0-904]

Length=905
                                                                      Score     E

ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           258   1e-81   
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           257   3e-81   
gb|ADB11327.1|  tau class glutathione transferase GSTU45                248   6e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      248   7e-78   
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      248   1e-77   
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      245   1e-76   
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      245   1e-76   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       241   2e-75   
emb|CDP06553.1|  unnamed protein product                                241   5e-75   
ref|XP_008370016.1|  PREDICTED: glutathione S-transferase U8-like       240   1e-74   
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       239   2e-74   
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    239   3e-74   
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      238   6e-74   Vitis vinifera
ref|XP_009378880.1|  PREDICTED: probable glutathione S-transferase      238   6e-74   
ref|XP_010039176.1|  PREDICTED: probable glutathione S-transferase      238   7e-74   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      237   2e-73   
ref|XP_003529121.1|  PREDICTED: probable glutathione S-transferas...    236   3e-73   
ref|XP_008370015.1|  PREDICTED: probable glutathione S-transferase      236   3e-73   
ref|XP_007026866.1|  Tau class glutathione transferase GSTU45           236   5e-73   
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      236   6e-73   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       235   7e-73   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    235   9e-73   
ref|XP_006429233.1|  hypothetical protein CICLE_v10012710mg             235   1e-72   
gb|AEB77869.1|  glutathione S-transferase protein                       235   1e-72   
gb|KHN05113.1|  Putative glutathione S-transferase                      234   1e-72   
ref|NP_001238659.1|  glutathione S-transferase GST 7                    234   2e-72   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    234   4e-72   
gb|AEB77872.1|  glutathione S-transferase protein                       232   1e-71   
ref|XP_010039179.1|  PREDICTED: glutathione S-transferase U8-like       232   1e-71   
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    231   2e-71   
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                231   3e-71   
gb|KHN05121.1|  Putative glutathione S-transferase                      231   3e-71   
ref|XP_010039180.1|  PREDICTED: glutathione S-transferase U8-like       232   6e-71   
ref|XP_008370017.1|  PREDICTED: probable glutathione S-transferase      230   6e-71   
ref|XP_009378879.1|  PREDICTED: probable glutathione S-transferase      230   9e-71   
ref|XP_004302690.1|  PREDICTED: probable glutathione S-transferas...    229   1e-70   
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       229   1e-70   
ref|XP_010684665.1|  PREDICTED: glutathione S-transferase U8-like       229   2e-70   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      229   3e-70   
ref|XP_009596758.1|  PREDICTED: probable glutathione S-transferase      229   3e-70   
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      228   4e-70   
gb|AFK47124.1|  unknown                                                 228   5e-70   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             227   1e-69   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               226   2e-69   
ref|XP_007207190.1|  hypothetical protein PRUPE_ppa017086mg             227   2e-69   
gb|AGV54744.1|  glutathione transferase                                 226   2e-69   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      226   3e-69   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                226   3e-69   
gb|KHN06986.1|  Putative glutathione S-transferase                      226   4e-69   
gb|AFK40836.1|  unknown                                                 225   5e-69   
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              225   6e-69   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   225   7e-69   
gb|AFS51729.1|  tau class glutathione S-transferase                     225   8e-69   
ref|NP_001238721.1|  glutathione S-transferase GST 13                   224   1e-68   
ref|XP_010039177.1|  PREDICTED: glutathione S-transferase U8-like       225   1e-68   
gb|AAO69664.1|  glutathione S-transferase                               224   1e-68   Phaseolus acutifolius
gb|AFK43265.1|  unknown                                                 224   1e-68   
gb|KHN05118.1|  Putative glutathione S-transferase                      224   2e-68   
emb|CDP06552.1|  unnamed protein product                                224   2e-68   
ref|NP_001234082.1|  uncharacterized protein LOC543813                  224   2e-68   
ref|NP_001238439.1|  probable glutathione S-transferase                 224   2e-68   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               224   2e-68   
gb|ABW69659.2|  glutathione S-transferase                               224   3e-68   Gossypium hirsutum [American cotton]
gb|ADD71974.1|  glutathione S-transferase                               223   3e-68   
ref|XP_008240078.1|  PREDICTED: probable glutathione S-transferase      224   3e-68   
gb|KHN25840.1|  Putative glutathione S-transferase                      223   3e-68   
ref|XP_002520478.1|  glutathione s-transferase, putative                223   3e-68   Ricinus communis
gb|AFK45620.1|  unknown                                                 223   4e-68   
ref|XP_009776230.1|  PREDICTED: probable glutathione S-transferase      223   6e-68   
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   223   6e-68   
ref|XP_010101874.1|  putative glutathione S-transferase                 222   6e-68   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                223   6e-68   
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       223   7e-68   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             223   7e-68   
gb|KEH28979.1|  glutathione S-transferase, amino-terminal domain ...    222   7e-68   
ref|XP_006576598.1|  PREDICTED: probable glutathione S-transferas...    222   1e-67   
ref|NP_001238675.1|  glutathione S-transferase GST 8                    222   1e-67   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   222   1e-67   
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       222   1e-67   
gb|KHG28543.1|  Glutathione S-transferase U8 -like protein              221   2e-67   
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             221   3e-67   
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    221   3e-67   
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    221   3e-67   
ref|XP_003623208.1|  Glutathione S-transferase GST                      221   3e-67   
gb|KHN47446.1|  Putative glutathione S-transferase                      221   4e-67   
gb|KHN05112.1|  Putative glutathione S-transferase                      221   4e-67   
gb|ACU15816.1|  unknown                                                 221   4e-67   Glycine max [soybeans]
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       221   4e-67   
ref|XP_007140455.1|  hypothetical protein PHAVU_008G113700g             220   5e-67   
ref|NP_001237856.1|  uncharacterized protein LOC100500680               220   5e-67   
ref|XP_011077664.1|  PREDICTED: probable glutathione S-transferase      221   8e-67   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       220   8e-67   
gb|AFK49084.1|  unknown                                                 219   1e-66   
ref|XP_009591433.1|  PREDICTED: glutathione S-transferase U8-like       219   1e-66   
gb|ACU24385.1|  unknown                                                 219   1e-66   Glycine max [soybeans]
emb|CAN62219.1|  hypothetical protein VITISV_042912                     219   1e-66   Vitis vinifera
ref|XP_004492380.1|  PREDICTED: probable glutathione S-transferas...    218   3e-66   
ref|NP_187538.1|  glutathione S-transferase TAU 8                       218   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ86006.1|  unknown                                                 218   4e-66   Medicago truncatula
gb|AFK47387.1|  unknown                                                 218   4e-66   
ref|XP_007134772.1|  hypothetical protein PHAVU_010G074600g             218   5e-66   
ref|XP_006366496.1|  PREDICTED: probable glutathione S-transferas...    217   7e-66   
ref|XP_009789711.1|  PREDICTED: probable glutathione S-transferase      217   7e-66   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g             217   8e-66   
ref|XP_008240102.1|  PREDICTED: glutathione S-transferase U8-like       217   8e-66   
gb|AAA87183.1|  auxin-induced protein                                   218   8e-66   Vigna radiata [mung bean]
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      217   9e-66   
gb|AIS71913.1|  hypothetical protein                                    217   1e-65   
ref|XP_003623174.1|  hypothetical protein MTR_7g065290                  217   1e-65   
ref|XP_010027076.1|  PREDICTED: probable glutathione S-transferase      217   1e-65   
ref|XP_010024690.1|  PREDICTED: probable glutathione S-transferase      217   1e-65   
ref|XP_006407694.1|  hypothetical protein EUTSA_v10021472mg             217   1e-65   
gb|KCW61132.1|  hypothetical protein EUGRSUZ_H03905                     217   1e-65   
ref|XP_006572808.1|  PREDICTED: uncharacterized protein LOC100306...    217   1e-65   
ref|XP_002520474.1|  glutathione s-transferase, putative                216   2e-65   Ricinus communis
ref|XP_009618409.1|  PREDICTED: probable glutathione S-transferase      215   4e-65   
ref|XP_009613724.1|  PREDICTED: probable glutathione S-transferase      215   5e-65   
ref|XP_002884725.1|  predicted protein                                  215   6e-65   
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      215   6e-65   
ref|XP_010101873.1|  putative glutathione S-transferase                 214   9e-65   
ref|XP_009625219.1|  PREDICTED: probable glutathione S-transferase      214   9e-65   
ref|XP_010693980.1|  PREDICTED: probable glutathione S-transferase      214   1e-64   
ref|XP_008240089.1|  PREDICTED: glutathione S-transferase U8-like       214   2e-64   
ref|XP_003623196.1|  Glutathione S-transferase                          214   2e-64   
ref|XP_003623211.1|  Glutathione S-transferase GST                      214   2e-64   
emb|CAN73675.1|  hypothetical protein VITISV_001110                     213   2e-64   Vitis vinifera
ref|XP_004507184.1|  PREDICTED: probable glutathione S-transferas...    212   6e-64   
ref|XP_009767205.1|  PREDICTED: probable glutathione S-transferase      213   6e-64   
ref|XP_003623210.1|  Glutathione S-transferase GST                      212   7e-64   
ref|XP_009788521.1|  PREDICTED: probable glutathione S-transferase      212   8e-64   
ref|XP_003623195.1|  Glutathione S-transferase GST                      212   8e-64   
ref|XP_009123411.1|  PREDICTED: glutathione S-transferase U8            212   9e-64   
ref|XP_002520472.1|  glutathione s-transferase, putative                212   1e-63   Ricinus communis
ref|NP_001237841.1|  uncharacterized protein LOC100306119               212   1e-63   
ref|XP_010486488.1|  PREDICTED: glutathione S-transferase U8-like       212   1e-63   
gb|KEH23050.1|  glutathione S-transferase, amino-terminal domain ...    212   1e-63   
ref|XP_010464567.1|  PREDICTED: glutathione S-transferase U8            212   1e-63   
ref|NP_001234086.1|  uncharacterized protein LOC543814                  211   2e-63   
ref|XP_004246388.1|  PREDICTED: probable glutathione S-transferase      211   2e-63   
ref|XP_004147912.1|  PREDICTED: probable glutathione S-transferas...    211   2e-63   
ref|XP_002283736.1|  PREDICTED: probable glutathione S-transferase      211   2e-63   Vitis vinifera
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            211   2e-63   Vitis vinifera
emb|CDY22184.1|  BnaC01g39170D                                          211   3e-63   
emb|CBI16040.3|  unnamed protein product                                214   4e-63   
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             210   4e-63   
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            210   4e-63   Vitis vinifera
ref|XP_010696150.1|  PREDICTED: glutathione S-transferase U8-like       210   4e-63   
ref|XP_004157054.1|  PREDICTED: probable glutathione S-transferas...    210   5e-63   
ref|XP_009626799.1|  PREDICTED: probable glutathione S-transferas...    209   5e-63   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            209   9e-63   Vitis vinifera
ref|XP_003623173.1|  hypothetical protein MTR_7g065270                  209   1e-62   
ref|XP_004507183.1|  PREDICTED: probable glutathione S-transferas...    209   1e-62   
ref|XP_004492379.1|  PREDICTED: probable glutathione S-transferas...    209   1e-62   
ref|XP_006357580.1|  PREDICTED: glutathione S-transferase U8-like       209   2e-62   
ref|XP_003623202.1|  Glutathione S-transferase GST                      209   2e-62   
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like       208   2e-62   
gb|AES79420.2|  glutathione S-transferase, amino-terminal domain ...    208   2e-62   
ref|XP_004166786.1|  PREDICTED: probable glutathione S-transferas...    208   2e-62   
gb|AFK44026.1|  unknown                                                 208   3e-62   
ref|XP_010101872.1|  putative glutathione S-transferase                 207   3e-62   
gb|KDO57979.1|  hypothetical protein CISIN_1g027827mg                   207   4e-62   
ref|XP_004249548.1|  PREDICTED: probable glutathione S-transferase      207   5e-62   
ref|XP_006429234.1|  hypothetical protein CICLE_v10012717mg             207   6e-62   
gb|AFK37419.1|  unknown                                                 207   6e-62   
ref|XP_009606316.1|  PREDICTED: probable glutathione S-transferase      207   7e-62   
ref|XP_009626798.1|  PREDICTED: probable glutathione S-transferas...    207   7e-62   
emb|CAN73674.1|  hypothetical protein VITISV_001109                     211   8e-62   Vitis vinifera
ref|XP_008448766.1|  PREDICTED: probable glutathione S-transferase      207   9e-62   
ref|XP_002532525.1|  glutathione s-transferase, putative                207   9e-62   Ricinus communis
ref|XP_010674216.1|  PREDICTED: glutathione S-transferase U8-like       207   9e-62   
ref|XP_008448631.1|  PREDICTED: glutathione S-transferase U8-like       207   1e-61   
ref|XP_006339006.1|  PREDICTED: probable glutathione S-transferas...    206   1e-61   
ref|XP_009629347.1|  PREDICTED: probable glutathione S-transferase      206   1e-61   
ref|XP_010650966.1|  PREDICTED: glutathione S-transferase U8            206   2e-61   
gb|KGN54330.1|  hypothetical protein Csa_4G304760                       206   2e-61   
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      206   2e-61   Vitis vinifera
ref|XP_009802971.1|  PREDICTED: probable glutathione S-transferase      206   2e-61   
gb|AFK36747.1|  unknown                                                 206   2e-61   
ref|XP_004147931.1|  PREDICTED: probable glutathione S-transferas...    206   2e-61   
ref|XP_004492376.1|  PREDICTED: probable glutathione S-transferas...    206   3e-61   
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    212   3e-61   Vitis vinifera
ref|XP_008359780.1|  PREDICTED: probable glutathione S-transferase      205   4e-61   
ref|XP_006367676.1|  PREDICTED: probable glutathione S-transferas...    205   4e-61   
ref|XP_009787286.1|  PREDICTED: glutathione S-transferase U8-like       205   4e-61   
ref|XP_009768031.1|  PREDICTED: probable glutathione S-transferase      205   4e-61   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     204   6e-61   Vitis vinifera
ref|NP_001238643.1|  glutathione S-transferase GST 6                    204   6e-61   
ref|XP_010325822.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    204   6e-61   
gb|ACU15611.1|  unknown                                                 204   9e-61   Glycine max [soybeans]
ref|XP_002520477.1|  glutathione s-transferase, putative                204   1e-60   Ricinus communis
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     204   1e-60   
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      204   1e-60   Vitis vinifera
ref|XP_009767206.1|  PREDICTED: probable glutathione S-transferase      204   1e-60   
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          205   1e-60   
emb|CBI16039.3|  unnamed protein product                                206   1e-60   
ref|XP_002520476.1|  glutathione s-transferase, putative                204   2e-60   Ricinus communis
gb|KHN05114.1|  Putative glutathione S-transferase                      203   2e-60   
gb|KDP34500.1|  hypothetical protein JCGZ_11050                         203   2e-60   
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840          203   2e-60   
ref|XP_004246383.1|  PREDICTED: probable glutathione S-transferase      203   2e-60   
ref|XP_006849226.1|  hypothetical protein AMTR_s00027p00230760          203   2e-60   
ref|XP_009399930.1|  PREDICTED: probable glutathione S-transferase      203   2e-60   
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      203   2e-60   
ref|XP_006367664.1|  PREDICTED: probable glutathione S-transferas...    203   2e-60   
ref|XP_006298410.1|  hypothetical protein CARUB_v10014479mg             204   3e-60   
ref|XP_006367677.1|  PREDICTED: probable glutathione S-transferas...    202   4e-60   
gb|KDP42181.1|  hypothetical protein JCGZ_02911                         202   5e-60   
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    202   8e-60   
gb|AGH14251.1|  glutathione S-transferase                               201   1e-59   
ref|XP_006360613.1|  PREDICTED: probable glutathione S-transferas...    201   1e-59   
ref|XP_008448643.1|  PREDICTED: probable glutathione S-transferas...    201   1e-59   
ref|XP_004302691.1|  PREDICTED: glutathione S-transferase U8-like       201   1e-59   
gb|ABD83308.1|  Fgenesh protein 133                                     201   1e-59   Beta vulgaris [beet]
ref|XP_002520473.1|  glutathione s-transferase, putative                202   1e-59   Ricinus communis
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      201   1e-59   
ref|XP_004246379.1|  PREDICTED: probable glutathione S-transferase      201   1e-59   
ref|XP_004147913.1|  PREDICTED: glutathione S-transferase U8-like       201   1e-59   
ref|NP_001234778.1|  glutathione S-transferase-like protein             201   2e-59   
ref|XP_004246378.1|  PREDICTED: glutathione S-transferase U8            201   2e-59   
gb|KDP40336.1|  hypothetical protein JCGZ_02334                         201   2e-59   
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    201   2e-59   
ref|XP_008448743.1|  PREDICTED: probable glutathione S-transferase      201   2e-59   
ref|XP_006367665.1|  PREDICTED: probable glutathione S-transferas...    201   3e-59   
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          200   3e-59   
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    200   3e-59   
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like       200   3e-59   
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           200   4e-59   
ref|XP_009606317.1|  PREDICTED: probable glutathione S-transferase      200   4e-59   
ref|XP_008448653.1|  PREDICTED: glutathione S-transferase U8-like...    199   5e-59   
gb|KEH26957.1|  glutathione S-transferase                               199   5e-59   
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     199   6e-59   
ref|XP_010470684.1|  PREDICTED: glutathione S-transferase U8-like       200   6e-59   
ref|XP_002520480.1|  glutathione s-transferase, putative                199   7e-59   Ricinus communis
gb|ABW81037.1|  glutathione-s-transferase 7                             199   7e-59   Arabidopsis lyrata subsp. lyrata
gb|ADN03963.1|  GST1                                                    199   8e-59   
ref|XP_002862399.1|  glutathione-s-transferase                          199   8e-59   
ref|XP_004492381.1|  PREDICTED: glutathione S-transferase L2, chl...    206   8e-59   
ref|XP_006849223.1|  hypothetical protein AMTR_s00027p00230090          199   9e-59   
ref|NP_001237670.1|  glutathione S-transferase GST 11                   199   1e-58   
ref|NP_180503.1|  glutathione S-transferase tau 7                       199   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246385.1|  PREDICTED: probable glutathione S-transferase      199   1e-58   
ref|XP_003623172.1|  Glutathione S-transferase GST                      203   1e-58   
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like       199   1e-58   
ref|XP_004147908.1|  PREDICTED: probable glutathione S-transferas...    198   1e-58   
ref|XP_006294944.1|  hypothetical protein CARUB_v10023998mg             199   1e-58   
ref|XP_006849232.1|  hypothetical protein AMTR_s00027p00233060          199   2e-58   
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase      198   2e-58   Vitis vinifera
gb|AFW90580.1|  glutathione S-transferase-like protein                  198   2e-58   
ref|XP_007035120.1|  Glutathione S-transferase tau 7                    199   2e-58   
ref|XP_009629346.1|  PREDICTED: probable glutathione S-transferase      198   2e-58   
ref|XP_002524046.1|  glutathione s-transferase, putative                198   2e-58   Ricinus communis
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                   197   4e-58   
ref|XP_003623168.1|  hypothetical protein MTR_7g065230                  197   4e-58   
ref|XP_002881042.1|  glutathione-s-transferase                          197   4e-58   
ref|XP_009370935.1|  PREDICTED: glutathione transferase GST 23-like     197   5e-58   
gb|KDP38795.1|  hypothetical protein JCGZ_05131                         197   5e-58   
gb|AFY26875.1|  glutathione-S-transferase                               197   6e-58   
ref|XP_009606319.1|  PREDICTED: probable glutathione S-transferase      197   6e-58   
gb|ABW81189.1|  glutathione-S-transferase                               197   8e-58   Arabidopsis cebennensis
ref|XP_008240195.1|  PREDICTED: probable glutathione S-transferase      196   8e-58   
ref|XP_007208182.1|  hypothetical protein PRUPE_ppa018112mg             196   9e-58   
ref|XP_007200426.1|  hypothetical protein PRUPE_ppa011079mg             196   9e-58   
sp|Q03663.1|GSTX2_TOBAC  RecName: Full=Probable glutathione S-tra...    196   1e-57   Nicotiana tabacum [American tobacco]
ref|XP_002532523.1|  glutathione s-transferase, putative                196   1e-57   Ricinus communis
ref|XP_006367671.1|  PREDICTED: probable glutathione S-transferas...    196   1e-57   
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      196   1e-57   
ref|XP_003623171.1|  Glutathione S-transferase GST                      202   1e-57   
ref|XP_006367663.1|  PREDICTED: probable glutathione S-transferas...    196   1e-57   
gb|ACU13496.1|  unknown                                                 196   1e-57   Glycine max [soybeans]
ref|XP_004168417.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    196   1e-57   
ref|XP_004246380.1|  PREDICTED: probable glutathione S-transferase      196   1e-57   
ref|XP_004246387.1|  PREDICTED: probable glutathione S-transferase      196   2e-57   
ref|NP_001234088.1|  uncharacterized protein LOC543815                  196   2e-57   
ref|XP_008448606.1|  PREDICTED: probable glutathione S-transferase      196   2e-57   
ref|XP_010414386.1|  PREDICTED: glutathione S-transferase U7            196   2e-57   
gb|ADB11358.1|  tau class glutathione transferase GSTU26                196   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    195   3e-57   
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             195   4e-57   
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     195   4e-57   
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             195   4e-57   
ref|XP_006346688.1|  PREDICTED: probable glutathione S-transferas...    196   4e-57   
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     194   5e-57   
ref|XP_006367667.1|  PREDICTED: probable glutathione S-transferas...    194   5e-57   
ref|XP_003623199.1|  Glutathione S-transferase                          195   5e-57   
gb|KHN05115.1|  Putative glutathione S-transferase                      194   6e-57   
ref|XP_004246386.1|  PREDICTED: probable glutathione S-transferase      194   7e-57   
ref|XP_008224351.1|  PREDICTED: probable glutathione S-transferase      194   7e-57   
gb|AAX20044.1|  probable glutathione-S-transferase                      194   7e-57   
emb|CDP11459.1|  unnamed protein product                                194   9e-57   
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     194   9e-57   
emb|CDX97887.1|  BnaC04g40520D                                          194   9e-57   
ref|XP_004246384.1|  PREDICTED: probable glutathione S-transferase      194   1e-56   
ref|XP_009770673.1|  PREDICTED: probable glutathione S-transferase      194   1e-56   
gb|KFK38292.1|  hypothetical protein AALP_AA3G095200                    193   1e-56   
gb|KCW61134.1|  hypothetical protein EUGRSUZ_H03907                     193   1e-56   
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      194   1e-56   
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      193   1e-56   
ref|XP_006420235.1|  hypothetical protein CICLE_v10006671mg             194   2e-56   
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-like     193   2e-56   
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             193   2e-56   
ref|XP_006378334.1|  hypothetical protein POPTR_0010s08170g             193   2e-56   
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             193   2e-56   
ref|XP_007226113.1|  hypothetical protein PRUPE_ppa011087mg             192   3e-56   
ref|XP_010510492.1|  PREDICTED: glutathione S-transferase U7-like       194   3e-56   
ref|XP_006829148.1|  hypothetical protein AMTR_s00001p00269490          192   4e-56   
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          192   4e-56   
ref|XP_004301267.1|  PREDICTED: glutathione S-transferase U7-like       192   4e-56   
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like       192   4e-56   
ref|XP_008382671.1|  PREDICTED: glutathione transferase GST 23-like     192   5e-56   
gb|AFK41941.1|  unknown                                                 192   5e-56   
ref|XP_002518184.1|  glutathione s-transferase, putative                192   6e-56   
ref|XP_009802972.1|  PREDICTED: probable glutathione S-transferase      192   6e-56   
ref|XP_009626800.1|  PREDICTED: probable glutathione S-transferase      192   6e-56   
dbj|BAA78580.1|  Dcarg-1                                                191   6e-56   
ref|XP_009606318.1|  PREDICTED: probable glutathione S-transferase      191   7e-56   
ref|XP_004168418.1|  PREDICTED: probable glutathione S-transferas...    192   7e-56   
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      191   7e-56   
ref|XP_008382670.1|  PREDICTED: glutathione transferase GST 23-like     191   8e-56   
ref|XP_008232144.1|  PREDICTED: probable glutathione S-transferase      191   9e-56   
ref|XP_010685658.1|  PREDICTED: glutathione S-transferase U7-like       191   1e-55   
ref|XP_011041491.1|  PREDICTED: probable glutathione S-transferase      191   1e-55   
ref|XP_009770038.1|  PREDICTED: probable glutathione S-transferase      191   1e-55   
ref|XP_010469955.1|  PREDICTED: glutathione S-transferase U7-like       191   1e-55   
ref|XP_004290016.1|  PREDICTED: glutathione transferase GST 23-li...    191   1e-55   
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...    191   1e-55   
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     191   2e-55   
ref|XP_002520475.1|  glutathione s-transferase, putative                190   2e-55   
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     190   3e-55   
ref|XP_010264127.1|  PREDICTED: uncharacterized protein LOC104602212    196   3e-55   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    190   3e-55   
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      190   3e-55   
gb|ABW74586.1|  glutathione-S-transferase                               190   3e-55   
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      190   3e-55   
ref|XP_004147907.1|  PREDICTED: probable glutathione S-transferas...    189   4e-55   
ref|XP_006582837.1|  PREDICTED: uncharacterized protein LOC100306...    189   4e-55   
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase      190   4e-55   
ref|XP_007209589.1|  hypothetical protein PRUPE_ppa011268mg             189   4e-55   
gb|KGN54328.1|  hypothetical protein Csa_4G304250                       189   5e-55   
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             189   6e-55   
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    189   7e-55   
ref|XP_008382674.1|  PREDICTED: probable glutathione S-transferase      189   8e-55   
ref|XP_002524047.1|  glutathione s-transferase, putative                189   9e-55   
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    189   1e-54   
gb|ACN60408.1|  glutathione S-transferase                               188   1e-54   
gb|KHN06423.1|  Putative glutathione S-transferase                      188   1e-54   
gb|KDP42182.1|  hypothetical protein JCGZ_02912                         189   1e-54   
ref|XP_004157055.1|  PREDICTED: glutathione S-transferase U8-like       188   1e-54   
gb|KGN54321.1|  hypothetical protein Csa_4G303690                       188   1e-54   
ref|XP_007035122.1|  Glutathione S-transferase tau 7 isoform 2          188   1e-54   
ref|XP_004166785.1|  PREDICTED: probable glutathione S-transferas...    188   1e-54   
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             188   1e-54   
ref|XP_006420435.1|  hypothetical protein CICLE_v10005833mg             188   2e-54   
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    188   2e-54   
ref|XP_006367668.1|  PREDICTED: probable glutathione S-transferas...    188   2e-54   
emb|CAN72240.1|  hypothetical protein VITISV_010777                     188   2e-54   
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...    187   2e-54   
gb|AFK48430.1|  unknown                                                 187   2e-54   
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    187   2e-54   
gb|ADB11374.1|  tau class glutathione transferase GSTU50                187   3e-54   
ref|XP_007035121.1|  Glutathione S-transferase tau 7 isoform 1          188   3e-54   
ref|XP_010325821.1|  PREDICTED: probable glutathione S-transferase      187   3e-54   
emb|CAN78656.1|  hypothetical protein VITISV_006850                     187   3e-54   
emb|CDO99237.1|  unnamed protein product                                187   3e-54   
ref|XP_002521517.1|  glutathione s-transferase, putative                188   3e-54   
ref|XP_008372419.1|  PREDICTED: glutathione transferase GST 23-like     187   3e-54   
ref|XP_006367674.1|  PREDICTED: probable glutathione S-transferas...    187   4e-54   
ref|XP_003623200.1|  Glutathione S-transferase GST                      186   4e-54   
gb|ADB11377.1|  putative tau class glutathione transferase GSTU53       187   4e-54   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                     187   4e-54   
ref|XP_008448664.1|  PREDICTED: probable glutathione S-transferase      187   4e-54   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     187   4e-54   
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferas...    187   5e-54   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    187   5e-54   
ref|XP_006367670.1|  PREDICTED: probable glutathione S-transferas...    186   5e-54   
ref|XP_002527848.1|  glutathione s-transferase, putative                186   7e-54   
ref|XP_002524048.1|  glutathione s-transferase, putative                187   7e-54   
ref|NP_001063423.1|  Os09g0467200                                       186   7e-54   
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferas...    186   7e-54   
ref|XP_006493982.1|  PREDICTED: probable glutathione S-transferas...    186   8e-54   
emb|CDY51369.1|  BnaA04g28630D                                          186   8e-54   
ref|XP_004307163.1|  PREDICTED: probable glutathione S-transferas...    186   9e-54   
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g             186   1e-53   
emb|CDP08048.1|  unnamed protein product                                187   1e-53   
gb|ADB11328.1|  tau class glutathione transferase GSTU46                186   1e-53   
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     186   1e-53   
ref|XP_007050084.1|  Glutathione S-transferase tau 7                    185   2e-53   
ref|XP_007034533.1|  Glutathione S-transferase tau 7                    185   2e-53   
ref|XP_002523996.1|  glutathione s-transferase, putative                185   2e-53   
ref|XP_004971259.1|  PREDICTED: glutathione transferase GST 23-like     185   2e-53   
ref|XP_010269443.1|  PREDICTED: probable glutathione S-transferase      185   2e-53   
gb|KEH35720.1|  glutathione S-transferase, amino-terminal domain ...    185   3e-53   
gb|AFK37185.1|  unknown                                                 185   3e-53   
gb|EMT19525.1|  hypothetical protein F775_31981                         185   3e-53   
ref|XP_002315604.1|  hypothetical protein POPTR_0010s07180g             184   3e-53   
ref|XP_009140998.1|  PREDICTED: glutathione S-transferase U7            185   3e-53   
ref|NP_001234986.1|  glutathione S-transferase GST 19                   185   3e-53   
emb|CDP11462.1|  unnamed protein product                                186   3e-53   
ref|XP_011016467.1|  PREDICTED: glutathione S-transferase U8-like       182   4e-53   
gb|ADB11325.1|  tau class glutathione transferase GSTU36                184   4e-53   
ref|XP_010271921.1|  PREDICTED: probable glutathione S-transferase      185   4e-53   
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             184   4e-53   
emb|CBI26437.3|  unnamed protein product                                185   4e-53   
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   184   4e-53   
gb|AES79389.2|  glutathione S-transferase                               184   4e-53   
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      185   4e-53   
ref|XP_009343222.1|  PREDICTED: glutathione transferase GST 23-li...    184   5e-53   
ref|XP_004290017.1|  PREDICTED: glutathione transferase GST 23-li...    184   5e-53   
ref|XP_008448754.1|  PREDICTED: glutathione S-transferase U8-like       184   5e-53   
ref|XP_003578262.1|  PREDICTED: glutathione transferase GST 23-li...    184   5e-53   
gb|AFK38810.1|  unknown                                                 184   5e-53   
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      184   5e-53   
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      184   6e-53   
gb|ADB11315.1|  tau class glutathione transferase GSTU11                184   6e-53   
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   184   6e-53   
gb|ABK26947.1|  unknown                                                 184   6e-53   
gb|AFF18812.1|  glutathione transferase                                 184   6e-53   
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g             184   7e-53   
ref|XP_006849236.1|  hypothetical protein AMTR_s00027p00235060          184   7e-53   
gb|ABW81093.1|  GST17                                                   183   7e-53   
ref|XP_010036925.1|  PREDICTED: glutathione transferase GST 23-like     184   8e-53   
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like     184   8e-53   
ref|XP_006367673.1|  PREDICTED: probable glutathione S-transferas...    183   9e-53   
emb|CDP08010.1|  unnamed protein product                                184   9e-53   
gb|AFF18816.1|  glutathione transferase                                 184   9e-53   
ref|XP_008448618.1|  PREDICTED: glutathione S-transferase U8-like       184   9e-53   
gb|ACF74302.1|  glutathione S-transferase 3                             183   1e-52   
ref|XP_006494151.1|  PREDICTED: probable glutathione S-transferas...    183   1e-52   
ref|XP_006420441.1|  hypothetical protein CICLE_v10005837mg             183   1e-52   
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     183   1e-52   
gb|ADB11365.1|  tau class glutathione transferase GSTU38                183   1e-52   
ref|XP_010263987.1|  PREDICTED: probable glutathione S-transferase      183   1e-52   
gb|KHG11258.1|  putative glutathione S-transferase                      183   1e-52   
ref|XP_002315608.2|  hypothetical protein POPTR_0010s07120g             183   1e-52   
ref|XP_006494139.1|  PREDICTED: probable glutathione S-transferas...    183   1e-52   
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          183   1e-52   
ref|XP_004290018.1|  PREDICTED: glutathione transferase GST 23-li...    183   1e-52   
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    183   1e-52   
gb|KDP39591.1|  hypothetical protein JCGZ_02611                         182   2e-52   
ref|XP_002314527.2|  hypothetical protein POPTR_0010s07090g             182   2e-52   
ref|NP_001235260.1|  uncharacterized protein LOC100306196               182   2e-52   
ref|XP_010097693.1|  putative glutathione S-transferase                 182   2e-52   
ref|XP_004290015.1|  PREDICTED: glutathione transferase GST 23-like     182   2e-52   
ref|XP_002315609.1|  hypothetical protein POPTR_0010s07170g             182   3e-52   
ref|XP_004971265.1|  PREDICTED: probable glutathione S-transferas...    182   3e-52   
ref|XP_006829814.1|  hypothetical protein AMTR_s00119p00077600          182   3e-52   
ref|XP_011029699.1|  PREDICTED: probable glutathione S-transferase      182   3e-52   
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     182   3e-52   
ref|XP_010243633.1|  PREDICTED: glutathione transferase GST 23-like     182   3e-52   
ref|XP_007159485.1|  hypothetical protein PHAVU_002G241400g             182   3e-52   
tpg|DAA55821.1|  TPA: glutathione S-transferase                         182   3e-52   
gb|AFP20277.1|  glutathione transferase 23                              182   3e-52   
ref|XP_007200139.1|  hypothetical protein PRUPE_ppa017192mg             182   3e-52   
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                   182   4e-52   
gb|EMT29674.1|  hypothetical protein F775_18354                         182   4e-52   
ref|XP_007034526.1|  Glutathione S-transferase tau 7                    182   4e-52   
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    182   4e-52   
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      182   4e-52   
ref|XP_006494143.1|  PREDICTED: probable glutathione S-transferas...    182   4e-52   
ref|NP_001147759.1|  glutathione S-transferase                          182   5e-52   
ref|XP_002266744.1|  PREDICTED: probable glutathione S-transferase      182   5e-52   
ref|XP_003632026.2|  PREDICTED: probable glutathione S-transferase      182   5e-52   
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like     182   5e-52   
ref|XP_003623207.1|  hypothetical protein MTR_7g065710                  182   5e-52   
ref|XP_002267733.1|  PREDICTED: probable glutathione S-transferase      182   5e-52   
ref|XP_004972343.1|  PREDICTED: probable glutathione S-transferas...    182   5e-52   
gb|KEH20685.1|  glutathione S-transferase                               181   6e-52   
ref|XP_009347672.1|  PREDICTED: glutathione S-transferase U8-like       181   6e-52   
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    181   6e-52   
ref|XP_004147934.1|  PREDICTED: uncharacterized protein LOC101220464    191   7e-52   
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             181   7e-52   
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like     181   7e-52   
ref|XP_008363399.1|  PREDICTED: glutathione transferase GST 23-like     181   7e-52   
ref|XP_004290013.1|  PREDICTED: glutathione transferase GST 23-like     181   7e-52   
ref|XP_011004483.1|  PREDICTED: probable glutathione S-transferase      181   8e-52   
ref|NP_001104994.1|  glutathione transferase GST 23                     181   9e-52   
gb|AFK41515.1|  unknown                                                 179   1e-51   
ref|XP_006410006.1|  hypothetical protein EUTSA_v10017660mg             181   1e-51   
ref|XP_006829147.1|  hypothetical protein AMTR_s00001p00269450          181   1e-51   
ref|XP_011041490.1|  PREDICTED: probable glutathione S-transferase      180   1e-51   
ref|XP_004297032.1|  PREDICTED: probable glutathione S-transferas...    180   1e-51   
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             181   1e-51   
gb|KHG11257.1|  Glutathione transferase GST 23                          180   1e-51   
ref|XP_002518185.1|  glutathione s-transferase, putative                181   1e-51   
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     181   1e-51   
tpg|DAA61851.1|  TPA: hypothetical protein ZEAMMB73_518022              181   2e-51   
ref|XP_008235551.1|  PREDICTED: probable glutathione S-transferase      180   2e-51   
gb|ACJ83863.1|  unknown                                                 180   2e-51   
ref|XP_002307924.1|  hypothetical protein POPTR_0006s02510g             180   2e-51   
ref|XP_006489727.1|  PREDICTED: probable glutathione S-transferas...    180   2e-51   
ref|XP_006420440.1|  hypothetical protein CICLE_v10005850mg             180   2e-51   
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...    180   2e-51   
ref|XP_004290019.1|  PREDICTED: probable glutathione S-transferas...    180   2e-51   
ref|XP_006494137.1|  PREDICTED: probable glutathione S-transferas...    180   3e-51   
ref|XP_002267691.1|  PREDICTED: probable glutathione S-transferase      180   3e-51   
gb|EAY77227.1|  hypothetical protein OsI_05199                          180   3e-51   
ref|XP_002301833.2|  hypothetical protein POPTR_0002s25530g             180   3e-51   
ref|XP_007200028.1|  hypothetical protein PRUPE_ppa024281mg             179   3e-51   
ref|XP_006420234.1|  hypothetical protein CICLE_v10005809mg             179   3e-51   
emb|CDM86451.1|  unnamed protein product                                180   3e-51   
ref|XP_006367672.1|  PREDICTED: probable glutathione S-transferas...    179   3e-51   



>ref|XP_007026863.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07365.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=228

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 166/216 (77%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SPFS RVE+AL+LKG+QY++I EED   NKSPLLLKYNPVHKKIPVLLHNG
Sbjct  4    EVKVFGAWGSPFSRRVELALQLKGVQYEYI-EEDVLKNKSPLLLKYNPVHKKIPVLLHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AESL+ILEYI+ETW  N  P+LP+DPY +A ARFWA F+DEKC+   RK  +++ESE
Sbjct  63   KPIAESLVILEYIEETWKGN--PILPEDPYDKAMARFWANFVDEKCLPVLRKAGWSQESE  120

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +  +E    L  L   L GK  FGG++VG+VDIAA  +GYW+ VIQEA G+EVLS EK
Sbjct  121  REKVVEEACECLKTLESALRGKRFFGGDTVGMVDIAANFIGYWLRVIQEATGMEVLSAEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              ++++W +  +S CS++K +LPPRDKLLA+ +ARI
Sbjct  181  FPELFKWTDEFVS-CSIVKGSLPPRDKLLAFVKARI  215



>ref|XP_007026865.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07367.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=220

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 165/216 (76%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SPFS RVE+AL+LKG+QY++I EED   NKSPLLLKYNPVHKK+PVLLHNG
Sbjct  4    EVKVFGAWGSPFSRRVELALQLKGVQYEYI-EEDVHKNKSPLLLKYNPVHKKVPVLLHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AESL+ILEYI+ETW  N  P+LP+DPY RA ARFWAKFIDEKC+ A  K  ++ ESE
Sbjct  63   KPIAESLVILEYIEETWKGN--PILPEDPYDRAMARFWAKFIDEKCLPAIWKAGWSPESE  120

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +  +E    L  L   L GK  FGG+ VG+VDIAA  +GYW+ +IQE  G+E+LS EK
Sbjct  121  REKPVEEACECLKTLESALGGKRFFGGDKVGMVDIAANFIGYWLRLIQEVTGMELLSAEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              ++++W +  +S CSV+K +LPPRDKLLA+++ARI
Sbjct  181  FPELFKWTDEFVS-CSVVKGSLPPRDKLLAFFKARI  215



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 169/218 (78%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE+ALKLKG++Y++I E+    NKSPLLLKYNP+HKK+PVLLH
Sbjct  1    MAEVKLLGAWGSPFSRRVEMALKLKGVEYEYIDED--LANKSPLLLKYNPIHKKVPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK++AESL+ILEYIDETW +N  P+LP+DPY +A ARFWAKFIDEKC+ A  +I+ ++E
Sbjct  59   NGKTMAESLVILEYIDETWKSN--PILPEDPYDKAMARFWAKFIDEKCMPAIWQIMLSKE  116

Query  385  S--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            +  EKA +E    L  L +EL  K  FGGE++GLVDI A  +G+W+   QEA G+E++++
Sbjct  117  NEREKAIEEAIQHLKTLENELKDKKFFGGETIGLVDIVANFIGFWLGAAQEATGMELVNK  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   + +W++   + CSV+KENLPPRDKL+A+ + R+
Sbjct  177  ERFPVLCKWIDE-YANCSVVKENLPPRDKLIAFLRPRL  213



>ref|XP_010037776.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49511.1| hypothetical protein EUGRSUZ_K03034 [Eucalyptus grandis]
Length=226

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 163/216 (75%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS R+EIALK+KG++Y+++ EED   NKS LLLKYNPVHKKIPVL+HNG
Sbjct  4    ELKLFGVWGSPFSRRIEIALKIKGVEYEYL-EEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AES +ILEYIDETW++N  P+LP+DPY+RA ARFWAKFIDEKCV A  K L +   E
Sbjct  63   KPIAESQVILEYIDETWNDN--PILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L+ L  EL GK  FGGE+VG VDI A  +G+W+  +QEAAG + L+ +K
Sbjct  121  KEKANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTEDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +Y+W E   + C VIKENLPPRDK+LA+++A++
Sbjct  181  FPVLYKWAEEFKN-CPVIKENLPPRDKILAFFKAQL  215



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 162/216 (75%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS R+EIALK+KG++Y+++ EED   NKS LLLKYNPVHKKIPVL+HNG
Sbjct  4    ELKLFGVWGSPFSRRIEIALKIKGVEYEYL-EEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AES +ILEYIDETW++N  P+LP+DPY+RA ARFWAKFIDEKCV A  K L +   E
Sbjct  63   KPIAESQVILEYIDETWNDN--PILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L+ L  EL GK  FGGE+VG VDI A  +G+W+  +QEAAG + L+ +K
Sbjct  121  KEKANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTEDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +Y+W E   + C VIKENLPPRDK+LA ++AR+
Sbjct  181  FPVLYKWAEEFKN-CPVIKENLPPRDKILADFKARL  215



>ref|XP_011000057.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011000058.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 170/218 (78%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE+ALKLKG++Y++I+++    NKSPLLLKYNP+HKK+PVLLH
Sbjct  1    MAEVKLLGAWGSPFSRRVEMALKLKGVEYEYIEQD--LANKSPLLLKYNPIHKKVPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK++AESL+ILEYIDETW +N  P+LP+DPY +A ARFWAKFIDEKC+ A  +I++++E
Sbjct  59   NGKAMAESLVILEYIDETWKSN--PILPEDPYDKAMARFWAKFIDEKCMPAIWQIMWSKE  116

Query  385  S--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            +  EKA +E    L  L +EL  K  FGGE++GLVDI A  +G+W+    EA G+E++++
Sbjct  117  NEREKAIEEAIQHLKTLENELKDKKFFGGETIGLVDIVANFIGFWLGAAAEATGMELVNK  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   + +W++  ++ CSV+KEN+PPRDKL+A+ + R 
Sbjct  177  ERFPILCKWIDEYVN-CSVVKENIPPRDKLIAFLRPRF  213



>ref|XP_010037777.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49512.1| hypothetical protein EUGRSUZ_K03036 [Eucalyptus grandis]
Length=226

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 161/216 (75%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS R+EIALK+KG++Y+++ EED   NKS LLLKYNPVHKK+PVL+HN 
Sbjct  4    ELKLFGSWGSPFSRRIEIALKIKGVEYEYL-EEDIIHNKSALLLKYNPVHKKVPVLVHNS  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AES +ILEYIDETW++N  P+LP+DPY+RA ARFWAKFIDEKCV    K   +   E
Sbjct  63   KPIAESQVILEYIDETWNDN--PILPRDPYKRAMARFWAKFIDEKCVPTIWKSFMSGGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L+ L  EL GK  FGGE+VG VDI A  + +W+  +QEAAG++VL+ +K
Sbjct  121  REKAHEEACELLSTLEGELKGKKFFGGETVGFVDIVASFISHWVGPVQEAAGVDVLTEDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +Y+W E   + C VIKENLPPRDK+LA+++AR+
Sbjct  181  FPMLYKWAEEFKN-CPVIKENLPPRDKILAFFKARL  215



>ref|XP_010037773.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
 gb|KCW49510.1| hypothetical protein EUGRSUZ_K03031 [Eucalyptus grandis]
Length=213

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 157/214 (73%), Gaps = 6/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS R+EIALK+KG++Y+++ EED   NKS LLLKYNPVHKK+PVL+HNG
Sbjct  4    ELKLFGAWGSPFSRRIEIALKIKGVEYEYL-EEDIFHNKSALLLKYNPVHKKVPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AES +ILEYIDETW++N   + P+DPY++A A FWAKFIDEKCV A  K  +    E
Sbjct  63   KPIAESQVILEYIDETWNDNL--IFPRDPYKKAMAHFWAKFIDEKCVPALWKSYMSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA DE    L  L  EL GK  FGGE+VG VDI A  +G+W+  +QEAAG +VL+ +K
Sbjct  121  REKAHDEACELLRTLEGELKGKKFFGGETVGFVDIVASFIGHWVGALQEAAGFDVLTEDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
               +Y+W E   + C VIKENLPPRDK+LA+++A
Sbjct  181  FPMLYKWAEDFKN-CPVIKENLPPRDKILAFFKA  213



>emb|CDP06553.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 162/225 (72%), Gaps = 7/225 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV++ G P SPFS RVEIALKLKG+ YDFI E+    NKSP LL+YNPVHKKIPVLLH
Sbjct  1    MEEVKLFGHPASPFSCRVEIALKLKGVHYDFIAEDPS--NKSPQLLQYNPVHKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            NGK +AESL+ILEYIDE W  N  P+LP++P+++A+ARFWA +++EKC+ A  K  ++  
Sbjct  59   NGKPIAESLVILEYIDEVWKTN--PILPQNPHEKAKARFWANYVEEKCLPALFKTFWSVG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            E+ +K + E    L  L DEL GK  FGG+S+GLVDI A  + +W   IQEA GL+VL++
Sbjct  117  EQYDKDKAEAGEVLKFLEDELQGKKFFGGDSIGLVDIVANFMAFWFRTIQEALGLDVLTK  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKGIIA  693
            +   K++EW E  ++ CS I + LPP+DKL+A +    +G+ ++A
Sbjct  177  DNFPKLWEWAENYVN-CSDINQFLPPKDKLIAIFPPPYMGQHLVA  220



>ref|XP_008370016.1| PREDICTED: glutathione S-transferase U8-like [Malus domestica]
Length=222

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 162/215 (75%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SP+S RVEIALKLK ++Y+F+ EED + +KS LLLK NPVH+KIPVLLHNG
Sbjct  4    EVKLLGVWGSPYSRRVEIALKLKNVEYEFV-EEDLQ-SKSALLLKSNPVHQKIPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEES  387
            K LAES +ILEYIDETW     P+LPKDPY+RAQARFWA+FIDEKC+ AT K+L+  EE 
Sbjct  62   KPLAESQVILEYIDETWKEGF-PILPKDPYERAQARFWARFIDEKCLPATYKVLWGCEEH  120

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L +L +EL  K  F GE+VGLVDI A  +GYW+  IQE  G+E+L++EK 
Sbjct  121  EKAVEEACELLKILENELKDKKFFAGETVGLVDIVANFIGYWLRAIQEVVGVELLTKEKL  180

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+Y W +     CSV +E+LPP+DKL+A+ + R+
Sbjct  181  PKLYNWSDEF---CSVFQESLPPKDKLVAHIRGRL  212



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 160/215 (74%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   S FS RVEI LK+KG++Y++++E+ ++ NKS LLL+YNPVHKK+PVL+HNG
Sbjct  4    ELKLLGAWGSSFSRRVEIVLKIKGVEYEYLEEDVFQ-NKSDLLLQYNPVHKKVPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AESL+ILEYIDETW +N  P+LP+DPY+RA ARFWAKF+DEKC  A  K       E
Sbjct  63   KPIAESLVILEYIDETWKDN--PILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E Q  L+ L  EL GK  FGGE+VG +DI A  VGYW  V+QEA G++VL+ EK
Sbjct  121  REKAHEEAQELLSTLEGELEGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W E   + C VI+ENLPPRD+L+A+++ +
Sbjct  181  FPALCKWAEGFQN-CPVIRENLPPRDRLVAFFKTK  214



>ref|XP_010279540.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nelumbo 
nucifera]
Length=227

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 157/216 (73%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G  +SPFS RVE+ALKLKG+QY++I E+    NKSPLLLKYNP+HKK+PVLLHNG
Sbjct  4    EVKLIGAWISPFSLRVELALKLKGVQYEYIDED--LSNKSPLLLKYNPIHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE--  384
            K +AES +ILEYIDETW      LLP+DPY+RA  RFW KFIDEKC+ A  K  + EE  
Sbjct  62   KPIAESTVILEYIDETWKGYH--LLPEDPYERAMTRFWVKFIDEKCIEAIWKACWIEERK  119

Query  385  SEKARDEVQGALNLLVDEL-NGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
             EKA +E +  L +L +EL  G+  F G+++G VDIAAI + +W+ V+QE  G+ ++  E
Sbjct  120  QEKAIEEAKETLKILENELKKGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGISLMDEE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +++W+E  ++ C V+ ENLPPRDKL AYYQ  
Sbjct  180  KFPVLHKWIEEFIN-CDVVGENLPPRDKLFAYYQGH  214



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 158/216 (73%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G  +S FS RVEIALKLKG+QY++I+ +    NKSPLLLK NPVHKK+PVLLHNG
Sbjct  4    EVKLIGMWVSSFSLRVEIALKLKGVQYEYIEVD--LTNKSPLLLKSNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
            K +AESL+ILEYIDETW +N  P+LP+ PY RA ARFWAK+IDEKCV A  K  + EE  
Sbjct  62   KPIAESLVILEYIDETWKDN--PILPQHPYDRAMARFWAKYIDEKCVPALWKACWCEEKE  119

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L  L +EL  K  FGGESVG VDI A  +G+W+  I EA G+E+L+R+K
Sbjct  120  REKAVEEACVCLKTLENELKDKKFFGGESVGFVDIVANFIGFWVGAIGEAVGVELLTRDK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               + +W +  +  C VIKENLP +DK++A+Y+ R+
Sbjct  180  FPILCKWSDEHVG-CRVIKENLPSKDKVVAFYRTRV  214



>ref|XP_009378880.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=222

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 162/216 (75%), Gaps = 7/216 (3%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             EV++LG   SPFS RVEIALKLK ++Y+F+ EED + +KS LLLK NPVH+ IPVLLHN
Sbjct  3    DEVKLLGVWASPFSRRVEIALKLKNVEYEFV-EEDLQ-SKSDLLLKSNPVHQMIPVLLHN  60

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEE  384
            G+++AES +ILEYIDE W     P+LPKDPY+RAQARFWA+FIDEKC+ AT K+L+ +EE
Sbjct  61   GRAIAESQVILEYIDENWKEGF-PILPKDPYERAQARFWARFIDEKCLPATYKVLWGSEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L +L +EL  K  F GE+VGLVDI A  +GYW+  IQE  G+E+L++EK
Sbjct  120  HEKAVEEACELLKILENELKDKKFFAGETVGLVDIVANFIGYWLRAIQEVVGVELLTKEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              K+Y W +     CSV +E+LPPRDKL+A+ + R+
Sbjct  180  LPKLYNWSDEF---CSVFQESLPPRDKLVAHIRDRL  212



>ref|XP_010039176.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=213

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 157/214 (73%), Gaps = 15/214 (7%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS R+EIALK+KG++Y+++ EED   NKS LLLKYNPVHKKIPVL+HNG
Sbjct  4    ELKLFGVWGSPFSRRIEIALKIKGVEYEYL-EEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AES +ILEYIDETW++N  P+LP+DPY+RA ARFWAKFIDEK            E E
Sbjct  63   KPIAESQVILEYIDETWNDN--PILPRDPYKRAMARFWAKFIDEK-----------PERE  109

Query  391  KARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKHA  570
            KA +E    L+ L  EL GK  FGGE+VG VDI A  + +W+  +QEA G++VL+ +K  
Sbjct  110  KAHEEACELLSTLEGELKGKKFFGGETVGFVDIVASFISHWVGPVQEAVGVDVLTEDKFP  169

Query  571  KIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             +Y+W E    KC VIKENLPPRDK+LA+++AR+
Sbjct  170  MLYKWAEEF-KKCPVIKENLPPRDKILAFFKARL  202



>ref|XP_010037779.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49514.1| hypothetical protein EUGRSUZ_K03039 [Eucalyptus grandis]
Length=230

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 158/216 (73%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   +PFS RVEIALK+KG++Y+++ + D   NKS LLL+YNPVHKK+PVL+HNG
Sbjct  4    ELKLLGAWANPFSRRVEIALKIKGVEYEYL-DGDIIHNKSALLLEYNPVHKKMPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+ILEYIDETW +N  P+LP+DPY+RA ARFWAKF+DEKCV A  K  ++  EE
Sbjct  63   KPIAESLMILEYIDETWKDN--PILPRDPYKRAMARFWAKFLDEKCVPALWKYCWSLGEE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E A +E  G L +L  EL  K  FGG ++G VDI A  VG WI VIQEA G  +L+ +K
Sbjct  121  QENAYEEACGVLKILEGELEDKKFFGGNNLGFVDITANSVGLWIVVIQEAGGFNILTPDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              ++ +W E   S C V+KENLPPRD+L A ++AR 
Sbjct  181  FPRLCKWAEEFRS-CPVVKENLPPRDRLYALFKARF  215



>ref|XP_003529121.1| PREDICTED: probable glutathione S-transferase-like isoformX1 
[Glycine max]
 gb|KHN05111.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 152/219 (69%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV +LG   SPF  RV+IALKLKGIQY F +E     NKS LLLKYNPVHKK+PV +
Sbjct  4    NQEEVSLLGVVGSPFVCRVQIALKLKGIQYKFFEEN--LVNKSELLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A  K ++  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIGGAVWKSVFTV  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L  E+ GK  FGGE  G+VDIAAI + +W+ ++QE AGLE+ 
Sbjct  120  DEKEREKNVEESLEALQFLESEIKGKKFFGGEEFGMVDIAAIFIAFWVPMVQEIAGLELF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y W +  MS   V+KE LPPRD L A+++AR
Sbjct  180  TSEKFPKLYNWSQEFMSH-PVVKEVLPPRDPLFAFFKAR  217



>ref|XP_008370015.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=221

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 162/217 (75%), Gaps = 7/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALKLK ++Y+F+ +ED + +KS LLLK NPVH+KIPVLLH
Sbjct  1    MAEVKLLGSWGSPFSRRVEAALKLKNVEYEFV-DEDLQ-SKSALLLKSNPVHQKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            N + +AES +ILEYIDETW     P+LPKDPY+RAQARFWA+FIDEKC+ AT K L+ +E
Sbjct  59   NDRPIAESQVILEYIDETWKEGF-PILPKDPYERAQARFWARFIDEKCLPATWKALWGSE  117

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA +E    L +L +EL  K  F GE+VGLVDI A  + +W+  IQE  G+E+LS+E
Sbjct  118  EPEKAVEEACELLKILENELKDKKFFAGETVGLVDIVANFIAFWLRAIQELVGVELLSKE  177

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K  K+Y W +     CSV +ENLPP+D+L+A+++ R+
Sbjct  178  KLPKLYNWSDEF---CSVFQENLPPKDRLVAHFRGRL  211



>ref|XP_007026866.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07368.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=224

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 163/222 (73%), Gaps = 8/222 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQE--EDYRFNKSPLLLKYNPVHKKIPVLLH  204
            EV++ G   SPFS RVEIAL+LKGI +++I+E   D +F KSPLLLKYNP+HKK+PVLLH
Sbjct  4    EVKLFGAWGSPFSRRVEIALELKGIPFEYIEENVSDDKF-KSPLLLKYNPIHKKVPVLLH  62

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK + ESLIILEY+DETW +N  P+LP+DP++R  ARFWA+FIDEKC+    K L    
Sbjct  63   NGKPVLESLIILEYVDETWKDN--PILPEDPHERTMARFWARFIDEKCMPPVWKALLGTG  120

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EKA +EV+  L  L   LNGK  FGGE++GL+DIAA  + +W+ VIQE +GLE L+ 
Sbjct  121  EEREKALEEVRECLKTLEGVLNGKRFFGGETIGLLDIAANFIAFWLRVIQEVSGLEFLTA  180

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKG  684
            +K   + +W +  +S C+ +KE+LPPRDKL+A+ +  + G G
Sbjct  181  DKCPVLIKWCDEFVS-CNPVKEHLPPRDKLIAFMKNWLSGDG  221



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 159/215 (74%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   S FS RVEIALK+KG++Y++++E+ ++ NKS LLL+YNPVHKK+PVL+HNG
Sbjct  4    ELKLLGAWGSSFSRRVEIALKIKGVEYEYLEEDVFQ-NKSDLLLQYNPVHKKVPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AESL+IL+YIDETW +N  P+LP+DPY+RA ARFWAKF+DEKC  A  K       E
Sbjct  63   KPIAESLVILKYIDETWKDN--PILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E Q  L+ L  EL GK  FGGE+VG +DI A  VGYW  V+QEA G++VL+ EK
Sbjct  121  REKAHEEAQELLSTLEGELKGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W E   + C VI ENLPPRD+L+ +++ +
Sbjct  181  FPVLCKWAEGFQN-CPVIWENLPPRDRLVGFFKTK  214



>ref|XP_006480912.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=220

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 163/217 (75%), Gaps = 6/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++ G   SPFS RVEIALKLKG++Y++I+E+    NKSPLLL+YNP+HKK+PVL+H
Sbjct  1    MAQVQLFGLWGSPFSCRVEIALKLKGVEYEYIEED--LSNKSPLLLQYNPIHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
              K +AESL+ILEYIDETW N   P+LP DPY+RA ARFWAKFIDEKC+ A  K  ++EE
Sbjct  59   KRKPIAESLVILEYIDETW-NERNPILPHDPYERATARFWAKFIDEKCIFALWKACWSEE  117

Query  385  SEKARDEVQGALNL--LVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E+     +   +L  L D L  K  FGG+ +GLVDI A  +G+W+ +I+EA G+++L+ 
Sbjct  118  KEREEAAREACEHLQTLEDVLKDKRFFGGDMIGLVDIVANFMGFWLGIIEEATGVKLLTE  177

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            EK+ K+Y+W E  ++ CS IKENLPPRDKLLAY +AR
Sbjct  178  EKYPKLYKWSEEFVN-CSAIKENLPPRDKLLAYMRAR  213



>ref|XP_010279542.1| PREDICTED: probable glutathione S-transferase isoform X3 [Nelumbo 
nucifera]
Length=227

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 158/216 (73%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G  +SP S RVE+ALKLKG++Y++I E+    NKSPLLLKYNP+HKK+PVLLHNG
Sbjct  4    EVKLIGAWVSPVSLRVELALKLKGVKYEYIDED--LSNKSPLLLKYNPIHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AES +ILEYIDETW      LLP+DPY+RA  RFW KFIDEKC A   +  ++E  E
Sbjct  62   KPIAESAVILEYIDETWKGYQ--LLPEDPYERAVTRFWVKFIDEKCNATLWRACWSEASE  119

Query  385  SEKARDEVQGALNLLVDEL-NGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
             EKA +E +  L +L +EL  GK  FGG+++G VDIAAI + +W+ V+QE  G+ ++  E
Sbjct  120  QEKAIEEARENLKILENELKKGKKFFGGDNIGSVDIAAIYIAFWVGVLQEVVGISLMDEE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +++W+E  ++ C V+KENLPPRDKL AYYQ  
Sbjct  180  KFPVLHKWIEEFIN-CDVVKENLPPRDKLFAYYQGH  214



>ref|XP_006429233.1| hypothetical protein CICLE_v10012710mg [Citrus clementina]
 gb|ESR42473.1| hypothetical protein CICLE_v10012710mg [Citrus clementina]
Length=220

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 164/217 (76%), Gaps = 6/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++ G   SPFS RVEIALKLKG++Y++I+E+    NKSPLLL+YNP+HKK+PVL+H
Sbjct  1    MAQVQLFGLWGSPFSCRVEIALKLKGVEYEYIEED--LSNKSPLLLQYNPIHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
              K +AESL+ILEYIDETW N   P+LP DPY+RA ARFWAKFIDEKC+ A  K  ++EE
Sbjct  59   KRKPIAESLVILEYIDETW-NERNPILPHDPYERATARFWAKFIDEKCIFALWKACWSEE  117

Query  385  SEKARDEVQGALNL--LVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E+     + + +L  L D L  K  FGG+ +GLVDI A  +G+W+ +I+EA G+++L+ 
Sbjct  118  KEREEAAREASEHLQTLEDVLKDKRFFGGDMIGLVDIVANFIGFWLGIIEEATGVKLLTE  177

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            EK+ K+Y+W E  ++ CS IKENLPPRDKLLAY +AR
Sbjct  178  EKYPKLYKWSEEFVN-CSAIKENLPPRDKLLAYMRAR  213



>gb|AEB77869.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=222

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 164/220 (75%), Gaps = 9/220 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++ G  LSPFS RVE+ALK+KG++Y++I+E      KS LLL+YNPVHKK+PVL+H
Sbjct  1    MAEVKLFGASLSPFSRRVEMALKVKGVEYEYIEEN--LAEKSSLLLEYNPVHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            N K + ESL+ILEYIDETW  N  P++P+DPY RA ARFWAKFID+KC+ A  + L+++E
Sbjct  59   NRKPIVESLVILEYIDETWKQN--PIMPEDPYDRATARFWAKFIDDKCLPAFWQALWSKE  116

Query  385  S--EKARDEVQGALNLLVDELN--GKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +  EKA++E    L  L +ELN  G   FGGE++GLVDIAA   GYW+ ++QEAA ++ +
Sbjct  117  NEREKAKEEACHHLKTLENELNAKGTKFFGGETIGLVDIAANFFGYWLAILQEAAEMDFV  176

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            ++E+    ++W++   S CS IKE+LP +DK+LA +Q+R 
Sbjct  177  TKEEFPVFFDWIDEF-SSCSAIKESLPAKDKMLAVFQSRF  215



>gb|KHN05113.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  +V++LG   SPF  RV+IALKLKG+QY F+ EE+ R NKS LLLK NPVHKKIPV +
Sbjct  4    NQEDVKLLGATGSPFVCRVQIALKLKGVQYKFL-EENLR-NKSELLLKSNPVHKKIPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K +Y  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVVGAAWKYIYTV  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +EL  K  FGGE +GLVDIAA+ + +WI +IQE  GL++ 
Sbjct  120  DEKEREKNVEESYEALQFLENELKDKKFFGGEEIGLVDIAAVFIAFWIPIIQEVLGLKLF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            + EK  K+Y+W +  ++   V+K+ LPPRD+L A+Y+A
Sbjct  180  TSEKFPKLYKWSQEFINH-PVVKQVLPPRDQLFAFYKA  216



>ref|NP_001238659.1| glutathione S-transferase GST 7 [Glycine max]
 gb|AAG34797.1|AF243362_1 glutathione S-transferase GST 7 [Glycine max]
Length=225

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  +V++LG   SPF  RV+IALKLKG+QY F+ EE+ R NKS LLLK NPVHKK+PV +
Sbjct  4    NQEDVKLLGATGSPFVCRVQIALKLKGVQYKFL-EENLR-NKSELLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K +Y  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVVGAAWKYIYTV  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +EL  K  FGGE +GLVDIAA+ + +WI +IQE  GL++ 
Sbjct  120  DEKEREKNVEESYEALQFLENELKDKKFFGGEEIGLVDIAAVFIAFWIPIIQEVLGLKLF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            + EK  K+Y+W +  ++   V+K+ LPPRD+L A+Y+A
Sbjct  180  TSEKFPKLYKWSQEFINH-PVVKQVLPPRDQLFAFYKA  216



>ref|XP_010279541.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 156/216 (72%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G  +SP S RVE+ALKLKG++Y++I E+    NKSPLLLKYNP+HKK+PVLLHNG
Sbjct  4    EVKLIGAWVSPVSLRVELALKLKGVKYEYIDED--LSNKSPLLLKYNPIHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE--  384
            K +AES +ILEYIDETW      LLP+DPY+RA  RFW KFIDEKC+ A  K  + EE  
Sbjct  62   KPIAESAVILEYIDETWKGYQ--LLPEDPYERAVTRFWVKFIDEKCIEAIWKACWIEERK  119

Query  385  SEKARDEVQGALNLLVDEL-NGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
             EKA +E +  L +L +EL  G+  F G+++G VDIAAI + +W+ V+QE  G+ ++  E
Sbjct  120  QEKAIEEAKETLKILENELKKGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGISLMDEE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +++W+E  ++ C V+ ENLPPRDKL AYYQ  
Sbjct  180  KFPVLHKWIEEFIN-CDVVGENLPPRDKLFAYYQGH  214



>gb|AEB77872.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=222

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 163/220 (74%), Gaps = 9/220 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++ G  LSPFS RVE+ALK+KG++Y++I+E      KS LLL+YNPVHKK+PVL+H
Sbjct  1    MAEVKLFGASLSPFSRRVEMALKVKGVEYEYIEEN--LAEKSSLLLEYNPVHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            N K + ESL+ILEYIDETW  N  P++P+DPY RA ARFWAKFID+KC+ A  + L+++E
Sbjct  59   NRKPIVESLVILEYIDETWKQN--PIMPEDPYDRATARFWAKFIDDKCLPAFWQALWSKE  116

Query  385  S--EKARDEVQGALNLLVDELN--GKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +  EKA++E    L  L +ELN  G   FGG ++GLVDIAA   GYW+ ++QEAA ++ +
Sbjct  117  NEREKAKEEACHHLKTLENELNAKGTKFFGGGTIGLVDIAANFFGYWLAILQEAAEMDFV  176

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            ++E+    ++W++   S CS IKE+LP +DK+LA +Q+R 
Sbjct  177  TKEEFPVFFDWIDEF-SSCSAIKESLPAKDKMLAVFQSRF  215



>ref|XP_010039179.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=216

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = +1

Query  58   SPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGKSLAESLII  237
            SPFS+RVEIALK+KG++Y++  EED   +KSP LLKYNPVHKKIPVL+HNGK + ES +I
Sbjct  3    SPFSWRVEIALKMKGVKYEY-SEEDIHHSKSPALLKYNPVHKKIPVLVHNGKPIVESHVI  61

Query  238  LEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EESEKARDEVQ  411
            LEYIDETW +N  P+LP+DPY+RA ARFWAKF+DEKC+    K   +   E EK  +E +
Sbjct  62   LEYIDETWKDN--PILPRDPYKRAMARFWAKFLDEKCMQTLWKSFTSIGAEREKMHEEAR  119

Query  412  GALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKHAKIYEWME  591
              L+ L  EL GK  FGGE+VG +DI A  VGYW+ VIQEA G +VL+  +   + +W E
Sbjct  120  QLLSTLEGELKGKKFFGGETVGFIDIMANFVGYWVGVIQEAVGADVLTEGEFPLLCKWAE  179

Query  592  ALMSKCSVIKENLPPRDKLLAYYQAR  669
               + C VIKENLP +DKLLA+++ +
Sbjct  180  EFQN-CPVIKENLPLKDKLLAFFKVQ  204



>ref|XP_003529119.1| PREDICTED: probable glutathione S-transferase isoform 1 [Glycine 
max]
Length=225

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 157/219 (72%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV IALKLKG++Y ++ EE+ R NKS LLLK NPVHKKIPV +
Sbjct  4    SQEEVTLLGATGSPFVCRVHIALKLKGVEYKYV-EENLR-NKSELLLKSNPVHKKIPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HNGKS+AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A+ K ++  
Sbjct  62   HNGKSIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVFGASWKAVFTA  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +E+  K  FGGE +GLVDIAA+ + +W+ ++QE AGLE+ 
Sbjct  120  DEKEREKNVEEAIDALQFLENEIKDKKFFGGEEIGLVDIAAVYIAFWVPMVQEIAGLELF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K++ W +  ++   ++KE+LPPRD + A+++ R
Sbjct  180  TSEKFPKLHNWSQEFLNH-PIVKESLPPRDPVFAFFKGR  217



>gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Erythranthe guttata]
Length=222

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 153/214 (71%), Gaps = 6/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+VLG   SPFS RVE+ALK KG++Y++I E+D + NKSPLLL YNPVHKK+PVLLHNG
Sbjct  4    EVQVLGSWASPFSKRVEMALKFKGVEYEYI-EQDLK-NKSPLLLNYNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESLIILEYID+TW     P+LPKDPYQRA ARFWAKF+D+KC+    K  ++  EE
Sbjct  62   KPIAESLIILEYIDDTWQQG-PPILPKDPYQRAHARFWAKFVDDKCMPQVWKACWSEGEE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E   AL  L +E+ GK  FGG++VGLVD +A  + YW  ++ E +GL+ L+ EK
Sbjct  121  REKAMEEASKALEFLENEIKGKKFFGGDNVGLVDFSANFLAYWCGILAELSGLQFLTEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +  + +W +     CS +KENLP + K++  +  
Sbjct  181  YPNLTKWADEFCG-CSFVKENLPDKGKMVHVFNG  213



>gb|KHN05121.1| Putative glutathione S-transferase [Glycine soja]
Length=232

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 157/219 (72%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV IALKLKG++Y ++ EE+ R NKS LLLK NPVHKKIPV +
Sbjct  4    SQEEVTLLGATGSPFVCRVHIALKLKGVEYKYV-EENLR-NKSELLLKSNPVHKKIPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HNGKS+AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A+ K ++  
Sbjct  62   HNGKSIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVFGASWKAVFTA  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +E+  K  FGGE +GLVDIAA+ + +W+ ++QE AGLE+ 
Sbjct  120  DEKEREKNVEEAIDALQFLENEIKDKKFFGGEEIGLVDIAAVYIAFWVPMVQEIAGLELF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K++ W +  ++   ++KE+LPPRD + A+++ R
Sbjct  180  TSEKFPKLHNWSQEFLNH-PIVKESLPPRDPVFAFFKGR  217



>ref|XP_010039180.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
 gb|KCW49509.1| hypothetical protein EUGRSUZ_K03030 [Eucalyptus grandis]
Length=278

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 156/215 (73%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   SPFS+RVEIALK+KG++Y++  EED   NKSP LLK+NPVHKK+PVL+HNG
Sbjct  4    ELKLLGAWGSPFSWRVEIALKMKGVKYEY-SEEDILHNKSPALLKFNPVHKKVPVLIHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K + ES +ILEYIDETW +N   +LP+DPY+RA ARFWAKF+DEKC+    K   +   E
Sbjct  63   KPIVESHVILEYIDETWKDNL--ILPRDPYKRAMARFWAKFLDEKCMQTLWKSCTSIGAE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E +  L+ L  EL GK  FGGE+VG VDI A  VGYW+ VIQEA G +VL+  +
Sbjct  121  REKAHEEARLLLSTLEGELKGKKFFGGETVGFVDIMANFVGYWVGVIQEAVGADVLTEGE  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W E   ++  VIKENLPP+DK LA+++ +
Sbjct  181  FPLLCKWAEEFQNR-PVIKENLPPKDKFLAFFKVQ  214



>ref|XP_008370017.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=221

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 157/215 (73%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS RVEIALKLKG++Y++  EED + +KS LLLK NPVH+KIPVLLHN 
Sbjct  4    EVKLLGVWGSPFSRRVEIALKLKGVKYEYF-EEDLQ-SKSALLLKSNPVHQKIPVLLHND  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEES  387
            + +AES +ILEYID+TW     P+LPKDPY+RAQARFWA+FIDEKC+ A  K L+ +EE 
Sbjct  62   RPIAESQVILEYIDQTWKEGF-PILPKDPYERAQARFWARFIDEKCLPAAWKALWGSEEP  120

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L +L +EL  K  FGGE+VGLVDI A  + YW+  IQE  G+E+L++EK 
Sbjct  121  EKAVEEACELLKILENELKDKKFFGGETVGLVDIVANFIAYWLGAIQEVVGVELLTKEKL  180

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              +Y+W +     CS   E+LPPRDKL+ +++ R 
Sbjct  181  PDLYDWSDEF---CSAFHESLPPRDKLVTFFRRRF  212



>ref|XP_009378879.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   230 bits (586),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 160/215 (74%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   S FS RVEIALKLKG++Y+++ EED + +KSPLLLK NP+H+KIPVLLH+ 
Sbjct  4    EVKLLGVWGSAFSGRVEIALKLKGVKYEYV-EEDLQ-SKSPLLLKSNPIHQKIPVLLHSD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEES  387
            + +AES +ILEYIDETW     P+LP DPY+RAQARFWA+FIDEKC+ A  K L+ +EE 
Sbjct  62   RPIAESQVILEYIDETWKEGF-PILPTDPYERAQARFWARFIDEKCLPAAWKALWGSEEP  120

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L +L +EL  K  FGGE+VGLVDI A  + YW+  IQE  G+++L++EK 
Sbjct  121  EKAVEEACELLKILENELKDKKFFGGETVGLVDIVANFIAYWLGAIQEVVGVKLLTKEKL  180

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              +Y+W +     CSV  E+LPPRDKL+A+++ R+
Sbjct  181  PDLYDWSDEF---CSVFHESLPPRDKLVAFFRRRL  212



>ref|XP_004302690.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 158/219 (72%), Gaps = 7/219 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS RVE+ALKLKG++YDF  +ED + NKS LLLKYNPVHKKIPVL+H G
Sbjct  4    EVKLFGVWGSPFSKRVEMALKLKGVEYDFF-DEDLQ-NKSELLLKYNPVHKKIPVLVHKG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKI-LYAEES  387
            K +AES IILEYIDETW+     LLPKDPYQRA ARFWA+F++EKC+ A  K  +  E+ 
Sbjct  62   KPIAESAIILEYIDETWEGFA--LLPKDPYQRATARFWARFVEEKCMPAMFKCSVGTEDR  119

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAA-IVVGYWIDVIQEAAGLEVLSREK  564
            EKA +E    L LL +EL GK  FGGE +G VDI A  + GYW+   QE  G+E+L++EK
Sbjct  120  EKAVEEAYETLKLLENELKGKKFFGGEEIGFVDIVADFIGGYWLRDFQEVVGMELLTKEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGK  681
              K+ EW +  ++  +VIKE LPPRDKL+A+++ R   K
Sbjct  180  LPKLCEWSDEFVNH-AVIKEVLPPRDKLIAFFRTRFGSK  217



>ref|XP_010037778.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 159/215 (74%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   S +S RVE+ALK+K ++Y+++++E +  NKS LLLKYNPVHKK+PVL+HNG
Sbjct  4    ELKLLGMWGSLYSRRVEMALKIKRVKYEYLEQEIFH-NKSALLLKYNPVHKKVPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AES +ILEYIDETW +N  P+LP+DPY+RA ARFWAKF+DEKCV A  K  +    E
Sbjct  63   KPIAESQMILEYIDETWKDN--PILPQDPYERAMARFWAKFVDEKCVPALWKSCMSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA++E    L+ L  EL GK  FGGE++G VDI   V+ YW+ V+QEA G++VL+ +K
Sbjct  121  REKAQEEACELLSTLEGELKGKKFFGGENIGFVDIVGDVLAYWVGVLQEAVGVDVLTEDK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               +  W E   + C V+KENLPPRDKLLA+++ +
Sbjct  181  FPVLCRWAEDFRN-CPVVKENLPPRDKLLAFFKTQ  214



>ref|XP_010684665.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=223

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 155/216 (72%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V+G   SPFS RVE+ALKLKGI Y++ +EED   +KSP LLK NPVHKKIPV +HNG
Sbjct  5    EVKVIGCWGSPFSRRVEVALKLKGIPYNY-KEEDPYISKSPELLKGNPVHKKIPVFIHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            + LAES +I+EYIDE W     P+LP DPYQR++ARFWAKFIDEKC+ +    L+A  +E
Sbjct  64   RPLAESQVIMEYIDEAWQG--YPILPLDPYQRSRARFWAKFIDEKCITSLWNTLWATEDE  121

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK   E +  L +L  E+ GK  FGGE++G VDI A  +G+W+  +QEA G  + +++ 
Sbjct  122  YEKLLKEAKENLQVLEKEIEGKKFFGGENIGFVDIVANFIGFWLGCVQEAVGRTIFTKQS  181

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +  + +W E  +S C++IKENLPPRD+L+ Y++ RI
Sbjct  182  YPFLSKWAEEYVS-CNIIKENLPPRDRLVTYFKIRI  216



>ref|XP_010039178.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49505.1| hypothetical protein EUGRSUZ_K03024 [Eucalyptus grandis]
Length=226

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 158/215 (73%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   SPFS RVEIALK+KG++Y++++E+ +  NK+ LLL+YN VHKK+PVL+HNG
Sbjct  4    ELKLLGVWGSPFSRRVEIALKIKGVEYEYLKEDVFH-NKNDLLLQYNLVHKKVPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AESL+IL+YIDETW +N  P+LP+DPY+RA A FWAKF+DEKC  A  K       E
Sbjct  63   KPIAESLVILKYIDETWKDN--PILPRDPYERAMAHFWAKFLDEKCRPALWKSYTSVGPE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E Q  L+ L  EL GK  FGGE+VG VDI A  V YW  V+QEA G++VL+ EK
Sbjct  121  REKAHEEAQELLSTLEGELKGKKFFGGETVGFVDIVANFVWYWAGVLQEAVGVDVLTEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W E   + C VI+ENLPPRD+L+ +++A+
Sbjct  181  FPVLCKWAEGFQN-CPVIRENLPPRDRLVDFFKAQ  214



>ref|XP_009596758.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=223

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            MS V++LG   SPFS RVE AL +KGI+Y+ I+E+    NKSPLLL+ NPVHKKIPVLLH
Sbjct  1    MSRVKLLGHSGSPFSRRVEWALNIKGIEYELIEED--LPNKSPLLLQSNPVHKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            NGK +AESL+I+EYIDET+D  +  +LPKDPY RA ARFWAKF+DEKC+ A  K L++  
Sbjct  59   NGKPIAESLVIVEYIDETFDGPS--ILPKDPYDRAVARFWAKFLDEKCLPAAWKALWSKG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK ++E    L +L +EL  K  FGGE +G VDIAA  VG+W+ +++EA G+ +++ 
Sbjct  117  EEQEKDKEETYEVLKVLDNELKDKKFFGGEKIGFVDIAANFVGFWVGIVEEATGVVLVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   +  W +  ++ CS +KEN+P RD LL Y++ R+
Sbjct  177  EKFPHLCVWRDEYLN-CSQVKENMPNRDMLLGYFKGRV  213



>ref|XP_008793317.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 155/215 (72%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS RVE+AL+LKGI YD+I EED   NKSPLLLKYNP+HKK+PV LH G
Sbjct  4    EVKLLGSWGSPFSRRVELALRLKGISYDYI-EEDLS-NKSPLLLKYNPIHKKVPVFLHGG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K + ESL+ILEYI+ETW+ + A +LPKDPY+RA ARFW+ F+DEKC+ A     + E   
Sbjct  62   KPVVESLVILEYIEETWEGDHA-ILPKDPYERAMARFWSTFVDEKCIPAFWMSCWTEGDM  120

Query  391  KARDEVQGALNL--LVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            +    +Q   NL  L  EL GK  FGG+++G+VDIAA  + +W  V+QE AG+ +++ EK
Sbjct  121  QQNFMIQSKENLSILEGELKGKKFFGGDAIGMVDIAAFFIAHWAGVLQEVAGISLINEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            H  +++W+E  MS  S++ E LP R+ LLAY+QA+
Sbjct  181  HPILFKWIEEFMSS-SIVMECLPAREGLLAYFQAK  214



>gb|AFK47124.1| unknown [Lotus japonicus]
Length=221

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 156/218 (72%), Gaps = 9/218 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV+  G   SPF+ RV+IALKLKGIQY +I EED R NKS  LLKYNPVHKK+PVL+H
Sbjct  1    MAEVQFFGVGGSPFARRVQIALKLKGIQYTYI-EEDLR-NKSEQLLKYNPVHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            NGK LAESL+ILEYIDETW+N   P+LP+ PY+RA ARFW++FID+K + A  +  +   
Sbjct  59   NGKPLAESLVILEYIDETWNN--YPILPQQPYERALARFWSRFIDDKILPAISRAAWTAN  116

Query  379  -EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             EE EK   E   AL  L  EL  K  FGGE++GLVDIA   + +W+ VI+E+ G  +L+
Sbjct  117  QEEREKGIQESVEALQFLEKELKHK-FFGGETIGLVDIAGAFLAFWLPVIEESTGFSLLT  175

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             EK  K+Y+W +  ++   V+KENLPPRDKLL +++ R
Sbjct  176  SEKFPKLYKWSQDFINH-PVVKENLPPRDKLLGFFKGR  212



>ref|XP_007140454.1| hypothetical protein PHAVU_008G113600g [Phaseolus vulgaris]
 gb|AEX38001.1| glutathione transferase [Phaseolus vulgaris]
 gb|ESW12448.1| hypothetical protein PHAVU_008G113600g [Phaseolus vulgaris]
Length=225

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 155/219 (71%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV+IALKLKGI+Y +++E     NKS  LLKYNPVHKK+PV +
Sbjct  4    SQEEVTLLGATASPFVCRVKIALKLKGIEYKYVEEN--LGNKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAAT-RKILYA  378
            H  K LAESL+I+EYIDETW+NN  P+LP DPYQRA ARFW+KFID+K V AT + +  A
Sbjct  62   HGDKPLAESLVIVEYIDETWNNN--PILPSDPYQRALARFWSKFIDDKIVGATWKSVFTA  119

Query  379  EESEKARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++  E   +L  L +E+  K  FGGE +GLVDIAA+ V +WI ++QE  GLE+L
Sbjct  120  DEKEREKNVAEASESLQFLENEIGDKKFFGGEELGLVDIAAVYVAFWIPLVQEIGGLELL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK   +Y+W +  +S   ++KE+LPPRD +  +++ R
Sbjct  180  TSEKFPNLYKWSQEFVSH-PIVKESLPPRDPVFGFFKGR  217



>ref|NP_001235279.1| uncharacterized protein LOC100527381 [Glycine max]
 gb|ACU16470.1| unknown [Glycine max]
 gb|KHN06030.1| Putative glutathione S-transferase [Glycine soja]
Length=219

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 7/217 (3%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV +LG   SPFS RV++ALKLKG+ Y +  EED   NKS  LL+YNPVHKK+PVL+
Sbjct  4    NHEEVILLGKWASPFSNRVDLALKLKGVPYKY-SEEDLA-NKSADLLRYNPVHKKVPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HNG  L ESLII+EYIDETW NN  PLLP+DPY+RA ARFW+K +D+K + A     +++
Sbjct  62   HNGNPLPESLIIVEYIDETWKNN--PLLPRDPYERALARFWSKTLDDKILPAIWNACWSD  119

Query  382  ES--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
            E+  EKA +E   AL +L + L  K  FGGES+GLVDIAA  +GYW+ ++QE AGLE+L+
Sbjct  120  ENGREKAVEEALEALKILQEALKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLT  179

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             EK  K+Y+W +  ++   VIKE LPPRD+L A++QA
Sbjct  180  IEKFPKLYKWSQEFINH-PVIKEGLPPRDELFAFFQA  215



>ref|XP_007207190.1| hypothetical protein PRUPE_ppa017086mg [Prunus persica]
 gb|EMJ08389.1| hypothetical protein PRUPE_ppa017086mg [Prunus persica]
Length=226

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 156/223 (70%), Gaps = 5/223 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+  G   SP S RV+IAL+LKG++  F  EED + NKSPLL+KYNPVHKK+PVL+HN 
Sbjct  6    EVKHFGVRGSPLSLRVDIALRLKGVKSKFC-EEDLQ-NKSPLLIKYNPVHKKVPVLVHNE  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-EES  387
            K +AESL+ILEYIDETW +   P+LP+DPYQRA ARFWA FIDEKC  A  K  +  E  
Sbjct  64   KPIAESLVILEYIDETWKHQGLPILPQDPYQRANARFWASFIDEKCSPAICKAYWEIEGH  123

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L  L +EL     FGGE++G VD+AA  +GYW+  IQEA G+EVL++EK 
Sbjct  124  EKAMEEACELLQSLENELKDNKFFGGETIGFVDMAASFIGYWLRPIQEAVGVEVLTKEKC  183

Query  568  AKIYEWMEALMSKCSVIKENLPP-RDKLLAYYQARIIGKGIIA  693
             K+Y+W +  +S  SV+KE LPP ++ L+A++  R     ++A
Sbjct  184  PKLYDWCDEFVSH-SVVKEVLPPNKETLIAFFLGRCESTKLLA  225



>gb|AGV54744.1| glutathione transferase [Phaseolus vulgaris]
Length=225

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 155/219 (71%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV+IALKLKGI+Y +++E     NKS  LLKYNPVHKK+PV +
Sbjct  4    SQEEVTLLGATASPFVCRVKIALKLKGIEYKYVEEN--LGNKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAAT-RKILYA  378
            H  K LAESL+I+EYIDETW+NN  P+LP DPYQRA ARFW+KFID+K V AT + +  A
Sbjct  62   HGDKPLAESLVIVEYIDETWNNN--PILPSDPYQRALARFWSKFIDDKIVGATWKSVFTA  119

Query  379  EESEKARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++  E   +L  L +E+  K  FGGE +GLVDIAA+ V +WI ++QE  GLE+L
Sbjct  120  DEKEREKNVAEASESLQFLENEIADKKFFGGEELGLVDIAAVYVAFWIPLVQEIGGLELL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK   +Y+W +  +S   ++KE+LPPRD +  +++ R
Sbjct  180  TSEKFPNLYKWSQEFVSH-PIVKESLPPRDPVFGFFKGR  217



>ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
 ref|XP_008781208.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=225

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 155/214 (72%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SPFS RV IAL+LKG+ Y++I EED   NKS LLL+YNPVHKK+PVL+H G
Sbjct  4    EVKVFGHWTSPFSCRVGIALRLKGVPYEYI-EEDLS-NKSSLLLEYNPVHKKVPVLVHGG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE--  384
            + +AESL++LEYI+ETW  N  P+LP+DP++RA ARFW KF+DEKC+    K L++E   
Sbjct  62   RPIAESLVVLEYIEETWRGN--PMLPQDPHRRAMARFWTKFVDEKCMPIMWKSLWSEGEM  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +K  +E    L++L  EL+GK  FGG S+GLVDIAA  + YW +V+QE AG+ + + EK
Sbjct  120  QQKLMEETNENLSILERELDGKKFFGGNSIGLVDIAANFLSYWTEVLQEVAGISLFNEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            H  +++W    MS    +KE LPP+D+LL+++QA
Sbjct  180  HPILFKWANEFMSS-DAVKECLPPKDELLSHFQA  212



>gb|EYU26623.1| hypothetical protein MIMGU_mgv1a013321mg [Erythranthe guttata]
Length=223

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 155/214 (72%), Gaps = 5/214 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SP + RVEIALKLKG++Y++I EED + NKSPLLL YNPVHKK+PVLLHNG
Sbjct  4    EVKLFGAWGSPSTRRVEIALKLKGVKYEYI-EEDLK-NKSPLLLTYNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--AEE  384
            + +AESLIILEYID+TW     P+LPKDPYQR++ARFWAKF+D+K      K  +   EE
Sbjct  62   QPIAESLIILEYIDDTWQQQGPPILPKDPYQRSKARFWAKFLDDKFAPQIWKACWGEGEE  121

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E   +L LL +E+ GK LFGG+++GLVDI A  + YW +++Q+  GL+  +REK
Sbjct  122  REKGIEEATESLKLLENEIKGKKLFGGDNLGLVDIVAHFMAYWSEILQQLLGLDFFTREK  181

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +  ++ W +   + CS +KENLPP+ +L+  ++ 
Sbjct  182  YPNLFNWGDEFCN-CSFVKENLPPKHELVLIFKG  214



>gb|KHN06986.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 151/219 (69%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  +V++LG   SPF  RV+IALKLKGI+Y F++E     NKS LLLK NPVHKK+PV +
Sbjct  4    SQEDVKLLGVLGSPFVCRVQIALKLKGIEYKFVEEN--LANKSDLLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPY RA ARFW+KFID+K   A  K ++  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYHRALARFWSKFIDDKVFGAAWKSVFTL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +EL     FGGE  GLVDIAAI + +WI + QE AGL++ 
Sbjct  120  DEKEREKNVEESLEALQFLENELKDNKFFGGEEFGLVDIAAIFIAFWIPIFQEIAGLQIF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y+W +  MS   V+KE LPPRD L A+++AR
Sbjct  180  TSEKFPKLYKWSQEFMSH-PVVKEVLPPRDPLFAFFKAR  217



>gb|AFK40836.1| unknown [Lotus japonicus]
Length=225

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 155/218 (71%), Gaps = 8/218 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPF  RV+IALKLKG++Y FI EE+ R NKS LLLKYNPVHKK+PV +
Sbjct  4    NQEEVKLLGATGSPFVCRVQIALKLKGVEYKFI-EENLR-NKSELLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCV-AATRKILYA  378
            HN K +AESL+ILEYI+ETW  N  P+LP +PYQRA ARFW+KFID+K V AA + +  A
Sbjct  62   HNEKPIAESLVILEYIEETWKGN--PILPTNPYQRALARFWSKFIDDKVVTAAWKSVFTA  119

Query  379  EESEKARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++  E   AL  L +EL  K  FGGE  G VDI A+ + +WI +IQE AGL++ 
Sbjct  120  DEKEREKNIQESFEALQFLENELKDKKFFGGEEFGFVDITAVFIAFWIPMIQEIAGLQLF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            + EK  K+Y+W +  ++   V+KE LPPRD + A+++ 
Sbjct  180  TAEKFPKLYKWSQEFLNH-PVVKECLPPRDPVFAFFKG  216



>gb|KHG09979.1| Glutathione S-transferase U8 -like protein [Gossypium arboreum]
Length=225

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 152/216 (70%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SP+S+R E+ALKLKG+ Y++I E+ +  NKS LLLKYNPVHKK+PVLLHNG
Sbjct  4    EVKVFGYWASPYSYRAELALKLKGVSYEYINEDIFG-NKSDLLLKYNPVHKKVPVLLHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
            K + ES++ILEYI+ETW +N  P LP+DPY +A ARFW KFIDEKC        ++ E+ 
Sbjct  63   KPIVESVVILEYIEETWKHN--PYLPQDPYDKATARFWIKFIDEKCFPTLWLAAWSSENE  120

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E    +  L   LNGK  FGGE++G+VDI A  VGY+I V QE  GL +LS +K
Sbjct  121  REKVTNEACEYMKTLESALNGKKFFGGETIGMVDIVASSVGYFIRVTQEIMGLNLLSADK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              ++++W E   + CS++KE+LPPRDKLL + +  I
Sbjct  181  FPQLFQWSEDF-ANCSIVKESLPPRDKLLPFVKGLI  215



>gb|KDO66688.1| hypothetical protein CISIN_1g038634mg [Citrus sinensis]
Length=222

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 152/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R+E+ALKLKG+ +++I EED   NKSP LLKYNPVHKKIPVL+HN 
Sbjct  4    EVKLYGTWSSPFSRRIELALKLKGVPFEYI-EEDLS-NKSPELLKYNPVHKKIPVLVHNS  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AES +ILEYIDE W+NN  P+LP+DPYQRA ARFW KFIDEK +A   K  +AE  E
Sbjct  62   KPIAESQVILEYIDEIWNNN--PILPQDPYQRAMARFWGKFIDEKALATRMKANFAEGKE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E   +E    +  L +ELNGK  FGGE++G VDI AIVV  W  + QE  G+E  + EK
Sbjct  120  RELVTEEFFQQMKFLENELNGKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVETFTEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
               +++W+  + ++  V+ E  PPR+K LAY +ARI G
Sbjct  180  FPVLFKWIRKI-TEIDVVNECRPPREKHLAYVKARIEG  216



>gb|AFS51729.1| tau class glutathione S-transferase [Glycine soja]
Length=219

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV +LG   SPFS RV++ALKLKG+ Y +  EED   NKS  LL+YNPVHKK+PVL+HNG
Sbjct  7    EVILLGKWASPFSNRVDLALKLKGVPYKY-SEEDLA-NKSADLLRYNPVHKKVPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
              L ESLII+EYIDETW NN  PLLP+DPY+RA ARFW+K +D+K + A     +++E+ 
Sbjct  65   NPLPESLIIVEYIDETWKNN--PLLPRDPYERALARFWSKTLDDKILPAIWNACWSDENG  122

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E   AL +L + L  K  FGGES+GLVDIAA  +GYW+ ++QE AGLE+L+ EK
Sbjct  123  REKAVEEALEALKILQEALKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEK  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
              K+Y+W +  ++   VIKE LPPRD+L A++QA
Sbjct  183  FPKLYKWSQEFINH-PVIKEGLPPRDELFAFFQA  215



>ref|NP_001238721.1| glutathione S-transferase GST 13 [Glycine max]
 gb|AAG34803.1|AF243368_1 glutathione S-transferase GST 13 [Glycine max]
 gb|KHN47445.1| Putative glutathione S-transferase [Glycine soja]
Length=220

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 156/214 (73%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV +LG   SPFS RV++ALKLKG+ Y +  EED   NKS  LLKYNPVHKK+PVL+HNG
Sbjct  8    EVRLLGKWASPFSNRVDLALKLKGVPYKY-SEEDLA-NKSADLLKYNPVHKKVPVLVHNG  65

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
              L ESLII+EYIDETW NN  PLLP+DPY+RA ARFW+K +D+K + A     +++E+ 
Sbjct  66   NPLPESLIIVEYIDETWKNN--PLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENG  123

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E   AL +L + L  K  FGGES+GLVDIAA  +GYW+ ++QE AGLE+L+ EK
Sbjct  124  REKAVEEALEALKILQETLKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEK  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
              K+Y W +  ++   VIKE LPPRD+L A+++A
Sbjct  184  FPKLYNWSQDFINH-PVIKEGLPPRDELFAFFKA  216



>ref|XP_010039177.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=230

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 151/217 (70%), Gaps = 6/217 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   SPFS+R+EIAL +KG +Y++  EED   +KSP LLKYNP+H  +PVL+HNG
Sbjct  8    ELKLLGAWGSPFSWRIEIALNMKGDKYEY-SEEDIHHSKSPTLLKYNPMHNNVPVLVHNG  66

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K + ES +ILEYIDETW +N  P+LP+DPY+RA ARFWAKF+DEKC+    K   +   E
Sbjct  67   KPIVESHVILEYIDETWKDN--PILPRDPYERAMARFWAKFLDEKCMQTLWKCCTSIRAE  124

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L+ L  EL GK  F GE+V  VDI    VGYW+ VIQEA G +VL+  +
Sbjct  125  REKAHEEAHQLLSTLEGELKGKKFFRGETVEFVDIMTNFVGYWVGVIQEAVGADVLTEGE  184

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARII  675
               + +W E   + CSVI+ENLPP+DK LA+++ + +
Sbjct  185  FPLLCKWAEEFQN-CSVIEENLPPKDKFLAFFKVQAV  220



>gb|AAO69664.1| glutathione S-transferase [Phaseolus acutifolius]
Length=225

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 155/219 (71%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV+IALKLKGI+Y +++E     NKS  LLKYNPVHKK+PV +
Sbjct  4    SQEEVTLLGATGSPFVCRVKIALKLKGIEYKYVEEN--LANKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAAT-RKILYA  378
            H  K LAESL+I+EYIDETW+NN  P+LP DPYQRA ARFW+KFID+  V +T + +  A
Sbjct  62   HGDKPLAESLVIVEYIDETWNNN--PILPSDPYQRALARFWSKFIDDNIVGSTWKSVFTA  119

Query  379  EESEKARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++  E   +L  L +E+  K  FGGE +GLVDIAA+ V +WI ++QE AGLE+L
Sbjct  120  DEKEREKNVAEASESLQFLENEIADKKFFGGEELGLVDIAAVYVAFWIPLVQEIAGLELL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK   +Y+W +  +S   ++KE+LPPRD +  +++ R
Sbjct  180  TSEKFPNLYKWSQEFVSH-PIVKESLPPRDPVFGFFKGR  217



>gb|AFK43265.1| unknown [Medicago truncatula]
Length=220

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 158/217 (73%), Gaps = 7/217 (3%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV +LG   SPFS R+++ALKLKG+ Y + +E     NKS  LLKYNPV+KK+P+L+
Sbjct  5    NQEEVRLLGKWASPFSNRIDLALKLKGVPYKYFEEN--LANKSDDLLKYNPVYKKVPILV  62

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HNG  +AESLIILEYIDETW NN  PLL +DPY+RA ARFW+K +D+K ++A     +++
Sbjct  63   HNGNPIAESLIILEYIDETWKNN--PLLSEDPYERALARFWSKTLDDKILSAIWNACWSD  120

Query  382  ES--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
            E   EKA +E   AL +L DE+  K  FGGE++GLVDIAA  +GYW+ ++QE AGLE+L+
Sbjct  121  EKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVDIAANFIGYWVYILQEIAGLELLT  180

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             EK  K+Y+W +  ++   VIKE LPPRD+L A+++A
Sbjct  181  LEKFPKVYKWSQEFINH-PVIKEGLPPRDELFAFFKA  216



>gb|KHN05118.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 154/219 (70%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV IALKLKG++Y ++ EE+ R NKS LLLK NPVHKK+PV +
Sbjct  4    SQEEVTLLGATGSPFVCRVHIALKLKGVEYKYV-EENLR-NKSELLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A  K ++  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVFGAAWKSVFTA  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +E+  K  FGGE +GLVDIAA+ + +W+ ++QE AGLE+ 
Sbjct  120  DEKEREKNVEEAIEALQFLENEIKDKKFFGGEEIGLVDIAAVYIAFWVPMVQEIAGLELF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K++ W +  ++   ++KE+LPPRD + A+++ R
Sbjct  180  TSEKFPKLHNWSQEFLNH-PIVKESLPPRDPVFAFFKGR  217



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 160/225 (71%), Gaps = 7/225 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV++ G  +SPF   VEIAL +KGIQY++I+E+    NKSP LL+YNPV+KKIPVLLH
Sbjct  1    MEEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEED--LTNKSPQLLQYNPVYKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK + ES++ILEYIDETW NN  P+LP+DP+++A+ARFWA F+D+KC  A  K ++  +
Sbjct  59   NGKPIVESMVILEYIDETWKNN--PILPEDPFEKARARFWANFVDQKCFPALWKTIWSTS  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            E+ E+ + E    L +L +EL GK  FGG+S+G+VDI A  +G+    IQEA  L+V + 
Sbjct  117  EQYEQNKAEALERLKVLENELGGKRFFGGDSIGMVDIVANFIGFSFRTIQEALKLDVFTE  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKGIIA  693
            +   K++EW E   + CS +K+ LPP+DKL+A +    +GK +++
Sbjct  177  DNFPKLWEWAENF-ANCSPVKKCLPPQDKLIANFPPAYMGKTLVS  220



>ref|NP_001234082.1| uncharacterized protein LOC543813 [Solanum lycopersicum]
 gb|AAG16756.1| putative glutathione S-transferase T1 [Solanum lycopersicum]
Length=224

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 153/218 (70%), Gaps = 5/218 (2%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V G    PF+ RVE+ALKLKG++Y++I+E+  R NKS  L+KYNP++K++PVL+H
Sbjct  1    MGEVKVHGIFAGPFNKRVELALKLKGVKYEYIEED--RSNKSDELVKYNPIYKQVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK + ES+IILEYID+TW+NNT PLLPK PYQR+ ARF AK IDEK + A  K+ Y   
Sbjct  59   NGKPICESIIILEYIDDTWENNTIPLLPKHPYQRSMARFLAKLIDEKLMGAMYKVCYGKG  118

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  DE    L  L +EL  K  FGG+S+G VDI A  +  W   IQEA G+E+L+ 
Sbjct  119  EEREKGCDETFEVLKYLDNELQNKKFFGGDSIGFVDIVASYIALWFGAIQEAIGMELLTE  178

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +K  K+ +W++  +  C ++KENLP R+ L+  Y+A+ 
Sbjct  179  QKFPKLSKWIDEFLC-CRIVKENLPNREVLVLLYKAQF  215



>ref|NP_001238439.1| probable glutathione S-transferase [Glycine max]
 sp|P32110.1|GSTX6_SOYBN RecName: Full=Probable glutathione S-transferase; AltName: Full=G2-4; 
AltName: Full=Heat shock protein 26A [Glycine max]
 gb|AAA33973.1| Gmhsp26-A [Glycine max]
 gb|ACU17044.1| unknown [Glycine max]
Length=225

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 151/216 (70%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG++Y F++E     NKS LLLKYNPVHKK+PV +HN 
Sbjct  7    DVKLLGIVGSPFVCRVQIALKLKGVEYKFLEEN--LGNKSDLLLKYNPVHKKVPVFVHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            + +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K ++    +
Sbjct  65   QPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVSKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGGE  GLVDIAA+ + +WI + QE AGL++ + E
Sbjct  123  EREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +Y+W +  ++    + E LPPRD L AY++AR
Sbjct  183  KFPILYKWSQEFLNH-PFVHEVLPPRDPLFAYFKAR  217



>ref|NP_001236169.1| uncharacterized protein LOC100500052 [Glycine max]
 gb|ACU14762.1| unknown [Glycine max]
Length=225

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 157/219 (72%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF+ RV+IALKLKG++Y +++E     NKS LLLK NPVHKK+PV +
Sbjct  4    SQEEVTLLGVIGSPFACRVKIALKLKGVEYKYVEEN--LANKSDLLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCV-AATRKILYA  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V AA   +   
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAAWNAVFTV  119

Query  379  EESEKARDEVQG--ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++ V+   AL  L +E+  K  FGGE VGLVDIA + + +W+ +IQE AGLE+L
Sbjct  120  DEKEREKNVVETYEALQFLENEIKDKKFFGGEEVGLVDIAGVYIAFWVPLIQEIAGLELL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            S EK  K+Y+W +  ++   ++KE+LPPRD + A+++ R
Sbjct  180  SSEKFPKLYKWSQEFVNH-PIVKESLPPRDPVFAFFKGR  217



>gb|ABW69659.2| glutathione S-transferase [Gossypium hirsutum]
Length=225

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 152/216 (70%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SP+S+R E+ALKLKG+ Y++I E+ +  NKS LLLKYNPVHKK+PVLLHNG
Sbjct  4    EVKVFGYWASPYSYRAELALKLKGVSYEYINEDIFG-NKSDLLLKYNPVHKKVPVLLHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
            KS+ ES++ILEYI+ETW +N    LP+DPY +A ARFW KFIDEKC        ++ E+ 
Sbjct  63   KSIVESVVILEYIEETWKHNL--YLPQDPYDKATARFWIKFIDEKCFPTLWLAAWSPENE  120

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E    +  L   LNGK  FGGE++G+VDI A  VGY+I V QE  GL +LS +K
Sbjct  121  REKVTNEACEYMKTLESALNGKKFFGGETIGMVDIVASSVGYFIRVTQEIMGLNLLSADK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              ++++W E   + CS++KE+LPPRDKLL + +  I
Sbjct  181  FPQLFQWSEDF-ANCSIVKESLPPRDKLLPFVKGLI  215



>gb|ADD71974.1| glutathione S-transferase [Glycine soja]
Length=219

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+ +LG   SPFS RV++ALKLKG+ Y +  EED   NKS  LL+YNPVHKK+PVL+HNG
Sbjct  7    ELILLGKWASPFSNRVDLALKLKGVPYKY-SEEDLA-NKSADLLRYNPVHKKVPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
              L ESLII+EYIDETW NN  PLLP+DPY+RA ARFW+K +D+K + A     +++E+ 
Sbjct  65   NPLPESLIIVEYIDETWKNN--PLLPRDPYERALARFWSKTLDDKILPAIWNACWSDENG  122

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E   AL +L + L  K  FGGES+GLVDIAA  +GYW+ ++QE AGLE+L+ EK
Sbjct  123  REKAVEEALEALKILQEALKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEK  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
              K+Y+W +  ++   VIKE LPPRD+L A++QA
Sbjct  183  FPKLYKWSQEFINH-PVIKEGLPPRDELFAFFQA  215



>ref|XP_008240078.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=226

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 151/214 (71%), Gaps = 5/214 (2%)
 Frame = +1

Query  58   SPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGKSLAESLII  237
            SP S RV+IAL+LKG++  F  EED + NKSP L+KYNPVHKK+PVL+HN K +AESL+I
Sbjct  15   SPLSLRVDIALRLKGVKSKFC-EEDLQ-NKSPSLIKYNPVHKKVPVLVHNEKPIAESLVI  72

Query  238  LEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-EESEKARDEVQG  414
            LEYIDETW +   P+LP+DPYQRA ARFWA FIDEKC  A  K  +  E  EKA +E   
Sbjct  73   LEYIDETWKHQGLPILPQDPYQRANARFWASFIDEKCSPAICKAYWEIEGHEKAMEEACE  132

Query  415  ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKHAKIYEWMEA  594
             L  L +EL     FGGE++G VD+AA  +GYW+  IQEA G+EVL++EK  K+Y+W + 
Sbjct  133  LLKFLENELKDNKFFGGETIGFVDMAASFIGYWLRPIQEAVGVEVLTKEKCPKLYDWCDE  192

Query  595  LMSKCSVIKENLPP-RDKLLAYYQARIIGKGIIA  693
             +S  SV+KE LPP ++ L+A++  R     ++A
Sbjct  193  FVSH-SVVKEVLPPNKETLIAFFLGRCESTKLLA  225



>gb|KHN25840.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 156/219 (71%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF+ RV+IALKLKG++Y +++E     NKS LLLK NPVHKK+PV +
Sbjct  4    SQEEVTLLGVIGSPFACRVKIALKLKGVEYKYVEEN--LANKSDLLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCV-AATRKILYA  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V AA   +   
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAAWNAVFTV  119

Query  379  EESEKARDEVQG--ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
            +E E+ ++ V+   AL  L +E+  K  FGGE VGLVDIA + + +W+ +IQE AGLE+L
Sbjct  120  DEKEREKNVVETYEALQFLENEIKDKKFFGGEEVGLVDIAGVYIAFWVPLIQEIAGLELL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            S EK  K+Y+W +  ++   ++KE LPPRD + A+++ R
Sbjct  180  SSEKFPKLYKWSQEFVNH-PIVKEGLPPRDPVFAFFKGR  217



>ref|XP_002520478.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41891.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 150/219 (68%), Gaps = 8/219 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SP+S RVEIALKLKGIQY++I+E+    NKS LLLKYNPVH+KIPVL+HNG
Sbjct  4    EVKVFGTWSSPYSRRVEIALKLKGIQYEYIEED--LSNKSDLLLKYNPVHEKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--AEE  384
            K +AESL+ILEYIDETW +N  P+LPKDPY RA ARFW  F+DEK +   +K     AEE
Sbjct  62   KPVAESLVILEYIDETWQDN--PILPKDPYSRAMARFWTNFVDEKILQTAKKTRTAKAEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAA-GLEVLSRE  561
             E+   E+   + LL  EL GK  FGGE +G VDI A V+ YW  V+ +     E +S E
Sbjct  120  LEQLHQEIYQDMKLLESELEGKEFFGGEKIGQVDIVAFVILYWFHVMSQGVLQTEFISEE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
            K   +++WM A + +   IKE LPPRDK +AY +AR + 
Sbjct  180  KFPVLHKWM-AKLCEIDAIKECLPPRDKHVAYMKARFVS  217



>gb|AFK45620.1| unknown [Lotus japonicus]
Length=219

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 156/215 (73%), Gaps = 7/215 (3%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             EV +LG   SPFS RV++ALKLKG+ Y++  EED   NKS  LLKYNPV+KK+PVL+HN
Sbjct  6    GEVRLLGKWASPFSNRVDLALKLKGVPYNY-SEEDLA-NKSADLLKYNPVYKKVPVLVHN  63

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES  387
            G  LAESL+ILEYIDETW NN  P LP+DPY+RA ARFW+K +D+K +       +++E 
Sbjct  64   GNPLAESLVILEYIDETWKNN--PFLPQDPYERAVARFWSKTLDDKILPPIWNACWSDEK  121

Query  388  --EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
              EKA +E   AL LL D+L     FGGE++GLVDIAA  +GYW+ ++QE AGLE+L+ E
Sbjct  122  GREKAVEEALEALKLLQDQLKDNRFFGGETIGLVDIAANFIGYWVSILQEIAGLELLTVE  181

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K  K+++W +  ++   VIKE LPPRD+L A+++A
Sbjct  182  KFPKLFKWSQEFVNH-PVIKEGLPPRDELFAFFKA  215



>ref|XP_009776230.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=221

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SP S RVE AL++KG++Y+ I EED + NKSPLLL+ NPVHKKIPVLLHNG
Sbjct  4    EVKLLGINGSPASRRVEWALRIKGVEYELI-EEDLQ-NKSPLLLQSNPVHKKIPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+I+EYIDET+D  +  +LPKDPY RA ARFWAKF+DEKC+ A  K L++  EE
Sbjct  62   KPIAESLVIVEYIDETFDGPS--ILPKDPYDRADARFWAKFLDEKCLPAVWKALWSKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK ++E    L +L +EL  K  FGGE +G VDIAA  VG+W+ +++EA G+ +++ EK
Sbjct  120  QEKDKEEAYEVLKVLDNELKDKKYFGGEKIGFVDIAANFVGFWVGIVEEATGVVLVTSEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
                  W E  ++ CS +KEN+P R+ LL Y++ R++ 
Sbjct  180  FPHFCTWREEYLN-CSQVKENMPNREMLLGYFKGRVLA  216



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G  +SPFS R+E+ALKLKG+ ++++ EED   NKSP LLKYNPVHKKIPVL+HNG
Sbjct  4    EVKLYGTWVSPFSRRIELALKLKGVPFEYM-EEDLS-NKSPELLKYNPVHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AESL+ILEYIDETW NN  P+LP+DPYQRA  RFWAKFIDEK +A   K  + E  E
Sbjct  62   KPIAESLVILEYIDETWKNN--PILPQDPYQRAMVRFWAKFIDEKILATGWKANFGEGKE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E A +E    +  L +ELNGK  F GE++G +DI A ++ +W  V Q+A G+E  ++EK
Sbjct  120  REVAIEEFAEQMKFLENELNGKDFFEGETIGFLDIVANLIAFWFPVRQDALGIEAFTQEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
               +++W+ A ++K  ++ E  PPR+K LA+ +ARI G
Sbjct  180  FPVLFKWI-ANITKIDLVNECRPPREKHLAFVKARIEG  216



>ref|XP_010101874.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90011.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 157/215 (73%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   S FS RV+IALKLKGI Y++  EED   NKS LL+KYNP+HKK+PVL+H+ 
Sbjct  4    EVKVFGCWGSAFSLRVDIALKLKGIDYEY-HEEDLS-NKSSLLIKYNPIHKKVPVLVHHN  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-EES  387
            K LAES +ILEYIDETW+N   P+LPKDPY+RA+ARFWA+FID+KC     K  ++ +E 
Sbjct  62   KPLAESQVILEYIDETWEN--YPILPKDPYERAKARFWARFIDDKCFPEIWKAYWSKDER  119

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E+   L  L +ELN    FGGE+VGLVDI   ++ YW+ V+QE AG+E+L+ EK 
Sbjct  120  EKAVEELIELLKFLENELND-NFFGGETVGLVDIVGSLIAYWLPVVQEVAGVEILTEEKF  178

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+  W    ++  SV+KE LP R+KL+AY++AR+
Sbjct  179  PKLCRWSHEFVNH-SVVKEVLPCREKLIAYFRARL  212



>gb|EYU26621.1| hypothetical protein MIMGU_mgv1a013264mg [Erythranthe guttata]
Length=225

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 157/219 (72%), Gaps = 7/219 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++ G   SPFS RVE+ALKLKG++Y++I EED + NKSPLLL YNPVHKK+PVLLH
Sbjct  1    MAEVKLFGVWDSPFSKRVELALKLKGVKYEYI-EEDLK-NKSPLLLNYNPVHKKVPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK ++ESLIILEYID+TW     P+LPKDPY R++ARFWAKF+D+KC+ A  K  +   
Sbjct  59   NGKPISESLIILEYIDDTWQQGP-PILPKDPYLRSKARFWAKFVDDKCIPAMWKACWQKG  117

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGG-ESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
            EE EKA +E   AL  L +E+ GK  FGG +S+GLVDIAA V+     +I E  G++ L 
Sbjct  118  EEGEKAMEEANDALEFLENEIKGKRFFGGDDSIGLVDIAADVIACRNGIIAELMGVQFLR  177

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            ++K   + +W +   + CS +KEN PP  KL+ +Y+A I
Sbjct  178  KDKFPNLCKWADEYCN-CSFVKENQPPNQKLIHHYKALI  215



>ref|XP_006488416.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=223

 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G  +SPFS R+E+ALKLKG+ +++I  +    NKSP LLKYNP+HKKIPVL+HNG
Sbjct  5    EVKLYGTWVSPFSRRIELALKLKGVPFEYIGVD--LSNKSPELLKYNPIHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+ ESLIILEYID+TW NN  P+LP+DP+QRA ARFWAKFIDEK +A   K   AE  E
Sbjct  63   KSIVESLIILEYIDDTWKNN--PILPRDPHQRAVARFWAKFIDEKLLATGMKASLAEGKE  120

Query  391  KA--RDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            K    +E+   + LL +ELNGK  FGGE++GLVDI A VV +W  V  E  G+EV+++EK
Sbjct  121  KELLNEEILEQMKLLENELNGKDFFGGEAIGLVDIVATVVAFWFPVSHEVLGVEVITQEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
               + +W+  L  +  V+ ++ PPR+K +A+ +AR+ G
Sbjct  181  FPVLLKWIGKL-QEIDVVSQSRPPREKHVAHVRARMEG  217



>ref|XP_006424949.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
 gb|ESR38189.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
Length=222

 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G  +SPFS R+E+ALKLKG+ +++I  +    NKSP LLKYNP+HKKIPVL+HNG
Sbjct  4    EVKLYGTWVSPFSRRIELALKLKGVPFEYIGVD--LSNKSPELLKYNPIHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+ ESLIILEYID+TW NN  P+LP+DP+QRA ARFWAKFIDEK +A   K   AE  E
Sbjct  62   KSIVESLIILEYIDDTWKNN--PILPRDPHQRAVARFWAKFIDEKLLATGMKASLAEGKE  119

Query  391  KA--RDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            K    +E+   + LL +ELNGK  FGGE++GLVDI A VV +W  V  E  G+EV+++EK
Sbjct  120  KELLNEEILEQMKLLENELNGKDFFGGEAIGLVDIVATVVAFWFPVSHEVLGVEVITQEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
               + +W+  L  +  V+ ++ PPR+K +A+ +AR+ G
Sbjct  180  FPVLLKWIGKL-QEIDVVSQSRPPREKHVAHVRARMEG  216



>gb|KEH28979.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=220

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 157/217 (72%), Gaps = 7/217 (3%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV +LG   SPFS R+++ALKLKG+ Y + +E     NKS  LLKYNPV+KK+P+L+
Sbjct  5    NQEEVRLLGKWASPFSNRIDLALKLKGVPYKYSEEN--LANKSDDLLKYNPVYKKVPILV  62

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HNG  +AESLIILEYIDETW NN  PLL +DPY+RA ARFW+K +D+K + A     +++
Sbjct  63   HNGNPIAESLIILEYIDETWKNN--PLLSEDPYERALARFWSKTLDDKILPAIWNACWSD  120

Query  382  ES--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
            E   EKA +E   AL +L DE+  K  FGGE++GLVDIAA  +GYW+ ++QE AGLE+L+
Sbjct  121  EKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVDIAANFIGYWVYILQEIAGLELLT  180

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             EK  K+Y+W +  ++   VIKE LPPRD+L A+++A
Sbjct  181  LEKFPKVYKWSQEFINH-PVIKEGLPPRDELFAFFKA  216



>ref|XP_006576598.1| PREDICTED: probable glutathione S-transferase-like isoform X1 
[Glycine max]
Length=226

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = +1

Query  19   RNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVL  198
            ++  EVE+ G   SPF+ RV+IAL+LKG+QY +  EED R NKS LLLKYNPVHKK+PVL
Sbjct  3    KDYGEVELFGVGGSPFARRVQIALELKGVQYTYF-EEDLR-NKSALLLKYNPVHKKVPVL  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            +HNG+ LAESL+ILEYIDETW+N+  P+LP+ PY RA ARFW+++ID+KC+ A  K  + 
Sbjct  61   VHNGRPLAESLVILEYIDETWENHH-PILPQQPYDRALARFWSRYIDDKCLPAISKAAFT  119

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
               EE +K  +E   +L +L +EL  K  FGGE++ +VDIAA  + +W+  I+EA GL++
Sbjct  120  VDKEERDKGTEESLESLQILENELKHK-FFGGETIDIVDIAAGFIAFWLPAIEEAVGLKL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            L+ EK  K+Y+W E   +   ++K+NLP RD+L+ +++AR
Sbjct  179  LTNEKFPKLYKWGED-YTNHPIVKKNLPQRDRLVGFFKAR  217



>ref|NP_001238675.1| glutathione S-transferase GST 8 [Glycine max]
 gb|AAG34798.1|AF243363_1 glutathione S-transferase GST 8 [Glycine max]
Length=225

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 153/218 (70%), Gaps = 8/218 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  EV +LG   SPF  RV IALKLKG+QY ++ EE+ R NKS LLLK NPVHKK+PV +
Sbjct  4    SQEEVTLLGATGSPFVCRVHIALKLKGVQYKYV-EENLR-NKSELLLKSNPVHKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A  K ++  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVFGAAWKSVFTA  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +E+  K  FGGE +GLVDIAA+ + +W+ ++QE AGLE+ 
Sbjct  120  DEKEREKNVEEAIEALQFLENEIKDKKFFGGEEIGLVDIAAVYIAFWVPMVQEIAGLELF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            + EK  K++ W +  ++   ++KE+LPPRD + ++++ 
Sbjct  180  TSEKFPKLHNWSQEFLNH-PIVKESLPPRDPVFSFFKG  216



>gb|KDO66686.1| hypothetical protein CISIN_1g041800mg [Citrus sinensis]
Length=223

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G  +SPFS R+E+ALKLKG+ +++I  +    NKSP LLKYNP+HKKIPVL+HNG
Sbjct  5    EVKLYGTWVSPFSRRIELALKLKGVPFEYIGVD--LSNKSPELLKYNPIHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+ ESLIILEYID+TW NN  P+LP+DP+QRA ARFWAKFIDEK +A   K   AE  E
Sbjct  63   KSIVESLIILEYIDDTWKNN--PILPRDPHQRAVARFWAKFIDEKLLATGMKASLAEGKE  120

Query  391  KA--RDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            K    +E+   + LL +ELNGK  FGGE++GLVDI A VV +W  +  E  G+EV+++EK
Sbjct  121  KELLNEEILEQMKLLENELNGKDFFGGEAIGLVDIVATVVAFWFPISHEVLGVEVITQEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
               + +W+  L  +  V+ ++ PPR+K +A+ +AR+ G
Sbjct  181  FPVLLKWIGKL-QEIDVVNQSRPPREKHVAHVRARMEG  217



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 151/215 (70%), Gaps = 7/215 (3%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++ G   SPFS RVEIAL++KGI+Y+F++E+    +KS  L KYNP+HKK+PVL+H+GK
Sbjct  3    VKIYGTWASPFSMRVEIALQIKGIEYEFVEED--LLHKSDELAKYNPIHKKVPVLIHDGK  60

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--ES  387
             + ESL+ILEYIDETW  N  P+LP D YQ+AQARFWAKF+D+K     R  L +E  ES
Sbjct  61   VMVESLVILEYIDETWKAN--PILPTDAYQKAQARFWAKFVDDKVTPLVRSALMSEGEES  118

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA  ++   L +L  E+ GK  FGG+S+G +DI A +V +WI  +QE  G EV+++EK 
Sbjct  119  EKAIPQLDEVLQILESEIKGKQFFGGKSIGYLDIVASMVPFWITCLQEVVGKEVITKEKF  178

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              I  W + L+  CSV+K+N+P  D+L  +YQAR 
Sbjct  179  PSISSWADELLG-CSVMKQNVPHHDRLKEFYQARF  212



>gb|KHG28543.1| Glutathione S-transferase U8 -like protein [Gossypium arboreum]
Length=216

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 156/216 (72%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SPFS +VE+AL+LKG+ YD+I EED   NKS LL +YNPVHKK+PVLLHNG
Sbjct  4    EVKVFGAWASPFSRKVELALRLKGVPYDYI-EEDLN-NKSSLLWQYNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+AES++ILEYI+ETW   T P+LP+DP  +A+ARFW  FID KC +A RK+ ++ E E
Sbjct  62   KSIAESIVILEYIEETW--KTYPILPQDPNDKAKARFWINFIDGKCSSAIRKVAFSPEEE  119

Query  391  KARDEVQG--ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +   +    L  L   LNGK  FGG+++G+VDI A+ + +W+   QE  GLE+LS EK
Sbjct  120  REKAVEEACECLKTLESALNGKKFFGGDTIGMVDIVALFIAFWLRPFQEIMGLELLSSEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +++W +  +S CS++KE LPPRDKL+A+ +A +
Sbjct  180  FPNLFKWTDDFVS-CSIVKELLPPRDKLVAHIKAHL  214



>ref|XP_006424951.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
 gb|ESR38191.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
Length=228

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 152/225 (68%), Gaps = 7/225 (3%)
 Frame = +1

Query  4    KAIQLRNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHK  183
            K   L    EV++ G   SPFS R+E+ALKLKG+ +++I EED   NKSP LLKYNP HK
Sbjct  1    KCKTLTMAEEVKLYGTWSSPFSRRIELALKLKGVPFEYI-EEDLS-NKSPELLKYNPAHK  58

Query  184  KIPVLLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATR  363
            KIPVL+HN K +AES +ILEYIDE W+NN  P+LP+DPYQRA ARFW KFIDEK +A   
Sbjct  59   KIPVLVHNSKPIAESQVILEYIDEIWNNN--PILPQDPYQRAMARFWGKFIDEKVLATRM  116

Query  364  KILYAE--ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAA  537
            K  +AE  E E   +E    +  L +ELNGK  FGGE++G VDI AIVV  W  + QE  
Sbjct  117  KANFAEGKERELVTEEFFQQMEFLENELNGKDFFGGETIGFVDIVAIVVAIWFPLTQEVL  176

Query  538  GLEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            G++  + EK   +++W+  + ++  V+ E  PPR+K LAY +ARI
Sbjct  177  GVDTFTEEKFPVLFKWIRKI-TEIDVVNECRPPREKHLAYVKARI  220



>ref|XP_003529123.1| PREDICTED: probable glutathione S-transferase-like [Glycine max]
Length=225

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 152/216 (70%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG++Y F++E     NKS LLLKYNPVHKK+PV +HN 
Sbjct  7    DVKLLGIVGSPFVCRVQIALKLKGVEYKFLEEN--LGNKSDLLLKYNPVHKKVPVFVHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            + +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K ++    +
Sbjct  65   QPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGGE  GLVDIAA+ + +WI + QE AGL++ + E
Sbjct  123  EREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +Y+W E  ++   +++E LPPRD L  +++AR
Sbjct  183  KFPILYKWSEESLNH-PLVQEVLPPRDPLFTFFKAR  217



>ref|XP_003529124.1| PREDICTED: probable glutathione S-transferase-like [Glycine max]
Length=225

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 152/216 (70%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG+QY F+ E++ R NKS LLLK NPVHKK+PV +HN 
Sbjct  7    DVKLLGIVGSPFVCRVKIALKLKGVQYKFL-EQNLR-NKSELLLKSNPVHKKVPVFIHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K +AESL+I+EYIDETW NN  P+LP DPYQR  ARFW+KFID+K V A  K ++    +
Sbjct  65   KPIAESLVIVEYIDETWKNN--PILPSDPYQRTLARFWSKFIDDKIVGAVLKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGGE  GLVDIAA+ + +WI + QE AGL++ + E
Sbjct  123  EREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +Y+W +  ++   +++E LPPRD L  +++AR
Sbjct  183  KFPILYKWSQEFLNH-PLVQEVLPPRDPLFTFFKAR  217



>ref|XP_003623208.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AES79426.1| glutathione S-transferase [Medicago truncatula]
 gb|AFK36177.1| unknown [Medicago truncatula]
Length=225

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 159/220 (72%), Gaps = 10/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPF  RV+IALKLKGI+Y F++E     NKS LLLKYNPV+KKIPV +
Sbjct  4    NQEEVKLLGAIGSPFVCRVQIALKLKGIEYKFLEEN--MANKSELLLKYNPVYKKIPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN K ++ESL+I+EYIDETW  N  P+LP DPYQRA ARFW+ FID+K +AA+ K ++  
Sbjct  62   HNEKPISESLLIIEYIDETWKQN--PILPSDPYQRALARFWSNFIDDKIIAASIKAVHTV  119

Query  382  ESEKARDE-VQG---ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
              EK R++ V+G   AL +L +EL  K  FGGE +G+VDIAA+ + +WI +IQE  GL++
Sbjct  120  HDEKEREKNVEGTIEALQILENELKDK-FFGGEEIGIVDIAAVYIAFWIPLIQEITGLQL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            L+ EK  K+ +W +  ++   ++KEN+PPR+ L AY++A 
Sbjct  179  LNAEKCPKLSKWSQEFLNH-PIVKENMPPREPLFAYFKAH  217



>gb|KHN47446.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 160/220 (73%), Gaps = 8/220 (4%)
 Frame = +1

Query  19   RNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVL  198
            ++  EVE+ G   SPF+ RV+IAL+LKG+QY +  EED R NKS LLLKYNPVHKK+PVL
Sbjct  3    KDYGEVELFGVGGSPFARRVQIALELKGVQYTYF-EEDLR-NKSALLLKYNPVHKKVPVL  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            +HNG+ LAESL+ILEYIDETW+N+  P+LP+ PY RA ARFW+++ID+KC+ A  K  + 
Sbjct  61   VHNGRPLAESLVILEYIDETWENHH-PILPQQPYDRALARFWSRYIDDKCLPAISKAAFT  119

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
               EE +K  +E   +L +L +EL     FGGE++ +VDIAA  + +W+  I+EA GL++
Sbjct  120  VDKEERDKGTEESLESLQILENELK-HNFFGGETIDIVDIAAGFIAFWLPAIEEAVGLKL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            L+ EK  K+Y+W E   +   ++K+NLP RD+L+ +++AR
Sbjct  179  LTNEKFPKLYKWGED-YTNHPIVKKNLPQRDRLVGFFKAR  217



>gb|KHN05112.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 151/216 (70%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG++Y F++E     NKS LLLKYNPVHKK+PV +HN 
Sbjct  7    DVKLLGIVGSPFVCRVQIALKLKGVEYKFLEEN--LGNKSDLLLKYNPVHKKVPVFVHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K ++    +
Sbjct  65   KPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGGE  GLVDIAA+ + +WI + QE AGL++ + E
Sbjct  123  EREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +Y+W +  ++    ++E LPPRD L  +++AR
Sbjct  183  KFPILYKWSQESLNH-PFVQEVLPPRDPLFTFFKAR  217



>gb|ACU15816.1| unknown [Glycine max]
Length=228

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 151/216 (70%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG++Y F++E     NKS LLLKYNPVHKK+PV +HN 
Sbjct  7    DVKLLGIVGSPFVCRVQIALKLKGVEYKFLEEN--LGNKSDLLLKYNPVHKKVPVFVHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K +AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K V A  K ++    +
Sbjct  65   KPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGGE  GLVDIAA+ + +WI + QE AGL++ + E
Sbjct  123  EREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K   +Y+W +  ++    ++E LPPRD L  +++AR
Sbjct  183  KFPILYKWSQESLNH-PFVQEVLPPRDPLFTFFKAR  217



>ref|XP_006488417.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=222

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 150/216 (69%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R+E+ALKLKG+ +++I EED   NKSP LLKYNP HKKIPVL+HN 
Sbjct  4    EVKLYGTWSSPFSRRIELALKLKGVPFEYI-EEDLS-NKSPELLKYNPAHKKIPVLVHNS  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AES +ILEYIDE W+NN  P+LP+DPYQRA ARFW KFIDEK +A   K  +AE  E
Sbjct  62   KPIAESQVILEYIDEIWNNN--PILPQDPYQRAMARFWGKFIDEKVLATRMKANFAEGKE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E   +E    +  L +ELNGK  FGGE++G VDI AIVV  W  + QE  G++  + EK
Sbjct  120  RELVTEEFFQQMEFLENELNGKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVDTFTEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +++W+  + ++  V+ E  PPR+K LAY +ARI
Sbjct  180  FPVLFKWIRKI-TEIDVVNECRPPREKHLAYVKARI  214



>ref|XP_007140455.1| hypothetical protein PHAVU_008G113700g [Phaseolus vulgaris]
 gb|ESW12449.1| hypothetical protein PHAVU_008G113700g [Phaseolus vulgaris]
Length=225

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (69%), Gaps = 8/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPF  R  IALK KGI+Y+F++E     NKS  LLKYNPVHKK+PV +
Sbjct  4    NQGEVKLLGVLGSPFVCRARIALKFKGIEYEFVEEN--LANKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AES+II+EYIDETW+NN  P+ P DP+Q+A ARFW+KFID+K V A  K  +  
Sbjct  62   HNEKPIAESMIIVEYIDETWNNN--PISPSDPHQKALARFWSKFIDDKVVGAAWKSAFTV  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK   E    L  L DE+  K  FGGE +GLVDIA + + +W+ ++QE AGL++L
Sbjct  120  DEKEREKNLQEALEGLQFLEDEIKEKKFFGGEEIGLVDIAGVFIAFWMPIVQEIAGLQLL  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            S EK   +Y+W + L++  SV+KE LPPR+ L A+++ R
Sbjct  180  SSEKFPNLYKWSQELINH-SVVKEVLPPREPLFAFFKGR  217



>ref|NP_001237856.1| uncharacterized protein LOC100500680 [Glycine max]
 gb|ACU15822.1| unknown [Glycine max]
Length=225

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 147/216 (68%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKGI+Y F++E     NKS LLLK NPVHKK+PV +HN 
Sbjct  7    DVKLLGVVGSPFVCRVQIALKLKGIEYKFVEEN--LANKSDLLLKSNPVHKKVPVFIHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K +AESL+I+EYIDETW NN  P+LP +PY RA ARFW+KFID+K   A  K ++    +
Sbjct  65   KPIAESLVIVEYIDETWKNN--PILPSEPYHRALARFWSKFIDDKVFGAAWKSVFTLDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL     FGGE  GLVDIAAI + +WI + QE AGL++ + E
Sbjct  123  EREKNVEESLEALQFLENELKDNKFFGGEEFGLVDIAAIFIAFWIPIFQEIAGLQIFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K  K+Y+W +  MS   V+KE LPPRD L    QAR
Sbjct  183  KFPKLYKWSQEFMSH-PVVKEVLPPRDPLFCLLQAR  217



>ref|XP_011077664.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=253

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 158/213 (74%), Gaps = 9/213 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +M EV+VLG   SPFS RVE+ALKLKG++Y++++E+    NKSPLLLK+NPVHKK+PVLL
Sbjct  27   SMGEVKVLGAWGSPFSRRVEMALKLKGVEYEYMEED--LINKSPLLLKHNPVHKKLPVLL  84

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN   +A+SL+ILEYIDETW+    P+LPKDPY+R++ARFWAKF+D++C+ A  K  ++ 
Sbjct  85   HNANPIADSLVILEYIDETWEG--PPILPKDPYERSKARFWAKFVDDECLPAMWKACWSS  142

Query  382  ESEKARDEVQGA--LNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGL--EV  549
              E+ + + +    L  L  E+ GK  FGG+++G+VDIAA  + YW  +I E  GL  EV
Sbjct  143  GEEREKAKEEAVELLKFLDSEIKGKKWFGGDNIGIVDIAANFIAYWFGIIAEVVGLVDEV  202

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKL  648
            +++EKH  + +W+E   +KCS +KEN+PP+DKL
Sbjct  203  ITQEKHPNLCKWIEK-YNKCSFVKENVPPKDKL  234



>ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like [Elaeis guineensis]
Length=226

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 156/215 (73%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFS RVE+AL+LKGI YD++ EED   NKSP LLKYNP+HKKIPVLLH G
Sbjct  4    ELKLFGVWGSPFSRRVELALRLKGIPYDYM-EEDLS-NKSPSLLKYNPIHKKIPVLLHGG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K + ESL+ILEYI+ETW+ N A +LPKDPY+RA ARFWA+F+D+KC+ A     + E   
Sbjct  62   KPVVESLVILEYIEETWEGNHA-ILPKDPYERAMARFWARFLDDKCMPAMWMSCWTEGDA  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +    E +  L++L  EL GK  FGG ++GLVDIAA+ + +W  V+QE AG+ +++ EK
Sbjct  121  QQNFMKESKENLSILEGELKGKKFFGGNAIGLVDIAALFIAHWAGVLQEVAGISLVNEEK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            H  +++W+E  +S   ++ E LP R++LLA++QA+
Sbjct  181  HPILFKWIEEFISS-DIVVECLPARERLLAFFQAK  214



>gb|AFK49084.1| unknown [Medicago truncatula]
Length=220

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 156/217 (72%), Gaps = 7/217 (3%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV +LG   SPFS R+++ALKL+G+ Y + +E     NKS  LLKYNPV+KK+P+L+
Sbjct  5    NQEEVRLLGKWASPFSNRIDLALKLEGVPYKYSEEN--LANKSDDLLKYNPVYKKVPILV  62

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HNG  +AESLIILEYIDETW NN  PLL +DPY+RA ARFW K +D+K + A     +++
Sbjct  63   HNGNPIAESLIILEYIDETWKNN--PLLSEDPYERALARFWFKTLDDKILPAIWNACWSD  120

Query  382  ES--EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
            E   EKA +E   AL +L DE+  K  FGGE++GLVDIAA  +GYW+ ++QE AGLE+L+
Sbjct  121  EKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVDIAANFIGYWVYILQEIAGLELLT  180

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             EK  K+Y+W +  ++   VIKE LPPRD+L A+++A
Sbjct  181  LEKFPKVYKWSQEFINH-PVIKEGLPPRDELFAFFKA  216



>ref|XP_009591433.1| PREDICTED: glutathione S-transferase U8-like [Nicotiana tomentosiformis]
Length=223

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 159/221 (72%), Gaps = 10/221 (5%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M E+++LG   SPFS RVEIALKLKGIQY++I+E+    NKS  LLKYNPVHKKIP++LH
Sbjct  1    MEEIKLLGSWASPFSLRVEIALKLKGIQYEYIEED--LLNKSATLLKYNPVHKKIPLILH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK +AESL+ILEYIDETW + + PLLPKD  QRA ARFWA F+DEKC+   +K+ Y E 
Sbjct  59   NGKPIAESLVILEYIDETWKDES-PLLPKDHNQRAMARFWANFLDEKCLPEMKKLCY-ES  116

Query  385  SEKARDEVQGALNLLVDE-----LNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
            + + R++ +G L+ L+       +  K  FG   VG ++I +I++ YW+ VIQEA  +++
Sbjct  117  NNEIREKARGELHELLKLLENEIIKDKNFFGVNKVGYIEIVSILITYWLGVIQEALKVDI  176

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            L++E+   I  W E ++S  S IKENLPPR+KLLA+Y+  +
Sbjct  177  LTKEEFPNICAWAENVIS-FSFIKENLPPREKLLAFYKMYV  216



>gb|ACU24385.1| unknown [Glycine max]
Length=206

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 148/205 (72%), Gaps = 8/205 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV +LG   SPF  RV IALKLKG++Y ++ EE+ R NKS LLLK NPVHKKIPV +HNG
Sbjct  7    EVTLLGATGSPFVCRVHIALKLKGVEYKYV-EENLR-NKSELLLKSNPVHKKIPVFIHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            KS+AESL+I+EYIDETW NN  P+LP DPYQRA ARFW+KFID+K   A+ K ++    +
Sbjct  65   KSIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKVFGASWKAVFTADEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +E+  K  FGGE +GLVDIAA+ + +W+ ++QE AGLE+ + E
Sbjct  123  EREKNVEEAIDALQFLENEIKDKKFFGGEEIGLVDIAAVYIAFWVPMVQEIAGLELFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPP  636
            K  K++ W +  ++   ++KE+LPP
Sbjct  183  KFPKLHNWSQEFLNH-PIVKESLPP  206



>emb|CAN62219.1| hypothetical protein VITISV_042912 [Vitis vinifera]
Length=221

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 156/217 (72%), Gaps = 9/217 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++ G   S F  RVE+AL+LKG+Q+++++E+ Y  NKSP LLKYNPVHKKIPVLLHNG
Sbjct  4    QVQLFGVWGSFFGRRVEVALRLKGVQFEYVEEDLY--NKSPSLLKYNPVHKKIPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
              LAESL+ILEYIDETW +N  P+ PKDPY+RA+ARFWAKFIDEK     RK L ++E +
Sbjct  62   NPLAESLVILEYIDETWKHN--PIFPKDPYERARARFWAKFIDEKLWPVVRKALGSKEEK  119

Query  391  KARD---EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            + R+   E    L  L  EL  K  FGGES G +DIAA+V+  W+ + QEA G+E + +E
Sbjct  120  EQREAIGETHEHLETLESELKEKKFFGGESRGYLDIAAMVI-IWLGIAQEALGVEFIPKE  178

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K  +++EW + L+   +V KE +PPR+KL A+++AR 
Sbjct  179  KFPRLHEWQQRLVED-AVFKECVPPREKLGAFFKARF  214



>ref|XP_004492380.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=225

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 154/220 (70%), Gaps = 10/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  +V++LG   S F  RV+IALKLKGIQY F++E     NKS LLLKYNPV+KKIPV +
Sbjct  4    NQDDVKLLGAVGSAFVCRVQIALKLKGIQYKFLEEN--MANKSDLLLKYNPVYKKIPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN K ++ESL+ILEYIDETW  N  P+LP DPY+RA ARFW+KFID+K +A + K ++  
Sbjct  62   HNDKPVSESLVILEYIDETWKQN--PILPSDPYRRALARFWSKFIDDKIIATSIKAVHTV  119

Query  382  ESEKAR----DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
            + EK R    +E   AL +L +EL  K  FGGE++G VDIAA+ + +WI +IQ+  GL++
Sbjct  120  DDEKEREKNVEESSEALQILENELKDK-FFGGENIGFVDIAAVYIAFWIPLIQDITGLQL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             + EK   +Y+W    ++   ++KEN+PPRD + AY++A 
Sbjct  179  FNAEKCPNLYKWSHEFLNH-PIVKENMPPRDPIFAYFKAH  217



>ref|NP_187538.1| glutathione S-transferase TAU 8 [Arabidopsis thaliana]
 sp|Q9SR36.1|GSTU8_ARATH RecName: Full=Glutathione S-transferase U8; Short=AtGSTU8; AltName: 
Full=GST class-tau member 8 [Arabidopsis thaliana]
 gb|AAF14025.1|AC011436_9 putative glutathione transferase [Arabidopsis thaliana]
 gb|AAM63323.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|ABD60727.1| At3g09270 [Arabidopsis thaliana]
 gb|AEE74745.1| glutathione S-transferase TAU 8 [Arabidopsis thaliana]
Length=224

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 155/213 (73%), Gaps = 5/213 (2%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPFS RVE+ LKLKGI Y++I+E+ Y  N+SP+LLKYNP+HKK+PVL+HNG+
Sbjct  7    VKLLGLWGSPFSKRVEMVLKLKGIPYEYIEEDVYG-NRSPMLLKYNPIHKKVPVLIHNGR  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESEK  393
            S+AESL+I+EYI++TW   T  +LP+DPY+RA ARFWAK++DEK + A +K  +  ESE+
Sbjct  66   SIAESLVIVEYIEDTW-KTTHTILPQDPYERAMARFWAKYVDEKVMLAVKKACWGPESER  124

Query  394  ARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
             ++  E    L  L  EL  K  FGGE++G VDIAA  +GYW+ + QEA+G+ +++ E+ 
Sbjct  125  EKEVKEAYEGLKCLEKELGDKLFFGGETIGFVDIAADFIGYWLGIFQEASGVTIMTAEEF  184

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             K+  W E  +   + IKE LPP++KL+A  +A
Sbjct  185  PKLQRWSEDFVGN-NFIKEVLPPKEKLVAVLKA  216



>gb|ACJ86006.1| unknown [Medicago truncatula]
 gb|AFK37765.1| unknown [Medicago truncatula]
 gb|AFK44018.1| unknown [Medicago truncatula]
 gb|KEH28980.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=225

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = +1

Query  19   RNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVL  198
            ++  EV++LG   SPF  RV+IALKLKGI+Y +I EE+ R NKS LLLKYNP+HKK+PV 
Sbjct  3    KDQGEVQLLGVGGSPFVRRVQIALKLKGIEYTYI-EENLR-NKSDLLLKYNPIHKKVPVF  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            +HNGK LAESL+ILEYIDETW+N   P+ P+ PY++A ARFW++FID+K + A  K  + 
Sbjct  61   VHNGKPLAESLVILEYIDETWEN--YPIFPQQPYEKALARFWSRFIDDKILPAISKAAWT  118

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
               EE EK  +E   AL  L +EL  K  FGGE++ +VDIAA  + +W+  I+EA GL+V
Sbjct  119  VNKEEREKGIEESLQALQFLENELKHK-FFGGENISIVDIAASYLAFWLPAIEEAVGLKV  177

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            LS +K  K+Y+W +   +   ++KENLPP+D LL ++++R
Sbjct  178  LSSDKFPKLYKWSQEF-NNHPIVKENLPPKDGLLGFFKSR  216



>gb|AFK47387.1| unknown [Medicago truncatula]
Length=225

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 150/219 (68%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N   V++LG   SPF  RV+IALKLKGI+Y+F++E      KS LLLKYNPVHKK+PV +
Sbjct  4    NQEHVKLLGATGSPFVCRVQIALKLKGIEYEFLEEN--LATKSELLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDE W  N  P+LP DP+QRA ARFW+KFID+K V+A+ K ++  
Sbjct  62   HNDKPISESLVILEYIDEVWKQN--PILPTDPHQRALARFWSKFIDDKIVSASSKSVFTL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +EL GK  FGGE    VDIAA+ V +WI ++Q+  GL++ 
Sbjct  120  DEKEREKNVEETTEALQFLQNELKGK-YFGGEEFNFVDIAAVFVAFWIPLVQDIIGLQLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y W +  +    V+KE +PPR+ L A+++ R
Sbjct  179  TAEKFPKLYNWSQEFLDH-PVVKETIPPREPLFAFFKGR  216



>ref|XP_007134772.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
 gb|ESW06766.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
Length=224

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 157/219 (72%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            +  +VE+ G   SP++ RV+IAL+LKGIQY +  EED R NKS LLLKYNP+HKK+PVL+
Sbjct  4    HYGDVELFGVRGSPYAVRVQIALELKGIQYTYF-EEDLR-NKSDLLLKYNPIHKKVPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HNG+ LAESL+ILEYIDETW N+  P+ P+ PY RA ARFW++FID+KC+ A  K  +  
Sbjct  62   HNGRPLAESLVILEYIDETWGNH--PIFPQQPYHRALARFWSRFIDDKCLPAILKAAFTA  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              EE +K  +E   AL +L DEL  K  FGGES+GLVDIAA  + +W+  I+EA GL++L
Sbjct  120  NEEERQKGTEESLDALQILEDELKQK-FFGGESIGLVDIAAGFIAFWLPAIEEAVGLKLL  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              +K  K+ +W E   +   V+KE+LP R++++ +++AR
Sbjct  179  ISQKFPKLSKWSEE-YTNHPVVKESLPQRERVVGFFKAR  216



>ref|XP_006366496.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=224

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 152/218 (70%), Gaps = 5/218 (2%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV V G    PF+ RVE+ALKLKG++Y++I+E+  R NKS  L+KYNP++K++PVL+H
Sbjct  1    MGEVNVHGIFAGPFNKRVELALKLKGVKYEYIEED--RSNKSDELVKYNPIYKQVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK + ES+IILEYID+TW++NT PLLPK+PYQR+ ARF AK IDEK + A  K+ Y   
Sbjct  59   NGKPICESIIILEYIDDTWESNTIPLLPKNPYQRSMARFLAKLIDEKLMGAMYKVCYGKG  118

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  DE    L    +EL  K  FGG+++G +DI A  +  W   IQEA G+E+L+ 
Sbjct  119  EEKEKGCDETLEVLKYFDNELQNKKFFGGDNLGFIDIVASYIALWFGAIQEAIGMELLTE  178

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +K  K+ +W++  +S   ++KENLP R+ L+  Y+A+ 
Sbjct  179  QKFPKLSKWIDEFLS-SRIVKENLPTREVLVPLYKAQF  215



>ref|XP_009789711.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 159/218 (73%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG  LSPFS RVE ALK+KG++Y+FI EED + NKSPLLL+ NP+HKKIPVL+H
Sbjct  1    MAEVKLLGVSLSPFSRRVEWALKIKGVEYEFI-EEDLQ-NKSPLLLQSNPIHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK ++ES+IILEYIDET++  +  +LPKDPY+RA ARFWA F+D KC+    K L+   
Sbjct  59   NGKPISESMIILEYIDETFEGPS--ILPKDPYERALARFWANFLDVKCITTIGKALFGKG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EES+KA++E    L +L +EL  K  F G++ G  DIAA ++ +W+ +++EA+G+ +++ 
Sbjct  117  EESDKAKEECGELLKILDNELKDKKFFVGDNFGYADIAANLMAFWLGILEEASGVILVTN  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK      W +  ++ CS +KE LP RD LLA++Q R 
Sbjct  177  EKFPNFCAWKDEYIN-CSQVKEYLPSRDALLAHFQPRF  213



>ref|XP_007134780.1| hypothetical protein PHAVU_010G075400g [Phaseolus vulgaris]
 gb|ESW06774.1| hypothetical protein PHAVU_010G075400g [Phaseolus vulgaris]
Length=220

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 155/215 (72%), Gaps = 7/215 (3%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
            SEV VLG   SPFS RV++ALKLKG+ Y + +E+    NKS  LLKYNPVHKK+PVL+HN
Sbjct  7    SEVRVLGKWASPFSNRVDLALKLKGVSYKYCEED--LANKSQDLLKYNPVHKKVPVLIHN  64

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES  387
            G  LAESL+I+EYIDETW NN  PLLP+DPY+RA A FWAK +D+K + A     +++E 
Sbjct  65   GNPLAESLVIVEYIDETWKNN--PLLPQDPYERALAHFWAKTLDDKILPAIWNACWSDEK  122

Query  388  EKARDEVQGALNLLVDE--LNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
             + + E +    L + +  L GK  FGGES+GLVDIAA  +GYW+ ++QE AGL++L+ E
Sbjct  123  GREKAEEEALEALEILQEALKGKRFFGGESIGLVDIAANFIGYWVAILQEIAGLKLLTLE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K  K+Y+W +  ++   VIKE LPPRD+L A+++A
Sbjct  183  KFPKLYKWSQEFLNH-PVIKEGLPPRDELFAFFKA  216



>ref|XP_008240102.1| PREDICTED: glutathione S-transferase U8-like [Prunus mume]
Length=220

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 156/215 (73%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++L    SPFS RVEIAL+LKG+QY+F  EED + NKS LLLK NPVHKKIPVLLHN 
Sbjct  4    EVKLLRVWGSPFSSRVEIALRLKGVQYEFF-EEDLQ-NKSALLLKSNPVHKKIPVLLHND  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEES  387
            K +AES ++LEYIDETW    + +LP+DPY+RA+ARFWA+FIDEKC+ A     + +EE 
Sbjct  62   KPIAESQVVLEYIDETWKQGFS-ILPEDPYERARARFWARFIDEKCLPAIWNACWGSEEH  120

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L LL  EL G   FGGE VGLVDI    + YW+  IQE  G+E+L++EK 
Sbjct  121  EKAVEEACELLKLLEHELKGNKFFGGEKVGLVDIVGNFIAYWLRAIQEVVGVEILTKEKL  180

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+Y+W +  +   +V++E+LPPRDKL+A+++ R 
Sbjct  181  PKLYDWSDEFV---NVLQESLPPRDKLVAFFRGRF  212



>gb|AAA87183.1| auxin-induced protein [Vigna radiata]
Length=230

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 150/210 (71%), Gaps = 8/210 (4%)
 Frame = +1

Query  58   SPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGKSLAESLII  237
            SPF  RV+IALKLKG++Y ++ EE++R NKS  LLKYNPVHKK+PV +H  K L ESL+I
Sbjct  21   SPFVCRVKIALKLKGVEYKYV-EENFR-NKSEQLLKYNPVHKKVPVFVHGDKPLPESLVI  78

Query  238  LEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---EESEKARDEV  408
            +EYIDETW+NN  P+L  DPYQRA ARFW+KFID+K V A+ K ++    +E EK   E 
Sbjct  79   VEYIDETWNNN--PILASDPYQRALARFWSKFIDDKIVGASWKSVFTVDEKEREKNIAET  136

Query  409  QGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKHAKIYEWM  588
              +L  L +E+  K  FGGE +GLVDIAA+ V +WI +IQE AGLE+L+ EK   +Y W 
Sbjct  137  YESLQFLENEIKEKKFFGGEELGLVDIAAVYVAFWIPLIQEIAGLELLTSEKFPNLYRWS  196

Query  589  EALMSKCSVIKENLPPRDKLLAYYQARIIG  678
            +  ++   ++KE+LPPRD + A+++ R  G
Sbjct  197  QEFLNH-PIVKESLPPRDPVFAFFKGRYEG  225



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   217 bits (553),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 154/216 (71%), Gaps = 7/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V+G   S F +R+E ALKL+GI+Y++++E D R NKSPLLLKYNPVHKK+PV LH
Sbjct  1    MGEVKVVGSSPSLFCYRIEWALKLQGIEYEYLKE-DLR-NKSPLLLKYNPVHKKVPVFLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE-  381
            NG+ +AESL+ILEYIDETW NN  PLLP+DP++RA ARFWAKF DEKC+      L AE 
Sbjct  59   NGRPIAESLVILEYIDETWKNN--PLLPEDPHERALARFWAKFGDEKCLMGAWAALCAEG  116

Query  382  -ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E EKA +     LN L  ++ GK  FGG+++G +D+    + +W+DV+ E  G+++   
Sbjct  117  PEKEKAVETAMETLNYLEKQIEGKKFFGGKTIGFLDLVIGWIPHWLDVLDEVGGMKLFDA  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            E+   ++EW +  + +  +IK+  PPRD+++AY+Q+
Sbjct  177  ERFPCLHEWAQNFI-QIPIIKDCHPPRDEMVAYFQS  211



>gb|AIS71913.1| hypothetical protein [Nicotiana tabacum]
Length=218

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 159/218 (73%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V G    PF+ RVE+ALKLKG++Y++I+E+  R NKS  LLKYNPV+K++PVL+H
Sbjct  1    MGEVKVYGIIAGPFNRRVELALKLKGVEYEYIEED--RSNKSAQLLKYNPVYKQVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK + ESLIILEYIDETW+ +T PLLPKDPYQRA ARFWAKFIDEK +AA  K++ ++ 
Sbjct  59   NGKPICESLIILEYIDETWE-DTCPLLPKDPYQRAMARFWAKFIDEKLLAAVYKLVSSKG  117

Query  385  SEKARDEVQGA--LNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             EK +   +    L  L +EL  K  FGG+++G +DI A  + +W   IQE+ GLE+L++
Sbjct  118  EEKEKGWEETTELLKFLENELQNKKFFGGDNIGFLDIVASYI-HWFGAIQESLGLELLTK  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+  K+ +W++  +S C +I ENLPPR+ L+  Y+A+ 
Sbjct  177  EQFPKLCKWIDEFLS-CRIIMENLPPRELLVPLYKAQF  213



>ref|XP_003623174.1| hypothetical protein MTR_7g065290 [Medicago truncatula]
 gb|ACJ86145.1| unknown [Medicago truncatula]
 gb|AES79392.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
 gb|AFK40393.1| unknown [Medicago truncatula]
Length=224

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (69%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV+V G   SPF  RVEIALKLKG++Y  I E++   N S  L KYNPV+KK+PV +
Sbjct  4    NKEEVKVFGLVESPFVTRVEIALKLKGVEY--IYEKEKFGNLSDTLKKYNPVYKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+ILEYIDETW  N  P+LP DPYQRA  RFW+  ID+KC++  RK  +  
Sbjct  62   HNDKPIAESLVILEYIDETWKQN--PILPSDPYQRALVRFWSNLIDDKCLSGVRKACFTL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK+ +E + AL  L +EL  K  FGGE +G VDIAA+++ +WI +IQEA GL++ 
Sbjct  120  DEKEREKSIEETKEALQFLENELKDK-FFGGEEIGFVDIAAVLIAFWIPIIQEAFGLKLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + E+  K+Y W +   +   ++KE LPPR+ LLA+Y+AR
Sbjct  179  TSEEFPKLYNWSQEF-NNHPIVKEKLPPRETLLAFYKAR  216



>ref|XP_010027076.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=232

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 150/218 (69%), Gaps = 5/218 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS+R+E+ALK+KG++Y++  E+     KS LLL+YNPVHKKIPVL+HNG
Sbjct  5    EVKLLGAWGSPFSWRLEVALKMKGVEYEYFDEDLMNRPKSSLLLEYNPVHKKIPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AESL+ILEYIDE W++    LLP+DP  RA ARFWAKF+D+KC  A  +    E  E
Sbjct  65   KPIAESLVILEYIDEIWNDRPVILLPQDPRDRAIARFWAKFMDDKCAPALWRSCRREGIE  124

Query  385  SEKARDEVQGALNLLVDELNGKT--LFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E A +E    LN+L  EL  K    FGG+++G VDIA   +GYWI VIQE AG+ +L+ 
Sbjct  125  RENAFEEACALLNVLEAELKDKQKRFFGGDTIGFVDIAGNFIGYWIGVIQEVAGVRLLTP  184

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   + +W         +IKENLPPR++L A+++AR 
Sbjct  185  EKFPLLCKWC-CEFQNFPIIKENLPPREQLFAFFKARF  221



>ref|XP_010024690.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=236

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 5/218 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS+RVE+ALK+KG++Y++  E+     KS LLL+YNPVHKKIPVL+HNG
Sbjct  5    EVKLLGAWGSPFSWRVEVALKMKGVEYEYFDEDLMNRPKSSLLLEYNPVHKKIPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            KS+AESL+ILEYIDE W++    LLP+DP  RA ARFWAKF+D+ CV A  +    E  E
Sbjct  65   KSIAESLVILEYIDEIWNDRPVILLPQDPRDRAIARFWAKFMDDNCVPALWRSCRREGIE  124

Query  385  SEKARDEVQGALNLLVDELNGKT--LFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E A +E    LN+L  EL  K    FGG+++G VDI    +GYWI VIQE AG+ +L+ 
Sbjct  125  RENAFEEAYALLNVLEAELRDKQKRFFGGDTIGFVDITGNFIGYWIGVIQEVAGVRLLTP  184

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   + +W         + KENLPPR++L A+++AR 
Sbjct  185  EKFPLLCKWC-CEFQNFPIFKENLPPREQLFAFFKARF  221



>ref|XP_006407694.1| hypothetical protein EUTSA_v10021472mg [Eutrema salsugineum]
 gb|ESQ49147.1| hypothetical protein EUTSA_v10021472mg [Eutrema salsugineum]
Length=224

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 153/215 (71%), Gaps = 5/215 (2%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPFS RVE+ LKLKGI Y++I EED   NKSP+LLKYNP+HKK+PVL+H GK
Sbjct  7    VKLLGLWGSPFSKRVEMVLKLKGIPYEYI-EEDVYGNKSPMLLKYNPIHKKVPVLIHGGK  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESEK  393
             +AESL+I+EYI++TW   + P+LP+DPY+R+ ARFWAK++DEK + A  K  +  ESE+
Sbjct  66   CIAESLVIVEYIEDTW-KTSYPILPQDPYERSMARFWAKYVDEKVMLALWKACWGPESER  124

Query  394  AR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
             +  +E    L  L  EL  K  FGGE++G VDIAA  +GYW+ ++QEA+G+ +++ EK 
Sbjct  125  EKLVEEAYEGLKCLETELGEKRFFGGETIGFVDIAADFIGYWLGIVQEASGVTIMTAEKF  184

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+  W E  +   +VIKE LPP+ KL A  +A+ 
Sbjct  185  LKLQRWSEDFVGN-NVIKEVLPPKQKLAALLKAQF  218



>gb|KCW61132.1| hypothetical protein EUGRSUZ_H03905, partial [Eucalyptus grandis]
Length=233

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 149/218 (68%), Gaps = 5/218 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS+RVE+ALK+KG++Y++  E+     KS LLL+YNPVHKKIPVL+HNG
Sbjct  2    EVKLLGAWGSPFSWRVEVALKMKGVEYEYFDEDLMNRPKSSLLLEYNPVHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            KS+AESL+ILEYIDE W++    LLP+DP  RA ARFWAKF+D+ CV A  +    E  E
Sbjct  62   KSIAESLVILEYIDEIWNDRPVILLPQDPRDRAIARFWAKFMDDNCVPALWRSCRREGIE  121

Query  385  SEKARDEVQGALNLLVDELNGKT--LFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E A +E    LN+L  EL  K    FGG+++G VDI    +GYWI VIQE AG+ +L+ 
Sbjct  122  RENAFEEAYALLNVLEAELRDKQKRFFGGDTIGFVDITGNFIGYWIGVIQEVAGVRLLTP  181

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   + +W         + KENLPPR++L A+++AR 
Sbjct  182  EKFPLLCKWC-CEFQNFPIFKENLPPREQLFAFFKARF  218



>ref|XP_006572808.1| PREDICTED: uncharacterized protein LOC100306119 isoform X1 [Glycine 
max]
 gb|KHN06031.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 9/221 (4%)
 Frame = +1

Query  19   RNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVL  198
            ++  EVE+ G   SPF+ RV+IAL+LKG+QY +  EED R NKS LL+KYNP+HKK+PVL
Sbjct  3    KDYGEVELFGVGGSPFARRVQIALELKGVQYTYF-EEDLR-NKSDLLIKYNPIHKKVPVL  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            +HNG+ LAESL+ILEYIDETW+N+  P+LP+ PY RA ARFW++FID+KC+ A  K  + 
Sbjct  61   VHNGRPLAESLVILEYIDETWENHH-PILPQQPYDRALARFWSRFIDDKCMPAISKAAFT  119

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGE-SVGLVDIAAIVVGYWIDVIQEAAGLE  546
               EE +K  +E   +L +L + L  K  FGGE ++G+VDIAA  + +W+  I+EA GL+
Sbjct  120  ADKEERDKGTEESLESLQILENVLKHK-FFGGETTIGIVDIAAGFIAFWLPAIEEAVGLK  178

Query  547  VLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            +L+ EK  K+Y+W E   +   V+K+NLP RD+++ +++AR
Sbjct  179  LLTNEKFPKLYKWGED-YTNHPVVKKNLPQRDRVVGFFKAR  218



>ref|XP_002520474.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41887.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 151/211 (72%), Gaps = 7/211 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+E+ALKLKGIQY++I EED   NKSPLLL  NPVHKKIPVL+HNG
Sbjct  4    EVKLLGAWASPFSHRIELALKLKGIQYEYI-EEDLS-NKSPLLLSTNPVHKKIPVLIHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AESL+ILEYI+ETW +N  P+LPKDPY RA ARFWAKF+DEK +    K   A+E E
Sbjct  62   KPIAESLVILEYIEETWQSN--PILPKDPYDRAVARFWAKFVDEKILQTASKFRSAKEEE  119

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            K +  +E+   L +L +EL G+  FGGES+G VDI    + +W  + QE   +E +S EK
Sbjct  120  KLQIFEELGQHLKVLENELRGREFFGGESIGFVDIVIFFIVHWFQLRQEVMQIEFISNEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
               + +++E L  +  V+KE+LPP++K LA+
Sbjct  180  FPVLCKYLEKL-HEIDVVKESLPPKEKHLAF  209



>ref|XP_009618409.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=220

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG  LSPFS RVE ALK+KG++Y+FI EED + NKSPLLL+ NPVH+KIPVL+H
Sbjct  1    MAEVKLLGVSLSPFSRRVEWALKIKGVEYEFI-EEDLQ-NKSPLLLQSNPVHQKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK ++ES+IILEYIDET++  +  +LPKDPY RA ARFWA F+D KC+    K L+   
Sbjct  59   NGKPISESMIILEYIDETFEGPS--ILPKDPYDRALARFWANFLDVKCITTIGKALFGKG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EES+KA++E    L +L +EL  K  F G++ G  DIAA ++ +W+ +++EA+G+ +++ 
Sbjct  117  EESDKAKEESSELLKILDNELKDKKFFVGDNFGFADIAANLMAFWLGILEEASGVILVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK      W +  ++ CS +K+ LP RD LLA++Q R 
Sbjct  177  EKFPNFCAWKDEYIN-CSQVKKYLPSRDVLLAHFQTRF  213



>ref|XP_009613724.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=218

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V G    PF+ RVE+ALKLKG++Y++I+E+  R NKS  LLKYNPV+K++PVL+H
Sbjct  1    MGEVKVYGIIAGPFNRRVELALKLKGVEYEYIEED--RSNKSAQLLKYNPVYKQVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK + ESLIILEYIDETW  +T PLLPKDPYQRA ARFWAKFIDEK + A  K++ ++ 
Sbjct  59   NGKPICESLIILEYIDETW-GDTCPLLPKDPYQRAMARFWAKFIDEKLLTAVYKLVSSKG  117

Query  385  SEKARDEVQGA--LNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             EK +   +    L  L +EL  K  FGG+++G +DI A  + +W   IQE+ GLE+L++
Sbjct  118  EEKEKGWEETTELLKFLENELQNKKFFGGDNIGFLDIVASYI-HWFGAIQESLGLELLTK  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+  K+ +W++  +S C +I ENLPPR+ L+  Y+A+ 
Sbjct  177  EQFPKLCKWIDEFLS-CRIIMENLPPRELLVPLYKAQF  213



>ref|XP_002884725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 155/214 (72%), Gaps = 5/214 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V+++G   SPFS RVE+ALKLKGI Y++I+E+ Y  NKSP+LLKYNPVHKK+PVL+HNG
Sbjct  6    QVKLMGLWGSPFSKRVEMALKLKGIPYEYIEEDVYG-NKSPMLLKYNPVHKKVPVLIHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            +S+AESL+I+EYI++TW   +  +LP+DPY+RA ARFWAK++D+K + A +K  +  ESE
Sbjct  65   RSIAESLVIVEYIEDTW-KTSHTILPQDPYERAMARFWAKYVDDKVMLAVKKACWGPESE  123

Query  391  KARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + ++  E    L  L   L  K  FGGE++G VDIAA  +GYW+ + QEA+G+ +++ E+
Sbjct  124  REKEVKEAYECLKCLEKVLGDKLFFGGETIGFVDIAADFIGYWLGIFQEASGVTIMTAEE  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
              K+  W E  +     IKE LPP++KL+A  +A
Sbjct  184  FPKLQRWSEDFVGN-DFIKEVLPPKEKLVAVLKA  216



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 147/213 (69%), Gaps = 7/213 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++ G   SPFSFRV++ALKLKGIQY++  EED + NKSP LLKY+PVHKKIPVL+H+G
Sbjct  5    ELKLFGAWFSPFSFRVKLALKLKGIQYEY-AEEDLQ-NKSPELLKYSPVHKKIPVLVHDG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K + ESLIILEYIDETW  N  PLLP+DPY+RA  RFW  F +EK + A R+ L++E  +
Sbjct  63   KPIVESLIILEYIDETWKQN--PLLPEDPYERAMVRFWVTFAEEKFIEALRRALFSEGTK  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK   ++  AL +L  EL GK  FGGE++G +DIA   V  W+ V++E A  +V    K
Sbjct  121  QEKEVKQIAEALEILERELKGKKFFGGETIGFLDIALSWVPAWLGVMEEVASFKVFDSNK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
                 EWM+    + S+ KE  PPRD+LL ++Q
Sbjct  181  FPCFKEWMDNF-QEFSITKETFPPRDELLVFFQ  212



>ref|XP_010101873.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90010.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   214 bits (545),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 155/215 (72%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   S FS RV+IALKLKGI Y++  EED  FNKS LL+KYNP+HKK+PVL+H+ 
Sbjct  4    EVKLFGAWGSAFSLRVDIALKLKGINYEY-HEEDL-FNKSSLLIKYNPIHKKVPVLVHHD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-EES  387
            K LAES +ILEYIDETW+N   P+LPKDPY+RA+ARFWA+FID+KC  A  K  ++ +E 
Sbjct  62   KPLAESQVILEYIDETWEN--YPILPKDPYERAKARFWARFIDDKCFPAIWKAYWSKDER  119

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E+   L  L +EL+    FGGE+VGLVDI   ++ +W+  + E AG+E+L+ EK 
Sbjct  120  EKAVEELIELLKFLENELDD-NFFGGETVGLVDIVGNIIAHWLPALHEVAGVEILTEEKF  178

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+  W    ++  SV+KE LP R+KL+A+ + R+
Sbjct  179  PKLCRWSHEFVNH-SVVKEVLPSREKLIAFLRDRL  212



>ref|XP_009625219.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   214 bits (546),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 156/213 (73%), Gaps = 7/213 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG  LSPFS RVE ALK+KG++Y+FI EED + NKSPLLL+ NPVH+KIPVL+H
Sbjct  1    MAEVKLLGVSLSPFSCRVEWALKIKGVEYEFI-EEDLQ-NKSPLLLQSNPVHQKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK ++ES++I+EYIDET++  +  +LPKDPY+RA ARFWA F+D KC+  T K  +   
Sbjct  59   NGKPISESMVIVEYIDETFEGPS--ILPKDPYERAMARFWANFLDVKCLTTTGKAYFGKG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EES+KA++E    L +L +EL  K  F G+S G  DIAA ++ +W+ +++EA+G+ +++R
Sbjct  117  EESDKAKEECGELLKILDNELKDKKFFVGDSFGFADIAANLIAFWLGIVEEASGVILVTR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
            EK      W +  ++ CS +KE  P RD LLA+
Sbjct  177  EKFPNFCAWKDEYIN-CSQVKEYFPSRDALLAH  208



>ref|XP_010693980.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=234

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 148/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M  VEV     S FS RVEIAL++KGI+Y  ++E+   FNKS  LLKYNP+HKK+P+++H
Sbjct  1    MGGVEVYRFWGSSFSMRVEIALQMKGIEYKIVEED--LFNKSEQLLKYNPIHKKVPIMIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE-  381
            +GK++AESL+ILEYIDETW  N  P+LP DP +RAQARFWAKF+D K     R  L  + 
Sbjct  59   DGKAMAESLVILEYIDETWKGN--PILPSDPSERAQARFWAKFVDNKLTPVMRSALLHKG  116

Query  382  -ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
              SEKA  E++  L +L +E+ G   FGG ++G +DI A +V +WI  +Q A+G EV +R
Sbjct  117  VRSEKATLELKELLQILENEIKGMQFFGGNNIGFLDIVAAIVPFWITCLQAASGKEVFTR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK+ +I  W + ++  C +IK+NLP  DKL  +Y+   
Sbjct  177  EKYPRICTWADQMLG-CKIIKQNLPDHDKLNEFYRGHF  213



>ref|XP_008240089.1| PREDICTED: glutathione S-transferase U8-like [Prunus mume]
Length=224

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 154/215 (72%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS RVEIAL+LKG+QY+F +E+ +  NKS LLLK NPVHKKIPVLLH+ 
Sbjct  4    EVKLLGLWKSPFSSRVEIALRLKGVQYEFFEEDLH--NKSALLLKSNPVHKKIPVLLHDD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AEES  387
            + +AES +ILEYIDETW    + +LP+DPY+RA ARFWA+FIDEKC+ A     + +EE 
Sbjct  62   RPIAESQVILEYIDETWKQGFS-ILPEDPYERAHARFWARFIDEKCLPAMWNACWGSEEH  120

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E    L LL  EL G   FGGE VGLVDI    + YW+  IQE  G+E+L++EK 
Sbjct  121  EKAVEEACELLKLLEHELKGNKFFGGEKVGLVDIVGNFIAYWLRAIQEVVGVEILTKEKL  180

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             K+Y+W +  +   +V++E+LPPRDKL+A+ +   
Sbjct  181  PKLYDWSDEFV---NVLQESLPPRDKLVAFLRGHF  212



>ref|XP_003623196.1| Glutathione S-transferase [Medicago truncatula]
 gb|AES79414.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 151/219 (69%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N   V++ G   SPF  RVEIALKLKG++Y +  E+    N S  L KYNP++KK+PVL+
Sbjct  4    NQENVKLFGMMASPFVSRVEIALKLKGVEYKYELEKGG--NLSDTLKKYNPIYKKVPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEY+DETW  N  P+LP DPY+RA ARFW KFID+KC++A RK  +  
Sbjct  62   HNDKPISESLVILEYVDETWKQN--PILPSDPYKRALARFWTKFIDDKCLSAARKAAFTI  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EKA +E + A  +L +EL  +T FGGE +G+VDIAA+ + +W  ++QEA  L + 
Sbjct  120  DEKEREKAIEETEEAFQVLENELK-ETFFGGEEIGIVDIAAVFIAFWFPIVQEATNLNLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y+W +   +   ++K+ LPPR+ LL Y++AR
Sbjct  179  TSEKFPKLYKWSQDF-TNHPIVKDKLPPREGLLTYFKAR  216



>ref|XP_003623211.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AES79429.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=226

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 152/220 (69%), Gaps = 10/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPF+ RV+IALK KGI+Y ++QE+    NKS LLL YNPVHKK+PV +
Sbjct  4    NQEEVQLLGALGSPFACRVQIALKWKGIEYKYVQED--LANKSDLLLIYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN K ++ESL+IL+YIDE W  N  P+LP DPYQ++ ARFW+KFID+K    T K +YA 
Sbjct  62   HNEKPISESLVILQYIDEVWKQN--PILPSDPYQKSLARFWSKFIDDKIATPTLKAVYAF  119

Query  382  ESEKAR----DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
              EK R    +E  GAL +L +EL  K  FGGE +G VDI+A+ + +WI + Q+  GL+ 
Sbjct  120  NDEKEREKNIEESTGALQILENELKDK-FFGGEEIGFVDISAVFIAFWIPLFQDLIGLKW  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             + EK+ K+Y+W +  ++   ++KEN+P RD L A ++AR
Sbjct  179  FTAEKYPKLYKWSQEFLNH-PIVKENVPLRDPLFANFKAR  217



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 156/217 (72%), Gaps = 9/217 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R+E+ALKLKG+Q+++I+E     NKSP LLKYNPVHKKIPVL+HNG
Sbjct  4    EVKLFGTWASPFSRRIEVALKLKGVQFEYIEEN--LXNKSPALLKYNPVHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+ILEYIDETW +N  P+LP DPY++A ARFWAK++D+K   A  K++ +  EE
Sbjct  62   KPVAESLVILEYIDETWKHN--PILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGL-EVLSRE  561
             +   +E+Q  L  L  EL  K  FGGES+G VDIAA ++ + + V QEA GL E+L+ E
Sbjct  120  QKAVIEEIQEQLKTLESELKEKKFFGGESLGFVDIAANIIVFLL-VAQEALGLMEILTEE  178

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K   ++EW + L+   +V KE +PPR++ L +++AR 
Sbjct  179  KFPVLHEWYZRLVDD-AVFKECVPPRERHLGFFKARF  214



>ref|XP_004507184.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=218

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 153/216 (71%), Gaps = 7/216 (3%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             EV +LG   SPFS RV++ALKLKG+ Y +  E     NKS  LLK+NPV+KK+PVL+HN
Sbjct  7    GEVRLLGKWSSPFSNRVDLALKLKGVSYKYSDEN--LANKSDDLLKFNPVYKKVPVLVHN  64

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES  387
            G  ++ESL+I+EYIDETW NN+  LL +DPY+RA ARFW+K +D+K + A     + +E 
Sbjct  65   GNPISESLVIVEYIDETWTNNS--LLSQDPYERALARFWSKTLDDKILPAIWNACWIDEK  122

Query  388  --EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
              EKA +E   AL +L   LN K  FGGE++GLVDIAA  +GYW+ V+QE  GLE+L+ E
Sbjct  123  GREKAVEEALEALKILEGALNDKKFFGGETIGLVDIAANFIGYWVSVLQEIKGLELLTIE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K  K+++W +  ++   VIKE LPPRD+L A+++A+
Sbjct  183  KFPKLFKWSQEFINH-PVIKEGLPPRDELFAFFKAK  217



>ref|XP_009767205.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
 sp|Q03662.1|GSTX1_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PGNT1/PCNT110 [Nicotiana tabacum]
 emb|CAA39709.1| auxin-induced protein [Nicotiana tabacum]
 emb|CAA39705.1| auxin-induced protein [Nicotiana tabacum]
Length=223

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 156/216 (72%), Gaps = 6/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I+E+  R NKS LLL+ NP+HKK+PVL+H
Sbjct  1    MAEVKLLGFWYSPFSRRVEWALKIKGVKYEYIEED--RDNKSSLLLQSNPIHKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK + ES++ILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K  A  +  L   E
Sbjct  59   NGKRIVESMVILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKVPAVVKTFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK ++EV   L +L +EL  K  F G+  G  DIAA +V +W+ V +EA+G+ +++ E
Sbjct  117  EQEKDKEEVCEMLKVLDNELKDKKFFVGDKFGFADIAANLVAFWLGVFEEASGVVLVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K     +W    ++ CS IKE+LPPRD+LLA+Y++R
Sbjct  177  KFPNFCKWRGEYIN-CSQIKESLPPRDELLAFYRSR  211



>ref|XP_003623210.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AES79428.1| glutathione S-transferase [Medicago truncatula]
Length=226

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 156/220 (71%), Gaps = 10/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  +V++LG   SPF  RV+IALK KGI+Y+F++E+    NKS LLLKYNPVHKKIPVL+
Sbjct  4    NQEDVKLLGVVGSPFFCRVQIALKFKGIEYEFVKED--LTNKSDLLLKYNPVHKKIPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN K ++ESL+ILEYIDE W  N  P+L  DPYQ++ ARFW+KFID+K V ++ K +YA 
Sbjct  62   HNEKPISESLVILEYIDEVWKQN--PILSSDPYQKSLARFWSKFIDDKIVTSSFKAVYAV  119

Query  382  ESEKAR----DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
              EK R    +E   AL +L +EL  K  FGGE +  VDIAA+ + +WI +IQ+ A L++
Sbjct  120  NDEKERQKNVEESTEALQILENELKNK-YFGGEEINFVDIAAVFIAFWIPLIQDIAELKL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             + EK+ K+Y+W +  ++  +V KE++P RD L A+++A+
Sbjct  179  FNAEKYPKLYKWSQEFLNHPAV-KEHVPARDPLFAFFKAK  217



>ref|XP_009788521.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=220

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 156/213 (73%), Gaps = 7/213 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+E+++LG  LSPF+ RVE ALK+KG++Y+ I E+    NKSPLLL+ NP+HKKIPVL+H
Sbjct  1    MAEMKLLGVSLSPFTHRVEWALKIKGVEYELIVEDPQ--NKSPLLLQSNPIHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK ++ES++ILEYIDET++  +  +LP+DPY RA ARFWAKF+DEKC+ A  K+ +   
Sbjct  59   NGKPISESMVILEYIDETFEGPS--ILPEDPYDRAIARFWAKFLDEKCLPAMGKVYFGTG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EES+KA++E    L +L +EL  K  F G+ +G  DIAA ++ +W+ +I+EA+G+ +++ 
Sbjct  117  EESDKAKEECNELLKILDNELKNKKFFVGDKIGFADIAANLMAFWMGIIEEASGVVLVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
            EK +    W E  ++ CS +K+NLP +D L A+
Sbjct  177  EKFSNYCVWREEYLN-CSQVKDNLPSKDALFAH  208



>ref|XP_003623195.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AES79413.1| glutathione S-transferase [Medicago truncatula]
 gb|AFK38518.1| unknown [Medicago truncatula]
Length=224

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 151/219 (69%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++ G   SPFS RVEIALKLKG++Y +  EE+   N S  ++KYNPV+KK+PVL+
Sbjct  4    NQEEVKLFGLVGSPFSTRVEIALKLKGVEYRY--EEEKVGNLSDTVIKYNPVYKKVPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW  N  P+LP DPY+RA ARFW+KFID+KC+    K  +  
Sbjct  62   HNDKPIAESLVIIEYIDETWKQN--PILPSDPYKRALARFWSKFIDDKCMIPAWKTAFTL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK+ +E + A   L +EL  K  FGG+ +GL+DI A+ + +W  ++QE  GL++ 
Sbjct  120  DEKEREKSFEETEDAFQFLENELKDK-FFGGDDIGLIDITAVFIAFWFPIVQEVTGLKLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y W +   +   ++KENLP R+ LLA+++AR
Sbjct  179  TSEKFPKLYNWSQDF-NNHPIVKENLPRREGLLAFFKAR  216



>ref|XP_009123411.1| PREDICTED: glutathione S-transferase U8 [Brassica rapa]
Length=226

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 153/216 (71%), Gaps = 5/216 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V+VLG   SPFS RVE+ LKLKGI Y++I EED    KSP+LLK NP+HKK+PVL+H G
Sbjct  6    QVQVLGLWGSPFSKRVEMVLKLKGIPYEYI-EEDVYVQKSPMLLKLNPIHKKVPVLVHQG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+AESL+I+EYI++TW   + PLLP DPY+R+ ARFWAK++D+K +    K  +  ESE
Sbjct  65   KSIAESLVIVEYIEDTW-KTSYPLLPHDPYERSMARFWAKYVDDKVMLTLWKACWGPESE  123

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +  +E    L  L +EL  K  FGGE++G VDIAA  + YW  + QEA+G+ +++ E+
Sbjct  124  REKMVEEAYDGLKYLEEELGDKQFFGGETIGFVDIAADFIAYWFGIAQEASGVMIMTAER  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              K+  W +  + + ++IKE LPP++KL+A ++A+ 
Sbjct  184  FPKLQRWSQNFV-RNNIIKEVLPPKEKLMALFKAQF  218



>ref|XP_002520472.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41885.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 152/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+E+ALKLKGIQY++I EED   NKS LLL  NPVHKKIPVL+HNG
Sbjct  4    EVKLLGTWASPFSHRIELALKLKGIQYEYI-EEDLS-NKSTLLLSTNPVHKKIPVLIHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AESL+ILEYI+ETW NN  P+LPKDPY RA ARFWAKF++EK +    K   A+E E
Sbjct  62   KPIAESLVILEYIEETWPNN--PILPKDPYNRALARFWAKFVEEKILQTASKFRVAKEEE  119

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            K +  +E+   L +L +EL  +   GGES+G VDI A  + YW  V QE   L ++S+EK
Sbjct  120  KKQIYEELDQQLKVLENELREREFSGGESIGFVDIVAFFILYWFQVRQEVLQLSLISKEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               + ++++ L+ +  ++KE LPP++K LAY +A  
Sbjct  180  FPVLCKYVDKLL-EIDMVKECLPPKEKHLAYVRAHF  214



>ref|NP_001237841.1| uncharacterized protein LOC100306119 [Glycine max]
 gb|ACU14149.1| unknown [Glycine max]
Length=232

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 159/222 (72%), Gaps = 9/222 (4%)
 Frame = +1

Query  19   RNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVL  198
            ++  EVE+ G   SPF+ RV+IAL+LKG+QY +  EED R NKS LL+KYNP+HKK+PVL
Sbjct  3    KDYGEVELFGVGGSPFARRVQIALELKGVQYTYF-EEDLR-NKSDLLIKYNPIHKKVPVL  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            +HNG+ LAESL+ILEYIDETW+N+  P+LP+ PY RA ARFW++FID+KC+ A  K  + 
Sbjct  61   VHNGRPLAESLVILEYIDETWENH-HPILPQQPYDRALARFWSRFIDDKCMPAISKAAFT  119

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGE-SVGLVDIAAIVVGYWIDVIQEAAGLE  546
               EE +K  +E   +L +L + L  K  FGGE ++G+VDIAA  + +W+  I+EA GL+
Sbjct  120  ADKEERDKGTEESLESLQILENVLKHK-FFGGETTIGIVDIAAGFIAFWLPAIEEAVGLK  178

Query  547  VLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +L+ EK  K+Y+W E   +   V+K+NLP RD+++   Q+ I
Sbjct  179  LLTNEKFPKLYKWGEDYTNH-PVVKKNLPQRDRVVGVLQSSI  219



>ref|XP_010486488.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010486489.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010486490.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
Length=223

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 152/216 (70%), Gaps = 6/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V+VLG   SPFS RVEI LKLKGI Y++I  ED   NKSP+LLKYNP+HKK+PVL+HNG
Sbjct  6    QVKVLGLWGSPFSKRVEIVLKLKGIPYEYI--EDVYGNKSPMLLKYNPIHKKVPVLVHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            +S+AESL+I+EYI++TW  +   +LP+DPY+RA ARFWAK++DEK + A  K  +  +SE
Sbjct  64   RSIAESLVIVEYIEDTWKTSYM-ILPQDPYERAMARFWAKYVDEKVMVAMWKACWGPKSE  122

Query  391  KARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + ++  E    L  L  EL  K  FGGE++G VDIAA  +GYW+ ++QEA+G+ +++ E+
Sbjct  123  REKETKEAYEGLKYLEKELGDKHFFGGETIGFVDIAADFIGYWLGIVQEASGVTIMTAEE  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +  W +  +S  + IKE LPP+ KL    +A+ 
Sbjct  183  FPNLQRWSKEFISN-NFIKEVLPPKQKLATLLKAQF  217



>gb|KEH23050.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 149/219 (68%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV+V G   SPF  RVEIALKLKG++Y + QE+    N S  L KYNPV+KK+PV +
Sbjct  4    NKEEVKVFGLVESPFVTRVEIALKLKGVEYKYEQEK--VGNLSETLKKYNPVYKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDETW  N  P+LP DP +RA ARFW+ FID+KC    RK+ +  
Sbjct  62   HNDKPISESLVILEYIDETWKQN--PILPSDPSKRALARFWSNFIDDKCSNGARKVCFPL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK+ +E + AL+ L +EL  K  FGGE +G VDIAA+V+ +W   IQEA GL++ 
Sbjct  120  DEKEREKSIEETKEALHFLENELKDK-FFGGEDIGFVDIAAVVISFWFSPIQEAFGLKLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + E+  K+Y W +   +   ++KE LPPR+ LLA+Y+ R
Sbjct  179  TIEEFPKLYNWSQEF-NNHPIVKEKLPPRETLLAFYKGR  216



>ref|XP_010464567.1| PREDICTED: glutathione S-transferase U8 [Camelina sativa]
Length=224

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 153/216 (71%), Gaps = 5/216 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V+VLG   SPFS RVE+ LKLKGI Y++I EED   NKSP+LLKYNP+HKK+PVL+HNG
Sbjct  6    QVKVLGLWGSPFSKRVEMVLKLKGIPYEYI-EEDVYGNKSPMLLKYNPIHKKVPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            +S+AESL+I+EYI++TW  +   +LP+DPY+RA ARFWAK++DEK + A  K  +   SE
Sbjct  65   RSIAESLVIVEYIEDTWKTSQT-ILPQDPYERAMARFWAKYVDEKVMVAIWKACWGPRSE  123

Query  391  KARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + ++  E    L  L  EL  K  FGGE++G VDIAA  +GYW+ ++QEA+G+ +++ E+
Sbjct  124  REKETKEAYEGLKYLEKELGDKHFFGGETIGFVDIAADFIGYWLGIVQEASGVTIMTAEE  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +  W +  +   + +KE LPP+ +L A ++A+ 
Sbjct  184  FPNLQRWSKDFIDN-NFVKEVLPPKHELAALFKAQF  218



>ref|NP_001234086.1| uncharacterized protein LOC543814 [Solanum lycopersicum]
 gb|AAG16757.1| putative glutathione S-transferase T2 [Solanum lycopersicum]
Length=218

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 155/218 (71%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+ V++LG  LSPFS RVE ALK+KG++Y+F++E+ +  NKSP+LL+ NP+HKKIPVL+H
Sbjct  1    MAGVKLLGISLSPFSRRVEWALKIKGVEYEFVEEDLH--NKSPVLLELNPIHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
            NGK + ES++I+EYIDET++  +  +LPKDPY RA ARFWAKF D+KC+    K ++   
Sbjct  59   NGKPICESMVIVEYIDETFEGPS--ILPKDPYDRAIARFWAKFFDDKCMPVMGKAIFGSG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EES KA++E+   + +L +EL  K  F G+  G  D+A  ++ YW+ +++EA+G   ++ 
Sbjct  117  EESNKAKEELGDLIKILENELKDKNFFVGDKFGFADMAGNLMAYWMGIVEEASGNIFVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK      W    ++ CS IKE LPPRD++LA+++AR 
Sbjct  177  EKFPIFCNWRNEYVN-CSTIKEYLPPRDEILAHFKARF  213



>ref|XP_004246388.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 152/216 (70%), Gaps = 6/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M +V++LG   SP S +VE ALKLKG++Y+FI+E     NKSPLLL+ NPVHKKIP+L+H
Sbjct  1    MVDVKLLGLWYSPASHKVEWALKLKGVKYEFIEENLQ--NKSPLLLESNPVHKKIPILIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK-ILYAE  381
            NGK + ES+IILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K  A     +L  E
Sbjct  59   NGKPICESMIILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKVGAMVNTFLLKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK + EV   LN+L +EL GK  F G+  G  D+AA  VGYW+ V QEA+G+ +++ E
Sbjct  117  EQEKGKKEVCEMLNVLDNELKGKKFFVGDKFGYADMAANFVGYWLGVFQEASGVVLVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K +    W +  ++ CS +KE LPPR+ LLA+ +AR
Sbjct  177  KFSNFCVWRDEYVN-CSQVKEYLPPRNDLLAFVEAR  211



>ref|XP_004147912.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 151/220 (69%), Gaps = 8/220 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  6    EVELFGGWMSPFSRRVELGLKLKGIDYKY-HEEDLK-NKSDFLLTYNPIYKKVPVFLHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYID+ W N+  P  P+ +PY+ AQARFWA +ID+K +AAT K   +   
Sbjct  64   NPISESLIILEYIDQVW-NSLYPFFPQQNPYETAQARFWANYIDDKVLAATLKAAKSSKR  122

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G+VDI   V+ YWI  I+EA G E+L+ 
Sbjct  123  EEREKGLEETEETLKPLEKELQNKKFFGGNKIGIVDIVGTVIAYWIPAIEEAFGFELLTT  182

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIG  678
            +K  K+ +W E +++  SV+K+ LPP+ KL+AY++ +++ 
Sbjct  183  KKFPKLTKWSEEIVNN-SVVKQVLPPKSKLVAYFELQVVS  221



>ref|XP_002283736.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=226

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 156/222 (70%), Gaps = 14/222 (6%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL---  201
            +V++ G   S F  RVE+AL+LKG+Q+++++E+ Y  NKSP LLKYNPVHKKIPVLL   
Sbjct  4    QVQLFGVWGSFFGRRVEVALRLKGVQFEYVEEDLY--NKSPSLLKYNPVHKKIPVLLCDN  61

Query  202  --HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY  375
              HNG  LAESL+ILEYIDETW +N  P+ PKDPY+RA+ARFWAKFIDEK     RK L 
Sbjct  62   MLHNGNPLAESLVILEYIDETWKHN--PIFPKDPYERARARFWAKFIDEKLWPVVRKALG  119

Query  376  AEESEKARD---EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLE  546
            ++E ++ R+   E    L  L  EL  K  FGGES G +DIAA+V+  W+ + QEA G+E
Sbjct  120  SKEEKEQREAIGETHEHLETLESELKEKKFFGGESWGYLDIAAMVI-IWLGIAQEALGVE  178

Query  547  VLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
             + +EK  ++++W + L+   +V KE +PPR+KL A+++AR 
Sbjct  179  FIPKEKFPRLHKWQQRLVED-AVFKECVPPREKLGAFFKARF  219



>ref|XP_002275539.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=221

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 154/215 (72%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G   SPFS RVEIALKLKG+QY++I+ +    NKSPLLLK NPVHKK+PVLLHNG
Sbjct  4    EVKLIGVWGSPFSRRVEIALKLKGVQYEYIEVD--LTNKSPLLLKSNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AESL+ILEYIDETW  N  P+LP+ PY RA ARFWAK+IDEKC+ A     + E  +
Sbjct  62   KPIAESLVILEYIDETWKAN--PILPQHPYDRAMARFWAKYIDEKCLPALWNACWCEKKD  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L  L +EL  K  FGGES+G VDIAA  +G+W+ V+ E  G+E+L+ +K
Sbjct  120  REKAVEEANVCLKTLENELKDKKFFGGESIGFVDIAANFIGFWVGVLGEVVGVELLTIDK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W +  +  CSVIKENLP ++KL AY + R
Sbjct  180  FPILCKWRDEYVG-CSVIKENLPSKEKLGAYLRTR  213



>emb|CDY22184.1| BnaC01g39170D [Brassica napus]
Length=226

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 153/216 (71%), Gaps = 5/216 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V+VLG   SPFS RVE+ LKLKGI Y++I EED    KSP+LLK NP+HKK+PVL+H G
Sbjct  6    QVQVLGLWGSPFSKRVEMVLKLKGIPYEYI-EEDVYVQKSPMLLKLNPIHKKVPVLVHQG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+AESL+I+EYI++TW   + PLLP DPY+R+ ARFWAK++D+K +    K  +  ESE
Sbjct  65   KSIAESLVIVEYIEDTW-KTSYPLLPHDPYERSMARFWAKYVDDKVMLTLWKACWGPESE  123

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +  +E    L  L ++L  K  FGGE++G VDIAA  + YW  + QEA+G+ +++ E+
Sbjct  124  REKMVEEAYDGLKYLEEDLGDKQFFGGETIGFVDIAADFIAYWFGIAQEASGVMIMTAER  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              K+  W +  + + ++IKE LPP++KL+A ++A+ 
Sbjct  184  FPKLQRWSQNFV-RNNIIKEVLPPKEKLMALFKAQF  218



>emb|CBI16040.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 165/233 (71%), Gaps = 10/233 (4%)
 Frame = +1

Query  1    AKAIQLRNMSE-VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPV  177
            A ++Q   M+E V++ G   SPFS R+E+ALKLKG+Q+++I+E     NKSP LLKYNPV
Sbjct  124  AISLQTATMAEEVKLFGTWASPFSRRIEVALKLKGVQFEYIEEN--LSNKSPALLKYNPV  181

Query  178  HKKIPVLLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA  357
            HKKIPVL+HNGK +AESL+ILEYIDETW +N  P+LP DPY++A ARFWAK++D+K   A
Sbjct  182  HKKIPVLVHNGKPVAESLVILEYIDETWKHN--PILPTDPYEKAMARFWAKYMDDKLWPA  239

Query  358  TRKILYA--EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQE  531
              K++ +  EE +   +E+Q  L  L  EL  K  FGGES+G VDIAA ++ + + V QE
Sbjct  240  ATKVVVSKGEEQKAVIEEIQEQLKTLESELKEKKFFGGESLGFVDIAANIIVFLL-VAQE  298

Query  532  AAGL-EVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKGI  687
            A GL E+L+ EK   ++EW + L+   +V KE +PPR++ L +++AR+  K +
Sbjct  299  ALGLMEILTEEKFPVLHEWYQRLVDD-AVFKECVPPRERHLGFFKARMNKKNL  350


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 14/155 (9%)
 Frame = +1

Query  313  ARFWAKFIDEKCVAATRKILYA--EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVD  486
            ARFWAK++D+K + A  K+  +  EE +   +E+Q  L  L  EL  K  FGGES+G VD
Sbjct  2    ARFWAKYMDDKLLPAAIKVAMSKGEEQKGVIEEIQKQLKTLESELKEKKFFGGESLGFVD  61

Query  487  IAAIVVGYWIDVIQEAAGLEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            IAA  +  W+ V QEA G+E+L+ EK   ++ W + L+   +V KE +PPR++ L++   
Sbjct  62   IAANTI-VWLVVAQEALGMEILTEEKFPVLHGWYQRLVDD-AVFKECMPPREQHLSFV--  117

Query  667  RIIGKGIIAH*VTVIYIIPSALLSRDVRTLGVRNS  771
                KGI    ++    + +A ++ +V+  G   S
Sbjct  118  ----KGISMAAIS----LQTATMAEEVKLFGTWAS  144



>ref|XP_006409999.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
 gb|ESQ51452.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
Length=225

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 151/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+EIAL LKG+ YDF  E+D   NKSPLLL+ NPVHK IPVL+HNG
Sbjct  7    EVKLLGMWASPFSRRIEIALTLKGVPYDF-SEQDIT-NKSPLLLQLNPVHKMIPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEK-CVAATRKI-LYAEE  384
            K ++ESL+ILEYID+TW NN  P+LP+DPY+RA ARFWAKF+DE+ CV A + +    EE
Sbjct  65   KPISESLVILEYIDDTWQNN--PILPQDPYERAMARFWAKFVDEQICVTAMKVVGKIGEE  122

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E   +  +  L  L  EL  K   GGES G VDI A +V +W+   +E  G++V+  EK
Sbjct  123  REAVVEATRDLLMFLEKELVQKDFLGGESFGFVDIVATLVAFWLMRTEEIVGVKVVPVEK  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              KI+ W++ LM + +VIK+ +PP D+ L+Y +AR+
Sbjct  183  FPKIHRWVKNLM-EINVIKKCIPPEDEHLSYIRARM  217



>ref|XP_002275435.3| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
 emb|CAN63896.1| hypothetical protein VITISV_041660 [Vitis vinifera]
Length=221

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 155/216 (72%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G   SPFS RVEIALKLKG+QY++I  +    NKSPLLLK NPVHKK+PVLLHNG
Sbjct  4    EVKLIGMWGSPFSRRVEIALKLKGVQYEYIDVD--LTNKSPLLLKSNPVHKKVPVLLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AESL+ILEYIDETW  N  P+LP+ PY RA ARFWAK+IDEKC+ A     + E  +
Sbjct  62   KPIAESLVILEYIDETWKAN--PILPQHPYDRAMARFWAKYIDEKCLPALWNACWCEKKD  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L  L +EL  K  FGGES+G VDIAA  +G+W+ V++E  G+E+L+ +K
Sbjct  120  REKAVEEANVGLETLENELKDKKFFGGESIGFVDIAANFIGFWVGVLEEVVGVELLTIDK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               + +W +  +  CS IKENLP ++KL AY++ R+
Sbjct  180  FPILCKWRDEYVG-CSGIKENLPSKEKLGAYFRTRV  214



>ref|XP_010696150.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=224

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 154/215 (72%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   SP+S RVEI L LKG+ YD+I EED + NKSP LLKYNPVHKK+PVL+ +G
Sbjct  5    EMKLLGLWCSPYSKRVEIGLCLKGLAYDYI-EEDVQ-NKSPELLKYNPVHKKVPVLVRDG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K +AESL+ILEYIDE   +  + +LP+ PY+RA ARFWA+FIDEKC+ +  +  +  E+E
Sbjct  63   KPVAESLVILEYIDEMCKDKPS-ILPEHPYERAMARFWARFIDEKCLPSIWRAFWGPENE  121

Query  391  K--ARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            +  A +E +  L +L  EL G   FGG S+G +DI A  + YW+D IQ+AAG E+L++E 
Sbjct  122  QESAGEEARNNLKILEKELKGNKFFGGTSIGYLDIVANFIAYWLDAIQKAAGKEILTKEL  181

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               + +W +  ++ C V+K+NLPP ++L+AYYQ R
Sbjct  182  FPLLSKWKDDFVA-CKVVKQNLPPWERLVAYYQIR  215



>ref|XP_004157054.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=220

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 146/216 (68%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  4    EVELFGGWMSPFSRRVELGLKLKGIDYKY-HEEDLK-NKSDFLLTYNPIYKKVPVFLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYID+ W N+  P  P+ +PY+ AQARFWAK+ID+K VAA RK+  +   
Sbjct  62   NPISESLIILEYIDQVW-NSLYPFFPQQNPYETAQARFWAKYIDDKVVAAIRKVAKSSKT  120

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G VDI   V+ YWI  I+E  G E+L+ 
Sbjct  121  EEREKDLEETEKTLEPLEKELQNKKFFGGNQIGFVDIVGTVIAYWIPAIEEGFGFELLTS  180

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +K  K+ +W E ++ K SV+K+ LPP+  L+AY Q 
Sbjct  181  KKFPKLTKWSEEIV-KNSVVKQVLPPKSVLVAYLQV  215



>ref|XP_009626799.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nicotiana 
tomentosiformis]
Length=212

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 153/216 (71%), Gaps = 6/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I E+  R NKS LLL+ NPV+KK+P+L+H
Sbjct  1    MAEVKLLGFWYSPFSHRVEWALKIKGVKYEYIDED--RNNKSSLLLQSNPVYKKVPILIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK + ES++ILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K  A     L   E
Sbjct  59   NGKPIVESMVILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKVTAVPNIFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++EV     +L +EL  K  F G+  G  DIAA +V +W+ V +EA+G+ +++ E
Sbjct  117  EQEKAKEEVCEMFKVLDNELKDKKFFVGDKFGFADIAANLVAFWLGVFEEASGVVLVTNE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K     +W    ++ CS IKE+LPPRD+LLA+Y+ R
Sbjct  177  KFPNFCKWRGEYIN-CSQIKESLPPRDELLAFYRVR  211



>ref|XP_002281843.2| PREDICTED: glutathione S-transferase U7 [Vitis vinifera]
Length=230

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 158/227 (70%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    AKAIQLRNMSE-VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPV  177
            A ++Q   M+E V++ G   S FS R+E+ALKLKG+Q+++I+E     NKSP LLKYNP+
Sbjct  3    AISLQTETMAEEVKLFGTWASVFSRRIEVALKLKGVQFEYIEEN--LSNKSPALLKYNPL  60

Query  178  HKKIPVLLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA  357
            HKKIPVL+HNGK +AESL+ILEYIDETW +N  P+LP DPY++A ARFWAK++D+K + A
Sbjct  61   HKKIPVLVHNGKPVAESLVILEYIDETWKHN--PILPTDPYEKAMARFWAKYMDDKLLPA  118

Query  358  TRKILYA--EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQE  531
              K+  +  EE +   +E+Q  L  L  EL  K  FGGES+G VDIAA  +  W+ V QE
Sbjct  119  AIKVAMSKGEEQKGVIEEIQKQLKTLESELKEKKFFGGESLGFVDIAANTI-VWLVVAQE  177

Query  532  AAGLEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            A G+E+L+ EK   ++ W + L+   +V KE +PPR++ L++ + R 
Sbjct  178  ALGMEILTEEKFPVLHGWYQRLVDD-AVFKECMPPREQHLSFVKVRF  223



>ref|XP_003623173.1| hypothetical protein MTR_7g065270 [Medicago truncatula]
 gb|AES79391.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 150/220 (68%), Gaps = 11/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRF-NKSPLLLKYNPVHKKIPVL  198
            N  EV+V G   SPFS RVEIALKLKG++Y   + E+ +F N S  L  YNPV+KK+PVL
Sbjct  4    NKEEVKVFGMVGSPFSTRVEIALKLKGVEY---KCENEKFGNLSDTLKNYNPVYKKVPVL  60

Query  199  LHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA  378
            ++N K ++ESL+ILEYIDETW  N  P+LP DPYQRA ARFW+ FID+KC+   RK  + 
Sbjct  61   VYNDKPISESLVILEYIDETWKQN--PILPSDPYQRAMARFWSNFIDDKCMNDVRKACFT  118

Query  379  ---EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
               +E EK+ +E + AL  L +EL  K  FGGE +G VDIAA+++ +WI  I+EA GL++
Sbjct  119  FDEKEREKSIEETKEALRFLENELKDK-FFGGEDIGFVDIAAVIISFWISPIEEAFGLKL  177

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             + E+  K+Y W +   +   ++ E LPPR+ LL +Y+ R
Sbjct  178  FTSEEFPKLYNWSQEFNNH-PIVNEKLPPREILLTFYKGR  216



>ref|XP_004507183.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=225

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 153/216 (71%), Gaps = 9/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPF  R++IALKLKG+ Y +I EE+ R NKS LLLK+NP+HKK+PV  HNG
Sbjct  7    EVQLLGVGGSPFVRRIQIALKLKGVHYTYI-EENLR-NKSDLLLKFNPIHKKVPVFFHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K LAESL+ILEYIDETW+N   P+ P+ PY++A ARFW+KFID+KC+ A  K  +    E
Sbjct  65   KPLAESLVILEYIDETWEN--YPIFPQQPYEKALARFWSKFIDDKCLPAISKAAWTVNKE  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGG ++ +VDIAA  + +W+ +++EA GL+ LS  
Sbjct  123  EREKGIEESLQALQFLENELKHK-FFGGVNINIVDIAASYLAFWLPLVEEAIGLKFLSSG  181

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K  K+Y+W +  ++   ++K NLPP++ +L ++++R
Sbjct  182  KFPKLYKWSQEFINH-PIVKANLPPKEGILGFFKSR  216



>ref|XP_004492379.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=225

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 149/220 (68%), Gaps = 10/220 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPF   V+IALKLKGI+Y++  EED   NKS LLLKYNPV+KK+PV +
Sbjct  4    NQEEVKLLGAVGSPFVCSVKIALKLKGIEYNY-HEEDLS-NKSDLLLKYNPVYKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HN K ++ESL+ILEYIDE W  N  P+L  DPYQRA ARFW+KFI +K V  + K     
Sbjct  62   HNEKPISESLVILEYIDEIWKQN--PILSSDPYQRALARFWSKFIHDKIVTTSIKAFRIV  119

Query  382  ESEKAR----DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
            + EK R    +E   AL +L +EL  K  FGG  +G VDI A+ + +WI +IQ+  GL++
Sbjct  120  DDEKEREKNVEESSEALQILENELKEK-FFGGNEIGFVDIVAVFIAFWIPLIQDITGLQL  178

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               EK+ K+Y+W +  ++   ++KEN+PPRD L AY++AR
Sbjct  179  FPAEKYPKLYKWSQEFLNH-PIVKENVPPRDLLFAYFKAR  217



>ref|XP_006357580.1| PREDICTED: glutathione S-transferase U8-like [Solanum tuberosum]
Length=232

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 154/221 (70%), Gaps = 12/221 (5%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV++LG  +SPFS RVE+ALKLKGI+Y++I E      K P ++KYNP++KK+PV  H
Sbjct  1    MEEVKLLGFWVSPFSIRVEMALKLKGIEYEYI-EAQLPIKKCPKIVKYNPIYKKVPVFFH  59

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK + ESL+ILEYIDE W++ T+ LLPKDPYQRA ARFWAKF+DEKC+    K  Y   
Sbjct  60   NGKPIPESLVILEYIDENWEDGTS-LLPKDPYQRAMARFWAKFMDEKCLPEIIKFCYDSN  118

Query  385  SEKARDEVQGALNLLVDEL-------NGKTLFGGES-VGLVDIAAIVVGYWIDVIQEAAG  540
             E  + +  G L  L+  L       N    FGGE+ VG ++I +I++ YW+ V+QEA  
Sbjct  119  YE-VKVKAMGELQELLKLLENELIKDNNNIFFGGENKVGYMEIVSILITYWLGVMQEALE  177

Query  541  LEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
            +++L++++   I EW + LMS CS +KENLPPR+KLLA+Y+
Sbjct  178  VDILNKKEFPNICEWADKLMS-CSFMKENLPPREKLLAFYK  217



>ref|XP_003623202.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AFK35059.1| unknown [Medicago truncatula]
Length=225

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 148/219 (68%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N   V++LG   SPF  RV+IALKLKGI+Y+F++E      KS  LLKYNPVHKK+PV +
Sbjct  4    NQEHVKLLGATGSPFVCRVQIALKLKGIEYEFVEEN--LATKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDE W  N  P+LP DP+QRA ARFW+KFID+K V+ + K +++ 
Sbjct  62   HNEKPISESLVILEYIDEVWKQN--PILPSDPHQRALARFWSKFIDDKIVSTSFKSVFSL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL+ L +EL  K  FGGE    VDIAA+ V +W+ ++Q+   L++ 
Sbjct  120  DEKEREKNIEEATEALHFLENELKDK-YFGGEEFNFVDIAAVFVAFWVPLVQDITELQLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y W +  +    V+KE LPPR+ L A+++ R
Sbjct  179  TAEKFPKLYNWSQEFLDH-PVVKETLPPREPLFAFFKGR  216



>ref|XP_010521899.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
Length=222

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 151/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+E+ALKLKG+ Y ++ EED   NKSPLLL+ NPVHKKIPV +HNG
Sbjct  6    EVKLLGLWSSPFSCRIEMALKLKGVPYKYL-EEDLE-NKSPLLLQLNPVHKKIPVFVHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEE  384
            K +AESL+IL+YIDETW +N  P+LP+DPY+RA ARFWA+FIDE+ +    KI+     E
Sbjct  64   KPIAESLVILDYIDETWKHN--PILPQDPYERAMARFWARFIDEQVLLTGLKIVAQTGRE  121

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E A +  +  +  L  EL GK  FGGES G +D+ A +V +W+    +  G+EVL  EK
Sbjct  122  REAAVEATRDLVKFLEKELKGKDFFGGESFGYLDMVATLVAFWLMRSDDLVGVEVLPEEK  181

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              +I+ W++ L S+  V+KE +PP+DK + Y +AR+
Sbjct  182  FPEIHRWVKKL-SEIPVVKECVPPKDKHVQYLRARL  216



>gb|AES79420.2| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=225

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 147/219 (67%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N   V +LG   SPF  RV+IALKLKGI+Y+F++E      KS  LLKYNPVHKK+PV +
Sbjct  4    NQEHVNLLGATGSPFVCRVQIALKLKGIEYEFVEEN--LATKSEQLLKYNPVHKKVPVFV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDE W  N  P+LP DP+QRA ARFW+KFID+K V+ + K +++ 
Sbjct  62   HNEKPISESLVILEYIDEVWKQN--PILPSDPHQRALARFWSKFIDDKIVSTSFKSVFSL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL+ L +EL  K  FGGE    VDIAA+ V +W+ ++Q+   L++ 
Sbjct  120  DEKEREKNIEEATEALHFLENELKDK-YFGGEEFNFVDIAAVFVAFWVPLVQDITELQLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + EK  K+Y W +  +    V+KE LPPR+ L A+++ R
Sbjct  179  TAEKFPKLYNWSQEFLDH-PVVKETLPPREPLFAFFKGR  216



>ref|XP_004166786.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN54320.1| hypothetical protein Csa_4G303680 [Cucumis sativus]
Length=222

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 148/221 (67%), Gaps = 8/221 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  6    EVELFGGWMSPFSRRVELGLKLKGIDYKY-HEEDLK-NKSDFLLTYNPIYKKVPVFLHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYID+ W N+  P  P+ +PY+ AQARFWA +ID+K +AAT K   +   
Sbjct  64   NPISESLIILEYIDQVW-NSLYPFFPQQNPYETAQARFWANYIDDKVLAATLKAAKSSKR  122

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G+VDI   V+ YWI  I+EA G E+L+ 
Sbjct  123  EEREKGLEETEETLKPLEKELQNKKFFGGNKIGIVDIVGTVIAYWIPAIEEAFGFELLTT  182

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGK  681
            +K  K+ +W E +++  SV+K+ LPP+  L+AY Q  +  K
Sbjct  183  KKFPKLTKWSEEIVNN-SVVKQVLPPKSNLVAYLQTVLTTK  222



>gb|AFK44026.1| unknown [Lotus japonicus]
Length=224

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 152/215 (71%), Gaps = 9/215 (4%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPF  RV+IALKLKG++Y+F+  E     KS LLLKYNPVHKK+PVL HN K
Sbjct  8    VQLLGIVGSPFVCRVQIALKLKGVEYEFV--EQTLGQKSELLLKYNPVHKKVPVLAHNEK  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---EE  384
             +AESL+ILEYIDETW +N  P+LP +PYQRA ARFW+KFID+K V  T K ++    EE
Sbjct  66   PIAESLVILEYIDETWKSN--PILPSEPYQRAMARFWSKFIDDKVVDTTWKSVFTVEEEE  123

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E+  AL  L +EL  K  FGGE  GLVDIAA+ V +++ + QE AGL + + EK
Sbjct  124  REKRIEELSEALQFLENELKDK-FFGGEEFGLVDIAAVFVAFYVPLFQEIAGLHLFTAEK  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              K+Y+W +  ++   V+KE+LPPRD L A+++ R
Sbjct  183  FPKLYDWSQDFLNH-PVVKESLPPRDPLFAFFKGR  216



>ref|XP_010101872.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90009.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 153/213 (72%), Gaps = 7/213 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G   SPFS RV+IALKLKGI  ++  EED   NKS LL+KYNP+HKK+PVL+H+ 
Sbjct  4    EVKVFGLWGSPFSRRVDIALKLKGIDSEY-HEEDLS-NKSSLLIKYNPIHKKVPVLVHHD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-EES  387
            K LAES +ILEYIDETW+N   P+LPKDPY+RA+ARF A+FID+KC  A  K  ++ +E 
Sbjct  62   KPLAESQVILEYIDETWEN--YPILPKDPYERAKARFGARFIDDKCFPAIWKAYWSKDER  119

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EKA +E+   L  L +ELN    FGGE+VGLVDI   ++ +W+  +QE AG+E+L+ EK 
Sbjct  120  EKAVEELIELLKFLENELND-NFFGGETVGLVDIVGSLIAHWLPALQEVAGVEILTEEKF  178

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             K+  W    ++  SV+KE LP R+KL+A ++A
Sbjct  179  PKLCRWTHEFVNH-SVVKEVLPSREKLIALFRA  210



>gb|KDO57979.1| hypothetical protein CISIN_1g027827mg [Citrus sinensis]
Length=218

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 155/218 (71%), Gaps = 8/218 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++ G   S FS R+EIALKLKG++Y+FI+E+    NKSPLLL+YN +HKK+PVL+H
Sbjct  1    MTEVQLFGLWGSFFSHRIEIALKLKGVEYEFIEEDLS--NKSPLLLQYNSIHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
             G  +AES +ILEYID+TW  +  P+LP++P++RA ARFWA+FIDEKC  A R     +E
Sbjct  59   KGNPIAESRVILEYIDDTWKGH--PILPENPHERANARFWAQFIDEKCRVALRNAYGCQE  116

Query  385  SEKARDEVQGALNLLV---DELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             E+  +  + A  LL    +EL  +  FGG+ +GLVDI A  +G+W+  IQEA  +++ +
Sbjct  117  KEREEEATREACELLKTLENELKNRRFFGGDKIGLVDIVANFIGFWLGAIQEALEVKLFT  176

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             ++  K+Y W E  ++ CS+IKE+LPPRDKL+++ + R
Sbjct  177  EDRFPKLYRWSEEFVN-CSIIKESLPPRDKLISFMRRR  213



>ref|XP_004249548.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=221

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 153/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            MS V++LG   SP S RVE ALK+KG++Y+FI E+    NKSPLLLK NPV+KKIPVLLH
Sbjct  1    MSRVKLLGVYGSPASQRVEWALKIKGVKYEFITED--LQNKSPLLLKSNPVYKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE-  381
            N K +AESL+I+EYIDE ++  +  +LPKDPY RA ARFW KF+DEKC+ A  K L+++ 
Sbjct  59   NDKPIAESLVIIEYIDEAFEGPS--ILPKDPYDRAIARFWVKFLDEKCLPAVWKALWSQG  116

Query  382  -ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E EK ++E    L ++ +EL  K  FGG+++G VD+ A  VG+WI +++EA G+ +++ 
Sbjct  117  DEQEKDKEEAYEVLKVIDNELKDKKFFGGDNIGFVDVVANFVGFWIGIVEEATGVVLVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E       W +  ++ C  +KEN+P R+ LL Y+++R+
Sbjct  177  ENFPNFCAWRDEYLN-CDRVKENMPSREMLLGYFKSRV  213



>ref|XP_006429234.1| hypothetical protein CICLE_v10012717mg [Citrus clementina]
 ref|XP_006480913.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
 gb|ESR42474.1| hypothetical protein CICLE_v10012717mg [Citrus clementina]
Length=218

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 155/218 (71%), Gaps = 8/218 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++ G   S FS R+EIALKLKG++Y+FI+E+    NKSPLLL+YN +HKK+PVL+H
Sbjct  1    MAEVQLFGLWGSFFSHRIEIALKLKGVEYEFIEEDLS--NKSPLLLQYNSIHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
             G  +AES +ILEYID+TW  +  P+LP++P++RA ARFWA+FIDEKC  A R     +E
Sbjct  59   KGNPIAESRVILEYIDDTWKGH--PILPENPHERANARFWAQFIDEKCRVALRNAYGCQE  116

Query  385  SEKARDEVQGALNLLV---DELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             E+  +  + A  LL    +EL  +  FGG+ +GLVDI A  +G+W+  IQEA  +++ +
Sbjct  117  KEREEEATREACELLKTLENELKDRRFFGGDRIGLVDIVANFIGFWLGAIQEALEVKLFT  176

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
             E+  K+Y W E  ++ CS+I+E+LPPRDKL+++ + R
Sbjct  177  EERFPKLYRWSEEFVN-CSIIRESLPPRDKLISFMRRR  213



>gb|AFK37419.1| unknown [Lotus japonicus]
Length=224

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 151/215 (70%), Gaps = 9/215 (4%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPF  RV+IALKLKG++Y+F+  E     KS LLLKYNPVHKK+PVL HN K
Sbjct  8    VQLLGIVGSPFVCRVQIALKLKGVEYEFV--EQTLGQKSELLLKYNPVHKKVPVLAHNEK  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---EE  384
             +AESL+ILEYIDETW +N  P+LP +PYQRA ARFW+KFID+K V  T K ++    EE
Sbjct  66   PIAESLVILEYIDETWKSN--PILPSEPYQRAMARFWSKFIDDKVVDTTWKSVFTVEEEE  123

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E+  AL  L +EL  K  FGGE  G VDIAA+ V +++ + QE AGL + + EK
Sbjct  124  REKRIEELSEALQFLENELKDK-FFGGEEFGFVDIAAVFVAFYVPLFQEIAGLHLFTAEK  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              K+Y+W +  ++   V+KE+LPPRD L A+++ R
Sbjct  183  FPKLYDWSQDFLNH-PVVKESLPPRDPLFAFFKGR  216



>ref|XP_009606316.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=212

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 154/215 (72%), Gaps = 6/215 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I+E+  R NKS LLL+ NPV+KK+PVL+H
Sbjct  1    MAEVKLLGFWYSPFSHRVEWALKIKGVKYEYIEED--RDNKSSLLLQSNPVYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK + ES+IILEYIDET++     +LPKDPY RA A FWAKF+D+K  A     L   E
Sbjct  59   NGKPIVESMIILEYIDETFEGPF--ILPKDPYDRALACFWAKFLDDKVTAVPNIFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA+++V     +L +EL  K  F G+  G  DIAA +V +W+ V +EA+G+ +++RE
Sbjct  117  EQEKAKEKVCEMFKVLDNELKDKKFFVGDKFGFADIAANLVAFWLGVFEEASGVVLVTRE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K +   +W    ++ CS IKE+LPPRD+LLA+Y+A
Sbjct  177  KFSIFCKWRGEYIN-CSQIKESLPPRDELLAFYRA  210



>ref|XP_009626798.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nicotiana 
tomentosiformis]
Length=216

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 154/220 (70%), Gaps = 10/220 (5%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I E+  R NKS LLL+ NPV+KK+P+L+H
Sbjct  1    MAEVKLLGFWYSPFSHRVEWALKIKGVKYEYIDED--RNNKSSLLLQSNPVYKKVPILIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKC---VAATRKILY  375
            NGK + ES++ILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K    V A   I  
Sbjct  59   NGKPIVESMVILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKSVLQVTAVPNIFL  116

Query  376  --AEESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
               EE EKA++EV     +L +EL  K  F G+  G  DIAA +V +W+ V +EA+G+ +
Sbjct  117  RKGEEQEKAKEEVCEMFKVLDNELKDKKFFVGDKFGFADIAANLVAFWLGVFEEASGVVL  176

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            ++ EK     +W    ++ CS IKE+LPPRD+LLA+Y+ R
Sbjct  177  VTNEKFPNFCKWRGEYIN-CSQIKESLPPRDELLAFYRVR  215



>emb|CAN73674.1| hypothetical protein VITISV_001109 [Vitis vinifera]
Length=341

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 153/216 (71%), Gaps = 9/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R+E+ALKLKGIQY++I+E+    NKSP LLKYNPVHKKIPVLLH G
Sbjct  4    EVKLFGMWASPFSRRIEVALKLKGIQYEYIEED--LSNKSPSLLKYNPVHKKIPVLLHKG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+ILEYIDETW +N  P+LP DPY+RA ARFWAKF+DEK   A +K+  +  EE
Sbjct  62   KPVAESLVILEYIDETWKHN--PILPADPYERAMARFWAKFLDEKLWPAAKKVALSKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
                 +E+Q  L  L  EL  K  FGGES+G VDIAA ++ +W+ V+QE  GL++L+ +K
Sbjct  120  HNGLIEEIQEHLKTLESELKEKKFFGGESLGFVDIAABII-FWLLVVQETLGLDILTEDK  178

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               ++EW   L+   +V KE +   ++LLA ++ R+
Sbjct  179  FPGLHEWYHRLLDD-AVFKECV-SMERLLASFKVRL  212



>ref|XP_008448766.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 147/215 (68%), Gaps = 8/215 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  6    EVELFGGWMSPFSRRVELGLKLKGINYKY-NEEDLK-NKSDFLLNYNPIYKKVPVFLHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYIDE W N+  P  P+ +PY+RAQARFWAK+ID+K VAA  K   +   
Sbjct  64   NPISESLIILEYIDEVW-NSVYPFFPQQNPYERAQARFWAKYIDDKVVAAILKAAKSSKR  122

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G VDI   V+ YWI  I+EA G EVL+ 
Sbjct  123  EEREKGLEETEETLEPLEKELQNKKFFGGNKIGFVDIVGTVIAYWIPAIEEAFGFEVLTT  182

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
            +K   + +W E ++++ SV+K+ LPP+  L+AY+Q
Sbjct  183  KKFPNLTKWSEEIVNQ-SVVKQVLPPKSNLVAYFQ  216



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 151/218 (69%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V+G   S F  RVE ALK+KG++Y++++E D R NKSP+LLK NPVHKK+PVL+H
Sbjct  1    MGEVKVIGSYTSLFCTRVEWALKIKGVEYEYLKE-DLR-NKSPILLKVNPVHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--A  378
              K +AESL+ILEYIDETW+ N  PL P+DPY+RA ARFWAKF D+KC+       +   
Sbjct  59   EEKPIAESLVILEYIDETWNKN--PLFPQDPYERAMARFWAKFADDKCLYGAFHACWKEG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EKA +    +  +L +++ GK  F GE +G +D+A   + YW++V++E  G++++  
Sbjct  117  EEKEKAIESAMESFAMLEEQIKGKKFFNGEQIGYLDLALGWIPYWLNVMEEVGGMKLVDA  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   ++EW ++ + +  +IKE LPPRD+L+ Y+   +
Sbjct  177  EKFPSLHEWTQSFI-EIPLIKECLPPRDQLVNYFTGSV  213



>ref|XP_010674216.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=222

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 149/218 (68%), Gaps = 9/218 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R++ ALKLKGI Y++I+E+    NKSP LLKYNP+HKKIPVL+HNG
Sbjct  10   EVKLFGRWASPFSHRIQTALKLKGIPYEYIEED--LTNKSPQLLKYNPIHKKIPVLVHNG  67

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K + ESLIIL+YIDETW+    PLLP DP+++A A FWA FIDEK   A +  L+ +  E
Sbjct  68   KPIVESLIILKYIDETWE--LFPLLPNDPWEKANALFWAIFIDEKLFRARKMALWGDEKE  125

Query  385  SEKARDEVQGALNLLVDELNGK--TLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            S++A +E    L  L +EL  K    FGGE +G VDI A  +G+W+ V +E     +L +
Sbjct  126  SKEAMEETFECLRWLENELKVKKSKFFGGECIGFVDIVANGIGFWVGVQEEVTNKRMLVQ  185

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   +++W +  +S C  +KE LPPR+KLLA YQAR+
Sbjct  186  ERFPLLWDWAQDFVS-CDAVKECLPPREKLLALYQARV  222



>ref|XP_008448631.1| PREDICTED: glutathione S-transferase U8-like [Cucumis melo]
Length=224

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 148/212 (70%), Gaps = 5/212 (2%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             EV+V G  L P+S RVE+ALKLKG+ Y  I +ED    KS LL+KYNPV+KK+PVL+H+
Sbjct  6    QEVQVFGFRLGPYSLRVELALKLKGVVYKHI-DEDLLNKKSDLLVKYNPVYKKVPVLVHH  64

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES  387
            GK ++ESL+ILEYI+ETW  N   +LPKDPYQRA ARFWAK+IDEK V A +K+  ++E 
Sbjct  65   GKPISESLVILEYIEETWTQNYT-ILPKDPYQRALARFWAKYIDEKVVPAVQKVARSQED  123

Query  388  EKAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E+ +  ++ Q AL  L +EL  K  FGG+++G VDIA +V+  WI   +EA G E+LS  
Sbjct  124  EREKSIEDAQAALEPLEEELKNKLFFGGDTIGFVDIAGLVLARWIPATEEAVGFELLSAH  183

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
            K   + +W +  ++  SV KE LP +D L+A+
Sbjct  184  KFPNLTKWSQDFVNH-SVAKEVLPEKDVLVAF  214



>ref|XP_006339006.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=221

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 155/218 (71%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            MS V++LG   SP S RVE ALK+KG++Y+FI E+    NKSPLLLK NPV+KKIPVLLH
Sbjct  1    MSGVKLLGVNGSPASQRVEWALKIKGVKYEFITEDLQ--NKSPLLLKSNPVYKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            N   ++ESL+I+EYIDE ++  +  +LPKDPY +A ARFWAKF+D+KC+ A  K L++  
Sbjct  59   NENPISESLVIIEYIDEAFEGPS--ILPKDPYDKAIARFWAKFLDDKCLPAVWKALWSQG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK ++E    L +L +EL  K  FGG+++G VDI A  VG+WI++++EA G+ +++ 
Sbjct  117  EEQEKDKEEAYEVLKVLDNELKDKKFFGGDNIGFVDIVANFVGFWIEIVEEATGVVLVTS  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK      W +  ++ C  +KEN+P R+ LL ++++R+
Sbjct  177  EKFPNFCVWRDEYLN-CDKVKENMPSREMLLGFFKSRV  213



>ref|XP_009629347.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=214

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 156/216 (72%), Gaps = 6/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I+E+  R NKS LLL+ NPVHKK+PVL+H
Sbjct  1    MAEVKLLGFWCSPFSHRVEWALKIKGVKYEYIEED--RDNKSSLLLQSNPVHKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            NGK + ES++ILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K  A     L   E
Sbjct  59   NGKPIVESMVILEYIDETFEGPS--ILPKDPYNRALARFWAKFLDDKVTAVVNTFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK ++EV   L +L +EL  K  F G+  G  DIAA +VG+W+ V +E +G+ +++ E
Sbjct  117  EQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFADIAANLVGFWLGVFEEVSGVVLVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K     +W +  ++ CS +KE+LPPRD+LLA+Y+AR
Sbjct  177  KFPNFSKWRDEYIN-CSQVKESLPPRDELLAFYRAR  211



>ref|XP_010650966.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=220

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 158/216 (73%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SP+S R+E+ALKLKG+Q+++I+E  Y  NKSP LLKYNPVHKK+PVL+HNG
Sbjct  4    EVKLFGAWGSPYSRRIELALKLKGLQFEYIEENLY--NKSPALLKYNPVHKKVPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
            K +AESL+ILEYIDETW +N  P LP DPY++A+ARFWA+FIDEK   A +K + +   E
Sbjct  62   KPVAESLVILEYIDETWKHN--PFLPTDPYEKAKARFWARFIDEKFWPAAKKAMASRGRE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E+A +E Q  L  L  EL  K +FG ES+G VDIAA ++ +W+ V QEA G+E+L+ EK
Sbjct  120  REEAIEEAQQHLKTLESELKEKKIFGRESLGFVDIAAHLL-FWLVVAQEAFGVEILTEEK  178

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               ++E  + L  + +V KE +PP+++L+AY + R+
Sbjct  179  FPAVHELYQRLADE-AVFKECMPPKEQLIAYLKVRL  213



>gb|KGN54330.1| hypothetical protein Csa_4G304760 [Cucumis sativus]
Length=220

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  4    EVELFGGWMSPFSRRVELGLKLKGIDYKY-HEEDLK-NKSDFLLTYNPIYKKVPVFLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYID+ W N+  P  P+ +PY+ AQARFWAK+ID+K +AAT K   +   
Sbjct  62   NPISESLIILEYIDQVW-NSLYPFFPQQNPYETAQARFWAKYIDDKVLAATLKAAKSSKR  120

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G+VDI   V+ YWI  I+E  G E+L+ 
Sbjct  121  EEKEKGLEETEETLKPLEKELQNKKFFGGNKIGIVDIVGTVIAYWIPAIEEGFGSELLTS  180

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +K  K+ +W E ++ K SV+K+ LPP+  L+AY Q 
Sbjct  181  KKFPKLTKWSEEIV-KNSVVKQVLPPKSVLVAYLQV  215



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 148/216 (69%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V+G  LS F  RVE ALKLKG++Y++I+E D R NKSP+LLKYNPVHKK+PVL+H  
Sbjct  4    EVKVIGSILSGFCVRVEWALKLKGVEYEYIKE-DLR-NKSPMLLKYNPVHKKVPVLVHGD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K + ESL+ILEYIDETW +N  PLLP+DPY+RA ARFWAK+ DEKC+    +   A  EE
Sbjct  62   KPIPESLVILEYIDETWKDN--PLLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +    +   L   + GK  FGGE +G +D+    + +W+ V++E  G+++L  E+
Sbjct  120  KEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAER  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               ++EW E  + +  +IKE +PPRD L+ ++ A +
Sbjct  180  FPSLHEWAENFI-QIPLIKECIPPRDDLVNHFHASL  214



>ref|XP_009802971.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=226

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 159/225 (71%), Gaps = 8/225 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV +LG   S +S RVE ALK+KG++Y+FI EED + NKSPLLL+ NPV KKIPVL+H
Sbjct  1    MAEVRLLGVSGSSYSRRVEWALKVKGVEYEFI-EEDLQ-NKSPLLLQSNPVFKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            NGK ++ES++ILEYIDET+D  +  +LP+DPY+RA ARFWAKF+D KC+    K L++  
Sbjct  59   NGKPISESMVILEYIDETFDGPS--ILPEDPYERAIARFWAKFLDGKCLEVVGKALWSKG  116

Query  379  -EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             +E +  + E    L ++ +EL  K  FGG+ +G VD+AA  + +W+++++EA G+ +++
Sbjct  117  KKEKQSIQQEAYEMLKIVDNELKDKKFFGGDKIGFVDVAANYIPFWLEIVEEATGVVLVT  176

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKGII  690
             EK   +  W +  +S CS +KENLP RD +L +++A++    ++
Sbjct  177  SEKFPHLCAWRDEYLS-CSEVKENLPDRDMMLGFFKAKVQAAAVL  220



>gb|AFK36747.1| unknown [Lotus japonicus]
Length=224

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 147/215 (68%), Gaps = 9/215 (4%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPF  RV+IAL LKG++Y+F+  E     KS LLLKYNPVHKK+PV +HN K
Sbjct  8    VQLLGIVGSPFVRRVQIALNLKGVEYEFV--EQIFGQKSDLLLKYNPVHKKVPVFVHNDK  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK---ILYAEE  384
             +AESL+ILEYIDETW +N  P+LP DPY+RA ARFW+KFID+K +  T K   IL   E
Sbjct  66   PIAESLVILEYIDETWKSN--PILPSDPYKRALARFWSKFIDDKVIDTTWKAVFILEEAE  123

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  +E+  AL  L +EL  K  FGGE    VDIAA+ + ++I + QE AGL +L+ E 
Sbjct  124  REKIIEELSEALQYLENELKEK-FFGGEEFEFVDIAAVFIAFYIPLFQEVAGLHLLTAEN  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              K+Y W +  ++   V+KE++PPRD LLA ++ R
Sbjct  183  FPKLYNWSQDFLNH-PVVKESMPPRDPLLAIFKGR  216



>ref|XP_004147931.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=220

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+ GG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  4    EVELFGGWMSPFSRRVELGLKLKGIDYKY-HEEDLK-NKSDFLLTYNPIYKKVPVFLHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYID+ W N+  P  P+ +PY+ AQARFWAK+ID+K +AAT K   +   
Sbjct  62   NPISESLIILEYIDQVW-NSLYPFFPQQNPYETAQARFWAKYIDDKVLAATLKAAKSSKR  120

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G+VDI   V+ YWI  I+E  G E+L+ 
Sbjct  121  EEREKGLEETEETLKPLEKELQNKKFFGGNKIGIVDIVGTVIAYWIPAIEEGFGSELLTS  180

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +K  K+ +W E ++ K SV+K+ LPP+  L+AY Q 
Sbjct  181  KKFPKLTKWSEEIV-KNSVVKQVLPPKSVLVAYLQV  215



>ref|XP_004492376.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=224

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 149/219 (68%), Gaps = 9/219 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  E+++ G  LSPF  RVEIALKLKG++Y +  E +   N S  L+ YNPV+KK+PVL+
Sbjct  4    NKEELKLFGMRLSPFVSRVEIALKLKGVEYKY--ELEKMGNLSETLINYNPVYKKVPVLV  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDE W  N  P+LP DPY+R+ ARFW+ FID+KC +A  K  Y  
Sbjct  62   HNEKPVSESLVILEYIDEIWKQN--PILPSDPYKRSLARFWSNFIDDKCFSAMGKTFYTI  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
               E E + +E + A+ +L +ELN K  FGGE +G +DI A+++ YW+ ++ EA GL++ 
Sbjct  120  DEHERETSIEETKVAIQILENELNDK-FFGGEDIGFLDITAVLIAYWLPILYEAIGLKLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            + +K  K+Y+W +   +   ++KE LPPR+ LLA+Y A 
Sbjct  179  TNDKFPKLYKWSQDF-NNHPIVKETLPPRETLLAFYIAH  216



>ref|XP_002281694.2| PREDICTED: uncharacterized protein LOC100246830 [Vitis vinifera]
Length=446

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 159/227 (70%), Gaps = 10/227 (4%)
 Frame = +1

Query  1    AKAIQLRNMSE-VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPV  177
            +K++Q   M+E V++ G   SPFS R+E+ALKLKGIQY++I EED   NKSP LLKYNPV
Sbjct  220  SKSLQAATMAEEVKLFGMWASPFSRRIEVALKLKGIQYEYI-EEDLS-NKSPSLLKYNPV  277

Query  178  HKKIPVLLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA  357
            HKKIPVLLH GK +AESL+ILEYIDETW +N  P+LP DPY+RA ARFWAKF+DEK   A
Sbjct  278  HKKIPVLLHKGKPVAESLVILEYIDETWKHN--PILPADPYERAMARFWAKFLDEKLWPA  335

Query  358  TRKILYA--EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQE  531
             +K+  +  EE     +E+Q  L  L  EL  K  FGGES+G VDIAA ++ +W+ V+QE
Sbjct  336  AKKVALSKGEEHNGLIEEIQEHLKTLESELKEKKFFGGESLGFVDIAADII-FWLLVVQE  394

Query  532  AAGLEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              GL++L+ +K   ++EW   L+   +V KE +   ++LLA ++ R 
Sbjct  395  TLGLDILTEDKFPGLHEWYHRLLDD-AVFKECV-SMERLLASFKVRF  439


 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 156/217 (72%), Gaps = 9/217 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS R+E+ALKLKG+Q+++I+E     NKSP LLKYNPVHKKIPVL+HNG
Sbjct  4    EVKLFGTWASPFSRRIEVALKLKGVQFEYIEEN--LSNKSPALLKYNPVHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+ILEYIDETW +N  P+LP DPY++A ARFWAK++D+K   A  K++ +  EE
Sbjct  62   KPVAESLVILEYIDETWKHN--PILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGL-EVLSRE  561
             +   +E+Q  L  L  EL  K  FGGES+G VDIAA ++ + + V QEA GL E+L+ E
Sbjct  120  QKAVIEEIQEQLKTLESELKEKKFFGGESLGFVDIAANIIVFLL-VAQEALGLMEILTEE  178

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K   ++EW + L+   +V KE +PPR++ L +++AR 
Sbjct  179  KFPVLHEWYQRLVDD-AVFKECVPPRERHLGFFKARF  214



>ref|XP_008359780.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=216

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 152/216 (70%), Gaps = 11/216 (5%)
 Frame = +1

Query  40   VLGGPLSPFSFRVEIALKLKGIQYDFIQEE-----DYRFNKSPLLLKYNPVHKKIPVLLH  204
            +LG   SPFS RVEIALKLKG++Y++++E+     D + NKS LLLKYNPVHKK+PVL+H
Sbjct  2    LLGVWGSPFS-RVEIALKLKGVKYEYVEEDLPNKKDLQ-NKSALLLKYNPVHKKVPVLVH  59

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            N K +AESL+I+EYIDETW +  +P+LP+DPYQRA ARFWA+FIDE C     K  + +E
Sbjct  60   NEKPIAESLVIVEYIDETWKHQGSPILPEDPYQRANARFWARFIDEXCKPGIIKAFFEKE  119

Query  385  SE-KARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
               KA DE +G L LL +EL     FGGE++G VDIAA ++G+W+   QEA  L +LS+E
Sbjct  120  XRXKAVDEARGLLKLLENELKDNKFFGGETIGFVDIAANLIGHWLKPAQEALELGLLSKE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K  K+++W +  +   S +KE LPP D L+    +R
Sbjct  180  KSPKLWDWXDEFV---SXVKETLPPTDNLIGLILSR  212



>ref|XP_006367676.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=225

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 150/218 (69%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   S FS RVE ALK+KG++Y++I+E+ +  NKS LLL+ NP+HKK+PVL+H
Sbjct  1    MAQVKLLGFWYSAFSHRVEWALKIKGVKYEYIEEDPH--NKSLLLLQSNPIHKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            NGK + ES++ILEYIDET+   +  +LPKDPY RA ARFWAKF D K VA     L    
Sbjct  59   NGKPICESMVILEYIDETFKGPS--ILPKDPYDRALARFWAKFFDNKVVAVVNAFLGKGN  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK ++EV   L +L  EL  K LF G+  G VDIAA +VG W+ V QEA+G+ + + E
Sbjct  117  EQEKGKEEVCEMLKVLEKELKDKKLFVGDKFGFVDIAANLVGLWMGVFQEASGVVLATNE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPR-DKLLAYYQARI  672
                   W +A ++ CS +KE LPPR D+LLA+YQA I
Sbjct  177  NFPNFCAWRDAYIN-CSQVKEYLPPRIDELLAFYQAYI  213



>ref|XP_009787286.1| PREDICTED: glutathione S-transferase U8-like [Nicotiana sylvestris]
Length=223

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 155/221 (70%), Gaps = 10/221 (5%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M ++++LG   SPFS RVEIALKLKGIQY++I+E+    NKS  LLKYNPV+K IPVLLH
Sbjct  1    MEDIKLLGSWASPFSVRVEIALKLKGIQYEYIEED--LSNKSATLLKYNPVYKMIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK +AESL+ILEYIDETW + T  LLPKD  QRA ARFWA F+DEKC+   +++ Y E 
Sbjct  59   NGKPIAESLVILEYIDETWKDETH-LLPKDLNQRAMARFWANFLDEKCLPEMKELCY-ES  116

Query  385  SEKARDEVQGALNLLVDE-----LNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
            + + R++ +G L+ L+       +  K  F    VG ++I +I++ YW+ +I EA  +++
Sbjct  117  NNEVREKARGELHELLKLLENEIIKDKNFFAVNRVGYIEIVSILITYWLGIIHEALKVDI  176

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            L++E+   I  W E ++S  S IKENLPPR+K+LA+Y+  +
Sbjct  177  LTKEEFPNICAWSEDVIS-FSFIKENLPPREKILAFYKMYV  216



>ref|XP_009768031.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=223

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 153/217 (71%), Gaps = 12/217 (6%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SPF+ RV+ ALK+KG++Y++I+E+  R NKS LLL+ NP+HKK+PVL+H
Sbjct  1    MAQVKLLGFWYSPFTHRVKWALKVKGVKYEYIEED--RANKSSLLLQSNPIHKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA----TRKIL  372
            NGK + ES++ILEYIDET+   +  +LPKDPY RA ARFWAKF+D+K  A      RK  
Sbjct  59   NGKPIVESMVILEYIDETFGGPS--ILPKDPYDRALARFWAKFLDDKVTAVPNIFRRK--  114

Query  373  YAEESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              EE EKA++EV+    +L +EL  K  F G+  G  DIAA +V +W+ V QE +G+ ++
Sbjct  115  -GEEQEKAKEEVREMFKVLDNELKDKKFFVGDKFGFADIAANLVAFWLGVFQETSGVVLV  173

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
            + EK     +W    ++ CS IKE+LPPRD+LLA+Y+
Sbjct  174  TSEKFPNFCKWRGEYIN-CSQIKESLPPRDELLAFYR  209



>emb|CAN73676.1| hypothetical protein VITISV_001111 [Vitis vinifera]
Length=220

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 150/216 (69%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   S FS R+E+ALKLKG+Q+++I+E     NKSP LLKYNP+HKKIPVL+HNG
Sbjct  4    EVKLFGTWASVFSRRIEVALKLKGVQFEYIEEN--LSNKSPALLKYNPLHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AESL+ILEYIDETW +N  P+LP DPY++A ARFWAK++D+K + A   +  +  EE
Sbjct  62   KPVAESLVILEYIDETWKHN--PILPTDPYEKAMARFWAKYMDDKLLPAAIXVAMSKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
                 +E+Q  L  L  EL  K  FGGES+G VDIAA  +  W+ V QEA G+E+L+ EK
Sbjct  120  QXGVIEEIQKQLKTLESELKEKKFFGGESLGFVDIAANTI-VWLVVAQEALGMEILTEEK  178

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               ++ W + L+   +V KE +PPR++ L++ + R 
Sbjct  179  FPVLHGWYQRLVDD-AVFKECMPPREQHLSFVKVRF  213



>ref|NP_001238643.1| glutathione S-transferase GST 6 [Glycine max]
 gb|AAG34796.1|AF243361_1 glutathione S-transferase GST 6 [Glycine max]
Length=225

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 149/215 (69%), Gaps = 8/215 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V +LG   SPF  RV+IALKLKGI+  F++E     NKS LLLK NPV+KK+PV +HN 
Sbjct  7    DVTLLGVVGSPFVCRVQIALKLKGIECKFLEEN--LANKSDLLLKSNPVYKKVPVFIHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K +AESL+I+EYIDETW NN  P+LP DPYQR+ ARFW+KFID+K V A+ K ++    +
Sbjct  65   KPIAESLVIVEYIDETWKNN--PILPSDPYQRSFARFWSKFIDDKIVGASWKSVFTVDEK  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK  +E   AL  L +EL  K  FGG+  G VDIA + + + I + QE AGL++ + E
Sbjct  123  EREKNVEESLEALQFLENELQDKRFFGGDEFGFVDIAGVFIAFSIPIFQEVAGLQLFTSE  182

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K  K+++W + L++   V+K+ LPPR+ L A++++
Sbjct  183  KFPKLFKWSQELINH-PVVKDVLPPREPLFAFFKS  216



>ref|XP_010325822.1| PREDICTED: LOW QUALITY PROTEIN: probable glutathione S-transferase 
[Solanum lycopersicum]
Length=224

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 151/215 (70%), Gaps = 6/215 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M +V++LG   SPF+ RVE  LKLKG++Y++I+E+  R+NKS LLL+ NP++KK+PVL+H
Sbjct  1    MEQVKLLGFWYSPFTNRVEWXLKLKGVKYEYIEED--RYNKSSLLLESNPIYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            N K + +S++ILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K V      L   E
Sbjct  59   NDKPICDSMVILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKVVTVVNAFLGKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E+EKA++EV   L +L +EL  K  F G+  G+ DI A +VG W+ V QE +G+E+++ E
Sbjct  117  ENEKAKEEVYEMLKILDNELKNKKFFVGDKFGIADIVANLVGLWLGVFQEGSGVELVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K      W +  ++ CS +KE LP RD LLA++QA
Sbjct  177  KFPNFCSWRDEYVN-CSQVKEYLPRRDDLLAFFQA  210



>gb|ACU15611.1| unknown [Glycine max]
Length=217

 Score =   204 bits (519),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV +LG   SPFS RV++ALKLKG+ Y +  EED   NKS  LLKYNPVHKK+PVL+HNG
Sbjct  8    EVRLLGKWASPFSNRVDLALKLKGVPYKY-SEEDLA-NKSADLLKYNPVHKKVPVLVHNG  65

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEES-  387
              L ESLII+EYIDETW NN  PLLP+DPY+RA ARFW+K +D+K + A     +++E+ 
Sbjct  66   NPLPESLIIVEYIDETWKNN--PLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENG  123

Query  388  -EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E   AL +L + L  K  FGGES+GLVDIAA ++GYW+ ++QE AGLE+L+ EK
Sbjct  124  REKAVEEALEALKILQETLKDKKFFGGESIGLVDIAANLIGYWVAILQEIAGLELLTIEK  183

Query  565  HAKIYEWMEALMS  603
              K+Y W +  ++
Sbjct  184  FPKLYNWSQDFIN  196



>ref|XP_002520477.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41890.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 150/215 (70%), Gaps = 8/215 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G   SPFS RVE+AL+LKGIQY++  EED R NK  LLLKYNPVHKKIPVL+HNG
Sbjct  4    EVKLMGMWASPFSRRVEMALRLKGIQYEYT-EEDLR-NKGELLLKYNPVHKKIPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K++AESL+ILEYIDETW +N  P +PKDPY RA  RFW  F++EK + A  K   A  EE
Sbjct  62   KTVAESLVILEYIDETWQDN--PNMPKDPYNRAMTRFWVNFVEEKILQAAYKTRTAEGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVI-QEAAGLEVLSRE  561
             E+    V   L LL +EL GK  FGGE +G VDI A  V YW  V+ Q+A  +E ++ E
Sbjct  120  REQLIQGVHQDLKLLENELKGKEFFGGEKIGYVDIVAFSVLYWYQVMCQDALEMEFITEE  179

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K   +++W+ A +S+   IKE++P ++K +A+ +A
Sbjct  180  KFPVLHKWI-AKLSEIDGIKESIPLKNKHVAHLKA  213



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 143/210 (68%), Gaps = 6/210 (3%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SPF+ RV  ALKLKG++YD+ QEED   NKSPLLL+YNPVHKKIPVL+HNGK
Sbjct  6    VKLLGHWASPFALRVHWALKLKGVEYDY-QEEDLP-NKSPLLLQYNPVHKKIPVLVHNGK  63

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEES  387
             +AES +ILEYIDETW  N  PLLP+DPY+RA+ARFWAKFID+KCV    +      EE 
Sbjct  64   PIAESSVILEYIDETWKKN--PLLPEDPYERAKARFWAKFIDDKCVPGIFRTFSKVGEEQ  121

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            +K   E +  L LL  EL+ K +FG   +G +D+A+  +  W  +++E   ++++  E+ 
Sbjct  122  QKIAKEARENLKLLEGELDKKRVFGDSRIGFIDVASAWIICWAQIVEEIVDIKLIDAEEM  181

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
              +  W E ++    V+KE  PP+DKLL +
Sbjct  182  PSLVAWFENVLEAAPVLKECTPPKDKLLEH  211



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 146/214 (68%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V+G   S F  RVE ALKLKG++Y++I+E D R NKSP+LLKYNPVHKK+PVL+H  
Sbjct  4    EVKVIGSIKSGFCVRVEWALKLKGVEYEYIKE-DLR-NKSPMLLKYNPVHKKVPVLVHGD  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K + ESL+ILEYIDETW +N  PLLP+DPY+RA ARFWAK+ DEKC+    +   A  EE
Sbjct  62   KPIPESLVILEYIDETWKDN--PLLPEDPYERAMARFWAKYADEKCMFGAWEAFKAEGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +    +   L   + GK  FGGE +G +D+    + +W+ V++E  G+++L  EK
Sbjct  120  KEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
               ++EW E  + +  +IKE +PPRD L+ ++ A
Sbjct  180  FPSLHEWAENFI-QIPLIKECIPPRDVLVNHFHA  212



>ref|XP_009767206.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=223

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 151/214 (71%), Gaps = 6/214 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SPFS RVE ALKLKG++Y+ + EED + NKSPLLL+ NPVHKKIPVL+H
Sbjct  1    MAQVKLLGLWYSPFSHRVEWALKLKGVKYELV-EEDLQ-NKSPLLLESNPVHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK ++ESL+ILEYIDET++  +  +LPKDPY R+ ARFWAKF+D+K        L   E
Sbjct  59   NGKPISESLVILEYIDETFEGPS--ILPKDPYDRSLARFWAKFLDDKVTVIVNTFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++EV   L +L +EL  K  F G+  G  DIAA  V +W+ V +EA+G+ +++ E
Sbjct  117  EQEKAKEEVCEMLKVLDNELKDKKFFVGDKFGFADIAANFVAFWLGVFEEASGVVLVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
            K     +W +   + CS +KE+LP RD+LL +++
Sbjct  177  KFPNFSKWRDE-YTNCSQVKESLPLRDELLPFFR  209



>ref|XP_007016281.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33900.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=261

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 151/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SP+S RVE+ALKLKGI Y++++E+    +KS LLLKYNPVH+KIPVL+HNG
Sbjct  43   EVKLFGMWASPYSRRVELALKLKGIPYEYVEED--LSSKSCLLLKYNPVHQKIPVLVHNG  100

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYAEE  384
            K +AESL+ILEYIDETW NN  P+LP+DPY RA ARFWAKFIDEK +  TRK  +   +E
Sbjct  101  KPIAESLVILEYIDETWTNN--PILPQDPYDRAMARFWAKFIDEKLLMTTRKASVASGKE  158

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E+A +E+   L LL  EL GK  F G S+G +DI A V+ +W   +QEA G+++ ++EK
Sbjct  159  KEQAIEEITEQLKLLESELQGKEYFSGPSIGYLDIVASVLVFWFGNLQEALGVDMFTKEK  218

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               I+ W+   +++   ++    P++K L Y + R+
Sbjct  219  FPIIFGWI-GKVAEIDAVEVCRIPKEKHLEYIRTRL  253



>emb|CBI16039.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 162/224 (72%), Gaps = 9/224 (4%)
 Frame = +1

Query  10   IQLRNMSE-VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKK  186
            +Q   M+E V++ G   SP+S R+E+ALKLKG+Q+++I+E  Y  NKSP LLKYNPVHKK
Sbjct  84   LQTATMAEEVKLFGAWGSPYSRRIELALKLKGLQFEYIEENLY--NKSPALLKYNPVHKK  141

Query  187  IPVLLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK  366
            +PVL+HNGK +AESL+ILEYIDETW +N  P LP DPY++A+ARFWA+FIDEK   A +K
Sbjct  142  VPVLVHNGKPVAESLVILEYIDETWKHN--PFLPTDPYEKAKARFWARFIDEKFWPAAKK  199

Query  367  ILYAE--ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAG  540
             + +   E E+A +E Q  L  L  EL  K +FG ES+G VDIAA ++ +W+ V QEA G
Sbjct  200  AMASRGREREEAIEEAQQHLKTLESELKEKKIFGRESLGFVDIAAHLL-FWLVVAQEAFG  258

Query  541  LEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +E+L+ EK   ++E  + L  + +V KE +PP+++L+AY + R+
Sbjct  259  VEILTEEKFPAVHELYQRLADE-AVFKECMPPKEQLIAYLKVRL  301


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  313  ARFWAKFIDEKCVAATRKILYA--EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVD  486
            ARFWAK+ID+K     +K++ +  EE +   +E+Q  L  L  EL     FGGES+G VD
Sbjct  2    ARFWAKYIDDKVNPIPKKVVVSKGEEQKGVIEEIQEQLKTLESELKETKFFGGESLGFVD  61

Query  487  IAAIVVGYWIDVIQEAAGL  543
            IAA ++  W+ V QEA G 
Sbjct  62   IAANIL-VWLLVAQEALGF  79



>ref|XP_002520476.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41889.1| glutathione s-transferase, putative [Ricinus communis]
Length=230

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 147/216 (68%), Gaps = 7/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            + E+++LG   SPFS R+ +ALKLKGIQY +I+++    NKSPLLL  NPVHKKIPVLLH
Sbjct  2    VEELKLLGTWASPFSHRIRLALKLKGIQYQYIEQD--LSNKSPLLLMSNPVHKKIPVLLH  59

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYA  378
            N   +AESL+ILEYID+TW ++  PLLPKDPY RA ARFWAKF+DEK +    K      
Sbjct  60   NDSPIAESLVILEYIDQTWKHH--PLLPKDPYDRAIARFWAKFVDEKILQTALKGSAATG  117

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            +E E+  +EV   L LLV+EL     FGGES+G +DI A  + Y+ +  Q    ++++S 
Sbjct  118  KEKEQVIEEVDQYLKLLVNELKDNDFFGGESIGYLDIVAFSIFYFFEGHQVIMRIKLISE  177

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            EK   +Y+WME L  +  VI E+LPP+DK L Y+ A
Sbjct  178  EKVPVLYKWMERLCER-DVICESLPPKDKHLGYFVA  212



>gb|KHN05114.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 149/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  +V +LG   SPF  RV+IALKLKGI+  F++E     NKS LLLK NPV+KK+PV +
Sbjct  4    NQEDVTLLGVVGSPFVCRVQIALKLKGIECKFLEEN--LANKSDLLLKSNPVYKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K +AESL+I+EYIDETW NN  P+LP DPYQR+ AR W+KFID+K V A+ K ++  
Sbjct  62   HNEKPIAESLVIVEYIDETWKNN--PILPSDPYQRSFARVWSKFIDDKIVGASWKSVFTV  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK  +E   AL  L +EL  K  FGG+  G VDIA + + + I + QE AGL++ 
Sbjct  120  DEKEREKNVEESLEALQFLENELQDKRFFGGDEFGFVDIAGVFIAFSIPIFQEVAGLQLF  179

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            + EK  K+++W + L++   V+K+ LPPR+ L A++++
Sbjct  180  TSEKFPKLFKWSQELINH-PVVKDVLPPREPLFAFFKS  216



>gb|KDP34500.1| hypothetical protein JCGZ_11050 [Jatropha curcas]
Length=224

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 7/214 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+E+ALKLKGIQY +I+E+   FNKSPLLL+ NPVHKK+PVL+HNG
Sbjct  4    EVKLLGAWASPFSHRIELALKLKGIQYHYIEED--LFNKSPLLLQSNPVHKKVPVLIHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKC--VAATRKILYAEE  384
            K ++ESL+IL+YI+ETW NN  P+LPKDPY RA  RFWAKFIDEK   +A+  K    EE
Sbjct  62   KPISESLVILDYIEETWQNN--PILPKDPYDRAVVRFWAKFIDEKILKIASKFKAAKGEE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             ++  +E+   L +L  EL  K  FGGE++G +DI A  + YW  V QE   ++ +S EK
Sbjct  120  KKQVLEELGEQLKILEKELEEKEFFGGETIGYLDIVAFFIVYWFQVRQEVLQIKFISEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
               +++WME L  +   + E LPP++K  AY ++
Sbjct  180  FPVVWKWMEKL-HQIDFVSECLPPKEKHYAYIRS  212



>ref|XP_006849222.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
 gb|ERN10803.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
Length=226

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 146/214 (68%), Gaps = 8/214 (4%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V +LG   SPF  RV++ALKLKGI+Y++I EED + NKSPLLLK NPVHKKIPVL+H  K
Sbjct  8    VRLLGSFRSPFVHRVQLALKLKGIEYEYI-EEDLK-NKSPLLLKANPVHKKIPVLIHGDK  65

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA--TRKILYAEES  387
             + ES++ILEYI+ETW  N  P+LPKDPY RAQARFWAKFIDEK + A  T       + 
Sbjct  66   PVCESVVILEYIEETWPEN--PILPKDPYDRAQARFWAKFIDEKVLLACWTAYSTQGVQQ  123

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
             KA +E Q +L  L   L GK  FGGE++G +DI A  +  W+ V+ EAA +E    EK 
Sbjct  124  AKALEEFQESLKTLERGLKGK-FFGGENIGFLDIVANFLSLWMGVLGEAANIEHYDAEKT  182

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              I+ W++  MS   V+KE+LP RDKLLA ++ R
Sbjct  183  PLIHSWIQQ-MSSNEVVKESLPSRDKLLANFKVR  215



>ref|XP_004246383.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 157/222 (71%), Gaps = 6/222 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SP+S RVE ALK+KG++Y+FI EED R NKSPLLL+ NP++KKIPVL+H
Sbjct  1    MADVKLLGLWYSPYSHRVEWALKIKGVEYEFI-EEDLR-NKSPLLLESNPIYKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK-ILYAE  381
            NGK + ES++I+EYIDET++  +  +LPKDPY RA ARFWAKF DEK  +  R   L  E
Sbjct  59   NGKPICESMVIVEYIDETFEGPS--ILPKDPYDRAIARFWAKFFDEKGSSVGRSFFLKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++E+   L ++ +EL  K  F  +  G VDI A VV  W+ V++EA+G+ +++ E
Sbjct  117  EQEKAKEELHEMLKVVDNELKDKKYFVVDKFGFVDIVANVVALWLGVLEEASGVVLVTNE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKGI  687
            K+   Y W +  ++ CS  K+ LP R++LLA ++ARI+   +
Sbjct  177  KYPNFYAWRDEYIN-CSENKKYLPSRNELLAKFKARILAASV  217



>ref|XP_006849226.1| hypothetical protein AMTR_s00027p00230760 [Amborella trichopoda]
 gb|ERN10807.1| hypothetical protein AMTR_s00027p00230760 [Amborella trichopoda]
Length=224

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 144/216 (67%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V +LG   SPF  RVE+ALKLKGI+Y+FI EED + NKSPLLL+ NPVHKKIPVL+H  
Sbjct  5    KVRLLGAWGSPFVHRVELALKLKGIEYEFI-EEDLK-NKSPLLLESNPVHKKIPVLIHGN  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE--E  384
              ++ES +ILEYIDETW     P+LPKDPY+RAQARFWAKFID+KC+  +      +  +
Sbjct  63   NPVSESTVILEYIDETWPE--IPILPKDPYERAQARFWAKFIDDKCLPVSWIAFTTQGGQ  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA  E Q  +  L   L  K  FGGE++  VD+    +GYW+ ++ EAAG++    EK
Sbjct  121  QEKALKEAQECIKTLEAALKAK-FFGGETIDYVDVVGNFLGYWMRILGEAAGIQYYDAEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
                + W+E   S   V+KE+LP  DKLLAY++  +
Sbjct  180  APVFHSWIEEFTS-VDVVKESLPTHDKLLAYFKGHL  214



>ref|XP_009399930.1| PREDICTED: probable glutathione S-transferase [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 152/215 (71%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V     SPFS+RVE+AL+LKG+ Y++I EED   NKS LLL+YNPVHKK+PVLLH+G
Sbjct  4    EVKVFRSWGSPFSYRVELALRLKGVAYEYI-EEDLS-NKSTLLLEYNPVHKKVPVLLHHG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--AEE  384
            K +AESL+ILEYI+ETW  N  P+LPKDP +RA ARFW++F+D+KC  A     +   E 
Sbjct  62   KPIAESLVILEYIEETWQEN--PILPKDPRERAVARFWSRFLDDKCSLALWMSCWTEGET  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +   ++ +  L+LL +EL GK  FGG+S+G+VDIAA  + +W+ V++E AG+ +L  EK
Sbjct  120  QQNFMEQAKECLHLLEEELKGKKFFGGDSIGMVDIAASFIAHWLGVLEEVAGISLLDEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            +  + +W E  + K   + E LP R  LLA++QAR
Sbjct  180  YPNLCKWTEEFL-KSDAVMECLPKRANLLAFFQAR  213



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 149/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV+++G   S FS RVE ALKLKGI+Y++I E D R NKS LLLK NPV+KKIPVLLH
Sbjct  1    MAEVKIIGSAASLFSVRVEWALKLKGIEYEYIVE-DLR-NKSELLLKSNPVYKKIPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            N K+++ESL+I+EYIDETW  N  P+LP+DPY RA ARFWAKF+DEK +    +   A  
Sbjct  59   NDKAISESLLIIEYIDETWKEN--PILPEDPYDRANARFWAKFLDEKGLLGAWEACQAEG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EKA +     L LL  E+ GK  FGGE +G +D+AA  + +W+ V+ E   + V  R
Sbjct  117  EEKEKAVEAAVQHLALLDKEIQGKKFFGGEKIGYLDLAAGWICHWLSVLDEVGEMNVFDR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   ++EW +  +    VIKE+LPPR+ L+ Y++  +
Sbjct  177  ERFPSLHEWAQNFIH-VPVIKESLPPREILVNYFKGSL  213



>ref|XP_006367664.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 154/218 (71%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+++++LG   SPF+ RVE ALK+KGI+Y++I+E+  R+NKSPLLL+ NP++KK+PVL+H
Sbjct  1    MAQIKLLGFWYSPFTHRVEWALKIKGIEYEYIEED--RYNKSPLLLESNPIYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK + +S++ILEYIDE ++  +  +LPKDPY RA ARFWAKF+D+K  A     L   E
Sbjct  59   NGKPICDSMVILEYIDEIFEGPS--ILPKDPYDRALARFWAKFLDDKVAAVVNAFLRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++E+   L +L +EL  K LF  +  G  D+AA +VG W+   +EA+G+ + + E
Sbjct  117  EHEKAKEEICEMLKILDNELKDKMLFVADKFGYADMAANLVGLWMGFFEEASGVVLATNE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPR-DKLLAYYQARI  672
            K      W +A ++ CS +KE LP R D+LLA+YQ R+
Sbjct  177  KFPNFCTWRDAYIN-CSQVKEYLPSRFDELLAFYQDRV  213



>ref|XP_006298410.1| hypothetical protein CARUB_v10014479mg, partial [Capsella rubella]
 gb|EOA31308.1| hypothetical protein CARUB_v10014479mg, partial [Capsella rubella]
Length=247

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 156/221 (71%), Gaps = 7/221 (3%)
 Frame = +1

Query  13   QLRNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIP  192
            ++    +V+VLG   SPFS RVE+ L+LKGI Y++I EED   NKSP+LLKYNP+HKK+P
Sbjct  22   KMNQEEQVQVLGLWGSPFSKRVEMVLQLKGIPYEYI-EEDVYGNKSPMLLKYNPIHKKVP  80

Query  193  VLLHNGKSLAESLIILEYIDETWDNNTAP-LLPKDPYQRAQARFWAKFIDEKCVAATRKI  369
            VL+HNG+S+AESL+I+EYI++TW   T P +LP+DPY+RA ARFWAK++DEK + A  K 
Sbjct  81   VLVHNGRSIAESLVIVEYIEDTW--KTGPTILPQDPYERAMARFWAKYVDEKVMVAMGKA  138

Query  370  LYAEESEKARDEVQG--ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGL  543
             +  ESE+ ++  +    L  L  E+  K  FGGE++G+VDIAA  +GYW+ ++QE +G+
Sbjct  139  FWGPESEREKERKEAYEGLISLEKEIGDKRFFGGETIGIVDIAADFIGYWLGIVQEVSGV  198

Query  544  EVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
             +++ E+   +  W E  +   ++IKE LPP+ KL A ++ 
Sbjct  199  TIMTAEEFPNLKRWSEDFVGN-NIIKEVLPPKQKLAALFKT  238



>ref|XP_006367677.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=215

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 151/221 (68%), Gaps = 8/221 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V+ LG   SPFS RVE ALK+KG++Y+FI E+D + NKSPLLL+ NP+HKKIPVL+H
Sbjct  1    MADVKFLGLWYSPFSHRVEWALKIKGVEYEFI-EQDLQ-NKSPLLLESNPIHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKI-LYAE  381
            NGKS+ ES++I+EYIDET++  +  +LPKDPY RA ARFW KF++++  A  + I L  E
Sbjct  59   NGKSICESMVIVEYIDETFEGPS--ILPKDPYDRALARFWVKFLEDQVAAVGKTIFLKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA+ E    L +L +EL  K  F G+  G  DI A V+  W+ V +EA+G+ +++ E
Sbjct  117  EQEKAKKEACEMLKILENELKDKKYFVGDKFGFADIGANVLAIWLGVFEEASGVPLVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGKG  684
             +  +Y W       C+  KE LP RD+LLA++QAR   K 
Sbjct  177  NYPNLYAWRNEY---CNQNKEYLPSRDELLAHFQARFPAKA  214



>gb|KDP42181.1| hypothetical protein JCGZ_02911 [Jatropha curcas]
Length=224

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 149/218 (68%), Gaps = 11/218 (5%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             EV++LG   SPFS R+++ALKLKGIQY++I+++    NKS LLLK NPVHKKIPVLLHN
Sbjct  4    GEVKLLGTWASPFSHRIKLALKLKGIQYEYIEQD--LTNKSTLLLKSNPVHKKIPVLLHN  61

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--E  381
            GK +AESL+ILEY+DE W NN  P LP+DPY +A ARFWA F+D+K +  T K   A  E
Sbjct  62   GKPIAESLVILEYVDEKWQNN--PFLPEDPYNKAMARFWATFVDQKILQVTLKASAATGE  119

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E E+  +EV   L LL +ELN K LFGGE++G +DI A  + Y+  + +E   +E++S E
Sbjct  120  EKEQILEEVDQYLKLLENELNEKDLFGGENIGYLDIVAFSILYFFQIRKEIMRIELISEE  179

Query  562  KHAKIYEWMEALMSKCSV--IKENLPPRDKLLAYYQAR  669
            K   +  W+  +   C V  + ++LPP+D+ L Y  A+
Sbjct  180  KFPVLNRWIGKI---CEVDEVNQSLPPKDRHLVYVVAK  214



>ref|XP_004137330.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN63854.1| hypothetical protein Csa_1G024860 [Cucumis sativus]
Length=224

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 148/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV+++G   S F  RVE ALKLKGI++++I E D R NKS LLLK NPVHKKIPV LH
Sbjct  1    MAEVKIIGSAGSLFCIRVEWALKLKGIEFEYIVE-DLR-NKSELLLKSNPVHKKIPVFLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            N K+++ESL+I+EYIDETW  N  P+LP+DPY RA ARFWAKF+DEK +    +   A  
Sbjct  59   NDKAISESLLIIEYIDETWKEN--PILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EKA +     L LL  E+ GK  FGGE +G +D+AA  + +W++V+ E   + V  R
Sbjct  117  EEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEMNVFDR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   ++EW +  +    VIKE+LPPR+ L+ Y++  +
Sbjct  177  ERVPSLHEWAQNFIH-VPVIKESLPPRETLVNYFKGSL  213



>gb|AGH14251.1| glutathione S-transferase [Musa acuminata AAA Group]
Length=224

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 151/215 (70%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V     SPFS+RVE+AL+LKG+ Y++I EED   NKS LLL+YNPVHKK+PVLLH+G
Sbjct  4    EVKVFRSWGSPFSYRVELALRLKGVAYEYI-EEDLS-NKSTLLLEYNPVHKKVPVLLHHG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--AEE  384
            K +AESL+ILEYI+ETW  N  P+LPKDP +RA  RFW++F+D+KC  A     +   E 
Sbjct  62   KPIAESLVILEYIEETWQEN--PILPKDPRERAVVRFWSRFLDDKCSLALWMSCWTEGET  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +   ++ +  L+LL +EL GK  FGG+S+G+VDIAA  + +W+ V++E AG+ +L  EK
Sbjct  120  QQNFMEQAKECLHLLEEELKGKKFFGGDSIGMVDIAASFIAHWLGVLEEVAGISLLDEEK  179

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            +  + +W E  + K   + E LP R  LLA++QAR
Sbjct  180  YPNLCKWTEEFL-KSDAVMECLPKRANLLAFFQAR  213



>ref|XP_006360613.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=227

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 152/225 (68%), Gaps = 7/225 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SPFS RVE ALK+KG++Y++I+E+  R NKS LLL+ NP+HK+IPVL+H
Sbjct  1    MAQVKLLGFWYSPFSHRVEWALKIKGVKYEYIEED--RNNKSSLLLQSNPIHKEIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK + ES++ILEYIDET+D  +  +LPKDPY RA ARFWAKF+D+K  A         +
Sbjct  59   NGKPIVESMVILEYIDETFDGPS--ILPKDPYDRALARFWAKFLDDKVTAVVNTFFRKGD  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK ++EV   L +L +EL  K  F G+  G  DI A +V  W+ V +EA+G+ +++ +
Sbjct  117  EQEKGKEEVYEMLKVLDNELKDKKFFVGDKFGFADIVANMVALWLGVYEEASGVVLVTSQ  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPP-RDKLLAYYQARIIGKGIIA  693
            K  K   W +  ++ CS +KE LP  RD+LL ++ AR+  +  + 
Sbjct  177  KFPKFCAWRDEYIN-CSQVKEYLPSRRDELLTFFHARVCARAQVT  220



>ref|XP_008448643.1| PREDICTED: probable glutathione S-transferase isoform X1 [Cucumis 
melo]
Length=222

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 146/216 (68%), Gaps = 8/216 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+LGG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  6    EVELLGGWMSPFSRRVELGLKLKGINYKY-NEEDLK-NKSDFLLNYNPIYKKVPVFLHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYA---  378
              ++ESLIILEYIDE W N+  P  P+ +PY+RAQARFWAK+ID+K VAA  K   +   
Sbjct  64   NPISESLIILEYIDEVW-NSVYPFFPQQNPYERAQARFWAKYIDDKVVAAILKAAKSSKR  122

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EK  +E +  L  L  EL  K  FGG  +G VDI   V+ YWI  ++EA G EVL+ 
Sbjct  123  EEREKGLEETEETLEPLEKELQNKKFFGGNKIGFVDIVGTVIAYWIPAVEEAFGFEVLTT  182

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            +K   + +W E ++++ SV+K+ LP +  L+AY Q 
Sbjct  183  KKFPNLTKWSEEIVNQ-SVVKQVLPLKSNLVAYLQV  217



>ref|XP_004302691.1| PREDICTED: glutathione S-transferase U8-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 149/215 (69%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SP+S RVEIALKLKG+Q+ + +E+    NKSP LLKYNPVHKKIPVL+H  
Sbjct  5    EVKLYGTWRSPYSRRVEIALKLKGVQHKYYEED--LTNKSPALLKYNPVHKKIPVLVHGE  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEE  384
            K +AES +ILEYIDETW      +LPKDP ++A+ARFWA+FIDEKC+ A +K     AEE
Sbjct  63   KVIAESHVILEYIDETWKGYN--ILPKDPCEKAKARFWARFIDEKCIPALKKACASIAEE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA +E    L LL DEL  K  FGG+ +GLVDI A  + +W+ V+QE  G+E+L+ +K
Sbjct  121  REKAVEEACELLQLLEDELKHKKYFGGDCIGLVDIVANFISHWLKVVQEVVGVELLTIKK  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              ++ EW E  +     +K+ LPP++KLLA + + 
Sbjct  181  FPRLCEWSEHFVCH-HAVKDCLPPKEKLLAVFHSH  214



>gb|ABD83308.1| Fgenesh protein 133 [Beta vulgaris]
Length=223

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 143/211 (68%), Gaps = 6/211 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V G   SP S RVEIALKLKG++Y+FI EED + NKS  LLKYNPVHKKIPVL+H
Sbjct  1    MEEVKVYGAWGSPPSHRVEIALKLKGVKYEFI-EEDLK-NKSEELLKYNPVHKKIPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRK--ILYA  378
            NG+ +AESL+ILEYIDE W     PLLP DPY RAQ RFWAKFI EK   A R   ++  
Sbjct  59   NGRPIAESLVILEYIDEIW--KQCPLLPTDPYDRAQTRFWAKFIAEKITPAVRDAMLIPG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            E++EK  +E+   L++L  E+  K   GG     +DI ++ V +WI ++QE +   VL+R
Sbjct  117  EDAEKKTEELIELLHILEKEIKEKKFVGGNRNKYMDIVSLYVIHWIPILQEYSSKHVLTR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLL  651
            EK   IY+W++ ++  C  I ENLP ++K+ 
Sbjct  177  EKFPGIYDWIDQVLLDCGDIMENLPDKNKMF  207



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 142/210 (68%), Gaps = 7/210 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G   SPF+ R ++ALKLKG+QY++I+E+    NKSPLLLKYNPV+KKIPVL+H G
Sbjct  27   EVQLIGMWASPFNCRAQLALKLKGVQYEYIEED--LSNKSPLLLKYNPVYKKIPVLVHKG  84

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K ++ESL+ILEYI+ETW NN  P++P+D Y  A ARFWA F DE  +    K   A  EE
Sbjct  85   KPISESLVILEYIEETWKNN--PIMPQDSYSTAIARFWANFADENILQTAIKSSKAKGEE  142

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EK  DEV   L LL +ELNGK  FGG+++G +DI A  + +W  V  E   +E+++ E 
Sbjct  143  REKLWDEVCQNLKLLENELNGKQFFGGKNIGYLDIVAFSLVHWFQVANEVTQMELITEEN  202

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLA  654
               + +W E  M    V+KE LPPRDK LA
Sbjct  203  FPGLLKWTEK-MGDIDVVKETLPPRDKHLA  231



>ref|XP_010663654.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 148/216 (69%), Gaps = 7/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+VLG  LS F  RVE ALKLKG+ Y+++ EED R NKSP+LL+ NPVHKK+PVL+H
Sbjct  1    MGEVKVLGASLSFFCCRVEWALKLKGVAYEYL-EEDLR-NKSPMLLQSNPVHKKVPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE-  381
            +G+ +AESL+ILEYIDE W     PLLP+DP +RA+ RFWA+F DEKCV        A+ 
Sbjct  59   DGRPIAESLVILEYIDEAWKG--YPLLPEDPSERAKIRFWARFTDEKCVLGAWAACCAKG  116

Query  382  -ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E EKA +  Q +L+ L  ++ GK  FGGE++GL+D+    +  WI+ ++E  G+++L  
Sbjct  117  HEREKAIESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDE  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            EK   +YEW +  ++   +I E +P +++L+ Y+Q 
Sbjct  177  EKFPSLYEWAQKFIN-IPIISERIPTKEELINYFQG  211



>ref|XP_004246379.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=220

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 153/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M ++++LG  LSPF+ RVE ALK+KG++Y+ I E+    NKSPLLL+YNP+HKKIPVL+H
Sbjct  1    MGKIKLLGVSLSPFTHRVEWALKIKGVEYELIVEDPQ--NKSPLLLEYNPIHKKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK + ES++I+EYIDET++  +  +LPKDPY RA ARFWAKF+D+KC+    K L   E
Sbjct  59   NGKPICESMVIVEYIDETFEGPS--ILPKDPYDRATARFWAKFLDDKCLPTMGKALLGNE  116

Query  385  SEKARDEVQGA--LNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             EK + + +    L +L +EL  K  F G+ +G VDIAA  + +W+ +I+EA+G+ ++  
Sbjct  117  EEKEKAKEECGELLKILDNELKDKEFFVGDKIGFVDIAANALAFWMGIIEEASGVILVKN  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK    Y W +  ++ CS +K+ LP RD+L +++Q+R 
Sbjct  177  EKFPNYYTWRDNYIN-CSQVKKYLPSRDELFSHFQSRF  213



>ref|XP_004147913.1| PREDICTED: glutathione S-transferase U8-like [Cucumis sativus]
 gb|KGN54318.1| hypothetical protein Csa_4G303170 [Cucumis sativus]
Length=224

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+V G    P+S RVE+ALKLKG+ Y+ I +ED    KS LL+KYNP++KK+PVL+H+G
Sbjct  7    EVQVFGFRSGPYSLRVELALKLKGVVYEHI-DEDLVNKKSDLLVKYNPIYKKVPVLVHHG  65

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K ++ESL+ILEYIDETW  N A +LP+DPYQRA ARFWAK+ID+K V A +K+  ++E E
Sbjct  66   KPISESLVILEYIDETWTENYA-ILPQDPYQRALARFWAKYIDDKVVPAAQKVARSQEDE  124

Query  391  KAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + +  ++ Q  L  L  EL  K+ FGG+ +G VDI  +V+  W+   +EA G E+LS  K
Sbjct  125  REKSIEDAQATLEPLEKELENKSFFGGDKIGFVDIVGLVLARWVPATEEAVGFELLSAHK  184

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
               + +W +  ++  SV KE LP +D L+A+
Sbjct  185  FPNLTKWSQNFVNH-SVAKEVLPKKDVLVAF  214



>ref|NP_001234778.1| glutathione S-transferase-like protein [Solanum lycopersicum]
 gb|ABM06179.1| glutathione S-transferase-like protein [Solanum lycopersicum]
Length=217

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 151/217 (70%), Gaps = 8/217 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V+++G   SPFS RVE ALK+KG++Y++I  ED   NKS LLL+ NP+HK +PVL+H
Sbjct  1    MADVKLIGLWYSPFSRRVEWALKIKGVEYEYI--EDDLHNKSLLLLQSNPIHKAVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY-AE  381
            NGK L ES +ILEYIDET++  +  +LPK+PY R+ ARFWAKF D+K +A  + I +  E
Sbjct  59   NGKPLCESSVILEYIDETFEGPS--ILPKEPYDRSLARFWAKFFDDKGLAIRKSIFFKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++EV   L +L +EL  K +F GE  G VDI A     W+ V++EA+G+ +++RE
Sbjct  117  EQEKAKEEVYDMLKVLDNELKNKKIFVGEKFGFVDIVANAAALWLGVLEEASGVVLVTRE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K+    +W +     C+  K+ LPPRD+LLA+YQ  I
Sbjct  177  KYPNFCDWRDEY---CTQNKKYLPPRDELLAHYQVYI  210



>ref|XP_004246378.1| PREDICTED: glutathione S-transferase U8 [Solanum lycopersicum]
Length=235

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 152/221 (69%), Gaps = 12/221 (5%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+VLG  +SPFS RVE+ALKLKGI+Y+FI E      K P ++KYNP++KK+PV LH
Sbjct  1    MEEVKVLGFWVSPFSLRVEMALKLKGIEYEFI-EAQRPIKKCPNIIKYNPIYKKVPVFLH  59

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
             G  + ESL+ILEYIDE W + T+ LLPKDPYQRA ARFWAKFIDEKC+    K+ Y   
Sbjct  60   KGNPIPESLVILEYIDENWKDGTS-LLPKDPYQRAIARFWAKFIDEKCLPEILKLCYDSN  118

Query  385  SEKARDEVQGALNLLVDEL-------NGKTLFGGES-VGLVDIAAIVVGYWIDVIQEAAG  540
             E  + +  G L  L+  L       N K  FGGE+ VG ++I +I++ YW+ V+QEA G
Sbjct  119  YE-VKVKAMGELQELLKLLENELMKDNNKIFFGGENKVGYMEIVSILITYWLGVMQEALG  177

Query  541  LEVLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQ  663
            +++L++++   I  W + ++S  S +KENLPPR+KLLA Y+
Sbjct  178  VDILNKKEFPNICGWADKVIS-FSFMKENLPPREKLLAIYK  217



>gb|KDP40336.1| hypothetical protein JCGZ_02334 [Jatropha curcas]
Length=230

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 145/215 (67%), Gaps = 6/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG  +SPF  RVE ALKLKG+ Y++I+E+   FNKSPLLL+ NPV+KK+PVL+H  
Sbjct  6    EVKLLGLWVSPFVRRVEWALKLKGVDYEYIEEDI--FNKSPLLLQLNPVNKKVPVLVHGN  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K +AES +ILEYIDETW +N  PLLP+DPYQRA+ARFWAKF +EK   A    L +  +E
Sbjct  64   KVIAESFVILEYIDETWKHNY-PLLPQDPYQRAKARFWAKFAEEKIFEAAWNALCSLGDE  122

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E+A      AL  L  EL GK  FGGE++G VDI A  + YW+ V +E   ++ +   +
Sbjct  123  KERAIKMTIEALEKLEGELEGKQFFGGENIGYVDILAGWISYWLPVWEEVGSMKFIDALQ  182

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               I  WM+  ++   VIK NLPPR+K+  Y+ +R
Sbjct  183  FPSICSWMDRFLNH-DVIKNNLPPREKMAVYFNSR  216



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 143/211 (68%), Gaps = 6/211 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SP + RV  ALKLKGI+YD+ QEED R NKSPLLL+YNPVHKKIPVL+HNG
Sbjct  5    KVKLLGNWASPSALRVHWALKLKGIEYDY-QEEDLR-NKSPLLLQYNPVHKKIPVLVHNG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEE  384
            K +AESL+ILEYI+ETW +N  PLLP+DPY+RA+ARFWAKF+D+KCV           EE
Sbjct  63   KPIAESLVILEYIEETWKHN--PLLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEE  120

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +K   E +  L +L  EL  K  FG   +G +D+A+  +  W  +++E   ++++  E+
Sbjct  121  QQKIAKEARENLKILEGELGKKHFFGDTKIGFMDVASAWIICWAQIVEEIVDIKLIDAEE  180

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
               +  W + ++    ++KE  PP+DKLL +
Sbjct  181  MPSLVSWFQNVLEAAPILKECTPPKDKLLEH  211



>ref|XP_008448743.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=223

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 148/221 (67%), Gaps = 8/221 (4%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            VEV G   SPFS RVE+ALKLKGIQYD+I+EE Y+  KS L+LK+NPV+KK+PVL+H GK
Sbjct  5    VEVFGAWFSPFSHRVELALKLKGIQYDYIEEEIYKKKKSDLILKFNPVYKKVPVLVHGGK  64

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA---TRKILYAEE  384
             +AES++IL+YIDE W +N  P+LP+ PY +A A FWAKF+D+K + +    R+    ++
Sbjct  65   PIAESIVILQYIDEIWKDN--PILPQHPYHKALALFWAKFLDDKVLPSLMKARRSSEGKD  122

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E+A  EV   L  L +EL GK  FGGE +G VDI A  + +W   + EA G+ +L+ E 
Sbjct  123  REEAIGEVSEGLRALEEELKGKKFFGGEKLGFVDIVANFIAHWSQAMDEAFGVRILTTEL  182

Query  565  H--AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGK  681
                 + +W    + +  +++ NLPP+ +LLA+++ + + K
Sbjct  183  QNLPSLTQWCHRFL-QHPIVEHNLPPKTQLLAFFKLQFVDK  222



>ref|XP_006367665.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 150/217 (69%), Gaps = 6/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SPF+ RVE ALK+KG++Y++I+E+  R+NKS LLL+ NP++KK+PVL+H
Sbjct  1    MAQVKLLGFWYSPFTHRVEWALKIKGVKYEYIEED--RYNKSSLLLESNPIYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            NGK + +S++ILEYIDET++  +  +LPKDP  RA ARFWAKF+D+K V      L   E
Sbjct  59   NGKPICDSMVILEYIDETFEGPS--ILPKDPQDRALARFWAKFLDDKVVTVVNAFLGKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++EV   L +L +EL  KT F     G  DI A +VG W+ V QE +G+E+++ E
Sbjct  117  EQEKAKEEVCEMLKILDNELKDKTFFVANKFGYADIVANLVGLWLGVFQEGSGIELVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K      W +  ++ CS +KE LP R+ LLA++Q  +
Sbjct  177  KFPNFCGWRDEYVN-CSQVKEYLPSRNDLLAFFQVFV  212



>ref|XP_007016280.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33899.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=221

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++ G   SPFS RVE+ALKLKGI Y++I EED   NKSP LLKYNP+HKK+P+L+H  
Sbjct  4    EVKLFGMWASPFSRRVELALKLKGIPYEYI-EEDLS-NKSPSLLKYNPIHKKVPLLVHKE  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            K LAESL+ILEY+DETW NN  P+LP+DPY+RA ARFWAKFIDEK +    K+ ++  +E
Sbjct  62   KPLAESLVILEYLDETWKNN--PILPQDPYERAMARFWAKFIDEKLLPTAAKVSHSTGKE  119

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             E+  +EV   L +L +EL GK  F G+S+G +DI A V+ +W     EA+G+  L+ EK
Sbjct  120  QEQGVEEVHQQLKILENELKGKEFFAGQSIGYLDIVAHVL-FWFYSAGEASGVNALTTEK  178

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
               IYEW+E L+ K   + E   P++K   + + R
Sbjct  179  FPIIYEWIEKLI-KIDAVNECRIPKEKHQDFIRLR  212



>ref|XP_004160429.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 148/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV+++G   S F  RVE ALKLKGI++++I E D R NKS LLLK NPVHKKIPV LH
Sbjct  1    MAEVKIIGSAGSLFCIRVEWALKLKGIEFEYIVE-DLR-NKSELLLKSNPVHKKIPVFLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            N K+++ESL+I+EYIDETW  N  P+LP+DPY RA ARFWAKF+DEK +    +   A  
Sbjct  59   NDKAISESLLIIEYIDETWKEN--PILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            EE EKA +     L LL  E+ GK  FGGE +G +D+AA  + +W++V+ E   + V  R
Sbjct  117  EEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEMNVFDR  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            E+   ++EW +  +    VI+E+LPPR+ L+ Y++  +
Sbjct  177  ERVPSLHEWAQNFIH-VPVIEESLPPRETLVNYFKGSL  213



>ref|XP_010521898.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
 gb|ABW81092.1| GST16 [Cleome spinosa]
Length=224

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 159/220 (72%), Gaps = 12/220 (5%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   S FS R+++AL++KG+ Y++++++    NKSPLLL+ NPVHKK+PVL+HNG
Sbjct  4    EVKLLGMWASLFSRRIDMALRIKGVPYEYLEQD--LTNKSPLLLQMNPVHKKVPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            KS+AESL+ILEYID+TW +N  P+LP+DPY+RA ARFWA+FIDEK V    +I   ++ E
Sbjct  62   KSIAESLVILEYIDQTWSHN--PILPQDPYERAMARFWARFIDEKIVPTGIEIAIEKDEE  119

Query  391  KARDEVQGALNL---LVDELNGKTLFGGESVGLVDIAAIVVGYWI---DVIQEAAGLEVL  552
                 ++ A  L   L  EL GK  FGG+++GLVDIAAI++ +W+   D I    G+++L
Sbjct  120  AREAAIEKARELMKYLEKELKGKDFFGGKTLGLVDIAAILIPFWLMRFDAIV-GIGVDIL  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            + +K  +I+ W++ L S+  V+KE +PP+D+ +AY +A +
Sbjct  179  AEDKFPEIHRWVKRL-SETDVVKECIPPKDEHVAYLKALV  217



>ref|XP_007036677.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
 gb|EOY21178.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
Length=224

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 150/218 (69%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+E++++   LS F  R+E ALKLKG+ Y+++ EED R NKSPLLL +NPVHKK+PVLL 
Sbjct  1    MAELKLIASSLSVFCARIEWALKLKGVGYEYL-EEDLR-NKSPLLLTHNPVHKKVPVLLQ  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            NGK +AESLIILEYI+ETW ++  PLLP+DPY++A ARFWAKF DEKC+        A  
Sbjct  59   NGKPIAESLIILEYIEETWKDS--PLLPEDPYEKAMARFWAKFADEKCLHGAFDACRAVG  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            +E EKA +    +   L  +L GK  FGGE +G +D+A   + +W++V++E   ++++  
Sbjct  117  DEKEKAIESAAKSFAFLEKQLEGKKYFGGEQIGYLDLALGWIPHWLNVMEEVGCMKLVDT  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            ++   +++W +  M +  +IKE LPPRDKLL  + A I
Sbjct  177  QRTPLLHQWGQEFM-EIPLIKECLPPRDKLLGRFTASI  213



>ref|XP_009606317.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=221

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 154/215 (72%), Gaps = 8/215 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV +LG   S +S RVE AL +KG++Y+FI EED + NKSPLLL+ NPVH+KIPVL+H
Sbjct  1    MGEVSLLGVSGSSYSRRVEWALNVKGVKYEFI-EEDLQ-NKSPLLLQSNPVHQKIPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGK ++ES++ILEYIDET++  +  +LP+DPY+RA ARFWA+F+D KC+ A  K L+++ 
Sbjct  59   NGKPISESMLILEYIDETFEGPS--ILPQDPYERATARFWARFLDGKCLEAVGKALWSKG  116

Query  385  SEKARDEVQGALNLL--VD-ELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             E+ +   Q A  LL  VD EL  K  FGG+ +G VD+AA  + +W+++++EA G+ +++
Sbjct  117  KEQEKSIQQEAYELLKIVDNELKDKKFFGGDKIGFVDLAANYIPFWLEIVEEATGVVLVT  176

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYY  660
             +K   +  W +  +S CS +KENLP RD +L ++
Sbjct  177  SQKFPHLCAWRDEYLS-CSEVKENLPDRDMMLVFF  210



>ref|XP_008448653.1| PREDICTED: glutathione S-transferase U8-like isoform X2 [Cucumis 
melo]
Length=215

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 145/213 (68%), Gaps = 9/213 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EVE+LGG +SPFS RVE+ LKLKGI Y +  EED + NKS  LL YNP++KK+PV LHNG
Sbjct  6    EVELLGGWMSPFSRRVELGLKLKGINYKY-NEEDLK-NKSDFLLNYNPIYKKVPVFLHNG  63

Query  211  KSLAESLIILEYIDETWDNNTAPLLPK-DPYQRAQARFWAKFIDEKCVAATRKILYAEES  387
              ++ESLIILEYIDE W N+  P  P+ +PY+RAQARFWAK+ID+K   ++++    EE 
Sbjct  64   NPISESLIILEYIDEVW-NSVYPFFPQQNPYERAQARFWAKYIDDKAAKSSKR----EER  118

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            EK  +E +  L  L  EL  K  FGG  +G VDI   V+ YWI  ++EA G EVL+ +K 
Sbjct  119  EKGLEETEETLEPLEKELQNKKFFGGNKIGFVDIVGTVIAYWIPAVEEAFGFEVLTTKKF  178

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
              + +W E ++++ SV+K+ LP +  L+AY Q 
Sbjct  179  PNLTKWSEEIVNQ-SVVKQVLPLKSNLVAYLQV  210



>gb|KEH26957.1| glutathione S-transferase [Medicago truncatula]
Length=223

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 150/218 (69%), Gaps = 7/218 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+++  P S    R+E AL++KG++Y++IQE+    NKSPLLL+ NPV+KK+PVLLH
Sbjct  1    MGEVKLIATPQSFPCARIEWALRIKGVEYEYIQED--LLNKSPLLLESNPVYKKVPVLLH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            +GKS+AESL+ILEYIDETW +N  PLLP DPY++A ARFWAKFIDEKC+        A+ 
Sbjct  59   DGKSIAESLVILEYIDETWKDN--PLLPLDPYEKALARFWAKFIDEKCIFGVWGACVAQG  116

Query  385  SEKAR--DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             EKA+  D    +L  L  ++ GK  FGGE +G +DI A  + YW++V++E   +E+++ 
Sbjct  117  EEKAKAVDAAIESLAFLEKQIQGKKFFGGEKIGYLDIVAGWISYWLNVLEELGEMELINA  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK   ++EW    + + S IK+ +PP++ ++ Y+   I
Sbjct  177  EKFPSLHEWGHNFI-QTSPIKDCIPPKEMVVEYFSFGI  213



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 6/210 (3%)
 Frame = +1

Query  34   VEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNGK  213
            V++LG   SP++ RV  ALKLKG++YD+ QEED   NKSPLLL+YNPVHKKIPVL+HNGK
Sbjct  6    VKLLGYWASPYALRVHWALKLKGVEYDY-QEEDLP-NKSPLLLQYNPVHKKIPVLVHNGK  63

Query  214  SLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEES  387
             +AESL+ILEYIDETW  N  PLLP+DPY+RA+ARFWAKF+D+KCV           EE 
Sbjct  64   PIAESLVILEYIDETWKQN--PLLPEDPYERAKARFWAKFVDDKCVPGIFATFSKVGEEQ  121

Query  388  EKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREKH  567
            +K   E +  L LL  EL+ K  FG   +G +D+A+  +  W  +++E   ++++  E+ 
Sbjct  122  QKIVKEARENLKLLEGELDKKRFFGDTRIGFIDVASAWIICWAQIVEEIIDIKLIDAEEM  181

Query  568  AKIYEWMEALMSKCSVIKENLPPRDKLLAY  657
              +  W + ++    ++KE  PP+DKLL +
Sbjct  182  PSLVVWFQNILEAAPILKECTPPKDKLLEH  211



>ref|XP_010470684.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010470778.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010470969.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
Length=230

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 147/216 (68%), Gaps = 5/216 (2%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V VLG   SPFS RVE+ LKLKGI Y++  EED   NKSP+LLKYNP+HKK PVL+HNG
Sbjct  6    QVTVLGLWGSPFSKRVEMVLKLKGIPYEY-NEEDVYGNKSPMLLKYNPIHKKDPVLVHNG  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            +S+AESL+I+EYI++TW  +   +LP+DPY+RA ARFWAK +DEK + A  K  +  +SE
Sbjct  65   RSIAESLVIVEYIEDTWKTSQT-ILPQDPYERAMARFWAKHVDEKVMVAMWKACWGPKSE  123

Query  391  KARD--EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
            + ++  E    L  L  EL  +  FGGE++G VDIAA  +GYW+ ++QEA+G+ +++ E+
Sbjct  124  REKETKEAYEGLKYLEKELGDRHFFGGETIGFVDIAADFIGYWLGIVQEASGVTIMTAEE  183

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
               +    +  +     IKE LPP+ K+ A  +A+ 
Sbjct  184  FPNLQRRSKDFIGN-DFIKEVLPPKQKIAALLKAQF  218



>ref|XP_002520480.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41893.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   199 bits (507),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 149/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV+++G   SPF+ RVE+ALK+KG++Y++I+E+    NKS LLLKYNP+HKK+PVL+HNG
Sbjct  4    EVKLIGNWASPFTRRVELALKIKGVKYEYIEED--LANKSDLLLKYNPIHKKVPVLVHNG  61

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--EE  384
            KS+ ESL+I+EYIDETW ++   +LPK+PY RA ARFWA+F+DEK +  T KI  A  EE
Sbjct  62   KSICESLVIIEYIDETWKHHHH-ILPKEPYHRAVARFWARFVDEKLLPTTFKIECAIKEE  120

Query  385  SEKARDEVQGALNLLVDELNGK--TLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             +K   EV   L LL  EL  K    FGG  +G +DI    +G+W+ V QE   +++++ 
Sbjct  121  KDKIIHEVHEHLKLLEHELKHKEHEFFGGLELGYLDIVTFFIGHWVQVHQEVMEIDLITE  180

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            EK+    +WM  L  K  ++   LPP++K +A+++A  
Sbjct  181  EKYPFFCKWMVKL-HKIDIVHGCLPPKEKHIAFFKAHF  217



>gb|ABW81037.1| glutathione-s-transferase 7 [Arabidopsis lyrata subsp. lyrata]
Length=227

 Score =   199 bits (507),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 147/216 (68%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+EIAL LKG+ Y+F  EED   NKS LLL+ NPV+K IPVL+HNG
Sbjct  9    EVKLLGMWASPFSRRIEIALTLKGVSYEF-SEEDIT-NKSSLLLQLNPVYKMIPVLVHNG  66

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEE  384
            K ++ESL+ILEYIDETW +N  P+LP+DPY++A ARFWAKF+DE+      K++    EE
Sbjct  67   KPISESLVILEYIDETWRDN--PILPQDPYEKAMARFWAKFVDEQIYVTAMKVVGKIGEE  124

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +   +  +  L  L  EL GK  FGG S+G VDI A +V +W+   +E  G++V+  EK
Sbjct  125  RDAVVEATRDLLMFLEKELVGKDFFGGRSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEK  184

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              +I+ W++ L+    VIK+ +PP D+ L Y +AR+
Sbjct  185  FPEIHRWVKNLLGN-DVIKKCIPPEDEHLQYIRARM  219



>gb|ADN03963.1| GST1 [Phytolacca acinosa]
Length=223

 Score =   199 bits (506),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 149/219 (68%), Gaps = 8/219 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+V G   SPFS RVEIALK+KG++Y+F++E+ +  NKS  LLKYNP+HKKIPVL+H
Sbjct  1    MGEVKVHGVKYSPFSKRVEIALKIKGVEYEFVEEDMH--NKSDQLLKYNPIHKKIPVLVH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--  378
            +GK +AESL+I+EYIDE W  N  P+LP DPY+RAQARFW KF D+K + A    L    
Sbjct  59   HGKPIAESLVIIEYIDEMWKAN--PILPTDPYERAQARFWTKFFDDKLLPALWNALMVQR  116

Query  379  EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDI-AAIVVGYWIDVIQEAAGLEVLS  555
            E+  KA +E   +L  L ++++GK        G +DI   I+V +WI +IQ+ +G E L+
Sbjct  117  EDEGKAMEEAHESLKSLENKMSGKEFSERIGFGFLDIQGGIMVAFWIPIIQQISGKEGLT  176

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            R+K+  I+ W + L+  C++IKENLP  D +    +AR+
Sbjct  177  RDKYPAIWAWADHLLG-CNLIKENLPDGDPIRTALKARL  214



>ref|XP_002862399.1| glutathione-s-transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38657.1| glutathione-s-transferase [Arabidopsis lyrata subsp. lyrata]
Length=227

 Score =   199 bits (506),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 146/215 (68%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+EIAL LKG+ Y+F  EED   NKS LLL+ NPV+K IPVL+HNG
Sbjct  9    EVKLLGMWASPFSRRIEIALTLKGVSYEF-SEEDIT-NKSSLLLQLNPVYKMIPVLVHNG  66

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL--YAEE  384
            K ++ESL+ILEYIDETW +N  P+LP+DPY++A ARFWAKF+DE+      K++    EE
Sbjct  67   KPISESLVILEYIDETWRDN--PILPQDPYEKAMARFWAKFVDEQIYVTAMKVVGKIGEE  124

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             +   +  +  L  L  EL GK  FGG S+G VDI A +V +W+   +E  G++V+  EK
Sbjct  125  RDAVVEATRDLLMFLEKELVGKDFFGGRSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEK  184

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
              +I+ W++ L+    VIK+ +PP D+ L Y +AR
Sbjct  185  FPEIHRWVKNLLGN-DVIKKCIPPEDEHLQYIRAR  218



>ref|XP_004492381.1| PREDICTED: glutathione S-transferase L2, chloroplastic-like [Cicer 
arietinum]
Length=460

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 151/217 (70%), Gaps = 10/217 (5%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            E+++LG   SPF  RV+IALKLKGI+Y +++E+    N S  LL YNPV+K +PVL+HN 
Sbjct  240  ELKLLGSVGSPFVIRVQIALKLKGIEYKYVEEK--LGNLSETLLNYNPVYKMVPVLVHND  297

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K ++ESL+ILEYIDETW  N  P+ P DPY++A  RFW+KFID+K V+++ K ++  + E
Sbjct  298  KPISESLVILEYIDETWKQN--PIFPSDPYKKALTRFWSKFIDDKIVSSSFKAVFTVDDE  355

Query  391  KAR----DEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
            K R    +E   AL +L +EL  K  FGGE  G VDIAA+ + +WI ++Q+  GL++ + 
Sbjct  356  KEREKNVEESSEALKILENELKDK-FFGGEEFGFVDIAAVFIAFWIPLVQDITGLQLFTA  414

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            EK+ K++ W +  ++   V+KENLPPR+ L A+++ R
Sbjct  415  EKYPKLHNWSQEFLNH-PVVKENLPPREPLFAFFKGR  450


 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 142/210 (68%), Gaps = 13/210 (6%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V++LG   SPF  RV+IALKLKG++Y +++E+    N S  L++YNPV+K +PV +HNG
Sbjct  25   DVKLLGSVGSPFVIRVQIALKLKGVEYKYVEEK--LGNLSETLIQYNPVYKMVPVFVHNG  82

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA---E  381
            K ++ES +ILEYIDETW  N  P+LP DPY++A ARFW+KFID+KCVAA  K ++    +
Sbjct  83   KPISESRVILEYIDETWKQN--PILPSDPYKKALARFWSKFIDDKCVAAAWKSVFMVDEK  140

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            + EKAR+E+  AL  L +EL  K  FGGE +G VDIAA+    +I + Q+ A  ++ + +
Sbjct  141  QREKAREELLEALQFLENELKDK-FFGGEDIGFVDIAAL----FIPLFQQVAEFQLFTSD  195

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLL  651
               K+Y+W     +   V+ E +P +D+ L
Sbjct  196  NFPKLYKWSLEFYNH-PVVNEIMPSKDQHL  224



>ref|XP_006849223.1| hypothetical protein AMTR_s00027p00230090 [Amborella trichopoda]
 gb|ERN10804.1| hypothetical protein AMTR_s00027p00230090 [Amborella trichopoda]
Length=227

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 143/214 (67%), Gaps = 8/214 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +V +LG   S F  RV +ALKLKGI+Y++I EED + NKSPLLL+ NPV+KK+PVL+H  
Sbjct  7    KVRLLGTWRSRFVHRVRLALKLKGIEYEYI-EEDLK-NKSPLLLESNPVYKKVPVLIHGN  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY--AEE  384
              ++ES++ILEYIDETW  N  PL+P+DPY RA  RFW+KFID+KC+A  R +L    EE
Sbjct  65   NVVSESMVILEYIDETWSEN--PLMPQDPYDRAITRFWSKFIDDKCLAPIRTVLLTDGEE  122

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             EKA  E + AL  L   L GK  FGGE +G VDIAA  +  W +V+ E  G + +  EK
Sbjct  123  QEKAMKEAKEALKTLERGLKGK-FFGGEVIGFVDIAASCLSIWSEVLGEVIGTKFIDSEK  181

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
               ++ W+E   S   ++KE+ PP DKL A Y+A
Sbjct  182  LPHLHSWIEEFTS-IDLVKESFPPYDKLFASYKA  214



>ref|NP_001237670.1| glutathione S-transferase GST 11 [Glycine max]
 gb|AAG34801.1|AF243366_1 glutathione S-transferase GST 11 [Glycine max]
 gb|KHN06985.1| Putative glutathione S-transferase [Glycine soja]
Length=222

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 148/216 (69%), Gaps = 13/216 (6%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV +LG   SPF  RV+IALKLKG++Y ++  ED   NKS LLLKYNPV+K IPVL+HN 
Sbjct  7    EVTLLGVVGSPFLHRVQIALKLKGVEYKYL--EDDLNNKSDLLLKYNPVYKMIPVLVHNE  64

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEESE  390
            K ++ESL+I+EYID+TW NN  P+LP DPYQRA ARFWAKFID+KCV    K  +  + +
Sbjct  65   KPISESLVIVEYIDDTWKNN--PILPSDPYQRALARFWAKFIDDKCVVPAWKSAFMTDEK  122

Query  391  KARDEVQG---ALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            +     +    AL+ L +EL GK  FGGE  G VDIAA++    I +IQE AGL++ + E
Sbjct  123  EKEKAKEELFEALSFLENELKGK-FFGGEEFGFVDIAAVL----IPIIQEIAGLQLFTSE  177

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            K  K+ +W +   +   V+ E +PP+D+L AY++AR
Sbjct  178  KFPKLSKWSQDFHNH-PVVNEVMPPKDQLFAYFKAR  212



>ref|NP_180503.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
 sp|Q9ZW24.1|GSTU7_ARATH RecName: Full=Glutathione S-transferase U7; Short=AtGSTU7; AltName: 
Full=GST class-tau member 7; AltName: Full=Glutathione 
S-transferase 25 [Arabidopsis thaliana]
 gb|AAG30137.1|AF288188_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC95196.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAK74037.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAL06974.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAM64426.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AEC08252.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
Length=227

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 150/221 (68%), Gaps = 11/221 (5%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++LG   SPFS R+EIAL LKG+ Y+F++++    NKS LLL+ NPVHK IPVL+
Sbjct  6    NSEEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDIT--NKSSLLLQLNPVHKMIPVLV  63

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE  381
            HNGK ++ESL+ILEYIDETW +N  P+LP+DPY+R  ARFW+KF+DE+      K++   
Sbjct  64   HNGKPISESLVILEYIDETWRDN--PILPQDPYERTMARFWSKFVDEQIYVTAMKVV--G  119

Query  382  ESEKARDEVQGA----LNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEV  549
            ++ K RD V  A    L  L  EL GK   GG+S+G VDI A +V +W+   +E  G++V
Sbjct  120  KTGKERDAVVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKV  179

Query  550  LSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            +  EK  +I+ W++ L+    VIK+ +PP D+ L Y +AR+
Sbjct  180  VPVEKFPEIHRWVKNLLGN-DVIKKCIPPEDEHLKYIRARM  219



>ref|XP_004246385.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 158/222 (71%), Gaps = 8/222 (4%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            + EV++LG   S +S RVE AL++KG++Y+FI EED + NKSPLLL+ NPV KKIPVL+H
Sbjct  2    VDEVKLLGVSGSSYSRRVEWALRVKGVKYEFI-EEDLQ-NKSPLLLESNPVLKKIPVLIH  59

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAEE  384
            NGKS+ ES++I+EYIDET++  +  +LPKDPY RA ARFWA F+D  C+ A RK L+++ 
Sbjct  60   NGKSICESMVIVEYIDETFEGPS--ILPKDPYDRAIARFWATFLDGMCLDAVRKGLWSKR  117

Query  385  SEKARD---EVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLS  555
             EK ++   E    L ++ +EL  K  F G+ +G VD+AA  + +W+++++EA G  +++
Sbjct  118  EEKEKNIQEEAYEMLKIVDNELKDKKFFSGDKIGFVDVAANYIPFWVEIVEEATGNVLIT  177

Query  556  REKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARIIGK  681
             EK   +  W++  + KCS ++ENLP RD +L++++A+ + +
Sbjct  178  SEKFPNLCAWIDKYL-KCSEVQENLPDRDMMLSFFKAKALAE  218



>ref|XP_003623172.1| Glutathione S-transferase GST [Medicago truncatula]
Length=348

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 144/213 (68%), Gaps = 9/213 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV+V G   SPF  RVEIALKLKG++Y + QE+    N S  L KYNPV+KK+PV +
Sbjct  4    NKEEVKVFGLVESPFVTRVEIALKLKGVEYKYEQEK--VGNLSETLKKYNPVYKKVPVFI  61

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA-  378
            HN K ++ESL+ILEYIDETW  N  P+LP DP +RA ARFW+ FID+KC    RK+ +  
Sbjct  62   HNDKPISESLVILEYIDETWKQN--PILPSDPSKRALARFWSNFIDDKCSNGARKVCFPL  119

Query  379  --EESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVL  552
              +E EK+ +E + AL+ L +EL  K  FGGE +G VDIAA+V+ +W   IQEA GL++ 
Sbjct  120  DEKEREKSIEETKEALHFLENELKDK-FFGGEDIGFVDIAAVVISFWFSPIQEAFGLKLF  178

Query  553  SREKHAKIYEWMEALMSKCSVIKENLPPRDKLL  651
            + E+  K+Y W +   +   ++KE LPPR+ LL
Sbjct  179  TIEEFPKLYNWSQEF-NNHPIVKEKLPPRETLL  210


 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +1

Query  22   NMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLL  201
            N  EV++ G   SPF  RVEIALKLKG++Y + + E ++ N S  L+ YNPV+KK+PVL+
Sbjct  224  NKEEVKLFGMKASPFVCRVEIALKLKGVEYKY-EVEKFQ-NLSDTLINYNPVYKKVPVLV  281

Query  202  HNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEK  345
            HN K +AESL+I+EYIDETW  N  P+LP DP +RA ARFW+KFID+K
Sbjct  282  HNDKPIAESLVIIEYIDETWKQN--PILPSDPSKRALARFWSKFIDDK  327



>ref|XP_006489728.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=227

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 148/217 (68%), Gaps = 8/217 (4%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
            ++V++LG   SPF+FRV  ALKLKG+++++I+E+   FNKS  LL+ NPVHKK+PVL+H+
Sbjct  3    TKVKLLGFWCSPFAFRVVWALKLKGVEFEYIEED--IFNKSTELLELNPVHKKVPVLVHD  60

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYA--E  381
             + + ES +ILEYIDETW  +  PLLP+DPY++A ARFWAKF DEK + +  K +++  E
Sbjct  61   KRVIVESFVILEYIDETWPQD--PLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGE  118

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAG-LEVLSR  558
            E +KA  E   +L  + + L GK   GG S+G +D+A   +GYWI V +EA G + +L  
Sbjct  119  EKQKAMKEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDS  178

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            +K   I EW    + K  VIKENLPPRD+ LAY   R
Sbjct  179  QKFPAIAEWSAKFL-KHPVIKENLPPRDRTLAYCHKR  214



>ref|XP_004147908.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN54327.1| hypothetical protein Csa_4G304240 [Cucumis sativus]
Length=222

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 150/220 (68%), Gaps = 9/220 (4%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            +VEV G   SPFS RVE+ALKLKGIQYD+I+EE Y+  KS L+LK+NPV+KK+PV +H G
Sbjct  4    KVEVFGAWFSPFSRRVELALKLKGIQYDYIEEEIYK-KKSDLILKFNPVYKKVPVFVHGG  62

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA---TRKILYAE  381
            K +AES++IL+YIDE+W +N  P+LP+ PY +A A FWAKF+D+K + +    R+    +
Sbjct  63   KPIAESIVILQYIDESWKDN--PILPQHPYHKALALFWAKFLDDKVLPSLMKARRSGEGK  120

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            + E+A  E +  L  L +EL GK  FGGE +G VDI A  + YW   + EA G+++L+ E
Sbjct  121  DREEAIGEAREGLRALEEELKGKKFFGGEKLGFVDIVANFIAYWSQAMDEAFGVQILTSE  180

Query  562  KH--AKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARII  675
                 ++ +W    + +  ++K NLPP+ +LLA ++++ +
Sbjct  181  LQNLPRLTQWCHHFL-QHPIVKHNLPPKTQLLALFKSQFV  219



>ref|XP_006294944.1| hypothetical protein CARUB_v10023998mg [Capsella rubella]
 gb|ABW81140.1| GST32 [Capsella rubella]
 gb|EOA27842.1| hypothetical protein CARUB_v10023998mg [Capsella rubella]
Length=228

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 151/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  31   EVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHNG  210
            EV++LG   SPFS R+EIAL LKG+ Y+F  E+D   NKS LLL+ NPV+K IPVL+HNG
Sbjct  10   EVKLLGMWASPFSRRIEIALTLKGVPYEF-SEQDIT-NKSDLLLRLNPVYKMIPVLVHNG  67

Query  211  KSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEK-CVAATRKI-LYAEE  384
            K ++ESL+ILEYID+TW NN  P+LP+DP +RA ARFWAK ID++ CVAA +      EE
Sbjct  68   KPISESLVILEYIDDTWRNN--PILPQDPSERAMARFWAKLIDQQICVAAMKVAGTIGEE  125

Query  385  SEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSREK  564
             + A +E +  L  L  EL GK  FGG+S+GLVDI A +V +W+   ++  G++V+  EK
Sbjct  126  RDAAVEETRNLLMFLEKELVGKDFFGGQSLGLVDIVATLVAFWLIRTEDLLGVKVVPVEK  185

Query  565  HAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
              +I+ W++ L S   VIK+ +PP D+ L Y +AR+
Sbjct  186  FPEIHRWVKNL-SGNDVIKKCIPPEDEHLEYIRARM  220



>ref|XP_006849232.1| hypothetical protein AMTR_s00027p00233060 [Amborella trichopoda]
 gb|ERN10813.1| hypothetical protein AMTR_s00027p00233060 [Amborella trichopoda]
Length=228

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 147/215 (68%), Gaps = 8/215 (4%)
 Frame = +1

Query  28   SEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLHN  207
             +V VLG   SPFS  V++ALKLKG+QY++I EED + NK PLLL+ NPVHKKIPVL+H 
Sbjct  7    QKVRVLGVWNSPFSAMVKLALKLKGVQYEYI-EEDLQ-NKGPLLLESNPVHKKIPVLIHG  64

Query  208  GKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAA--TRKILYAE  381
             K +AES++ILEYI+ETW  N  PLLP DPY+RAQARFWAKFI+EKC  A  T      E
Sbjct  65   RKPVAESVVILEYINETWPEN--PLLPNDPYERAQARFWAKFIEEKCGRAIWTAYGTQGE  122

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA  + +  L +L + L GK  F GE++G +DI A  + +W+ V++EAA ++    E
Sbjct  123  EKEKAIKDAEEGLKILEEGLKGK-FFNGETIGFLDIVACGIAFWLPVLEEAADIKFFDPE  181

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            K  ++  W E   +K  ++KE  PPRDKLL  ++A
Sbjct  182  KLPRLRCWTEE-YTKVELVKEAFPPRDKLLPAFKA  215



>ref|XP_002277759.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 146/216 (68%), Gaps = 7/216 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M EV+VLG  LS F  RVE ALKLKG+ Y+++ EED R NKSP+LL+ NPVHKK+PVL+ 
Sbjct  1    MGEVKVLGASLSFFCCRVEWALKLKGVAYEYL-EEDLR-NKSPMLLQSNPVHKKVPVLVQ  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILYAE-  381
            +G+ +AESL+ILEYIDE W     PLLP+DP +RA+ RFWA+F DEKCV        A+ 
Sbjct  59   DGRPIAESLVILEYIDEAWKG--YPLLPEDPSERAKTRFWARFTDEKCVLGAWAACCAKG  116

Query  382  -ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSR  558
             E EKA +  Q +L+ L  ++ GK  FGGE++GL+D+    +  WI+ ++E  G+++L  
Sbjct  117  HEREKAIESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDE  176

Query  559  EKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQA  666
            EK   +YEW +  ++   +I E +P ++ L+ Y+Q 
Sbjct  177  EKFPSLYEWAQKFIN-IPIISERIPTKEGLINYFQG  211



>gb|AFW90580.1| glutathione S-transferase-like protein [Solanum tuberosum]
Length=226

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 149/217 (69%), Gaps = 6/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M++V++LG   SPF+ RVE ALK+KG++Y++I+E+  R+NKS LLL+ NP++KK+PVL+H
Sbjct  1    MAQVKLLGFWYSPFTHRVEWALKIKGVKYEYIEED--RYNKSSLLLELNPIYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            NGK + +S++ILEYIDET++  +  +LPKD + RA ARFWAKF+D+K V      L   E
Sbjct  59   NGKPIIDSMVILEYIDETFEGPS--ILPKDSHDRALARFWAKFLDDKVVTVVNAFLGKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EKA++EV   L +L +EL  KT F     G  DI A +VG W+ V QE  G+E+++ E
Sbjct  117  EQEKAKEEVCEMLKILDNELKDKTFFVANKFGYADIVANLVGLWLGVFQEGFGIELVTSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K      W +  + KCS +KE LP R+ LLA++Q  +
Sbjct  177  KFPNFCGWRDEYV-KCSQVKEYLPSRNDLLAFFQVFV  212



>ref|XP_007035120.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY06046.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=248

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 147/221 (67%), Gaps = 8/221 (4%)
 Frame = +1

Query  16   LRNMSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPV  195
            L    EV++LG  +SPF FRVE ALK+KG++Y++I+E+   FNKS LL++ NPV KK+PV
Sbjct  22   LMATKEVKLLGFWVSPFVFRVEWALKIKGVKYEYIEED--IFNKSTLLMELNPVRKKVPV  79

Query  196  LLHNGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKILY  375
            L+H+GK +AES +ILEYIDETW  N  PLLP+DPYQRA ARFWAKF +EK +      L 
Sbjct  80   LVHDGKVIAESFVILEYIDETWKQN--PLLPQDPYQRALARFWAKFAEEKILEGAWNALC  137

Query  376  A--EESEKARDEVQGALNLLVDELNGK-TLFGGESVGLVDIAAIVVGYWIDVIQEAAGLE  546
            +  EE +KA  +   A+  +  EL GK   FGGESVG +DI    + YW+ V +E   +E
Sbjct  138  SQGEEKQKALRQTIEAMEKIEGELEGKQQFFGGESVGYLDIILGWISYWLPVWEEVGSME  197

Query  547  VLSREKHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQAR  669
            +L+  K   I  W+ + ++   VIK+ LPP DK+L Y+  R
Sbjct  198  ILNPIKFPAITAWINSFLNH-PVIKDKLPPTDKMLVYFHQR  237



>ref|XP_009629346.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=223

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 152/217 (70%), Gaps = 6/217 (3%)
 Frame = +1

Query  25   MSEVEVLGGPLSPFSFRVEIALKLKGIQYDFIQEEDYRFNKSPLLLKYNPVHKKIPVLLH  204
            M+EV++LG   SPFS RVE ALK+KG++Y++I+E+  R NKS LLL+ NPV+KK+PVL+H
Sbjct  1    MAEVKLLGFWYSPFSHRVEWALKIKGVKYEYIEED--RDNKSSLLLQSNPVYKKVPVLIH  58

Query  205  NGKSLAESLIILEYIDETWDNNTAPLLPKDPYQRAQARFWAKFIDEKCVAATRKIL-YAE  381
            NGK + ES+IILEYIDET++  +  +LPKDPY RA ARFWAKF+D+K  A         E
Sbjct  59   NGKPIVESMIILEYIDETFEGPS--ILPKDPYDRALARFWAKFLDDKVAAVVNTFFRKGE  116

Query  382  ESEKARDEVQGALNLLVDELNGKTLFGGESVGLVDIAAIVVGYWIDVIQEAAGLEVLSRE  561
            E EK ++EV   L +L +EL  K  F G+  G  DIAA +VG+W+ V +E  G+ ++  E
Sbjct  117  EQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFADIAANLVGFWLGVFEEGYGVVLVKSE  176

Query  562  KHAKIYEWMEALMSKCSVIKENLPPRDKLLAYYQARI  672
            K     +W +  ++ CS + E+LPPRD+LLA+++AR 
Sbjct  177  KFPNFSKWRDEYIN-CSQVNESLPPRDELLAFFRARF  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852