BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15211_g1_i2 len=406 path=[1:0-154 1224:155-158 160:159-405]

Length=406
                                                                      Score     E

ref|XP_010934445.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    242   7e-77   
ref|XP_010934455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   1e-76   
ref|XP_010934463.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    242   2e-76   
emb|CBI16497.3|  unnamed protein product                                239   4e-76   
emb|CBI29971.3|  unnamed protein product                                241   9e-76   
ref|XP_009599889.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    244   2e-74   
emb|CBI32154.3|  unnamed protein product                                238   3e-74   
ref|XP_006354152.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    243   4e-74   
ref|XP_004228610.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    242   7e-74   
ref|XP_006657539.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    243   7e-74   
ref|XP_009785248.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    242   7e-74   
ref|XP_004955769.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    243   1e-73   
ref|XP_007014729.1|  P-loop containing nucleoside triphosphate hy...    236   2e-73   
ref|XP_008667797.1|  PREDICTED: putative DEAD-box ATP-dependent R...    242   2e-73   
ref|XP_009603916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   2e-73   
ref|XP_003538523.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   3e-73   
ref|XP_009413313.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   3e-73   
ref|XP_009413311.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   3e-73   
ref|XP_011025172.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    240   4e-73   
ref|XP_002281113.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   4e-73   Vitis vinifera
ref|XP_009396921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   4e-73   
ref|XP_011025171.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    241   4e-73   
ref|NP_001059135.1|  Os07g0202100                                       241   6e-73   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183303.1|  uncharacterized protein LOC100501699               241   6e-73   
gb|EEC81697.1|  hypothetical protein OsI_25294                          240   7e-73   Oryza sativa Indica Group [Indian rice]
tpg|DAA42448.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    240   7e-73   
ref|XP_010923340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    240   9e-73   
ref|XP_009627657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    239   1e-72   
ref|XP_010257586.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    239   1e-72   
gb|KHN44489.1|  DEAD-box ATP-dependent RNA helicase 52                  234   1e-72   
emb|CDP14280.1|  unnamed protein product                                239   1e-72   
gb|KHG22973.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    239   1e-72   
ref|XP_002283489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    239   1e-72   Vitis vinifera
dbj|BAJ94111.1|  predicted protein                                      232   1e-72   
ref|XP_003551661.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   2e-72   
ref|XP_009418828.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    239   3e-72   
ref|NP_001051626.1|  Os03g0805200                                       239   3e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   3e-72   
gb|KDP26941.1|  hypothetical protein JCGZ_21034                         238   4e-72   
ref|XP_008788973.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   4e-72   
ref|XP_008370946.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   4e-72   
ref|XP_006842770.1|  hypothetical protein AMTR_s00133p00101570          238   4e-72   
emb|CDP17357.1|  unnamed protein product                                238   4e-72   
emb|CDX98304.1|  BnaC06g16650D                                          234   5e-72   
ref|XP_002304009.2|  hypothetical protein POPTR_0003s21330g             238   5e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004981371.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   6e-72   
ref|XP_008240826.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   6e-72   
ref|XP_007208033.1|  hypothetical protein PRUPE_ppa002959mg             238   6e-72   
ref|XP_002267581.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   6e-72   Vitis vinifera
ref|XP_010243434.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   7e-72   
ref|XP_008796685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   7e-72   
ref|XP_006650754.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   8e-72   
ref|XP_007014728.1|  Dead box ATP-dependent RNA helicase, putativ...    237   9e-72   
ref|XP_006411510.1|  hypothetical protein EUTSA_v10016388mg             237   1e-71   
ref|XP_004294989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    237   1e-71   
ref|XP_009769683.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   1e-71   
ref|XP_011075074.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_010506080.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_010508560.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_008387208.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_009335876.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_007204222.1|  hypothetical protein PRUPE_ppa002926mg             236   2e-71   
gb|KHG04878.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    236   2e-71   
ref|XP_011078806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   2e-71   
ref|XP_002879990.1|  hypothetical protein ARALYDRAFT_483345             236   2e-71   
ref|NP_181780.1|  DEAD-box ATP-dependent RNA helicase 37                236   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42134.1|  putative DEAD/DEAH box RNA helicase                     236   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241163.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   3e-71   
gb|EYU39976.1|  hypothetical protein MIMGU_mgv1a003137mg                235   3e-71   
ref|XP_008384403.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   4e-71   
gb|KHG12304.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    235   4e-71   
ref|XP_008349416.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    235   4e-71   
ref|XP_011078805.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   4e-71   
ref|XP_006290726.1|  hypothetical protein CARUB_v10016822mg             236   5e-71   
ref|XP_003531232.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    235   5e-71   
ref|XP_007159397.1|  hypothetical protein PHAVU_002G234900g             235   5e-71   
gb|KHN47963.1|  DEAD-box ATP-dependent RNA helicase 37                  235   5e-71   
ref|XP_011048237.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    235   5e-71   
ref|XP_011089700.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    235   6e-71   
ref|XP_006293841.1|  hypothetical protein CARUB_v10022826mg             235   6e-71   
ref|XP_003524948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   6e-71   
emb|CDX67752.1|  BnaA07g17920D                                          235   7e-71   
emb|CDY14843.1|  BnaC04g48400D                                          234   8e-71   
ref|XP_010693834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   1e-70   
ref|XP_009375510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   1e-70   
ref|XP_008351686.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   1e-70   
ref|XP_006492814.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   1e-70   
ref|XP_004234756.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   1e-70   
ref|XP_007163837.1|  hypothetical protein PHAVU_001G268400g             233   1e-70   
ref|XP_004303365.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   2e-70   
ref|NP_191416.1|  DEAD-box ATP-dependent RNA helicase 52                234   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502214.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   2e-70   
gb|KDP21899.1|  hypothetical protein JCGZ_03037                         233   3e-70   
ref|XP_007029089.1|  P-loop containing nucleoside triphosphate hy...    233   3e-70   
gb|KHG25034.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    233   4e-70   
ref|XP_011010680.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   4e-70   
ref|XP_011089120.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   4e-70   
gb|KDO70833.1|  hypothetical protein CISIN_1g007285mg                   233   4e-70   
ref|XP_006360604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   4e-70   
gb|EYU20677.1|  hypothetical protein MIMGU_mgv1a002900mg                233   4e-70   
ref|XP_010044956.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   5e-70   
ref|XP_010431461.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   5e-70   
ref|XP_009364117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   5e-70   
ref|XP_010517778.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   5e-70   
ref|XP_004142160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    232   6e-70   
gb|KGN54076.1|  hypothetical protein Csa_4G280530                       232   6e-70   
ref|XP_009104151.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   6e-70   
ref|XP_003601625.1|  DEAD-box ATP-dependent RNA helicase                232   7e-70   
ref|XP_006402772.1|  hypothetical protein EUTSA_v10005833mg             233   7e-70   
gb|AAL32524.1|  ATP-dependent RNA helicase-like protein                 227   8e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527063.1|  dead box ATP-dependent RNA helicase, putative      233   8e-70   Ricinus communis
ref|XP_002876468.1|  hypothetical protein ARALYDRAFT_486308             232   9e-70   
gb|EYU31690.1|  hypothetical protein MIMGU_mgv1a003053mg                231   1e-69   
ref|XP_003564206.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   1e-69   
ref|XP_008449802.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-69   
ref|XP_006663583.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   2e-69   
gb|EAZ18899.1|  hypothetical protein OsJ_34439                          229   2e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577389.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-69   
ref|NP_001168055.1|  uncharacterized protein LOC100381785               225   2e-69   Zea mays [maize]
ref|XP_010504814.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-69   
gb|EMS67020.1|  DEAD-box ATP-dependent RNA helicase 37                  231   2e-69   
ref|XP_009804880.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   3e-69   
ref|XP_010524794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   4e-69   
emb|CDY47978.1|  BnaA04g24560D                                          224   6e-69   
gb|EMS54351.1|  DEAD-box ATP-dependent RNA helicase 52C                 229   6e-69   
gb|EMT07342.1|  DEAD-box ATP-dependent RNA helicase 52C                 231   6e-69   
ref|XP_010101088.1|  DEAD-box ATP-dependent RNA helicase 37             229   8e-69   
ref|XP_006492811.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   9e-69   
ref|NP_001068221.1|  Os11g0599500                                       229   1e-68   Oryza sativa Japonica Group [Japonica rice]
gb|KDO70827.1|  hypothetical protein CISIN_1g007368mg                   229   1e-68   
ref|XP_006429937.1|  hypothetical protein CICLE_v10011322mg             229   1e-68   
ref|XP_002297644.2|  hypothetical protein POPTR_0001s04510g             229   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002531166.1|  dead box ATP-dependent RNA helicase, putative      228   1e-68   Ricinus communis
ref|XP_010036520.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   1e-68   
ref|XP_010549900.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   2e-68   
emb|CDX71944.1|  BnaC08g29300D                                          229   2e-68   
ref|XP_010504808.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   2e-68   
ref|XP_010431460.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   3e-68   
gb|EPS58220.1|  hypothetical protein M569_16595                         226   3e-68   
gb|EMT03384.1|  DEAD-box ATP-dependent RNA helicase 37                  232   4e-68   
ref|XP_002308349.2|  DEAD box RNA helicase family protein               226   4e-68   Populus trichocarpa [western balsam poplar]
emb|CDY49232.1|  BnaA09g55110D                                          227   5e-68   
ref|XP_009116534.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    227   9e-68   
ref|NP_567067.1|  DEAD-box ATP-dependent RNA helicase 11                226   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-67   
ref|XP_006292641.1|  hypothetical protein CARUB_v10018884mg             226   2e-67   
ref|XP_011047092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-67   
ref|XP_009400848.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-67   
ref|XP_002876466.1|  hypothetical protein ARALYDRAFT_486301             225   2e-67   
ref|XP_001778715.1|  predicted protein                                  224   2e-67   
gb|KEH41770.1|  DEAD-box ATP-dependent RNA helicase-like protein        225   2e-67   
ref|XP_006837823.1|  hypothetical protein AMTR_s00104p00136740          226   2e-67   
ref|XP_004514158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    225   3e-67   
ref|XP_009142072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    225   3e-67   
ref|XP_007204596.1|  hypothetical protein PRUPE_ppa003020mg             225   3e-67   
emb|CDY06034.1|  BnaA09g37460D                                          224   5e-67   
emb|CDX71948.1|  BnaC08g29260D                                          224   5e-67   
ref|XP_008242755.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    224   5e-67   
ref|XP_004980690.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    223   6e-67   
ref|XP_006402779.1|  hypothetical protein EUTSA_v10005841mg             224   7e-67   
ref|XP_009116530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    224   8e-67   
gb|KHN43994.1|  DEAD-box ATP-dependent RNA helicase 37                  219   8e-67   
ref|XP_002449794.1|  hypothetical protein SORBIDRAFT_05g023460          219   9e-67   Sorghum bicolor [broomcorn]
emb|CDX98301.1|  BnaC06g16620D                                          223   1e-66   
gb|KHN30513.1|  DEAD-box ATP-dependent RNA helicase 37                  219   1e-66   
emb|CDX67749.1|  BnaA07g17890D                                          223   1e-66   
ref|XP_001761340.1|  predicted protein                                  223   1e-66   
ref|XP_009104148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    223   2e-66   
gb|AFW60456.1|  putative DEAD-box ATP-dependent RNA helicase fami...    223   2e-66   
ref|XP_010250055.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    222   4e-66   
ref|XP_001773533.1|  predicted protein                                  221   5e-66   
ref|XP_007145713.1|  hypothetical protein PHAVU_007G262000g             221   1e-65   
ref|XP_002323346.1|  DEAD box RNA helicase family protein               220   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006575174.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    219   6e-65   
ref|XP_003533906.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    218   8e-65   
ref|XP_009400121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-63   
ref|XP_009413314.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    214   3e-63   
ref|XP_001774212.1|  predicted protein                                  213   8e-63   
ref|XP_011039505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-62   
ref|XP_002973432.1|  hypothetical protein SELMODRAFT_52088              210   2e-62   
ref|XP_010093725.1|  DEAD-box ATP-dependent RNA helicase 52B            211   6e-62   
ref|XP_008354506.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    208   6e-62   
gb|KHG00046.1|  DEAD-box ATP-dependent RNA helicase 52B                 211   6e-62   
ref|XP_009138956.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   6e-62   
ref|XP_002976475.1|  hypothetical protein SELMODRAFT_105510             211   9e-62   
emb|CDX88990.1|  BnaA04g01960D                                          208   3e-61   
ref|XP_002285108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    209   3e-61   Vitis vinifera
ref|XP_010250056.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    209   3e-61   
ref|XP_007013410.1|  P-loop containing nucleoside triphosphate hy...    209   4e-61   
emb|CBI28180.3|  unnamed protein product                                210   1e-60   
ref|XP_002976623.1|  hypothetical protein SELMODRAFT_151274             207   1e-60   
ref|XP_009767732.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    206   1e-60   
ref|XP_002973232.1|  hypothetical protein SELMODRAFT_267628             207   2e-60   
ref|XP_008362909.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   2e-60   
ref|XP_009599417.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    205   3e-60   
gb|EYU29788.1|  hypothetical protein MIMGU_mgv1a003663mg                205   4e-60   
ref|XP_010688023.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    205   1e-59   
emb|CAB68189.1|  ATP-dependent RNA helicase-like protein                205   1e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAN63495.1|  hypothetical protein VITISV_011670                     206   2e-59   Vitis vinifera
ref|XP_004508511.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    202   1e-58   
gb|KCW79815.1|  hypothetical protein EUGRSUZ_C01156                     199   2e-58   
ref|XP_003609294.1|  DEAD-box ATP-dependent RNA helicase                202   2e-58   
ref|XP_007154992.1|  hypothetical protein PHAVU_003G163700g             200   6e-58   
ref|XP_004965954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    200   7e-58   
ref|XP_007154991.1|  hypothetical protein PHAVU_003G163700g             200   1e-57   
gb|EAZ01575.1|  hypothetical protein OsI_23609                          196   1e-57   Oryza sativa Indica Group [Indian rice]
dbj|BAG97731.1|  unnamed protein product                                196   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058006.1|  Os06g0602400                                       196   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010227545.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   2e-57   
ref|XP_010050529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   4e-57   
sp|Q0DB53.2|RH52A_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA...    197   9e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004288811.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   1e-56   
ref|XP_004965955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   1e-56   
ref|XP_011084132.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   1e-56   
emb|CAA09202.1|  RNA helicase                                           187   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15101.1|  DEAD-box ATP-dependent RNA helicase 52                  194   3e-56   
emb|CDP10390.1|  unnamed protein product                                196   5e-56   
gb|EMS59718.1|  DEAD-box ATP-dependent RNA helicase 52A                 191   6e-56   
ref|XP_003550826.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   8e-56   
gb|EMT25305.1|  DEAD-box ATP-dependent RNA helicase 52A                 191   1e-55   
gb|KHN47164.1|  DEAD-box ATP-dependent RNA helicase 52B                 191   1e-55   
ref|NP_001130628.1|  putative DEAD-box ATP-dependent RNA helicase...    193   2e-55   Zea mays [maize]
ref|XP_006656210.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   3e-55   
ref|XP_005648013.1|  DEAD-domain-containing protein                     191   9e-55   
ref|XP_003541505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   9e-55   
ref|XP_002437244.1|  hypothetical protein SORBIDRAFT_10g023440          191   1e-54   Sorghum bicolor [broomcorn]
emb|CCO30428.1|  ATP-dependent RNA helicase                             184   1e-54   
gb|ELU43422.1|  ATP-dependent RNA helicase ded-1                        183   2e-54   
emb|CDM82047.1|  unnamed protein product                                191   6e-54   
ref|XP_005846110.1|  hypothetical protein CHLNCDRAFT_31911              188   9e-54   
gb|KFY06957.1|  hypothetical protein V491_08568                         177   3e-53   
ref|XP_001702547.1|  predicted protein                                  187   3e-53   Chlamydomonas reinhardtii
ref|XP_007382720.1|  DEAD-domain-containing protein                     187   4e-53   
emb|CEG82233.1|  Putative ATP-dependent RNA helicase                    178   5e-53   
ref|XP_011090642.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    181   5e-53   
ref|XP_003063379.1|  predicted protein                                  185   5e-53   
ref|XP_007348077.1|  DEAD-domain-containing protein                     187   6e-53   
ref|XP_002954083.1|  hypothetical protein VOLCADRAFT_82651              187   6e-53   
ref|XP_001401571.1|  ATP-dependent RNA helicase ded1                    187   6e-53   Aspergillus niger CBS 513.88
ref|XP_001821314.1|  ATP-dependent RNA helicase ded1                    187   9e-53   Aspergillus oryzae RIB40
ref|XP_002377087.1|  ATP dependent RNA helicase (Dbp1), putative        187   9e-53   Aspergillus flavus NRRL3357
gb|EIT78435.1|  ATP-dependent RNA helicase                              186   1e-52   
sp|C8V8H4.1|DED1_EMENI  RecName: Full=ATP-dependent RNA helicase ...    186   1e-52   Aspergillus nidulans FGSC A4
gb|KDD72261.1|  DEAD/DEAH box helicase                                  182   1e-52   
gb|EYE94909.1|  DEAD-domain-containing protein                          186   1e-52   
dbj|GAA82684.1|  ATP dependent RNA helicase                             186   2e-52   
dbj|GAD96414.1|  ATP dependent RNA helicase (Dbp1), putative            186   2e-52   
ref|XP_001267256.1|  ATP dependent RNA helicase (Dbp1), putative        186   2e-52   Aspergillus fischeri NRRL 181
gb|AAR09926.1|  similar to Drosophila melanogaster CG9748               174   3e-52   Drosophila yakuba
gb|KEP52760.1|  ATP-dependent RNA helicase ded1                         185   3e-52   
gb|EUC59118.1|  ATP-dependent RNA helicase ded1                         185   3e-52   
ref|XP_002565810.1|  Pc22g19070                                         186   3e-52   Penicillium rubens Wisconsin 54-1255
gb|EDP50144.1|  ATP dependent RNA helicase (Dbp1), putative             185   3e-52   Aspergillus fumigatus A1163
dbj|GAM40469.1|  ATP-dependent RNA helicase                             185   3e-52   
ref|XP_752059.1|  ATP dependent RNA helicase (Dbp1)                     185   3e-52   Aspergillus fumigatus Af293
ref|XP_007362874.1|  ATP-dependent RNA helicase ded-1                   185   3e-52   
emb|CDM27800.1|  ATP-dependent RNA helicase ded1                        185   4e-52   
gb|EKV20854.1|  ATP dependent RNA helicase (Dbp1), putative             185   4e-52   
gb|EKV19753.1|  ATP dependent RNA helicase (Dbp1), putative             185   4e-52   
gb|EPS28744.1|  hypothetical protein PDE_03690                          185   4e-52   
gb|KGO38127.1|  Helicase, C-terminal                                    185   5e-52   
emb|CDO67954.1|  Pl10 B SciPl10B                                        181   6e-52   
ref|XP_003023025.1|  hypothetical protein TRV_02846                     184   6e-52   
ref|XP_003012824.1|  hypothetical protein ARB_01075                     184   6e-52   
ref|XP_003236843.1|  ATP-dependent RNA helicase DED1                    184   6e-52   
gb|KGO76065.1|  Helicase, C-terminal                                    184   6e-52   
gb|EGE06089.1|  ATP-dependent RNA helicase DED1                         184   7e-52   
ref|XP_001214616.1|  ATP-dependent RNA helicase ded1                    184   7e-52   Aspergillus terreus NIH2624
gb|EJU03568.1|  DEAD-domain-containing protein                          184   7e-52   
gb|EGN95116.1|  hypothetical protein SERLA73DRAFT_162691                184   8e-52   
ref|XP_002485202.1|  ATP dependent RNA helicase (Dbp1), putative        184   1e-51   Talaromyces stipitatus ATCC 10500
gb|EZF29590.1|  ATP-dependent RNA helicase DED1                         180   1e-51   
ref|XP_008038001.1|  DEAD-domain-containing protein                     183   1e-51   
gb|ERT02079.1|  ATP-dependent RNA helicase ded1                         183   2e-51   
gb|KIH88372.1|  ATP-dependent RNA helicase                              183   2e-51   
ref|XP_002148977.1|  ATP dependent RNA helicase (Dbp1), putative        183   2e-51   Talaromyces marneffei ATCC 18224
ref|XP_008473002.1|  PREDICTED: ATP-dependent RNA helicase bel-like     176   2e-51   
ref|XP_002584070.1|  ATP-dependent RNA helicase ded1                    182   3e-51   Uncinocarpus reesii 1704
ref|XP_001271659.1|  ATP dependent RNA helicase (Dbp1), putative        182   3e-51   Aspergillus clavatus NRRL 1
gb|KDQ06858.1|  hypothetical protein BOTBODRAFT_181202                  182   4e-51   
ref|XP_007785467.1|  ATP-dependent RNA helicase DED1                    182   4e-51   
emb|CDO69658.1|  hypothetical protein BN946_scf184851.g46               182   4e-51   
gb|KDR67636.1|  hypothetical protein GALMADRAFT_79516                   182   4e-51   
ref|XP_011120545.1|  hypothetical protein AOL_s00054g927                182   5e-51   
gb|EHA20484.1|  hypothetical protein ASPNIDRAFT_203639                  186   5e-51   
gb|EME39162.1|  hypothetical protein DOTSEDRAFT_179601                  182   6e-51   
ref|XP_003302577.1|  hypothetical protein PTT_14452                     181   6e-51   
ref|XP_007753377.1|  ATP-dependent RNA helicase DED1                    182   6e-51   
ref|XP_008722829.1|  ATP-dependent RNA helicase ded1                    182   6e-51   
ref|XP_007865357.1|  DEAD-domain-containing protein                     181   7e-51   
gb|KFZ23063.1|  hypothetical protein V502_02473                         181   7e-51   
gb|KEY71570.1|  hypothetical protein S7711_06030                        181   9e-51   
gb|KFA76301.1|  hypothetical protein S40288_02956                       181   9e-51   
gb|KFY59917.1|  hypothetical protein V497_03999                         181   9e-51   
gb|KFY01812.1|  hypothetical protein O988_02537                         181   9e-51   
ref|XP_662070.1|  hypothetical protein AN4466.2                         185   9e-51   
gb|KFY88382.1|  hypothetical protein V500_06381                         181   9e-51   
emb|CCA71370.1|  probable DED1-ATP-dependent RNA helicase               181   9e-51   
ref|XP_002844169.1|  ATP-dependent RNA helicase DED1                    181   1e-50   
ref|XP_007850906.1|  atp-dependent rna helicase ded1                    181   1e-50   
ref|XP_001239942.1|  hypothetical protein CIMG_09563                    181   1e-50   
gb|KFH73783.1|  hypothetical protein MVEG_00997                         181   1e-50   
sp|Q1DJF0.2|DED1_COCIM  RecName: Full=ATP-dependent RNA helicase ...    181   1e-50   
gb|EFW19746.1|  ATP-dependent RNA helicase DED1                         181   1e-50   
ref|XP_003067450.1|  ATP-dependent RNA helicase, putative               181   1e-50   
emb|CDO67953.1|  Pl10 A SciPl10A                                        177   2e-50   
ref|XP_002506611.1|  predicted protein                                  180   2e-50   
ref|XP_007681524.1|  hypothetical protein BAUCODRAFT_80455              180   2e-50   
gb|ABD59346.1|  PL10                                                    173   2e-50   
gb|KFY71983.1|  hypothetical protein V499_07854                         180   2e-50   
gb|KFY22946.1|  hypothetical protein V493_06195                         180   2e-50   
ref|XP_007929031.1|  hypothetical protein MYCFIDRAFT_141983             179   3e-50   
ref|XP_001592708.1|  ATP-dependent RNA helicase DED1                    180   3e-50   
gb|KFY13019.1|  hypothetical protein V492_03541                         180   3e-50   
ref|XP_003348211.1|  hypothetical protein SMAC_04056                    179   3e-50   
ref|XP_003032720.1|  hypothetical protein SCHCODRAFT_67353              179   3e-50   
ref|XP_001550389.1|  hypothetical protein BC1G_10862                    179   4e-50   
gb|ELR05565.1|  hypothetical protein GMDG_07485                         179   4e-50   
gb|KFZ06689.1|  hypothetical protein V501_07140                         179   4e-50   
gb|EMF10010.1|  DEAD-domain-containing protein                          179   4e-50   
emb|CCX11757.1|  Similar to ATP-dependent RNA helicase ded1; acc....    179   4e-50   
gb|KHO01494.1|  ATP-dependent RNA helicase DED1                         179   4e-50   
gb|ERZ96860.1|  hypothetical protein GLOINDRAFT_340478                  179   4e-50   
ref|XP_001831713.1|  ATP-dependent RNA helicase ded-1                   179   5e-50   
ref|XP_009152271.1|  ATP-dependent RNA helicase ded1                    179   5e-50   
ref|XP_009847935.1|  hypothetical protein NEUTE1DRAFT_76089             179   5e-50   
ref|XP_007812291.1|  ATP-dependent RNA helicase DED1                    179   5e-50   
gb|EIE85344.1|  hypothetical protein RO3G_10054                         179   5e-50   
sp|Q9P6U9.1|DED1_NEUCR  RecName: Full=ATP-dependent RNA helicase ...    179   6e-50   
ref|XP_007916573.1|  putative atp-dependent rna helicase ded1 pro...    179   6e-50   
ref|XP_001933275.1|  ATP-dependent RNA helicase DED1                    179   7e-50   
ref|XP_001911681.1|  hypothetical protein                               179   7e-50   
gb|KIE00520.1|  ATP-dependent RNA helicase ded-1                        179   7e-50   
ref|XP_007750604.1|  ATP-dependent RNA helicase DED1                    179   7e-50   
gb|EPT00984.1|  hypothetical protein FOMPIDRAFT_1023527                 178   7e-50   
gb|KDE09770.1|  ATP-dependent RNA helicase DED1                         179   7e-50   
gb|KHJ30123.1|  putative atp-dependent rna helicase ded1                179   8e-50   
gb|EFX02574.1|  ATP dependent RNA helicase                              179   8e-50   
gb|EPB82606.1|  hypothetical protein HMPREF1544_10639                   179   8e-50   
ref|XP_001228973.1|  hypothetical protein CHGG_02457                    179   8e-50   
ref|XP_007791038.1|  putative atp-dependent rna helicase ded1 pro...    179   8e-50   
ref|XP_007770766.1|  DEAD-domain-containing protein                     179   8e-50   
gb|KDB13159.1|  ATP-dependent RNA helicase DED1                         179   8e-50   
ref|XP_007780258.1|  ATP-dependent RNA helicase DED1                    179   8e-50   
gb|EIE88385.1|  hypothetical protein RO3G_13096                         178   9e-50   
gb|EPB86144.1|  hypothetical protein HMPREF1544_07046                   178   9e-50   
ref|XP_003661548.1|  hypothetical protein MYCTH_2301066                 178   1e-49   
gb|KID87558.1|  ATP-dependent RNA helicase ded-1                        178   1e-49   
ref|XP_003649075.1|  hypothetical protein THITE_2107255                 178   1e-49   
ref|XP_007825388.1|  ATP-dependent RNA helicase ded-1                   178   1e-49   
gb|KFG81115.1|  ATP-dependent RNA helicase ded-1                        178   1e-49   
gb|KID65745.1|  ATP-dependent RNA helicase ded-1                        178   1e-49   
ref|XP_001883806.1|  predicted protein                                  178   1e-49   
ref|XP_008595831.1|  putative ATP-dependent RNA helicase DED1           178   1e-49   
gb|KGQ10141.1|  ATP-dependent RNA helicase DED1                         178   1e-49   
gb|KEF51914.1|  hypothetical protein A1O9_11903                         178   1e-49   
gb|ETR99951.1|  DEAD-domain-containing protein                          177   1e-49   
gb|KID72847.1|  ATP-dependent RNA helicase ded-1                        178   1e-49   
emb|CEG03027.1|  unnamed protein product                                177   2e-49   
ref|XP_011116182.1|  hypothetical protein H072_10748                    178   2e-49   
ref|XP_007599179.1|  DEAD/DEAH box helicase                             178   2e-49   
gb|EHK27224.1|  hypothetical protein TRIVIDRAFT_85827                   177   2e-49   
gb|EMS24562.1|  ATP-dependent rna helicase ded1                         177   2e-49   
ref|XP_007874686.1|  hypothetical protein PNEG_02665                    177   2e-49   
ref|XP_001794501.1|  hypothetical protein SNOG_03958                    177   2e-49   
gb|EKG14832.1|  RNA helicase ATP-dependent DEAD-box conserved site      177   2e-49   
emb|CCE27710.1|  probable ATP-dependent RNA helicase DED1               177   2e-49   
ref|XP_003842000.1|  hypothetical protein LEMA_P077600.1                177   2e-49   
ref|XP_005713662.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Pu...    177   2e-49   
sp|Q0UWA6.1|DED1_PHANO  RecName: Full=ATP-dependent RNA helicase ...    177   2e-49   
gb|KFA68235.1|  hypothetical protein S40285_01572                       177   2e-49   
gb|KDN68855.1|  putative DEAD/DEAH box helicase                         177   3e-49   
emb|CEG70812.1|  Putative ATP-dependent RNA helicase DED1               177   3e-49   
gb|ESZ99026.1|  ATP-dependent RNA helicase DED1                         177   3e-49   
emb|CDH50983.1|  atp-dependent rna helicase ded1                        177   3e-49   
emb|CDS12758.1|  Putative ATP-dependent RNA helicase DED1               177   3e-49   
emb|CCU76532.1|  ATP-dependent RNA helicase ded1                        177   3e-49   
ref|XP_007736749.1|  hypothetical protein A1O3_08461                    177   3e-49   
gb|EPQ64322.1|  ATP-dependent RNA helicase of the DEAD-box protei...    177   3e-49   
emb|CCF47213.1|  ATP-dependent RNA helicase DED1                        175   3e-49   
ref|XP_006696810.1|  hypothetical protein CTHT_0065070                  177   3e-49   
emb|CCJ29835.1|  unnamed protein product                                177   3e-49   
emb|CCM02583.1|  predicted protein                                      177   3e-49   
gb|KDQ50739.1|  hypothetical protein JAAARDRAFT_141462                  177   4e-49   
gb|EFX70372.1|  hypothetical protein DAPPUDRAFT_328137                  177   4e-49   
gb|KDR10924.1|  ATP-dependent RNA helicase DDX3X                        177   4e-49   
ref|XP_007584953.1|  putative atp-dependent rna helicase ded1 pro...    177   4e-49   
ref|XP_002000433.1|  GI10230                                            177   4e-49   
gb|KFH72588.1|  hypothetical protein MVEG_02877                         176   4e-49   
ref|XP_002493545.1|  ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA...    176   5e-49   
gb|EWG43924.1|  ATP-dependent RNA helicase DED1                         176   5e-49   
gb|EGU79814.1|  hypothetical protein FOXB_09673                         176   5e-49   
gb|EMT63863.1|  ATP-dependent RNA helicase DED1                         176   5e-49   
ref|XP_386980.1|  hypothetical protein FG06804.1                        176   5e-49   
ref|XP_001950362.2|  PREDICTED: putative ATP-dependent RNA helica...    176   6e-49   
ref|XP_009263253.1|  hypothetical protein FPSE_11861                    176   6e-49   
emb|CCT66070.1|  probable ATP-dependent RNA helicase DED1               176   6e-49   
gb|KFM25862.1|  DEAD-box ATP-dependent RNA helicase 52B                 178   6e-49   
ref|XP_002172053.1|  ATP-dependent RNA helicase Sum3                    176   6e-49   
dbj|BAJ91236.1|  predicted protein                                      176   6e-49   
gb|KEQ63046.1|  DEAD-domain-containing protein                          176   6e-49   
gb|KEQ98023.1|  hypothetical protein AUEXF2481DRAFT_27357               176   7e-49   
ref|XP_008719135.1|  ATP-dependent RNA helicase ded1                    176   7e-49   
ref|XP_002056603.1|  GJ11034                                            177   7e-49   
gb|KEQ83807.1|  DEAD-domain-containing protein                          176   7e-49   
ref|XP_005180410.1|  PREDICTED: ATP-dependent RNA helicase bel-like     176   7e-49   
emb|CCG85176.1|  ATP-dependent RNA helicase ded-1                       176   7e-49   
ref|XP_002137583.1|  GA27302                                            176   8e-49   
gb|KEQ71434.1|  DEAD-domain-containing protein                          176   8e-49   
emb|CEI96093.1|  Putative ATP-dependent RNA helicase DED1               176   8e-49   
ref|XP_002014109.1|  GL24500                                            176   9e-49   
gb|ENN77199.1|  hypothetical protein YQE_06337                          171   9e-49   
ref|XP_007293315.1|  ATP-dependent RNA helicase DED1                    176   9e-49   
gb|EMD39189.1|  hypothetical protein CERSUDRAFT_81950                   175   1e-48   
dbj|GAA95675.1|  hypothetical protein E5Q_02332                         176   1e-48   
ref|XP_007720710.1|  hypothetical protein A1O1_01607                    176   1e-48   
ref|XP_011049136.1|  PREDICTED: ATP-dependent RNA helicase bel          175   1e-48   
gb|KFM69414.1|  hypothetical protein X975_24536                         176   1e-48   
ref|XP_007702296.1|  hypothetical protein COCSADRAFT_162462             175   1e-48   
ref|XP_007710274.1|  hypothetical protein COCCADRAFT_90869              175   1e-48   
ref|XP_001994075.1|  GH22875                                            176   1e-48   
ref|NP_001153721.1|  ATP-dependent RNA helicase belle                   175   1e-48   
ref|XP_007261385.1|  ATP-dependent RNA helicase ded-1                   175   1e-48   
ref|XP_007838861.1|  ATP-dependent RNA helicase ded-1                   175   1e-48   
ref|XP_006462145.1|  hypothetical protein AGABI2DRAFT_70511             175   2e-48   
ref|XP_007327112.1|  hypothetical protein AGABI1DRAFT_35315             175   2e-48   
ref|XP_006961904.1|  predicted protein                                  174   2e-48   
ref|XP_009549497.1|  hypothetical protein HETIRDRAFT_410995             175   2e-48   
gb|EFQ29825.1|  DEAD/DEAH box helicase                                  175   2e-48   
ref|XP_007400817.1|  hypothetical protein PHACADRAFT_263884             174   2e-48   
ref|XP_003006198.1|  ATP-dependent RNA helicase ded1                    175   2e-48   
ref|XP_002073325.1|  GK14071                                            176   2e-48   
ref|XP_009648554.1|  ATP-dependent RNA helicase ded1                    175   2e-48   
ref|XP_008031296.1|  hypothetical protein SETTUDRAFT_44772              175   2e-48   
emb|CDR37486.1|  CYFA0S01e11100g1_1                                     174   2e-48   
gb|ELU14120.1|  hypothetical protein CAPTEDRAFT_224610                  176   2e-48   
emb|CCU97526.1|  unnamed protein product                                174   3e-48   
gb|ENH87426.1|  ATP-dependent rna helicase ded1                         174   3e-48   
ref|XP_002096830.1|  bel                                                175   3e-48   
gb|EFN69748.1|  ATP-dependent RNA helicase bel                          174   3e-48   
gb|EFZ17785.1|  hypothetical protein SINV_13785                         173   3e-48   
ref|XP_003050452.1|  hypothetical protein NECHADRAFT_71876              174   3e-48   
gb|EZA50947.1|  ATP-dependent RNA helicase bel                          174   3e-48   
gb|EHK41674.1|  hypothetical protein TRIATDRAFT_173488                  174   4e-48   
ref|NP_001262379.1|  belle, isoform B                                   175   4e-48   
gb|EFN80473.1|  ATP-dependent RNA helicase bel                          174   4e-48   
ref|XP_002104236.1|  GD20854                                            174   4e-48   
ref|NP_536783.1|  belle, isoform A                                      174   4e-48   
ref|XP_002032017.1|  GM26328                                            174   4e-48   
gb|AGJ89708.1|  FI21109p1                                               174   4e-48   
gb|AAL90351.1|  RE28061p                                                174   4e-48   
ref|XP_004535591.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    174   4e-48   
ref|XP_004535593.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    174   4e-48   
gb|EHJ68220.1|  ATP-dependent RNA helicase belle-like protein           174   4e-48   
ref|XP_004535594.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    174   5e-48   
ref|XP_001980939.1|  GG17436                                            174   5e-48   
ref|XP_001955251.1|  GF16329                                            174   5e-48   
ref|XP_008554956.1|  PREDICTED: ATP-dependent RNA helicase bel          174   5e-48   
gb|EPE05729.1|  atp-dependent rna helicase ded1                         174   6e-48   
ref|XP_006823432.1|  PREDICTED: putative ATP-dependent RNA helica...    174   6e-48   
emb|CEJ80912.1|  Putative ATP-dependent RNA helicase ded1               173   7e-48   
ref|XP_006668350.1|  ATP-dependent RNA helicase DED1                    173   8e-48   
ref|XP_002593182.1|  hypothetical protein BRAFLDRAFT_209728             172   9e-48   
ref|XP_007412038.1|  hypothetical protein MELLADRAFT_78286              172   9e-48   
ref|XP_005539203.1|  ATP-dependent RNA helicase                         172   1e-47   
gb|EPY49754.1|  ATP-dependent RNA helicase Sum3                         172   1e-47   
ref|XP_007304005.1|  DEAD-domain-containing protein                     172   1e-47   
gb|EMD90908.1|  hypothetical protein COCHEDRAFT_1176468                 172   1e-47   
ref|XP_007687731.1|  hypothetical protein COCMIDRAFT_94723              172   1e-47   
ref|XP_003330106.2|  hypothetical protein PGTG_11016                    172   1e-47   
gb|EUN24867.1|  hypothetical protein COCVIDRAFT_104943                  172   1e-47   
ref|NP_588033.1|  ATP-dependent RNA helicase Sum3                       172   1e-47   
ref|XP_006679985.1|  hypothetical protein BATDEDRAFT_35392              172   2e-47   
gb|KFH47596.1|  ATP-dependent RNA helicase-like protein                 172   2e-47   
dbj|BAA25324.1|  Moc2 RNA helicase                                      172   2e-47   
ref|XP_004173425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   2e-47   
gb|KDN46135.1|  DEAD-domain-containing protein                          172   2e-47   
ref|XP_007511580.1|  predicted protein                                  170   2e-47   
gb|ESX02190.1|  ATP-dependent RNA helicase DED1                         171   2e-47   
gb|ABE27760.1|  pl10-like protein                                       172   2e-47   
ref|XP_003699498.1|  PREDICTED: putative ATP-dependent RNA helica...    172   2e-47   
gb|EQL00986.1|  ATP-dependent RNA helicase DED1                         174   3e-47   
ref|XP_008217796.1|  PREDICTED: ATP-dependent RNA helicase bel is...    172   3e-47   
ref|XP_003425176.1|  PREDICTED: ATP-dependent RNA helicase bel is...    172   3e-47   
ref|XP_003398065.1|  PREDICTED: putative ATP-dependent RNA helica...    171   3e-47   
ref|XP_001605842.1|  PREDICTED: ATP-dependent RNA helicase bel is...    171   3e-47   
ref|XP_009009187.1|  hypothetical protein HELRODRAFT_105366             171   3e-47   
emb|CCH45957.1|  ATP-dependent RNA helicase                             171   3e-47   
dbj|GAC99780.1|  hypothetical protein PHSY_007383                       171   3e-47   
gb|EPX70888.1|  ATP-dependent RNA helicase Sum3                         171   3e-47   
ref|XP_003488524.1|  PREDICTED: putative ATP-dependent RNA helica...    171   4e-47   
ref|XP_391829.3|  PREDICTED: ATP-dependent RNA helicase bel             171   4e-47   
ref|XP_003425177.1|  PREDICTED: ATP-dependent RNA helicase bel is...    171   4e-47   
ref|XP_003692739.1|  PREDICTED: LOW QUALITY PROTEIN: putative ATP...    171   4e-47   
ref|XP_007376494.1|  hypothetical protein SPAPADRAFT_51698              171   4e-47   
ref|XP_005110573.1|  PREDICTED: putative ATP-dependent RNA helica...    171   5e-47   
ref|XP_795982.3|  PREDICTED: ATP-dependent RNA helicase DDX3Y-like      167   5e-47   
gb|ACT35658.1|  PL10-like protein                                       171   5e-47   
ref|XP_001383156.2|  ATP-dependent RNA helicase of DEAD box family      170   6e-47   
sp|A3LQ01.3|DED1_PICST  RecName: Full=ATP-dependent RNA helicase ...    170   6e-47   



>ref|XP_010934445.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Elaeis guineensis]
Length=316

 Score =   242 bits (618),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV ++DKRS+L+D+LHA+KAN +HGK+ALTLVFVETK+ AD
Sbjct  63   FLAVGRVGSSTDLIIQRVEFVLESDKRSHLMDLLHAQKANGVHGKQALTLVFVETKKGAD  122

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  123  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  182

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  183  FDLPNDIDDYVHRIG  197



>ref|XP_010934455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Elaeis guineensis]
Length=315

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV ++DKRS+L+D+LHA+KAN +HGK+ALTLVFVETK+ AD
Sbjct  62   FLAVGRVGSSTDLIIQRVEFVLESDKRSHLMDLLHAQKANGVHGKQALTLVFVETKKGAD  121

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  122  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  181

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  182  FDLPNDIDDYVHRIG  196



>ref|XP_010934463.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X3 [Elaeis guineensis]
Length=348

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV ++DKRS+L+D+LHA+KAN +HGK+ALTLVFVETK+ AD
Sbjct  95   FLAVGRVGSSTDLIIQRVEFVLESDKRSHLMDLLHAQKANGVHGKQALTLVFVETKKGAD  154

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  155  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  214

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  215  FDLPNDIDDYVHRIG  229



>emb|CBI16497.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   239 bits (609),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRS+L+D+LHA++AN +HGK+ LTLVFVETK+ AD
Sbjct  24   FLAVGRVGSSTDLIVQRVEFVHDTDKRSHLMDLLHAQRANGVHGKQYLTLVFVETKKGAD  83

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  84   SLEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGVTPILVATDVAARGLDIPHVAHVVN  143

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  144  FDLPNDIDDYVHRIG  158



>emb|CBI29971.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN  HGK++LTLVFVETK+ AD
Sbjct  152  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGAHGKQSLTLVFVETKKGAD  211

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  212  SLEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  271

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  272  FDLPNDIDDYVHRIG  286



>ref|XP_009599889.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nicotiana 
tomentosiformis]
 ref|XP_009599890.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nicotiana 
tomentosiformis]
Length=603

 Score =   244 bits (622),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  358  FLAVGRVGSSTDLIVQRVEYVQETDKRSHLMDLLHAQRANGAHGKQALTLVFVETKKGAD  417

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPATAIHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  418  SLENWLCMNGFPATAIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  477

Query  45   FDLPNDIDDYVHRIG  1
            FD+PNDIDDYVHRIG
Sbjct  478  FDIPNDIDDYVHRIG  492



>emb|CBI32154.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV+++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  152  FLAVGRVGSSTDLIVQRVEFVQESDKRSHLMDLLHAQRENGTHGKQALTLVFVETKKGAD  211

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT+IHGDR+QQEREHALR FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  212  ALEHWLCINGFPATSIHGDRSQQEREHALRLFKSGATPILVATDVAARGLDIPHVAHVVN  271

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  272  FDLPNDIDDYVHRIG  286



>ref|XP_006354152.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006354153.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like isoform 
X2 [Solanum tuberosum]
Length=604

 Score =   243 bits (620),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA+K N +HGK++LTLVFVETK+ AD
Sbjct  357  FLAVGRVGSSTDLIVQRVEYVQETDKRSHLMDLLHAQKENGVHGKQSLTLVFVETKKGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQEREHALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  417  ALEHWLCMNGFPATAIHGDRTQQEREHALRSFKTGHTPILVATDVAARGLDIPHVAHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  477  FDLPNDIDDYVHRIG  491



>ref|XP_004228610.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Solanum lycopersicum]
 ref|XP_010316203.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Solanum lycopersicum]
Length=604

 Score =   242 bits (618),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA+K N +HGK+ALTLVFVETK+ AD
Sbjct  357  FLAVGRVGSSTDLIVQRVEYVQETDKRSHLMDLLHAQKENGVHGKQALTLVFVETKKGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPA AIHGDRTQQEREHALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  417  ALEHWLCMNGFPAAAIHGDRTQQEREHALRSFKTGYTPILVATDVAARGLDIPHVAHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  477  FDLPNDIDDYVHRIG  491



>ref|XP_006657539.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B-like [Oryza 
brachyantha]
Length=646

 Score =   243 bits (621),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRSYL+D+LHA++AN  HGK+ALTLVFVETKR AD
Sbjct  390  FLAVGRVGSSTDLIVQRVEFVLEADKRSYLMDLLHAQRANGTHGKQALTLVFVETKRGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC+N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  450  ALENWLCNNCFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>ref|XP_009785248.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nicotiana 
sylvestris]
 ref|XP_009785249.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nicotiana 
sylvestris]
 ref|XP_009785250.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nicotiana 
sylvestris]
Length=597

 Score =   242 bits (618),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++ N +HGK+ALTLVFVETK+ AD
Sbjct  356  FLAVGRVGSSTDLIVQRVEYVQETDKRSHLMDLLHAQRENGVHGKQALTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPATAIHGDRTQQERE+ALR+FKTG TPI+VATDVA+RGLDIPHVAHV+N
Sbjct  416  SLEHWLCMNGFPATAIHGDRTQQEREYALRSFKTGHTPIMVATDVAARGLDIPHVAHVVN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  476  FDLPNDIDDYVHRIG  490



>ref|XP_004955769.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B-like [Setaria 
italica]
Length=649

 Score =   243 bits (619),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRSYL+D+LHA+KAN  HGK+ALTLVFVETKR AD
Sbjct  391  FLAVGRVGSSTDLIVQRVEFVLDADKRSYLMDLLHAQKANGTHGKQALTLVFVETKRGAD  450

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  451  ALEDWLYRNGFPATSIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  510

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  511  FDLPNDIDDYVHRIG  525



>ref|XP_007014729.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY32348.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=416

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  172  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  231

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  232  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGATPILVATDVAARGLDIPHVAHVVN  291

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  292  FDLPNDIDDYVHRIG  306



>ref|XP_008667797.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase family 
protein isoform X1 [Zea mays]
 ref|XP_008667798.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase family 
protein isoform X1 [Zea mays]
 tpg|DAA42444.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
isoform 1 [Zea mays]
 tpg|DAA42445.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
isoform 2 [Zea mays]
Length=647

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRSYL+D+LHA+KAN  HGK ALTLVFVETKR AD
Sbjct  389  FLAVGRVGSSTDLIVQRVEFVLDSDKRSYLMDLLHAQKANGTHGKHALTLVFVETKRGAD  448

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  449  ALEDWLFRNGFPATSIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  508

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  509  FDLPNDIDDYVHRIG  523



>ref|XP_009603916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nicotiana 
tomentosiformis]
 ref|XP_009603917.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nicotiana 
tomentosiformis]
Length=593

 Score =   241 bits (614),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V + DKRS+L+D+LHA++ N +HGK+ALTLVFVETK+ AD
Sbjct  352  FLAVGRVGSSTDLIVQRVEYVLETDKRSHLMDLLHAQRENGVHGKQALTLVFVETKKGAD  411

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPATAIHGDRTQQERE+ALR+FKTG TPI+VATDVA+RGLDIPHVAHV+N
Sbjct  412  SLEHWLCMNGFPATAIHGDRTQQEREYALRSFKTGHTPIMVATDVAARGLDIPHVAHVVN  471

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  472  FDLPNDIDDYVHRIG  486



>ref|XP_003538523.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Glycine 
max]
Length=604

 Score =   241 bits (614),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA+KAN + GK+ALTLVFVETK+ AD
Sbjct  360  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQKANGVQGKQALTLVFVETKKGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  420  SLEHWLCRNSFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>ref|XP_009413313.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=617

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRSYL+D+LH ++   +HGK+ALTLVFVETKR AD
Sbjct  376  FLAVGRVGSSTDLIVQRVEFVPESDKRSYLMDLLHGQRDTGVHGKQALTLVFVETKRGAD  435

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  436  SLEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  495

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  496  FDLPNDIDDYVHRIG  510



>ref|XP_009413311.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRSYL+D+LH ++   +HGK+ALTLVFVETKR AD
Sbjct  380  FLAVGRVGSSTDLIVQRVEFVPESDKRSYLMDLLHGQRDTGVHGKQALTLVFVETKRGAD  439

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  440  SLEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  499

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  500  FDLPNDIDDYVHRIG  514



>ref|XP_011025172.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Populus euphratica]
Length=606

 Score =   240 bits (613),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRS+L+D+LHA++AN +HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVYEPDKRSHLMDLLHAQRANGVHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCINNFPATSIHGDRSQQEREQALRSFKTGNTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_002281113.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Vitis 
vinifera]
Length=622

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN  HGK++LTLVFVETK+ AD
Sbjct  377  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGAHGKQSLTLVFVETKKGAD  436

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  437  SLEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  496

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  497  FDLPNDIDDYVHRIG  511



>ref|XP_009396921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   241 bits (614),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  387  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRVNGAHGKQALTLVFVETKKGAD  446

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N+FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  447  SLEHWLCMNEFPATTIHGDRTQQERERALRSFKSGATPILVATDVAARGLDIPHVAHVIN  506

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  507  FDLPNDIDDYVHRIG  521



>ref|XP_011025171.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Populus euphratica]
Length=624

 Score =   241 bits (614),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRS+L+D+LHA++AN +HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVYEPDKRSHLMDLLHAQRANGVHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCINNFPATSIHGDRSQQEREQALRSFKTGNTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|NP_001059135.1| Os07g0202100 [Oryza sativa Japonica Group]
 sp|Q6Z4K6.1|RH52B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52B; AltName: 
Full=OsPL10b [Oryza sativa Japonica Group]
 dbj|BAC83834.1| putative DEAD-box RNA helicase DEAD3 [Oryza sativa Japonica Group]
 dbj|BAF21049.1| Os07g0202100 [Oryza sativa Japonica Group]
 gb|EEE66762.1| hypothetical protein OsJ_23477 [Oryza sativa Japonica Group]
Length=638

 Score =   241 bits (614),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRSYL+D+LHA++AN  HGK+ALTLVFVETKR AD
Sbjct  383  FLAVGRVGSSTDLIVQRVEFVLDADKRSYLMDLLHAQRANGTHGKQALTLVFVETKRGAD  442

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  443  ALENWLYNNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  502

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  503  FDLPNDIDDYVHRIG  517



>ref|NP_001183303.1| uncharacterized protein LOC100501699 [Zea mays]
 gb|ACR36344.1| unknown [Zea mays]
Length=643

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRSYL+D++HA+KAN  HGK ALTLVFVETKR AD
Sbjct  390  FLAVGRVGSSTDLIVQRVEFVLDSDKRSYLMDLIHAQKANGTHGKHALTLVFVETKRGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  450  ALEDWLFRNGFPATSIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>gb|EEC81697.1| hypothetical protein OsI_25294 [Oryza sativa Indica Group]
Length=639

 Score =   240 bits (613),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRSYL+D+LHA++AN  HGK+ALTLVFVETKR AD
Sbjct  384  FLAVGRVGSSTDLIVQRVEFVLDADKRSYLMDLLHAQRANGTHGKQALTLVFVETKRGAD  443

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  444  ALENWLYNNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  503

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  504  FDLPNDIDDYVHRIG  518



>tpg|DAA42448.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=643

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRSYL+D++HA+KAN  HGK ALTLVFVETKR AD
Sbjct  390  FLAVGRVGSSTDLIVQRVEFVLDSDKRSYLMDLIHAQKANGTHGKHALTLVFVETKRGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  450  ALEDWLFRNGFPATSIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVIN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>ref|XP_010923340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Elaeis 
guineensis]
 ref|XP_010923341.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Elaeis 
guineensis]
 ref|XP_010923342.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Elaeis 
guineensis]
Length=626

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA++AN +HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEYVLESDKRSHLMDLLHAQRANGVHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_009627657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nicotiana 
tomentosiformis]
Length=610

 Score =   239 bits (610),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV D DKRS+L+D+LHA+ AN +HGK+ALTLVFVETK+ AD
Sbjct  367  FLAVGRVGSSTDLILQRVEFVHDGDKRSHLMDLLHAQMANGVHGKQALTLVFVETKKGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQERE ALR FK G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  427  ALEHWLCINGFPATAIHGDRTQQEREQALRTFKRGDTPILVATDVAARGLDIPHVSHVIN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>ref|XP_010257586.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nelumbo 
nucifera]
Length=622

 Score =   239 bits (611),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  377  FLAVGRVGSSTDLIVQRVEFVLESDKRSHLMDLLHAQRANGTHGKQALTLVFVETKKGAD  436

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  437  SLEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  496

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  497  FDLPNDIDDYVHRIG  511



>gb|KHN44489.1| DEAD-box ATP-dependent RNA helicase 52 [Glycine soja]
Length=421

 Score =   234 bits (597),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGR+GS TDLIVQRVE+V+++DK S+L+D+LHA+KAN + GK+ALTLVFVETK+ AD
Sbjct  177  FLAVGRMGSGTDLIVQRVEYVQESDKTSHLMDLLHAQKANGVQGKQALTLVFVETKKGAD  236

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  237  SLEHWLCRNSFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  296

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  297  FDLPNDIDDYVHRIG  311



>emb|CDP14280.1| unnamed protein product [Coffea canephora]
Length=613

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA+++N +HGK+ALTLVFVETK+ AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVPESDKRSHLMDLLHAQRSNGVHGKQALTLVFVETKKGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  431  ALEHWLCMNHFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVIN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>gb|KHG22973.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
Length=603

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  365  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  424

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  425  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKTGATPILVATDVAARGLDIPHVAHVVN  484

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  485  FDLPNDIDDYVHRIG  499



>ref|XP_002283489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Vitis vinifera]
 ref|XP_010651358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Vitis vinifera]
 emb|CAN78578.1| hypothetical protein VITISV_013679 [Vitis vinifera]
Length=612

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRS+L+D+LHA++AN +HGK+ LTLVFVETK+ AD
Sbjct  368  FLAVGRVGSSTDLIVQRVEFVHDTDKRSHLMDLLHAQRANGVHGKQYLTLVFVETKKGAD  427

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  428  SLEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGVTPILVATDVAARGLDIPHVAHVVN  487

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  488  FDLPNDIDDYVHRIG  502



>dbj|BAJ94111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LI QRVEFV++ DKRS+L+D+LHA++ +   GK+ALTLVFVETKR AD
Sbjct  103  FLAVGRVGSSTELIAQRVEFVQEADKRSHLMDLLHAQRDSSDQGKQALTLVFVETKRGAD  162

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT+IHGDR QQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  163  SLENWLCTNGFPATSIHGDRNQQEREHALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  222

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  223  FDLPNDIDDYVHRIG  237



>ref|XP_003551661.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C [Glycine max]
 gb|KHN24014.1| DEAD-box ATP-dependent RNA helicase 37 [Glycine soja]
Length=591

 Score =   238 bits (608),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA+KAN + GK+ALTLVFVETK+ AD
Sbjct  347  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQKANGVQGKQALTLVFVETKKGAD  406

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  407  ALEHWLCRNNFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  466

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  467  FDLPNDIDDYVHRIG  481



>ref|XP_009418828.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418829.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
Length=623

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ +  HGK+ALTLVFVETKR AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRDSGAHGKQALTLVFVETKRGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQEREHALR FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  431  SLEHWLCMNGFPATTIHGDRSQQEREHALRTFKSGATPILVATDVAARGLDIPHVAHVIN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>ref|NP_001051626.1| Os03g0805200 [Oryza sativa Japonica Group]
 sp|Q75HJ0.1|RH37_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 37; AltName: 
Full=OsPL10a [Oryza sativa Japonica Group]
 gb|AAS07217.1| putative helicase [Oryza sativa Japonica Group]
 gb|ABF99430.1| ATP-dependent RNA helicase An3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13540.1| Os03g0805200 [Oryza sativa Japonica Group]
 gb|EEE60132.1| hypothetical protein OsJ_13017 [Oryza sativa Japonica Group]
Length=637

 Score =   239 bits (609),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D+LHA+KAN  HGK+ALTLVFVETKR AD
Sbjct  388  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLLHAQKANGTHGKQALTLVFVETKRGAD  447

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  448  ALENWLYTNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  507

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  508  FDLPNDIDDYVHRIG  522



>ref|XP_009406538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
Length=629

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ +  HGK+ALTLVFVETKR AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRDSGAHGKQALTLVFVETKRGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  432  SLEHWLCTNGFPATTIHGDRTQQEREQALRSFKSGATPILVATDVAARGLDIPHVAHVIN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>gb|KDP26941.1| hypothetical protein JCGZ_21034 [Jatropha curcas]
Length=616

 Score =   238 bits (607),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE ALR+F++G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  433  SLEHWLCINGFPATSIHGDRTQQEREQALRSFRSGNTPILVATDVAARGLDIPHVAHVVN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>ref|XP_008788973.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Phoenix 
dactylifera]
 ref|XP_008788979.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Phoenix 
dactylifera]
 ref|XP_008788983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Phoenix 
dactylifera]
Length=633

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVE+V ++DKRS+L+D+LHA++AN +HGK+ALTLVFVETK+ AD
Sbjct  379  FLAVGRVGSSTDLILQRVEYVLESDKRSHLMDLLHAQRANGVHGKQALTLVFVETKKGAD  438

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  439  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  498

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  499  FDLPNDIDDYVHRIG  513



>ref|XP_008370946.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Malus 
domestica]
Length=621

 Score =   238 bits (607),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGAHGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPND+DDYVHRIG
Sbjct  492  FDLPNDVDDYVHRIG  506



>ref|XP_006842770.1| hypothetical protein AMTR_s00133p00101570 [Amborella trichopoda]
 gb|ERN04445.1| hypothetical protein AMTR_s00133p00101570 [Amborella trichopoda]
Length=621

 Score =   238 bits (607),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEYVLESDKRSHLMDLLHAQRANGTHGKQALTLVFVETKKGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGTTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>emb|CDP17357.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  366  FLAVGRVGSSTDLIVQRVEYVHESDKRSHLMDLLHAQRANGAHGKQALTLVFVETKKGAD  425

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  426  ALEHWLCVNGFPATAIHGDRTQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  485

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  486  FDLPNDIDDYVHRIG  500



>emb|CDX98304.1| BnaC06g16650D [Brassica napus]
Length=461

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  175  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  234

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  235  SLENWLCMNGFPATTIHGDRSQQEREMALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  294

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  295  FDLPNDIDDYVHRIG  309



>ref|XP_002304009.2| hypothetical protein POPTR_0003s21330g [Populus trichocarpa]
 gb|EEE78988.2| hypothetical protein POPTR_0003s21330g [Populus trichocarpa]
Length=624

 Score =   238 bits (606),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVYEPDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCINGFPATSIHGDRSQQEREQALRSFKTGNTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_004981371.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Setaria 
italica]
Length=640

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D+LHA+KAN  HGK+ALTLVFVETKR AD
Sbjct  390  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLLHAQKANAAHGKQALTLVFVETKRGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  450  ALEDWLYKNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>ref|XP_008240826.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Prunus 
mume]
Length=617

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  430  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>ref|XP_007208033.1| hypothetical protein PRUPE_ppa002959mg [Prunus persica]
 gb|EMJ09232.1| hypothetical protein PRUPE_ppa002959mg [Prunus persica]
Length=617

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  430  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>ref|XP_002267581.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Vitis 
vinifera]
Length=617

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV+++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  368  FLAVGRVGSSTDLIVQRVEFVQESDKRSHLMDLLHAQRENGTHGKQALTLVFVETKKGAD  427

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT+IHGDR+QQEREHALR FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  428  ALEHWLCINGFPATSIHGDRSQQEREHALRLFKSGATPILVATDVAARGLDIPHVAHVVN  487

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  488  FDLPNDIDDYVHRIG  502



>ref|XP_010243434.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Nelumbo 
nucifera]
Length=626

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  380  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGTHGKQALTLVFVETKKGAD  439

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  440  SLEHWLCINGFPATTIHGDRTQQEREQALRSFKSGVTPILVATDVAARGLDIPHVAHVVN  499

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  500  FDLPNDIDDYVHRIG  514



>ref|XP_008796685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Phoenix 
dactylifera]
Length=629

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEYVLESDKRSHLMDLLHAQRANGAHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCMNGFPATTIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_006650754.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Oryza 
brachyantha]
Length=635

 Score =   238 bits (606),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D+LHA+KAN  HGK+ALTLVFVETKR AD
Sbjct  392  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLLHAQKANGAHGKQALTLVFVETKRGAD  451

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDR+QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  452  ALENWLFTNGFPATSIHGDRSQQEREYALRSFKSGATPILVATDVAARGLDIPHVAHVIN  511

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  512  FDLPNDIDDYVHRIG  526



>ref|XP_007014728.1| Dead box ATP-dependent RNA helicase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32347.1| Dead box ATP-dependent RNA helicase, putative isoform 1 [Theobroma 
cacao]
Length=622

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  378  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  437

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  438  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGATPILVATDVAARGLDIPHVAHVVN  497

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  498  FDLPNDIDDYVHRIG  512



>ref|XP_006411510.1| hypothetical protein EUTSA_v10016388mg [Eutrema salsugineum]
 gb|ESQ52963.1| hypothetical protein EUTSA_v10016388mg [Eutrema salsugineum]
Length=621

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N IHGK++LTLVFVETKR AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIHGKQSLTLVFVETKRSAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLENWLCINGFPATSIHGDRTQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>ref|XP_004294989.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Fragaria 
vesca subsp. vesca]
Length=622

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGTQGKQALTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  SLEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_009769683.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nicotiana 
sylvestris]
 ref|XP_009769689.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Nicotiana 
sylvestris]
Length=610

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV D DKRS+L+D+LHA+ AN +HGK+ALTLVFVETK+ AD
Sbjct  367  FLAVGRVGSSTDLILQRVEFVHDGDKRSHLMDLLHAQMANGVHGKQALTLVFVETKKGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQERE ALR FK G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  427  ALEHWLCINGFPATAIHGDRTQQEREQALRTFKRGDTPILVATDVAARGLDIPHVSHVIN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>ref|XP_011075074.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
 ref|XP_011075075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
Length=612

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQR+EFV ++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRIEFVHESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  432  SLEHWLCLNGFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVIN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_010506080.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Camelina 
sativa]
 ref|XP_010506081.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Camelina 
sativa]
Length=621

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  433  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>ref|XP_010508560.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Camelina sativa]
 ref|XP_010508561.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Camelina sativa]
Length=623

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  433  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>ref|XP_008387208.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Malus 
domestica]
Length=621

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGAHGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPND+DDYVHRIG
Sbjct  492  FDLPNDVDDYVHRIG  506



>ref|XP_009335876.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Pyrus 
x bretschneideri]
Length=621

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGAHGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCMNGFPATTIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPND+DDYVHRIG
Sbjct  492  FDLPNDVDDYVHRIG  506



>ref|XP_007204222.1| hypothetical protein PRUPE_ppa002926mg [Prunus persica]
 gb|EMJ05421.1| hypothetical protein PRUPE_ppa002926mg [Prunus persica]
Length=621

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N +HGK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGVHGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>gb|KHG04878.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
Length=625

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  380  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGAHGKQALTLVFVETKKGAD  439

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  440  SLEHWLCINGFPATTIHGDRTQQERELALRSFKTGKTPILVATDVAARGLDIPHVAHVVN  499

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  500  FDLPNDIDDYVHRIG  514



>ref|XP_011078806.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Sesamum indicum]
Length=612

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGRVGSSTDLIVQRVEFV ++DKRSYL+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  372  FLTVGRVGSSTDLIVQRVEFVHESDKRSYLMDLLHAQRANGAQGKQALTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  432  SLEHWLCLNGFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVIN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_002879990.1| hypothetical protein ARALYDRAFT_483345 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56249.1| hypothetical protein ARALYDRAFT_483345 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  431  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>ref|NP_181780.1| DEAD-box ATP-dependent RNA helicase 37 [Arabidopsis thaliana]
 sp|Q84W89.2|RH37_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 37 [Arabidopsis 
thaliana]
 gb|AAD23001.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AEC10133.1| DEAD-box ATP-dependent RNA helicase 37 [Arabidopsis thaliana]
Length=633

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  433  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>gb|AAO42134.1| putative DEAD/DEAH box RNA helicase [Arabidopsis thaliana]
Length=633

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  433  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>ref|XP_008241163.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Prunus 
mume]
Length=621

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N +HGK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGVHGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCMNGFPATTIHGDRTQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>gb|EYU39976.1| hypothetical protein MIMGU_mgv1a003137mg [Erythranthe guttata]
Length=605

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV++ DKRS+L+D++HA++AN +HGK+ALTLVFVETK+ AD
Sbjct  356  FLAVGRVGSSTDLIVQRVEFVQECDKRSHLMDLIHAQRANGVHGKQALTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE+AL++FK+G TP+LVATDVA+RGLDIPHVAHVIN
Sbjct  416  ALEHWLCLNDFPATTIHGDRTQQEREYALKSFKSGRTPMLVATDVAARGLDIPHVAHVIN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  476  FDLPNDIDDYVHRIG  490



>ref|XP_008384403.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Malus 
domestica]
Length=619

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGAQGKQALTLVFVETKKGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  431  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>gb|KHG12304.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
 gb|KHG16753.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
 gb|KHG29897.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
Length=621

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV+++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVQESDKRSHLMDLLHAQRENGAHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCINGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_008349416.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Malus 
domestica]
Length=619

 Score =   235 bits (600),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRANGAQGKQALTLVFVETKKGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  431  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>ref|XP_011078805.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Sesamum indicum]
Length=659

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGRVGSSTDLIVQRVEFV ++DKRSYL+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  419  FLTVGRVGSSTDLIVQRVEFVHESDKRSYLMDLLHAQRANGAQGKQALTLVFVETKKGAD  478

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  479  SLEHWLCLNGFPATTIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVIN  538

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  539  FDLPNDIDDYVHRIG  553



>ref|XP_006290726.1| hypothetical protein CARUB_v10016822mg [Capsella rubella]
 gb|EOA23624.1| hypothetical protein CARUB_v10016822mg [Capsella rubella]
Length=643

 Score =   236 bits (601),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  358  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  417

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  418  SLENWLCTNGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  477

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  478  FDLPNDIDDYVHRIG  492



>ref|XP_003531232.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Glycine max]
Length=619

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCLNGFPATTIHGDRSQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_007159397.1| hypothetical protein PHAVU_002G234900g [Phaseolus vulgaris]
 gb|ESW31391.1| hypothetical protein PHAVU_002G234900g [Phaseolus vulgaris]
Length=615

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  430  SLEHWLCLNGFPATTIHGDRSQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>gb|KHN47963.1| DEAD-box ATP-dependent RNA helicase 37 [Glycine soja]
Length=620

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  375  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  434

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  435  SLEHWLCLNGFPATTIHGDRSQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  494

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  495  FDLPNDIDDYVHRIG  509



>ref|XP_011048237.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
 ref|XP_011048238.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
 ref|XP_011048239.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
Length=622

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+L+A++AN + GK+ALTLVFVETKR AD
Sbjct  378  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLYAQRANGVQGKQALTLVFVETKRGAD  437

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIP VAHV+N
Sbjct  438  SLEHWLCINNFPATSIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPRVAHVVN  497

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  498  FDLPNDIDDYVHRIG  512



>ref|XP_011089700.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
 ref|XP_011089701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
Length=611

 Score =   235 bits (599),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V + DKRS+L+D+LHA++AN +  K+ALTLVFVETK+ AD
Sbjct  366  FLAVGRVGSSTDLIVQRVEYVLETDKRSHLMDLLHAQRANGVQAKQALTLVFVETKKGAD  425

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  426  SLENWLCINGFPATSIHGDRTQQEREYALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  485

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  486  FDLPNDIDDYVHRIG  500



>ref|XP_006293841.1| hypothetical protein CARUB_v10022826mg [Capsella rubella]
 gb|EOA26739.1| hypothetical protein CARUB_v10022826mg [Capsella rubella]
Length=624

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE AL+AFK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLENWLCINGFPATSIHGDRSQQEREVALKAFKSGRTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>ref|XP_003524948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 isoform X1 
[Glycine max]
 ref|XP_006580156.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 isoform X2 
[Glycine max]
Length=614

 Score =   234 bits (598),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLEHWLCLNGFPATTIHGDRSQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>emb|CDX67752.1| BnaA07g17920D [Brassica napus]
Length=633

 Score =   235 bits (599),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  347  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  406

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  407  SLENWLCMNGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  466

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  467  FDLPNDIDDYVHRIG  481



>emb|CDY14843.1| BnaC04g48400D [Brassica napus]
Length=612

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  367  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  427  SLENWLCINGFPATSIHGDRSQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>ref|XP_010693834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Beta 
vulgaris subsp. vulgaris]
Length=630

 Score =   234 bits (598),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D++HA+KAN  HGK+ALTLVFVETK+ AD
Sbjct  373  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLIHAQKANGAHGKQALTLVFVETKKGAD  432

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  433  ALEHWLGMNGFPATSIHGDRTQQERELALRSFKSGNTPILVATDVAARGLDIPHVAHVIN  492

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  493  FDLPNDIDDYVHRIG  507



>ref|XP_009375510.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Pyrus 
x bretschneideri]
Length=622

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D++HA++AN   GK+ALTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLIHAQRANGAQGKQALTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_008351686.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Malus 
domestica]
Length=624

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D++HA++AN   GK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLIHAQRANGAQGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_006492814.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Citrus sinensis]
 ref|XP_006492815.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Citrus sinensis]
Length=609

 Score =   234 bits (596),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA+ AN +HGK+ALTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQVANGVHGKQALTLVFVETKKGAD  418

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  419  ALEHWLYTNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  478

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  479  FDLPNDIDDYVHRIG  493



>ref|XP_004234756.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Solanum 
lycopersicum]
Length=612

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRS+L+D+LHA+ AN +HGK +LTLVFVETK+ AD
Sbjct  367  FLAVGRVGSSTDLIVQRVEFVHDVDKRSHLMDLLHAQMANGVHGKHSLTLVFVETKKGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQERE ALR FK G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  427  ALEHWLCINGFPATAIHGDRTQQEREQALRTFKRGDTPILVATDVAARGLDIPHVSHVIN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>ref|XP_007163837.1| hypothetical protein PHAVU_001G268400g [Phaseolus vulgaris]
 gb|ESW35831.1| hypothetical protein PHAVU_001G268400g [Phaseolus vulgaris]
Length=593

 Score =   233 bits (595),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGS TDLIVQRVE+V+++DKRS+L+D+LHA++ N + GK+ALTLVFVETK+ AD
Sbjct  349  FLAVGRVGSITDLIVQRVEYVQESDKRSHLMDLLHAQRENGVQGKQALTLVFVETKKGAD  408

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  409  ALEHWLCRNNFPATTIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPHVAHVVN  468

Query  45   FDLPNDIDDYVHRIG  1
            F+LPND+DDYVHRIG
Sbjct  469  FELPNDVDDYVHRIG  483



>ref|XP_004303365.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  385  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGTHGKQALTLVFVETKKGAD  444

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  445  ALEHWLCVNGFPATTIHGDRTQQEREQALRSFKSGHTPILVATDVAARGLDIPHVAHVVN  504

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  505  FDLPNDIDDYVHRIG  519



>ref|NP_191416.1| DEAD-box ATP-dependent RNA helicase 52 [Arabidopsis thaliana]
 sp|Q9M2F9.1|RH52_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 52 [Arabidopsis 
thaliana]
 emb|CAB68195.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAK83627.1| AT3g58570/F14P22_160 [Arabidopsis thaliana]
 gb|AAM65677.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAO11647.1| At3g58570/F14P22_160 [Arabidopsis thaliana]
 gb|AEE79800.1| DEAD-box ATP-dependent RNA helicase 52 [Arabidopsis thaliana]
Length=646

 Score =   234 bits (597),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  360  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  420  SLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>ref|XP_004502214.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Cicer 
arietinum]
Length=617

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  364  FLAVGRVGSSTDLIDQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  423

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  424  ALEHWLCLNNFPATTIHGDRTQQERESALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  483

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  484  FDLPNDIDDYVHRIG  498



>gb|KDP21899.1| hypothetical protein JCGZ_03037 [Jatropha curcas]
Length=634

 Score =   233 bits (595),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVE+V + DKRS+L+D+LHA++  EI+GK++LTLVFVETK+ AD
Sbjct  390  FLAVGRVGSSTDLIIQRVEYVHETDKRSHLMDLLHAQRETEINGKQSLTLVFVETKKGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  450  SLEHWLCMNGFPATTIHGDRTQQEREMALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>ref|XP_007029089.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY09591.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=617

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQRVEFV + DKRS+L+D+LHA++ N IHGK ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTELIVQRVEFVHELDKRSHLMDLLHAQRENGIHGKHALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCMNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>gb|KHG25034.1| DEAD-box ATP-dependent RNA helicase 37 -like protein [Gossypium 
arboreum]
Length=613

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N  HGK+ALTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEFVLESDKRSHLMDLLHAQRENGNHGKQALTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FP+T IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLCMNGFPSTTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_011010680.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
 ref|XP_011010681.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
 ref|XP_011010682.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
Length=619

 Score =   233 bits (593),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+L+A++AN + GK+ALTLVFVETKR AD
Sbjct  375  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLYAQRANGVQGKQALTLVFVETKRGAD  434

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIP VAHV+N
Sbjct  435  SLEHWLCINNFPATSIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPRVAHVVN  494

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  495  FDLPNDIDDYVHRIG  509



>ref|XP_011089120.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
 ref|XP_011089121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Sesamum 
indicum]
Length=610

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V + DKRS+L+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  368  FLAVGRVGSSTDLIVQRVEYVLETDKRSHLMDLLHAQRANGDQGKQALTLVFVETKKGAD  427

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPA+AIHGDR+QQ+RE+ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  428  SLEHWLCMNHFPASAIHGDRSQQDREYALRSFKTGKTPILVATDVAARGLDIPHVAHVVN  487

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  488  FDLPNDIDDYVHRIG  502



>gb|KDO70833.1| hypothetical protein CISIN_1g007285mg [Citrus sinensis]
 gb|KDO70834.1| hypothetical protein CISIN_1g007285mg [Citrus sinensis]
Length=609

 Score =   233 bits (593),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA+ AN +HGK+ALTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQVANGVHGKQALTLVFVETKKGAD  418

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  419  ALEHWLYMNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  478

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  479  FDLPNDIDDYVHRIG  493



>ref|XP_006360604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360605.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Solanum tuberosum]
Length=618

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D DKRS+L+D+LHA+ AN +HGK  LTLVFVETK+ AD
Sbjct  367  FLAVGRVGSSTDLIVQRVEFVHDVDKRSHLMDLLHAQMANGVHGKHNLTLVFVETKKGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPATAIHGDRTQQERE ALR FK G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  427  ALEHWLCINGFPATAIHGDRTQQEREQALRTFKRGDTPILVATDVAARGLDIPHVSHVIN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>gb|EYU20677.1| hypothetical protein MIMGU_mgv1a002900mg [Erythranthe guttata]
Length=627

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  381  FLAVGRVGSSTDLIVQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  440

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N F AT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  441  SLEHWLCHNGFLATTIHGDRTQQEREMALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  500

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  501  FDLPNDIDDYVHRIG  515



>ref|XP_010044956.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Eucalyptus 
grandis]
 ref|XP_010044957.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Eucalyptus 
grandis]
 gb|KCW87089.1| hypothetical protein EUGRSUZ_B03621 [Eucalyptus grandis]
Length=634

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKK-ALTLVFVETKRRA  229
            FLAVGRVGSSTDLIVQRVEFV D DKRSYL+D+LHA++ N + GK+ +LTLVFVETK+ A
Sbjct  376  FLAVGRVGSSTDLIVQRVEFVHDADKRSYLMDLLHAQRDNVVQGKQQSLTLVFVETKKGA  435

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            DSLE WLC N FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHV+HVI
Sbjct  436  DSLENWLCHNGFPATSIHGDRTQQERESALRSFKTGRTPILVATDVAARGLDIPHVSHVI  495

Query  48   NFDLPNDIDDYVHRIG  1
            NFDLPNDIDDYVHRIG
Sbjct  496  NFDLPNDIDDYVHRIG  511



>ref|XP_010431461.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52-like [Camelina 
sativa]
Length=542

 Score =   231 bits (588),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  257  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  316

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  317  ALENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  376

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  377  FDLPNDIDDYVHRIG  391



>ref|XP_009364117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Pyrus 
x bretschneideri]
Length=619

 Score =   233 bits (593),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++ KRS+L+D+LHA++AN   GK+ALTLVFVETK+ AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVHESGKRSHLMDLLHAQRANGAQGKQALTLVFVETKKGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  431  SLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>ref|XP_010517778.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Camelina 
sativa]
Length=626

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N I GK+ALTLVFVETKR AD
Sbjct  375  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQALTLVFVETKRGAD  434

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE AL+AFK+G TPILVATDVA+RGLDIP VAHV+N
Sbjct  435  SLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAARGLDIPLVAHVVN  494

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  495  FDLPNDIDDYVHRIG  509



>ref|XP_004142160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Cucumis 
sativus]
Length=625

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRS+LLD+LHA++AN + GK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIAQRVEFVHEADKRSHLLDLLHAQRANGVQGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+F++G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCLNGFPATTIHGDRTQQEREQALRSFRSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>gb|KGN54076.1| hypothetical protein Csa_4G280530 [Cucumis sativus]
Length=627

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRS+LLD+LHA++AN + GK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIAQRVEFVHEADKRSHLLDLLHAQRANGVQGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+F++G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCLNGFPATTIHGDRTQQEREQALRSFRSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_009104151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52 [Brassica rapa]
Length=643

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  357  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  417  SLENWLCMNGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  477  FDLPNDIDDYVHRIG  491



>ref|XP_003601625.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES71876.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=613

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTDLIDQRVEYVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  418

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  419  ALEHWLCLNNFPATTIHGDRSQQEREAALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  478

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  479  FDLPNDIDDYVHRIG  493



>ref|XP_006402772.1| hypothetical protein EUTSA_v10005833mg [Eutrema salsugineum]
 gb|ESQ44225.1| hypothetical protein EUTSA_v10005833mg [Eutrema salsugineum]
Length=643

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  358  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  417

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  418  SLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  477

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  478  FDLPNDIDDYVHRIG  492



>gb|AAL32524.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM47956.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=421

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  174  FLAVGRVGSSTDLITQRVEFVQESDKRSHLMDLLHAQR--ETQDKQSLTLVFVETKRGAD  231

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  232  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  291

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  292  FDLPNDIDDYVHRIG  306



>ref|XP_002527063.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF35307.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=650

 Score =   233 bits (593),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 107/135 (79%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI+QRVEFV+++DKRS+L+D+LHA++AN + GK+ALTLVFVETK+ AD
Sbjct  405  FLAVGRVGSSTDLIIQRVEFVQESDKRSHLMDLLHAQRANGVQGKQALTLVFVETKKGAD  464

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N FPAT+IHGDR+QQERE ALR+F++G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  465  SLEHWLYVNGFPATSIHGDRSQQEREQALRSFRSGNTPILVATDVAARGLDIPHVAHVVN  524

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  525  FDLPNDIDDYVHRIG  539



>ref|XP_002876468.1| hypothetical protein ARALYDRAFT_486308 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52727.1| hypothetical protein ARALYDRAFT_486308 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  351  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  410

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  411  SLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  470

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  471  FDLPNDIDDYVHRIG  485



>gb|EYU31690.1| hypothetical protein MIMGU_mgv1a003053mg [Erythranthe guttata]
Length=611

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V + DKRS+L+D+LHA++AN +  K+ALTLVFVETK+ AD
Sbjct  357  FLAVGRVGSSTDLIVQRVEYVLETDKRSHLMDLLHAQRANGVQVKQALTLVFVETKKGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIPHV+HV+N
Sbjct  417  SLEHWLCINGFPATSIHGDRTQQEREYALRSFKSGNTPILVATDVAARGLDIPHVSHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  477  FDLPNDIDDYVHRIG  491



>ref|XP_003564206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Brachypodium 
distachyon]
Length=637

 Score =   231 bits (590),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D++HA+KAN + GK++LTLVFVETKR AD
Sbjct  390  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLIHAQKANTVPGKQSLTLVFVETKRGAD  449

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIP VAHVIN
Sbjct  450  ALENWLYTNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPDVAHVIN  509

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  510  FDLPNDIDDYVHRIG  524



>ref|XP_008449802.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Cucumis 
melo]
 ref|XP_008449803.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Cucumis 
melo]
Length=624

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V + DKRS+LLD+LHA++AN + GK++LTLVFVETK+ AD
Sbjct  372  FLAVGRVGSSTDLIAQRVEYVHEPDKRSHLLDLLHAQRANGVQGKQSLTLVFVETKKGAD  431

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDRTQQERE ALR+F++G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  432  ALEHWLCLNGFPATTIHGDRTQQEREQALRSFRSGNTPILVATDVAARGLDIPHVAHVVN  491

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  492  FDLPNDIDDYVHRIG  506



>ref|XP_006663583.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like, partial 
[Oryza brachyantha]
Length=529

 Score =   229 bits (584),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV++ DKRS+L+D+LHA++     GK  LTLVFVETKR AD
Sbjct  277  FLAVGRVGSSTDLIVQRVEFVQEADKRSHLMDLLHAQRDTATPGKPTLTLVFVETKRGAD  336

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  337  SLEHWLCMNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  396

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  397  FDLPNDIDDYVHRIG  411



>gb|EAZ18899.1| hypothetical protein OsJ_34439 [Oryza sativa Japonica Group]
Length=541

 Score =   229 bits (584),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV++ DKRS+L+D+LHA++ +   GK  LTLVFVETKR AD
Sbjct  289  FLAVGRVGSSTDLIVQRVEFVQEADKRSHLMDLLHAQRDSATPGKPTLTLVFVETKRGAD  348

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  349  SLEHWLCMNGFPATSIHGDRNQQEREYALRSFKSGHTPILVATDVAARGLDIPHVAHVVN  408

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  409  FDLPNDIDDYVHRIG  423



>ref|XP_003577389.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C [Brachypodium 
distachyon]
Length=609

 Score =   231 bits (588),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LI QRVEFV + DKRS+L+D+LHA++ +  HGK+ALTLVFVETKR AD
Sbjct  357  FLAVGRVGSSTELIAQRVEFVHEADKRSHLMDLLHAQRDSADHGKQALTLVFVETKRGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  417  SLENWLCTNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  477  FDLPNDIDDYVHRIG  491



>ref|NP_001168055.1| uncharacterized protein LOC100381785 [Zea mays]
 gb|ACN26948.1| unknown [Zea mays]
Length=388

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV++ DKRS+L+D+LHA++     GK+ LTLVFVETKR AD
Sbjct  143  FLAVGRVGSSTDLIAQRVEFVQEADKRSHLMDLLHAQRDT---GKQTLTLVFVETKRGAD  199

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  200  SLESWLCMNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  259

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  260  FDLPNDIDDYVHRIG  274



>ref|XP_010504814.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52 [Camelina sativa]
Length=643

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  418

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  419  ALENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  478

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  479  FDLPNDIDDYVHRIG  493



>gb|EMS67020.1| DEAD-box ATP-dependent RNA helicase 37 [Triticum urartu]
Length=646

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D++HA+KAN++ GK +LTLVFVETKR AD
Sbjct  400  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLIHAQKANDVPGKNSLTLVFVETKRGAD  459

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIP VAHVIN
Sbjct  460  ALENWLYTNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPDVAHVIN  519

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  520  FDLPNDIDDYVHRIG  534



>ref|XP_009804880.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like, partial 
[Nicotiana sylvestris]
Length=486

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++AN  HGK+ALTLVFVETK+ AD
Sbjct  358  FLAVGRVGSSTDLIVQRVEYVQETDKRSHLMDLLHAQRANGAHGKQALTLVFVETKKGAD  417

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPATAIHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  418  SLEHWLCMNGFPATAIHGDRTQQEREHALRSFKSGNTPILVATDVAARGLDIPHVAHVVN  477

Query  45   FDLPNDIDD  19
            FD+PNDIDD
Sbjct  478  FDIPNDIDD  486



>ref|XP_010524794.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524800.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010524809.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Tarenaya hassleriana]
Length=607

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV ++DKRS+L+D+LHA++ N I  K ALTLVFVETK+ AD
Sbjct  364  FLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLLHAQRENGIQDKHALTLVFVETKKGAD  423

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  424  SLEHWLCMNGFPATSIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  483

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  484  FDLPNDIDDYVHRIG  498



>emb|CDY47978.1| BnaA04g24560D [Brassica napus]
Length=418

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   G ++LTLVFVETKR AD
Sbjct  175  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQREN---GMQSLTLVFVETKRGAD  231

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  232  SLENWLCINGFPATSIHGDRSQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  291

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  292  FDLPNDIDDYVHRIG  306



>gb|EMS54351.1| DEAD-box ATP-dependent RNA helicase 52C [Triticum urartu]
Length=612

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LI QRVEFV++ DKRS+L+D+LHA++ +   GK+ALTLVFVETKR AD
Sbjct  369  FLAVGRVGSSTELIAQRVEFVQEADKRSHLMDLLHAQRDSSEQGKQALTLVFVETKRGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLENWLCTNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>gb|EMT07342.1| DEAD-box ATP-dependent RNA helicase 52C [Aegilops tauschii]
Length=729

 Score =   231 bits (590),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LI QRVEFV++ DKRS+L+D+LHA++ +   GK+ALTLVFVETKR AD
Sbjct  486  FLAVGRVGSSTELIAQRVEFVQEADKRSHLMDLLHAQRDSSEQGKQALTLVFVETKRGAD  545

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  546  SLENWLCTNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  605

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  606  FDLPNDIDDYVHRIG  620



>ref|XP_010101088.1| DEAD-box ATP-dependent RNA helicase 37 [Morus notabilis]
 gb|EXB86900.1| DEAD-box ATP-dependent RNA helicase 37 [Morus notabilis]
Length=612

 Score =   229 bits (584),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRS+L+D+LHA+K     GK+ALTLVFVETK+ AD
Sbjct  360  FLAVGRVGSSTDLIVQRVEFVHEADKRSHLMDLLHAQKETTAQGKQALTLVFVETKKGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL S+ FPAT+IHGDR+QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  420  SLEYWLTSSGFPATSIHGDRSQQEREYALRSFKSGKTPILVATDVAARGLDIPHVAHVIN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>ref|XP_006492811.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Citrus sinensis]
 ref|XP_006492812.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Citrus sinensis]
Length=606

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA+ AN +HGK++LTLVFVETK+ AD
Sbjct  356  FLAVGRVGSSTDLIVQRVEYVHESDKRSHLMDLLHAQVANGVHGKQSLTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  416  ALEHWLYMNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  476  FDLPNDIDDYVHRIG  490



>ref|NP_001068221.1| Os11g0599500 [Oryza sativa Japonica Group]
 sp|Q2R1M8.1|RH52C_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52C [Oryza 
sativa Japonica Group]
 gb|ABA94715.1| DEAD-box protein 3, X-chromosomal, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28584.1| Os11g0599500 [Oryza sativa Japonica Group]
Length=623

 Score =   229 bits (584),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV++ DKRS+L+D+LHA++ +   GK  LTLVFVETKR AD
Sbjct  371  FLAVGRVGSSTDLIVQRVEFVQEADKRSHLMDLLHAQRDSATPGKPTLTLVFVETKRGAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  431  SLEHWLCMNGFPATSIHGDRNQQEREYALRSFKSGHTPILVATDVAARGLDIPHVAHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  491  FDLPNDIDDYVHRIG  505



>gb|KDO70827.1| hypothetical protein CISIN_1g007368mg [Citrus sinensis]
 gb|KDO70828.1| hypothetical protein CISIN_1g007368mg [Citrus sinensis]
 gb|KDO70829.1| hypothetical protein CISIN_1g007368mg [Citrus sinensis]
Length=606

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA+ AN +HGK++LTLVFVETK+ AD
Sbjct  356  FLAVGRVGSSTDLIVQRVEYVHESDKRSHLMDLLHAQVANGVHGKQSLTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  416  ALEHWLYMNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  476  FDLPNDIDDYVHRIG  490



>ref|XP_006429937.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
 ref|XP_006429938.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
 ref|XP_006429939.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
 gb|ESR43177.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
 gb|ESR43178.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
 gb|ESR43179.1| hypothetical protein CICLE_v10011322mg [Citrus clementina]
Length=606

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA+ AN +HGK++LTLVFVETK+ AD
Sbjct  356  FLAVGRVGSSTDLIVQRVEYVHESDKRSHLMDLLHAQVANGVHGKQSLTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  416  ALEHWLYMNGFPATTIHGDRTQQERELALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  476  FDLPNDIDDYVHRIG  490



>ref|XP_002297644.2| hypothetical protein POPTR_0001s04510g [Populus trichocarpa]
 gb|EEE82449.2| hypothetical protein POPTR_0001s04510g [Populus trichocarpa]
Length=619

 Score =   229 bits (584),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+L+A++AN + GK+ LTLVFVETK+ AD
Sbjct  375  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLYAQRANGVQGKQDLTLVFVETKKGAD  434

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIP VAHV+N
Sbjct  435  SLEHWLCINNFPATSIHGDRSQQEREQALRSFKSGNTPILVATDVAARGLDIPRVAHVVN  494

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  495  FDLPNDIDDYVHRIG  509



>ref|XP_002531166.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF31209.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=585

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV + DKRS+L+D+LHA++  EI+ K +LTLVFVETK+ AD
Sbjct  342  FLAVGRVGSSTDLIVQRVEFVHETDKRSHLMDLLHAQRETEINIKHSLTLVFVETKKGAD  401

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  402  SLENWLCVNGFPATTIHGDRTQQEREMALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  461

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  462  FDLPNDIDDYVHRIG  476



>ref|XP_010036520.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Eucalyptus 
grandis]
 gb|KCW48132.1| hypothetical protein EUGRSUZ_K01867 [Eucalyptus grandis]
Length=622

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            +L VGRVGSSTDLIVQRVE V+++DKRS+L+D+LHA++ N  HGK+ALTLVFVETKR AD
Sbjct  378  YLTVGRVGSSTDLIVQRVELVRESDKRSHLMDLLHAQRENGFHGKQALTLVFVETKRGAD  437

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL +N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  438  SLENWLYTNGFPATSIHGDRSQQERELALRSFKSGRTPILVATDVAARGLDIPHVAHVIN  497

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  498  FDLPNDIDDYVHRIG  512



>ref|XP_010549900.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Tarenaya hassleriana]
 ref|XP_010549983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Tarenaya hassleriana]
Length=609

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV ++DKRS+L+D+LHA++ N I  K+ALTLVFVETK+ AD
Sbjct  365  FLAVGRVGSSTDLIAQRVEFVHESDKRSHLMDLLHAQRENGIQDKQALTLVFVETKKGAD  424

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  425  SLEHWLCMNGFPATSIHGDRSQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  484

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  485  FDLPNDIDDYVHRIG  499



>emb|CDX71944.1| BnaC08g29300D [Brassica napus]
Length=634

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N    K+ALTLVFVETK+ AD
Sbjct  348  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRDNGNQRKQALTLVFVETKKGAD  407

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  408  SLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  467

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  468  FDLPNDIDDYVHRIG  482



>ref|XP_010504808.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11 [Camelina sativa]
Length=609

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  E   K+ALTLVFVETKR AD
Sbjct  364  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLHAQR--ETQDKQALTLVFVETKRGAD  421

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  422  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  481

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  482  FDLPNDIDDYVHRIG  496



>ref|XP_010431460.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Camelina 
sativa]
Length=601

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  E   K+ALTLVFVETKR AD
Sbjct  367  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLHAQR--ETQDKQALTLVFVETKRGAD  424

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  425  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  484

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  485  FDLPNDIDDYVHRIG  499



>gb|EPS58220.1| hypothetical protein M569_16595, partial [Genlisea aurea]
Length=545

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V ++DKRS+L+D+LHA++ N+I G ++LTLVFVETK+ AD
Sbjct  342  FLAVGRVGSSTDLIVQRVEYVLESDKRSHLMDLLHAQRENDIVGNQSLTLVFVETKKGAD  401

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N FPAT IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHV+HVIN
Sbjct  402  SLENWLYHNGFPATTIHGDRTQQEREIALRSFKTGKTPILVATDVAARGLDIPHVSHVIN  461

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  462  FDLPNDIDDYVHRIG  476



>gb|EMT03384.1| DEAD-box ATP-dependent RNA helicase 37 [Aegilops tauschii]
Length=1065

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV + DKRSYL+D++HA+KAN++ GK +LTLVFVETKR AD
Sbjct  819  FLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLIHAQKANDVPGKNSLTLVFVETKRGAD  878

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL +N FPAT+IHGDRTQQERE+ALR+FK+G TPILVATDVA+RGLDIP VAHVIN
Sbjct  879  ALENWLYTNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIPDVAHVIN  938

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  939  FDLPNDIDDYVHRIG  953



>ref|XP_002308349.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE91872.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=550

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V + DKRS+L+D+LHA++  E++GK +LTLVFVETK+ AD
Sbjct  307  FLAVGRVGSSTDLIVQRVEYVHETDKRSHLMDLLHAQRETEVNGKHSLTLVFVETKKGAD  366

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N+FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  367  SLEHWLYVNKFPATSIHGDRSQQEREMALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  426

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  427  FDLPNDIDDYVHRIG  441



>emb|CDY49232.1| BnaA09g55110D [Brassica napus]
Length=625

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  346  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  405

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  406  SLENWLRINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  465

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  466  FDLPNDIDDYVHRIG  480



>ref|XP_009116534.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52-like [Brassica 
rapa]
 ref|XP_009116535.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52-like [Brassica 
rapa]
Length=642

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   GK+ALTLVFVETK+ AD
Sbjct  348  FLAVGRVGSSTDLIVQRVEFVHDSDKRSHLMDLLHAQRENGNQGKQALTLVFVETKKGAD  407

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N FPAT IHGDR+QQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  408  SLENWLRINGFPATTIHGDRSQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  467

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  468  FDLPNDIDDYVHRIG  482



>ref|NP_567067.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
 ref|NP_974455.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
 ref|NP_001030884.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
 sp|Q8LA13.1|RH11_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis 
thaliana]
 gb|AAM65637.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AEE79791.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
 gb|AEE79792.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
 gb|AEE79793.1| DEAD-box ATP-dependent RNA helicase 11 [Arabidopsis thaliana]
Length=612

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  365  FLAVGRVGSSTDLITQRVEFVQESDKRSHLMDLLHAQR--ETQDKQSLTLVFVETKRGAD  422

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  423  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  482

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  483  FDLPNDIDDYVHRIG  497



>ref|XP_010554902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Tarenaya 
hassleriana]
Length=611

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQRVEFV ++DKRS+L+D+LHA++ + I  K+ALTLVFVETK+ AD
Sbjct  364  FLAVGRVGSSTELIVQRVEFVHESDKRSHLMDLLHAQRESGIQDKQALTLVFVETKKGAD  423

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  424  SLEHWLCMNGFPATSIHGDRSQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  483

Query  45   FDLPNDIDDYVHRIG  1
            FDLPND+DDYVHRIG
Sbjct  484  FDLPNDVDDYVHRIG  498



>ref|XP_006292641.1| hypothetical protein CARUB_v10018884mg [Capsella rubella]
 gb|EOA25539.1| hypothetical protein CARUB_v10018884mg [Capsella rubella]
Length=609

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  362  FLAVGRVGSSTDLIAQRVEFVQESDKRSHLMDLLHAQR--ETQDKQSLTLVFVETKRGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  420  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>ref|XP_011047092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
 ref|XP_011047093.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
Length=618

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++  E++GK +LTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEYVQEIDKRSHLMDLLHAQRETEVNGKHSLTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N FPAT+IHGDR+QQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHWLYVNNFPATSIHGDRSQQEREMALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_009400848.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
Length=632

 Score =   226 bits (576),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQRVEFV + DKRSYL+D+LHA+K N  +GK+ALTLVFVETK+ AD
Sbjct  386  FLAVGRVGSSTELIVQRVEFVLEPDKRSYLMDLLHAQKVNGAYGKQALTLVFVETKKGAD  445

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  + FPAT IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  446  SLEHWLSMHGFPATTIHGDRTQQERERALRSFKSGVTPILVATDVAARGLDIPHVSHVIN  505

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  506  FDLPNDIDDYVHRIG  520



>ref|XP_002876466.1| hypothetical protein ARALYDRAFT_486301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52725.1| hypothetical protein ARALYDRAFT_486301 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QR+EFV+++DKRS+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  363  FLAVGRVGSSTDLITQRIEFVQESDKRSHLMDLLHAQR--ETQDKQSLTLVFVETKRGAD  420

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  421  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  480

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  481  FDLPNDIDDYVHRIG  495



>ref|XP_001778715.1| predicted protein [Physcomitrella patens]
 gb|EDQ56508.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   224 bits (572),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV+D DKRS L+D++HA+ A    G++ LTLVFVETK+ AD
Sbjct  344  FLAVGRVGSSTDLIVQRVEFVQDADKRSMLMDLIHAQSALAPPGQQTLTLVFVETKKGAD  403

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC   FPAT IHGDR+QQEREHALR+F+TG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  404  SLEDWLCRMGFPATTIHGDRSQQEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVVN  463

Query  45   FDLPNDIDDYVHRIG  1
            FDLP+DIDDYVHRIG
Sbjct  464  FDLPSDIDDYVHRIG  478



>gb|KEH41770.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=608

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++ N+++GK+ LTLVFVETK+ AD
Sbjct  367  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRENDVNGKQGLTLVFVETKKGAD  426

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPAT IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  427  ALEHCLCVNGFPATCIHGDRTQQEREQALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  486

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  487  FDLPNDIDDYVHRIG  501



>ref|XP_006837823.1| hypothetical protein AMTR_s00104p00136740 [Amborella trichopoda]
 gb|ERN00392.1| hypothetical protein AMTR_s00104p00136740 [Amborella trichopoda]
Length=637

 Score =   226 bits (575),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV++ DKRS+L+D+LHA+ +N   GK+ALTLVFVETKR AD
Sbjct  386  FLAVGRVGSSTDLIVQRVEFVQEMDKRSHLMDLLHAQVSNGAQGKQALTLVFVETKRGAD  445

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC+    ATAIHGDR+Q ERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  446  SLEHWLCTKGLSATAIHGDRSQYEREQALRSFKSGATPILVATDVAARGLDIPHVAHVVN  505

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  506  FDLPKDIDDYVHRIG  520



>ref|XP_004514158.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Cicer 
arietinum]
Length=612

 Score =   225 bits (573),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V D+DKRS+L+D+LHA++   ++GK+ LTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIAQRVEYVLDSDKRSHLMDLLHAQRETGVNGKQGLTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPAT IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  430  ALEHCLCVNGFPATCIHGDRTQQEREQALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>ref|XP_009142072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Brassica rapa]
Length=609

 Score =   225 bits (573),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVEFV D+DKRS+L+D+LHA++ N   G ++LTLVFVETKR AD
Sbjct  365  FLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQREN---GMQSLTLVFVETKRGAD  421

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR+QQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  422  SLENWLCINGFPATSIHGDRSQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  481

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  482  FDLPNDIDDYVHRIG  496



>ref|XP_007204596.1| hypothetical protein PRUPE_ppa003020mg [Prunus persica]
 gb|EMJ05795.1| hypothetical protein PRUPE_ppa003020mg [Prunus persica]
Length=611

 Score =   225 bits (573),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI Q++EFV+D DKRS+L+D LH+++AN  HGK ALTLVFVETKR AD
Sbjct  352  FLAVGRVGSSTDLIAQKIEFVEDMDKRSHLMDHLHSQQANGSHGKPALTLVFVETKRGAD  411

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPA AIHGD+ Q ERE ALR+FK G  PILVATDVASRGLDIPHVAHVIN
Sbjct  412  ALENWLCMNGFPAIAIHGDKVQMERERALRSFKCGSAPILVATDVASRGLDIPHVAHVIN  471

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  472  FDLPKGIDDYVHRIG  486



>emb|CDY06034.1| BnaA09g37460D [Brassica napus]
Length=575

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV ++DK+S+L+D+LHA++    H K++LTLVFVETKR AD
Sbjct  348  FLAVGRVGSSTDLIAQRVEFVHESDKKSHLMDLLHAQRDTGNHDKQSLTLVFVETKRGAD  407

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  408  SLENWLCMNDFPATTIHGDRTQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  467

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  468  FDLPNDIDDYVHRIG  482



>emb|CDX71948.1| BnaC08g29260D [Brassica napus]
Length=597

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV ++DK+S+L+D+LHA++    H K++LTLVFVETKR AD
Sbjct  348  FLAVGRVGSSTDLIAQRVEFVHESDKKSHLMDLLHAQRETGNHDKQSLTLVFVETKRGAD  407

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  408  SLENWLCMNDFPATTIHGDRTQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  467

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  468  FDLPNDIDDYVHRIG  482



>ref|XP_008242755.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Prunus 
mume]
Length=613

 Score =   224 bits (571),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI Q++EFV+D DKRS+L+D LH+++AN  HGK ALTLVFVETKR AD
Sbjct  354  FLAVGRVGSSTDLIAQKIEFVEDMDKRSHLMDHLHSQQANGSHGKPALTLVFVETKRGAD  413

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPA AIHGD+ Q ERE ALR+FK G  PILVATDVASRGLDIPHVAHVIN
Sbjct  414  ALENWLCMNGFPAIAIHGDKVQMERERALRSFKCGSAPILVATDVASRGLDIPHVAHVIN  473

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  474  FDLPKGIDDYVHRIG  488



>ref|XP_004980690.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Setaria 
italica]
Length=565

 Score =   223 bits (569),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQR+EFV++ DKRS+L+D+LHA++     GK+ LTLVFVETKR AD
Sbjct  316  FLAVGRVGSSTELIVQRIEFVQEADKRSHLMDLLHAQRDT---GKQNLTLVFVETKRGAD  372

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  373  SLESWLCMNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  432

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  433  FDLPNDIDDYVHRIG  447



>ref|XP_006402779.1| hypothetical protein EUTSA_v10005841mg [Eutrema salsugineum]
 gb|ESQ44232.1| hypothetical protein EUTSA_v10005841mg [Eutrema salsugineum]
Length=611

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV ++DK+S+L+D+LHA++ N    K++LTLVFVETKR AD
Sbjct  357  FLAVGRVGSSTDLIAQRVEFVHESDKKSHLMDLLHAQRENGAQDKQSLTLVFVETKRGAD  416

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N FPAT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  417  TLENWLCMNDFPATSIHGDRTQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVN  476

Query  45   FDLPNDIDDYVHRIG  1
            FDLPN+IDDYVHRIG
Sbjct  477  FDLPNEIDDYVHRIG  491



>ref|XP_009116530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Brassica 
rapa]
Length=611

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV ++DK+S+L+D+LHA++    H K++LTLVFVETKR AD
Sbjct  360  FLAVGRVGSSTDLIAQRVEFVHESDKKSHLMDLLHAQRDTGNHDKQSLTLVFVETKRGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT IHGDRTQQERE AL++FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  420  SLENWLCMNDFPATTIHGDRTQQEREVALKSFKSGRTPILVATDVAARGLDIPHVAHVVN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>gb|KHN43994.1| DEAD-box ATP-dependent RNA helicase 37 [Glycine soja]
Length=415

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++   ++GK+ LTLVFVETK+ AD
Sbjct  174  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRETGVNGKQGLTLVFVETKKGAD  233

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPA +IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  234  ALEHCLCVNGFPAASIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  293

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  294  FDLPNDIDDYVHRIG  308



>ref|XP_002449794.1| hypothetical protein SORBIDRAFT_05g023460 [Sorghum bicolor]
 gb|EES08782.1| hypothetical protein SORBIDRAFT_05g023460 [Sorghum bicolor]
Length=437

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV++ DKRS+L+D+LHA++     GK  LTLVFVETKR AD
Sbjct  185  FLAVGRVGSSTDLIAQRVEFVQEADKRSHLMDLLHAQRDT---GKPTLTLVFVETKRGAD  241

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIP VAHV+N
Sbjct  242  SLESWLCMNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPLVAHVVN  301

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  302  FDLPNDIDDYVHRIG  316



>emb|CDX98301.1| BnaC06g16620D [Brassica napus]
Length=601

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V + DK+S+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  350  FLAVGRVGSSTDLIAQRVEYVHEADKKSHLMDLLHAQR--ETQDKQSLTLVFVETKRSAD  407

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  408  ALENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  467

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  468  FDLPNDIDDYVHRIG  482



>gb|KHN30513.1| DEAD-box ATP-dependent RNA helicase 37 [Glycine soja]
Length=415

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++   ++GK+ LTLVFVETK+ AD
Sbjct  174  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRETGVNGKQGLTLVFVETKKGAD  233

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPA +IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  234  ALEHCLCVNGFPAASIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  293

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  294  FDLPNDIDDYVHRIG  308



>emb|CDX67749.1| BnaA07g17890D [Brassica napus]
Length=602

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V + DK+S+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  346  FLAVGRVGSSTDLIAQRVEYVHEADKKSHLMDLLHAQR--ETQDKQSLTLVFVETKRSAD  403

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  404  ALENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  463

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  464  FDLPNDIDDYVHRIG  478



>ref|XP_001761340.1| predicted protein [Physcomitrella patens]
 gb|EDQ73729.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   223 bits (567),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQRVE+V+D+DKRS L+D++HA+ A    G+++LTLVFVETK+ AD
Sbjct  355  FLAVGRVGSSTELIVQRVEYVQDSDKRSMLMDLIHAQSALAPPGQQSLTLVFVETKKGAD  414

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC   FPAT IHGDR+QQEREHALR+F+TG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  415  SLEDWLCRMGFPATTIHGDRSQQEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVVN  474

Query  45   FDLPNDIDDYVHRIG  1
            FDLP+DIDDYVHRIG
Sbjct  475  FDLPSDIDDYVHRIG  489



>ref|XP_009104148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11 [Brassica rapa]
Length=610

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V + DK+S+L+D+LHA++  E   K++LTLVFVETKR AD
Sbjct  354  FLAVGRVGSSTDLIAQRVEYVHEADKKSHLMDLLHAQR--ETQDKQSLTLVFVETKRSAD  411

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  412  ALENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  471

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  472  FDLPNDIDDYVHRIG  486



>gb|AFW60456.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=608

 Score =   223 bits (568),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV++ DKRS+L+D+LHA++     GK+ LTLVFVETKR AD
Sbjct  363  FLAVGRVGSSTDLIAQRVEFVQEADKRSHLMDLLHAQRDT---GKQTLTLVFVETKRGAD  419

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WLC N FPAT+IHGDR QQERE+ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  420  SLESWLCMNGFPATSIHGDRNQQEREYALRSFKSGQTPILVATDVAARGLDIPHVAHVVN  479

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  480  FDLPNDIDDYVHRIG  494



>ref|XP_010250055.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Nelumbo nucifera]
Length=621

 Score =   222 bits (566),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV++ DKRSYLLD+LHA+  +  HGK+ LTLVFVETK+ AD
Sbjct  343  FLAVGRVGSSTDLISQRVEFVQEKDKRSYLLDLLHAQSVSGTHGKQTLTLVFVETKKGAD  402

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL +N F ATAIHGD+ Q ERE ALR+FK+G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  403  SLEHWLSTNGFLATAIHGDKVQVEREKALRSFKSGHTPILVATDVAARGLDIPHVSHVIN  462

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  463  FDLPKDIDDYVHRIG  477



>ref|XP_001773533.1| predicted protein [Physcomitrella patens]
 gb|EDQ61733.1| predicted protein [Physcomitrella patens]
Length=600

 Score =   221 bits (564),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V+D DKRS L+D++HA+ A    G++ LTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTDLIVQRVEYVQDVDKRSMLMDLIHAQSALAPPGQQTLTLVFVETKKGAD  418

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC   FPAT IHGDR+QQEREHALR+F+TG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  419  ALEDWLCRLGFPATTIHGDRSQQEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVVN  478

Query  45   FDLPNDIDDYVHRIG  1
            FDLP+DIDDYVHRIG
Sbjct  479  FDLPSDIDDYVHRIG  493



>ref|XP_007145713.1| hypothetical protein PHAVU_007G262000g [Phaseolus vulgaris]
 gb|ESW17707.1| hypothetical protein PHAVU_007G262000g [Phaseolus vulgaris]
Length=609

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++ N I GK+ LTLVFVETK+ AD
Sbjct  365  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRENGICGKQGLTLVFVETKKGAD  424

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPA +IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  425  ALEHCLCVNGFPAASIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  484

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  485  FDLPNDIDDYVHRIG  499



>ref|XP_002323346.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF05107.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=611

 Score =   220 bits (561),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++  E++ K +LTLVFVETK+ AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEYVQEIDKRSHLMDLLHAQRETEVNSKHSLTLVFVETKKGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE  L  N FPAT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  429  SLEHLLHVNGFPATSIHGDRTQQEREMALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  488

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  489  FDLPNDIDDYVHRIG  503



>ref|XP_006575174.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Glycine max]
 ref|XP_006575175.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Glycine max]
 ref|XP_006575176.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X3 [Glycine max]
 ref|XP_006575177.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X4 [Glycine max]
Length=611

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++   ++GK+ LTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRETGVNGKQGLTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPA +IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  430  ALEHCLCVNGFPAASIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>ref|XP_003533906.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X1 [Glycine max]
 ref|XP_006587190.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X2 [Glycine max]
Length=611

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVE+V ++DKRS+L+D+LHA++   ++GK+ LTLVFVETK+ AD
Sbjct  370  FLAVGRVGSSTDLIAQRVEYVLESDKRSHLMDLLHAQRETGVNGKQGLTLVFVETKKGAD  429

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE  LC N FPA +IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIP VAHV+N
Sbjct  430  ALEHCLCVNGFPAASIHGDRTQQERELALRSFKTGNTPILVATDVAARGLDIPRVAHVVN  489

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  490  FDLPNDIDDYVHRIG  504



>ref|XP_009400121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGR+GSSTDLI QRVE+V D DKR  L+D+LHA++ N IH K+ LTLVFVETKR AD
Sbjct  178  FLTVGRIGSSTDLISQRVEYVPDVDKRGRLVDLLHAQRENGIHSKQLLTLVFVETKRAAD  237

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLERWL    FPAT+IHGD+TQ ERE ALR+FK+G TP++VATDVASRGLD+PHVA VIN
Sbjct  238  SLERWLSKTGFPATSIHGDKTQPERERALRSFKSGATPVMVATDVASRGLDVPHVALVIN  297

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  298  FDLPKDIDDYVHRIG  312



>ref|XP_009413314.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=594

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  VQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRADSLERWLCSNQFPAT  184
            +QRVEFV ++DKRSYL+D+LH ++   +HGK+ALTLVFVETKR ADSLE WLC N FPAT
Sbjct  367  IQRVEFVPESDKRSYLMDLLHGQRDTGVHGKQALTLVFVETKRGADSLEHWLCMNGFPAT  426

Query  183  AIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVINFDLPNDIDDYVHRI  4
             IHGDRTQQEREHALR+FK+G TPILVATDVA+RGLDIPHVAHVINFDLPNDIDDYVHRI
Sbjct  427  TIHGDRTQQEREHALRSFKSGATPILVATDVAARGLDIPHVAHVINFDLPNDIDDYVHRI  486

Query  3    G  1
            G
Sbjct  487  G  487



>ref|XP_001774212.1| predicted protein [Physcomitrella patens]
 gb|EDQ60988.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 3/138 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQRVE+V+D DKRS L+D++HA+ A    G+ +LTLVFVETK+ AD
Sbjct  350  FLAVGRVGSSTELIVQRVEYVQDADKRSMLMDLIHAQSALAPPGQTSLTLVFVETKKGAD  409

Query  225  SLERWLCSNQFPATAIHGDR---TQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAH  55
            +LE WLC   FPAT IHGDR     QEREHALR+F+TG TPILVATDVA+RGLDIPHVAH
Sbjct  410  ALEDWLCRMGFPATTIHGDRKVFPTQEREHALRSFRTGVTPILVATDVAARGLDIPHVAH  469

Query  54   VINFDLPNDIDDYVHRIG  1
            V+NFDLPNDIDDYVHRIG
Sbjct  470  VVNFDLPNDIDDYVHRIG  487



>ref|XP_011039505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Populus 
euphratica]
Length=616

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V++ DKRS+L+D+LHA++  E++ K +LTLVFVETK+ AD
Sbjct  374  FLAVGRVGSSTDLIVQRVEYVQEIDKRSHLMDLLHAQRETEVNSKHSLTLVFVETKKGAD  433

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE  L  N F AT+IHGDRTQQERE ALR+FK+G TPILVATDVA+RGLDIPHVAHV+N
Sbjct  434  SLEHLLHVNGFHATSIHGDRTQQEREMALRSFKSGKTPILVATDVAARGLDIPHVAHVVN  493

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  494  FDLPNDIDDYVHRIG  508



>ref|XP_002973432.1| hypothetical protein SELMODRAFT_52088, partial [Selaginella moellendorffii]
 gb|EFJ25806.1| hypothetical protein SELMODRAFT_52088, partial [Selaginella moellendorffii]
Length=506

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V D DKRS L+D++HA+K N ++G+  L LVFVETKR AD
Sbjct  268  FLAVGRVGSSTDLIVQRVEYVHDVDKRSMLMDMIHAQKPNGLNGQLPLILVFVETKRGAD  327

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL      AT IHGDRTQ EREHALR+F+TG TPILVATDVA+RGLDIPHVAHVIN
Sbjct  328  SLEDWLIQMGISATTIHGDRTQVEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVIN  387

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  388  YDLPSDIDDYVHRIG  402



>ref|XP_010093725.1| DEAD-box ATP-dependent RNA helicase 52B [Morus notabilis]
 gb|EXB54531.1| DEAD-box ATP-dependent RNA helicase 52B [Morus notabilis]
Length=634

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI Q+V++V+D DKR YL+ +LH +K N   GK ALTLVFVETK+RAD
Sbjct  362  FLAVGRVGSSTDLIAQKVDYVEDMDKRHYLMHILHDQKVNGTCGKHALTLVFVETKKRAD  421

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  N FPA AIHGD+ Q ERE AL++FK+G TPI+VATDVASRGLDIP+VAHVIN
Sbjct  422  ALEYWLSVNGFPAIAIHGDKVQMERERALKSFKSGATPIMVATDVASRGLDIPNVAHVIN  481

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  482  FDLPRDIDDYVHRIG  496



>ref|XP_008354506.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Malus 
domestica]
Length=471

 Score =   208 bits (529),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST LI QRVE V+D DKR++L+ +L +++AN  HGK ALTLVFVETKR AD
Sbjct  210  FLSVGRVGSSTGLITQRVELVEDMDKRNHLMKLL-SQQANGAHGKVALTLVFVETKRSAD  268

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N+FPA AIHGD+ Q ERE ALR FK G TPILVATDVASRGLDIPHV+HVIN
Sbjct  269  SLENWLRMNRFPAIAIHGDKVQMEREQALRLFKCGKTPILVATDVASRGLDIPHVSHVIN  328

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  329  FDLPKSIDDYVHRIG  343



>gb|KHG00046.1| DEAD-box ATP-dependent RNA helicase 52B [Gossypium arboreum]
Length=624

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEI-HGKKALTLVFVETKRRA  229
            FLAVGRVGSSTDLIVQRVE V++ DKRS+LLD+L ++++N   H K ALTLVFVETKR A
Sbjct  346  FLAVGRVGSSTDLIVQRVELVQEMDKRSHLLDLLRSQRSNATPHSKHALTLVFVETKRGA  405

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            + LERWL  N FPA A+HGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVI
Sbjct  406  NELERWLSRNGFPAIAMHGDKVQMEREQALRSFKSGATPILVATDVASRGLDIPHVAHVI  465

Query  48   NFDLPNDIDDYVHRIG  1
            NFD+P +IDDYVHRIG
Sbjct  466  NFDMPKNIDDYVHRIG  481



>ref|XP_009138956.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like [Brassica 
rapa]
Length=442

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTD I  +VE+V D+DKRS+L+ +LHA++ N    +++LTLVFVETKR AD
Sbjct  265  FLAVGRVGSSTDSITLKVEYVHDSDKRSHLMALLHAQRENGT--EQSLTLVFVETKRGAD  322

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE AL++FK+G TPI+VATDVA+RGLDIPHVAHV+N
Sbjct  323  TLENWLCMNEFPATSIHGDRTQQEREEALKSFKSGRTPIMVATDVAARGLDIPHVAHVVN  382

Query  45   FDLPNDIDDYVHRI  4
            FDLPNDID++VHRI
Sbjct  383  FDLPNDIDEFVHRI  396



>ref|XP_002976475.1| hypothetical protein SELMODRAFT_105510 [Selaginella moellendorffii]
 gb|EFJ22144.1| hypothetical protein SELMODRAFT_105510 [Selaginella moellendorffii]
Length=613

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE+V D DKRS L+D++HA+K N ++G+  L LVFVETKR AD
Sbjct  369  FLAVGRVGSSTDLIVQRVEYVHDVDKRSMLMDMIHAQKPNGLNGQLPLILVFVETKRGAD  428

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL      AT IHGDRTQ EREHALR+F+TG TPILVATDVA+RGLDIPHVAHVIN
Sbjct  429  SLEDWLIQMGISATTIHGDRTQVEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVIN  488

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  489  YDLPSDIDDYVHRIG  503



>emb|CDX88990.1| BnaA04g01960D [Brassica napus]
Length=558

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTD I  +VE+V D+DKRS+L+ +LHA++ N    +++LTLVFVETKR AD
Sbjct  157  FLAVGRVGSSTDSITLKVEYVHDSDKRSHLMALLHAQRENGT--EQSLTLVFVETKRGAD  214

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE AL++FK+G TPI+VATDVA+RGLDIPHVAHV+N
Sbjct  215  TLENWLCMNEFPATSIHGDRTQQEREEALKSFKSGRTPIMVATDVAARGLDIPHVAHVVN  274

Query  45   FDLPNDIDDYVHRI  4
            FDLPNDID++VHRI
Sbjct  275  FDLPNDIDEFVHRI  288



>ref|XP_002285108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Vitis 
vinifera]
Length=615

 Score =   209 bits (532),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 98/135 (73%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSSTDLIVQRVEFV+D DKR +L+D+L ++  N    K ALTLVFVETKR  D
Sbjct  345  FLSVGRVGSSTDLIVQRVEFVEDTDKRYHLMDLLQSQMTNRTPKKYALTLVFVETKRGVD  404

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE+WLC N   ATAIHGD+ Q ERE AL++FK+G TPI+VATDVA+RGLDIPHVAHVIN
Sbjct  405  ALEQWLCMNGLAATAIHGDKVQMERERALKSFKSGATPIMVATDVAARGLDIPHVAHVIN  464

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  465  FDLPKAIDDYVHRIG  479



>ref|XP_010250056.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like isoform 
X2 [Nelumbo nucifera]
Length=614

 Score =   209 bits (532),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 102/135 (76%), Positives = 114/135 (84%), Gaps = 7/135 (5%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV++ DKRSYLLD+LHA+        + LTLVFVETK+ AD
Sbjct  343  FLAVGRVGSSTDLISQRVEFVQEKDKRSYLLDLLHAQS-------QTLTLVFVETKKGAD  395

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL +N F ATAIHGD+ Q ERE ALR+FK+G TPILVATDVA+RGLDIPHV+HVIN
Sbjct  396  SLEHWLSTNGFLATAIHGDKVQVEREKALRSFKSGHTPILVATDVAARGLDIPHVSHVIN  455

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  456  FDLPKDIDDYVHRIG  470



>ref|XP_007013410.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY31029.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=628

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE V+D DKR++LL++LHA+K N    K  LTLVFVETKR AD
Sbjct  338  FLAVGRVGSSTDLIVQRVEIVQDMDKRNHLLNLLHAQKYNGSRSKHPLTLVFVETKRGAD  397

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  N FPA AIHG + Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  398  ELEHWLSRNGFPAIAIHGGKVQMERELALRSFKSGATPILVATDVASRGLDIPHVAHVIN  457

Query  45   FDLPNDIDDYVHRIG  1
            FDLP +IDDYVHRIG
Sbjct  458  FDLPKNIDDYVHRIG  472



>emb|CBI28180.3| unnamed protein product [Vitis vinifera]
Length=916

 Score =   210 bits (535),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 98/135 (73%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSSTDLIVQRVEFV+D DKR +L+D+L ++  N    K ALTLVFVETKR  D
Sbjct  633  FLSVGRVGSSTDLIVQRVEFVEDTDKRYHLMDLLQSQMTNRTPKKYALTLVFVETKRGVD  692

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE+WLC N   ATAIHGD+ Q ERE AL++FK+G TPI+VATDVA+RGLDIPHVAHVIN
Sbjct  693  ALEQWLCMNGLAATAIHGDKVQMERERALKSFKSGATPIMVATDVAARGLDIPHVAHVIN  752

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  753  FDLPKAIDDYVHRIG  767



>ref|XP_002976623.1| hypothetical protein SELMODRAFT_151274 [Selaginella moellendorffii]
 gb|EFJ22292.1| hypothetical protein SELMODRAFT_151274 [Selaginella moellendorffii]
Length=595

 Score =   207 bits (526),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE V++ +KRS L+D++H +KA   +G+  L LVFVETKR AD
Sbjct  361  FLAVGRVGSSTDLIVQRVERVQEAEKRSLLMDIIHGQKAIGANGQPPLMLVFVETKRGAD  420

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  + FPAT IHGDRTQ ERE ALR F+TG TPILVATDVA+RGLDIPHVAHVIN
Sbjct  421  ALEDWLIRSGFPATTIHGDRTQPEREQALRCFRTGMTPILVATDVAARGLDIPHVAHVIN  480

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  481  YDLPSDIDDYVHRIG  495



>ref|XP_009767732.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B-like [Nicotiana 
sylvestris]
Length=553

 Score =   206 bits (524),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLA G+VGSSTDLIVQ+VEFV D DK+ +LL++LHA+ +N+I  K ALTL+FVETKR AD
Sbjct  279  FLAAGKVGSSTDLIVQKVEFVPDTDKKDHLLNLLHAQHSNQIVAKLALTLIFVETKRGAD  338

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LERWL  +  P+ AIHGD+ Q ERE AL++FK+G TP+LVATDVA+RGLD+P+VAHVIN
Sbjct  339  TLERWLVRSGIPSIAIHGDKMQFERERALKSFKSGQTPVLVATDVAARGLDVPNVAHVIN  398

Query  45   FDLPNDIDDYVHRIG  1
            FDLP +IDDYVHRIG
Sbjct  399  FDLPRNIDDYVHRIG  413



>ref|XP_002973232.1| hypothetical protein SELMODRAFT_267628 [Selaginella moellendorffii]
 gb|EFJ25606.1| hypothetical protein SELMODRAFT_267628 [Selaginella moellendorffii]
Length=597

 Score =   207 bits (526),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLIVQRVE V++ +KRS L+D++H +KA   +G+  L LVFVETKR AD
Sbjct  363  FLAVGRVGSSTDLIVQRVERVQEAEKRSLLMDIIHGQKAIGANGQPPLMLVFVETKRGAD  422

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  + FPAT IHGDRTQ ERE ALR F+TG TPILVATDVA+RGLDIPHVAHVIN
Sbjct  423  ALEDWLIRSGFPATTIHGDRTQPEREQALRCFRTGMTPILVATDVAARGLDIPHVAHVIN  482

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  483  YDLPSDIDDYVHRIG  497



>ref|XP_008362909.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Malus 
domestica]
Length=624

 Score =   207 bits (527),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST LI QRVE V+D DKR++L+ +L +++AN  HGK ALTLVFVETKR AD
Sbjct  363  FLSVGRVGSSTGLIXQRVELVEDMDKRNHLMKLL-SQQANGAHGKVALTLVFVETKRSAD  421

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE WL  N+FPA AIHGD+ Q ERE ALR FK G TPILVATDVASRGLDIPHV+HVIN
Sbjct  422  SLENWLRMNRFPAIAIHGDKVQMEREQALRLFKCGKTPILVATDVASRGLDIPHVSHVIN  481

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  482  FDLPKSIDDYVHRIG  496



>ref|XP_009599417.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B-like [Nicotiana 
tomentosiformis]
Length=551

 Score =   205 bits (522),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 93/135 (69%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLA G+VGSSTDLIVQ+VEFV D DK+ +LL++LHA+ +N++  K ALTL+FVETKR AD
Sbjct  277  FLAAGKVGSSTDLIVQKVEFVPDTDKKDHLLNLLHAQHSNQMDAKLALTLIFVETKRGAD  336

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LERWL  +  P+ AIHGD+ Q ERE AL++FK+G TP+LVATDVA+RGLD+P+VAHVIN
Sbjct  337  TLERWLVRSGIPSIAIHGDKMQFERERALKSFKSGQTPVLVATDVAARGLDVPNVAHVIN  396

Query  45   FDLPNDIDDYVHRIG  1
            FDLP +IDDYVHRIG
Sbjct  397  FDLPRNIDDYVHRIG  411



>gb|EYU29788.1| hypothetical protein MIMGU_mgv1a003663mg [Erythranthe guttata]
Length=571

 Score =   205 bits (522),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 97/136 (71%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKK-ALTLVFVETKRRA  229
            FLA G+VGSSTDLIVQ+VEFV D DKR YL+++L +++ N    +  ALTLVFVETKR A
Sbjct  319  FLAAGKVGSSTDLIVQKVEFVADMDKRDYLVNLLRSQRTNNTTPQNNALTLVFVETKRGA  378

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            DSLERWLCS  FP+TAIHGD+ Q ERE AL+ F++G TPILVATDVA+RGLDIPHVAHVI
Sbjct  379  DSLERWLCSKGFPSTAIHGDKIQMERERALKLFRSGRTPILVATDVAARGLDIPHVAHVI  438

Query  48   NFDLPNDIDDYVHRIG  1
            N+DLP  +DDYVHRIG
Sbjct  439  NYDLPRAVDDYVHRIG  454



>ref|XP_010688023.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Beta 
vulgaris subsp. vulgaris]
Length=634

 Score =   205 bits (522),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VG+VGSSTDLI Q+VEFV D +KR +L D+L ++K N  +GK+ALT+VFVETKR  D
Sbjct  368  FLTVGKVGSSTDLIEQKVEFVADYNKRQHLKDLLMSQKMNGTNGKQALTIVFVETKRGVD  427

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL SN FPATAIHGD+ Q ERE AL++FK+G TPI+VATDVA+RGLDIP VAHVIN
Sbjct  428  DLEYWLSSNGFPATAIHGDKVQWERERALKSFKSGATPIIVATDVAARGLDIPCVAHVIN  487

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  488  FDLPRDIDDYVHRIG  502



>emb|CAB68189.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=603

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 115/135 (85%), Gaps = 11/135 (8%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSSTDLI QRVEFV+++DKRS+L+D+LHA++  +            +TKR AD
Sbjct  365  FLAVGRVGSSTDLITQRVEFVQESDKRSHLMDLLHAQRETQD-----------KTKRGAD  413

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC N+FPAT+IHGDRTQQERE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+N
Sbjct  414  TLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVATDVAARGLDIPHVAHVVN  473

Query  45   FDLPNDIDDYVHRIG  1
            FDLPNDIDDYVHRIG
Sbjct  474  FDLPNDIDDYVHRIG  488



>emb|CAN63495.1| hypothetical protein VITISV_011670 [Vitis vinifera]
Length=757

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSSTDLIVQRVEFV+D DKR +L+D+L ++  N    K ALTLVFVETKR  D
Sbjct  487  FLSVGRVGSSTDLIVQRVEFVEDTDKRYHLMDLLQSQMTNRTPKKYALTLVFVETKRGVD  546

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE+WLC N   ATAIHGD+ Q ERE A+++FK+G TPI+VATDVA+RGLDIPHVAHVIN
Sbjct  547  ALEQWLCMNGLAATAIHGDKVQMERERAMKSFKSGATPIMVATDVAARGLDIPHVAHVIN  606

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  IDDYVHRIG
Sbjct  607  FDLPKAIDDYVHRIG  621



>ref|XP_004508511.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52-like [Cicer 
arietinum]
Length=659

 Score =   202 bits (515),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 97/135 (72%), Positives = 115/135 (85%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQ++E V+D +KR+ L+D+L   + N ++GK ALTLVFVETK+ AD
Sbjct  349  FLAVGRVGSSTELIVQKIESVQDMEKRNRLVDLL---RHNVVNGKLALTLVFVETKKGAD  405

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC + FPA AIHGD+ Q ERE ALR+FK G TPI+VATDVASRGLDIPHVAHVIN
Sbjct  406  ALENWLCRSGFPAIAIHGDKVQMERERALRSFKRGYTPIMVATDVASRGLDIPHVAHVIN  465

Query  45   FDLPNDIDDYVHRIG  1
            FDLP D+DDYVHRIG
Sbjct  466  FDLPRDVDDYVHRIG  480



>gb|KCW79815.1| hypothetical protein EUGRSUZ_C01156 [Eucalyptus grandis]
Length=463

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHG-KKALTLVFVETKRRA  229
            FLAVGRVGSSTDLI Q+VEFV D DKRS+L+D+LH++  N   G K+ LTLVFVETKR A
Sbjct  176  FLAVGRVGSSTDLIAQKVEFVDDKDKRSFLVDLLHSQGKNGCVGSKQGLTLVFVETKRGA  235

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            D+LE WL  + F A AIHGD+ Q ERE ALR+F++G  PI+VATDVASRGLDIPHVAHVI
Sbjct  236  DALENWLLRSGFHAIAIHGDKVQMERERALRSFRSGTIPIMVATDVASRGLDIPHVAHVI  295

Query  48   NFDLPNDIDDYVHRIG  1
            N+DLP  IDDYVHRIG
Sbjct  296  NYDLPKSIDDYVHRIG  311



>ref|XP_003609294.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES91491.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=671

 Score =   202 bits (514),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQ++E V+D +KR+ L+D+L   + N ++GK ALTLVFVETK+ AD
Sbjct  359  FLAVGRVGSSTELIVQKIESVQDMEKRTRLVDLL---RRNVVNGKLALTLVFVETKKGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WLC   FPA AIHGD+ Q ERE ALR+FK G TPI+VATDVASRGLDIPHVAHVIN
Sbjct  416  ALENWLCRINFPAIAIHGDKVQMERERALRSFKRGLTPIMVATDVASRGLDIPHVAHVIN  475

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  476  FDLPRDIDDYVHRIG  490



>ref|XP_007154992.1| hypothetical protein PHAVU_003G163700g [Phaseolus vulgaris]
 gb|ESW26986.1| hypothetical protein PHAVU_003G163700g [Phaseolus vulgaris]
Length=617

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V D DKR  L+D L  +K +  +G+ ALTLVFVETKR AD
Sbjct  315  FLSVGRVGSSTELIVQKIELVHDTDKRDKLVDHLRRQKVHGTNGRHALTLVFVETKRGAD  374

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  + FPA AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  375  ALENWLLKSGFPAIAIHGDKVQLERERALRSFKSGNTPILVATDVASRGLDIPHVAHVIN  434

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  435  FDLPRDIDDYVHRIG  449



>ref|XP_004965954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like isoform 
X1 [Setaria italica]
Length=619

 Score =   200 bits (509),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            F+ VGRVGSSTDLI Q++EFV D +KR +LL++LH +     + K+ LTL+FVETKR AD
Sbjct  300  FITVGRVGSSTDLIEQKIEFVNDKEKRGFLLELLHKQSVGGGNSKQPLTLIFVETKREAD  359

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L  WL S  FPATAIHGDRTQQERE ALR+FK+G TPI+VATDVASRGLD+P+V HVIN
Sbjct  360  TLRYWLYSKGFPATAIHGDRTQQERESALRSFKSGATPIMVATDVASRGLDVPNVGHVIN  419

Query  45   FDLPNDIDDYVHRIG  1
            +DLP  I+DYVHRIG
Sbjct  420  YDLPKSIEDYVHRIG  434



>ref|XP_007154991.1| hypothetical protein PHAVU_003G163700g [Phaseolus vulgaris]
 gb|ESW26985.1| hypothetical protein PHAVU_003G163700g [Phaseolus vulgaris]
Length=642

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V D DKR  L+D L  +K +  +G+ ALTLVFVETKR AD
Sbjct  315  FLSVGRVGSSTELIVQKIELVHDTDKRDKLVDHLRRQKVHGTNGRHALTLVFVETKRGAD  374

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE WL  + FPA AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  375  ALENWLLKSGFPAIAIHGDKVQLERERALRSFKSGNTPILVATDVASRGLDIPHVAHVIN  434

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  435  FDLPRDIDDYVHRIG  449



>gb|EAZ01575.1| hypothetical protein OsI_23609 [Oryza sativa Indica Group]
Length=442

 Score =   196 bits (498),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI+Q+VE + D +KR YLLD+L  +     + K  + LTLVFVETKR 
Sbjct  153  FITVGRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKRE  212

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL S  FPATAIHGDRTQQERE ALR+FKTG TPI+VATDVASRGLD+P+VAHV
Sbjct  213  ADSLRYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVATDVASRGLDVPNVAHV  272

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  ++DYVHRIG
Sbjct  273  INYDLPKSVEDYVHRIG  289



>dbj|BAG97731.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   196 bits (499),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI+Q+VE + D +KR YLLD+L  +     + K  + LTLVFVETKR 
Sbjct  180  FITVGRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKRE  239

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL S  FPATAIHGDRTQQERE ALR+FKTG TPI+VATDVASRGLD+P+VAHV
Sbjct  240  ADSLRYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVATDVASRGLDVPNVAHV  299

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  300  INYDLPKSIEDYVHRIG  316



>ref|NP_001058006.1| Os06g0602400 [Oryza sativa Japonica Group]
 dbj|BAF19920.1| Os06g0602400, partial [Oryza sativa Japonica Group]
Length=484

 Score =   196 bits (499),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI+Q+VE + D +KR YLLD+L  +     + K  + LTLVFVETKR 
Sbjct  186  FITVGRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKRE  245

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL S  FPATAIHGDRTQQERE ALR+FKTG TPI+VATDVASRGLD+P+VAHV
Sbjct  246  ADSLRYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVATDVASRGLDVPNVAHV  305

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  306  INYDLPKSIEDYVHRIG  322



>ref|XP_010227545.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like [Brachypodium 
distachyon]
Length=488

 Score =   196 bits (499),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 94/137 (69%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q+VEF+ D +KR YLLD+L  +      GK  + LTLVFVETKR 
Sbjct  198  FITVGRVGSSTDLITQKVEFLSDGEKRIYLLDLLQKQSVGSSDGKLQQPLTLVFVETKRE  257

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL +  FPATAIHGDRTQ+ERE ALR+FK+G TPI+VATDVASRGLD+P+V HV
Sbjct  258  ADSLRYWLYNKGFPATAIHGDRTQEERESALRSFKSGLTPIMVATDVASRGLDVPNVGHV  317

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  318  INYDLPKSIEDYVHRIG  334



>ref|XP_010050529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Eucalyptus 
grandis]
Length=669

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHG-KKALTLVFVETKRRA  229
            FLAVGRVGSSTDLI Q+VEFV D DKRS+L+D+LH++  N   G K+ LTLVFVETKR A
Sbjct  382  FLAVGRVGSSTDLIAQKVEFVDDKDKRSFLVDLLHSQGKNGCVGSKQGLTLVFVETKRGA  441

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            D+LE WL  + F A AIHGD+ Q ERE ALR+F++G  PI+VATDVASRGLDIPHVAHVI
Sbjct  442  DALENWLLRSGFHAIAIHGDKVQMERERALRSFRSGTIPIMVATDVASRGLDIPHVAHVI  501

Query  48   NFDLPNDIDDYVHRIG  1
            N+DLP  IDDYVHRIG
Sbjct  502  NYDLPKSIDDYVHRIG  517



>sp|Q0DB53.2|RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52A [Oryza 
sativa Japonica Group]
 dbj|BAD35456.1| putative DEAD-box protein 3 [Oryza sativa Japonica Group]
 gb|EEE65977.1| hypothetical protein OsJ_21891 [Oryza sativa Japonica Group]
Length=602

 Score =   197 bits (500),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI+Q+VE + D +KR YLLD+L  +     + K  + LTLVFVETKR 
Sbjct  304  FITVGRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKRE  363

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL S  FPATAIHGDRTQQERE ALR+FKTG TPI+VATDVASRGLD+P+VAHV
Sbjct  364  ADSLRYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVATDVASRGLDVPNVAHV  423

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  424  INYDLPKSIEDYVHRIG  440



>ref|XP_004288811.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   197 bits (501),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 95/135 (70%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VG+VGSSTDLI Q+VEFV+D DK  +L  +L  ++ N  HGK A TLVFVETK+ A+
Sbjct  352  FLTVGKVGSSTDLIAQKVEFVRDMDKIQHLCSLLKNQRDNGTHGKLASTLVFVETKKGAN  411

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  N FPA AIHGD+ Q ERE ALR FK G TPILVATDVASRGLDIPHVAHVIN
Sbjct  412  QLENWLSRNGFPAIAIHGDKVQMERERALRLFKCGTTPILVATDVASRGLDIPHVAHVIN  471

Query  45   FDLPNDIDDYVHRIG  1
            FD P  IDDYVHRIG
Sbjct  472  FDFPKSIDDYVHRIG  486



>ref|XP_004965955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like isoform 
X2 [Setaria italica]
Length=510

 Score =   195 bits (495),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 92/137 (67%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q++EFV D +KR +LL++LH +     + K  + LTL+FVETKR 
Sbjct  189  FITVGRVGSSTDLIEQKIEFVNDKEKRGFLLELLHKQSVGGGNSKLQQPLTLIFVETKRE  248

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            AD+L  WL S  FPATAIHGDRTQQERE ALR+FK+G TPI+VATDVASRGLD+P+V HV
Sbjct  249  ADTLRYWLYSKGFPATAIHGDRTQQERESALRSFKSGATPIMVATDVASRGLDVPNVGHV  308

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  309  INYDLPKSIEDYVHRIG  325



>ref|XP_011084132.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52C-like [Sesamum 
indicum]
Length=583

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLA G+VGSSTDLIVQRVEFV D DKR  L+++L +   +    K +LTLVFVETKR AD
Sbjct  296  FLAAGKVGSSTDLIVQRVEFVCDVDKRYRLMNLLRSGMTDNSPSKDSLTLVFVETKRAAD  355

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LERWL    FP+TAIHGD+ Q ERE ALR F++G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  356  ALERWLSRKGFPSTAIHGDKIQMERERALRLFRSGCTPILVATDVAARGLDIPHVAHVIN  415

Query  45   FDLPNDIDDYVHRIG  1
            FDLP  +DDYVHRIG
Sbjct  416  FDLPRAVDDYVHRIG  430



>emb|CAA09202.1| RNA helicase [Arabidopsis thaliana]
Length=224

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = -2

Query  333  DKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRADSLERWLCSNQFPATAIHGDRTQQE  154
            DKRS+L+D+LHA++  E   K++LTLVFVETKR AD+LE WLC N+FPAT+IHGDRTQQE
Sbjct  1    DKRSHLMDLLHAQR--ETQDKQSLTLVFVETKRGADTLENWLCMNEFPATSIHGDRTQQE  58

Query  153  REHALRAFKTGGTPILVATDVASRGLDIPHVAHVINFDLPNDIDDYVHRIG  1
            RE ALR+FKTG TPILVATDVA+RGLDIPHVAHV+NFDLPNDIDDYVHRIG
Sbjct  59   REVALRSFKTGRTPILVATDVAARGLDIPHVAHVVNFDLPNDIDDYVHRIG  109



>gb|KHN15101.1| DEAD-box ATP-dependent RNA helicase 52 [Glycine soja]
Length=529

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V+D DKR +L++ L  +K +  +GK ALTLVFVETKR AD
Sbjct  229  FLSVGRVGSSTELIVQKIELVQDMDKRDHLINHLRRQKVHGANGKHALTLVFVETKRGAD  288

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  + F A AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  289  VLEGWLLRSGFSAVAIHGDKVQMERERALRSFKSGLTPILVATDVASRGLDIPHVAHVIN  348

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DID+YVHRIG
Sbjct  349  FDLPRDIDNYVHRIG  363



>emb|CDP10390.1| unnamed protein product [Coffea canephora]
Length=738

 Score =   196 bits (499),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLA G+VGSSTDLI QRVE+V D DK+++LL++L A++AN   GK ALTLVFVETK+ AD
Sbjct  467  FLAAGKVGSSTDLIAQRVEYVHDADKKNHLLNLLRAQRAN---GKHALTLVFVETKKGAD  523

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L+ WL    FP+ AIHGD+ Q ERE AL++F++G TPILVATDVA+RGLDIPHVAHVIN
Sbjct  524  ALQSWLSMKGFPSMAIHGDKVQMERERALKSFRSGLTPILVATDVAARGLDIPHVAHVIN  583

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DI DYVHRIG
Sbjct  584  FDLPRDIGDYVHRIG  598



>gb|EMS59718.1| DEAD-box ATP-dependent RNA helicase 52A [Triticum urartu]
Length=433

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q+VEFV  ++KR+YL+D+L  +      GK  + LTLVFVETKR 
Sbjct  150  FITVGRVGSSTDLITQQVEFVTHDEKRTYLIDLLQKQSFTSSDGKPQQPLTLVFVETKRE  209

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL +  FPATAIHGDRTQ+ERE ALR+FK+G TP++VATDV +RGLD+P+VAHV
Sbjct  210  ADSLRYWLYNKGFPATAIHGDRTQEERESALRSFKSGLTPVMVATDVVARGLDVPNVAHV  269

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  270  INYDLPKSIEDYVHRIG  286



>ref|XP_003550826.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B [Glycine max]
Length=610

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V+D DKR +L++ L  +K +  +GK ALTLVFVETKR AD
Sbjct  310  FLSVGRVGSSTELIVQKIELVQDMDKRDHLINHLRRQKVHGANGKHALTLVFVETKRGAD  369

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  + F A AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  370  VLEGWLLRSGFSAVAIHGDKVQMERERALRSFKSGLTPILVATDVASRGLDIPHVAHVIN  429

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DID+YVHRIG
Sbjct  430  FDLPRDIDNYVHRIG  444



>gb|EMT25305.1| DEAD-box ATP-dependent RNA helicase 52A [Aegilops tauschii]
Length=458

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q+VEFV  ++KR+YL+D+L  +      GK  + LTLVFVETKR 
Sbjct  187  FITVGRVGSSTDLITQQVEFVTHDEKRTYLIDLLQKQSFTSSDGKPQQPLTLVFVETKRE  246

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL +  FPATAIHGDRTQ+ERE ALR+FK+G TP++VATDV +RGLD+P+VAHV
Sbjct  247  ADSLRYWLYNKGFPATAIHGDRTQEERESALRSFKSGLTPVMVATDVVARGLDVPNVAHV  306

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  307  INYDLPKSIEDYVHRIG  323



>gb|KHN47164.1| DEAD-box ATP-dependent RNA helicase 52B [Glycine soja]
Length=475

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V+D DKR +L+  L  +  +  +GK ALTLVFVETKR AD
Sbjct  179  FLSVGRVGSSTELIVQKIEPVQDMDKRDHLIKHLRRQSVHGFNGKHALTLVFVETKRGAD  238

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  + F A AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  239  VLEGWLLRSGFSAVAIHGDKVQMERERALRSFKSGVTPILVATDVASRGLDIPHVAHVIN  298

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DID+YVHRIG
Sbjct  299  FDLPRDIDNYVHRIG  313



>ref|NP_001130628.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACF78925.1| unknown [Zea mays]
 gb|AFW76420.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=614

 Score =   193 bits (491),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            F+ VGRVGSSTDLI Q++EFV   +KR +LLD+L  +       K+ LTLVFVETKR AD
Sbjct  302  FVTVGRVGSSTDLIDQKIEFVNGGEKRGFLLDILQKQSVGLSKNKQPLTLVFVETKREAD  361

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL+  L SN F AT+IHGDRTQQERE AL++FK+G TPILVATDVASRGLD+P+VAHVIN
Sbjct  362  SLQYCLQSNGFSATSIHGDRTQQERERALKSFKSGATPILVATDVASRGLDVPNVAHVIN  421

Query  45   FDLPNDIDDYVHRIG  1
            +DLP  IDDYVHRIG
Sbjct  422  YDLPKSIDDYVHRIG  436



>ref|XP_006656210.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like [Oryza 
brachyantha]
Length=603

 Score =   193 bits (490),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI+Q+VE + D +KR YLLD+L  +     + K  + LTLVFVETKR 
Sbjct  300  FITVGRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKRE  359

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL S  FP T+IHG RTQQERE ALR+FKTG TPI+VATDVASRGLD+P+VAHV
Sbjct  360  ADSLRYWLYSKGFPTTSIHGGRTQQERESALRSFKTGHTPIMVATDVASRGLDVPNVAHV  419

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  420  INYDLPKSIEDYVHRIG  436



>ref|XP_005648013.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23469.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=573

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 8/135 (6%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQ +E+V   DKR  LLD++     N + G   LTLVFVETKR AD
Sbjct  306  FLAVGRVGSSTELIVQHIEYVSPGDKRQVLLDLI-----NTVEG---LTLVFVETKRGAD  357

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE +L  N FPAT+IHGDR+QQERE ALR+F++G TPILVATDVA+RGLDIPHV HVIN
Sbjct  358  ALEDFLAGNNFPATSIHGDRSQQEREAALRSFRSGRTPILVATDVAARGLDIPHVTHVIN  417

Query  45   FDLPNDIDDYVHRIG  1
            FDLP D+DDYVHRIG
Sbjct  418  FDLPTDVDDYVHRIG  432



>ref|XP_003541505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52B-like [Glycine 
max]
Length=586

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGSST+LIVQ++E V+D DKR +L+  L  +  +  +GK ALTLVFVETKR AD
Sbjct  291  FLSVGRVGSSTELIVQKIEPVQDMDKRDHLIKHLRRQSVHGFNGKHALTLVFVETKRGAD  350

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LE WL  + F A AIHGD+ Q ERE ALR+FK+G TPILVATDVASRGLDIPHVAHVIN
Sbjct  351  VLEGWLLRSGFSAVAIHGDKVQMERERALRSFKSGVTPILVATDVASRGLDIPHVAHVIN  410

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DID+YVHRIG
Sbjct  411  FDLPRDIDNYVHRIG  425



>ref|XP_002437244.1| hypothetical protein SORBIDRAFT_10g023440 [Sorghum bicolor]
 gb|EER88611.1| hypothetical protein SORBIDRAFT_10g023440 [Sorghum bicolor]
Length=567

 Score =   191 bits (484),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q++EFV D +KR +L+D+L  + A   + K  + LTLVFVETKR 
Sbjct  280  FVTVGRVGSSTDLIEQKLEFVNDGEKRGFLIDLLQKQSAGVANSKLQQPLTLVFVETKRE  339

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  +L S  FPATAIHGDRTQQERE AL++FK+G TPI+VATDVASRGLD+P+VAHV
Sbjct  340  ADSLRYFLQSKGFPATAIHGDRTQQERESALKSFKSGTTPIMVATDVASRGLDVPNVAHV  399

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  400  INYDLPKSIEDYVHRIG  416



>emb|CCO30428.1| ATP-dependent RNA helicase [Rhizoctonia solani AG-1 IB]
Length=303

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q++E+V+D DKRS LLD+LH+E       +  LTLVFVETKR AD
Sbjct  51   FLSVGRVGSTSENITQKIEYVEDQDKRSVLLDILHSEP------QGGLTLVFVETKRMAD  104

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             L  +L +N+FPAT+IHGDRTQ+ERE AL  F++G TPI+VAT VA+RGLDIP+V HV+N
Sbjct  105  MLSEYLMTNRFPATSIHGDRTQRERELALNTFRSGRTPIMVATAVAARGLDIPNVTHVVN  164

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  165  YDLPSDIDDYVHRIG  179



>gb|ELU43422.1| ATP-dependent RNA helicase ded-1 [Rhizoctonia solani AG-1 IA]
Length=274

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q++E+V+D DKRS LLD+LH+E       +  LTLVFVETKR AD
Sbjct  127  FLSVGRVGSTSENITQKIEYVEDQDKRSVLLDILHSEP------QGGLTLVFVETKRMAD  180

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             L  +L +N+FPAT+IHGDRTQ+ERE AL  F++G TPI+VAT VA+RGLDIP+V HV+N
Sbjct  181  MLSEYLMNNRFPATSIHGDRTQRERELALSTFRSGRTPIMVATAVAARGLDIPNVTHVVN  240

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  241  YDLPSDIDDYVHRIG  255



>emb|CDM82047.1| unnamed protein product [Triticum aestivum]
Length=776

 Score =   191 bits (484),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGK--KALTLVFVETKRR  232
            F+ VGRVGSSTDLI Q+VEFV  ++KR+YL+D+L  +      GK  + LTLVFVETKR 
Sbjct  355  FITVGRVGSSTDLITQQVEFVTHDEKRTYLIDLLQKQSFTSSDGKPQQPLTLVFVETKRE  414

Query  231  ADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHV  52
            ADSL  WL +  FPATAIHGDRTQ+ERE ALR+FK+G TP++VATDV +RGLD+P+VAHV
Sbjct  415  ADSLRYWLYNKGFPATAIHGDRTQEERESALRSFKSGLTPVMVATDVVARGLDVPNVAHV  474

Query  51   INFDLPNDIDDYVHRIG  1
            IN+DLP  I+DYVHRIG
Sbjct  475  INYDLPKSIEDYVHRIG  491



>ref|XP_005846110.1| hypothetical protein CHLNCDRAFT_31911 [Chlorella variabilis]
 gb|EFN54008.1| hypothetical protein CHLNCDRAFT_31911 [Chlorella variabilis]
Length=556

 Score =   188 bits (477),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 7/135 (5%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGRVGSSTDLIVQ +E+V   DKR  +LD+L   +       K LTL+FVETK+ AD
Sbjct  280  FLTVGRVGSSTDLIVQVIEYVPIQDKRQMVLDLLQTLE-------KGLTLIFVETKKGAD  332

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE +LC N  PAT+IHGDR+Q ERE ALR+F+TG TP+LVATDVA+RGLDIPHV HVIN
Sbjct  333  ALEDFLCRNGLPATSIHGDRSQAEREAALRSFRTGRTPVLVATDVAARGLDIPHVTHVIN  392

Query  45   FDLPNDIDDYVHRIG  1
            FDLP+DIDDYVHRIG
Sbjct  393  FDLPSDIDDYVHRIG  407



>gb|KFY06957.1| hypothetical protein V491_08568, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=187

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 7/135 (5%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D DKRS LLD+LH   A        LTL+FVETKR AD
Sbjct  12   FLSVGRVGSTSENITQKVEYVEDMDKRSVLLDILHTHGA-------GLTLIFVETKRMAD  64

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L +  FPAT+IHGDRTQ+ERE AL  F+ G  PILVAT VA+RGLDIP+V HV+N
Sbjct  65   SLSDFLINQNFPATSIHGDRTQRERERALEMFRNGRCPILVATAVAARGLDIPNVTHVVN  124

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  125  YDLPTDIDDYVHRIG  139



>ref|XP_001702547.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06326.1| predicted protein [Chlamydomonas reinhardtii]
Length=600

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 110/135 (81%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGRVGSSTDLIVQ +E+V   +K++ LLD++      E+  ++ LTLVFVETKR AD
Sbjct  359  FLTVGRVGSSTDLIVQHIEYVTPEEKQNTLLDLI---STVEVSRRQGLTLVFVETKRGAD  415

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LER L  NQ PAT+IHGDR+Q++RE ALR+FK+G TP++VATDVA+RGLDIPHV HVIN
Sbjct  416  ELERILTRNQLPATSIHGDRSQEQREMALRSFKSGKTPVMVATDVAARGLDIPHVTHVIN  475

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  476  YDLPKDIDDYVHRIG  490



>ref|XP_007382720.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN09452.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=639

 Score =   187 bits (476),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 112/135 (83%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I QR+EFV+D+DKRS LLD+L A++      K+ LTLVFVETKR AD
Sbjct  389  FLSVGRVGSTSENITQRIEFVEDHDKRSMLLDILTAQE------KQGLTLVFVETKRMAD  442

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             L  +L  +QFPAT+IHGDRTQ+ERE AL+ F+TG TPILVAT VA+RGLDIP+V HVIN
Sbjct  443  MLSDFLYQSQFPATSIHGDRTQREREMALQTFRTGRTPILVATAVAARGLDIPNVTHVIN  502

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  503  YDLPTDIDDYVHRIG  517



>emb|CEG82233.1| Putative ATP-dependent RNA helicase [Rhizopus microsporus]
Length=225

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q++E+V+D DKRS LLD+LH+   +EI G   L L+FVETKR AD
Sbjct  51   FLSVGRVGSTSENITQKIEYVEDEDKRSVLLDILHS---SEISG---LCLIFVETKRMAD  104

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L  +L  + FPATAIHGDRTQ+ERE AL +FKTG TPI+VAT VA+RGLDI +V+HVI+
Sbjct  105  ALSEFLLDHNFPATAIHGDRTQRERERALESFKTGRTPIMVATAVAARGLDIANVSHVIS  164

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  165  YDLPTDIDDYVHRIG  179



>ref|XP_011090642.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52-like [Sesamum 
indicum]
Length=323

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 7/142 (5%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAE-------KANEIHGKKALTLVFV  247
            FLA  +VGSSTDLIVQRVEFV+D DKR +L+ +LH         K + I  + ALTLVFV
Sbjct  108  FLAARKVGSSTDLIVQRVEFVRDVDKRDHLVILLHISTLFGRSCKVDIILLQDALTLVFV  167

Query  246  ETKRRADSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIP  67
            ET R AD+LE WL    FP+TAIHGD+ Q ERE AL+ F++G TPILVATDVA+ GLDIP
Sbjct  168  ETNRAADALECWLSRKGFPSTAIHGDKIQMERERALKLFRSGCTPILVATDVAAWGLDIP  227

Query  66   HVAHVINFDLPNDIDDYVHRIG  1
            HVAHVINFDLP  +DDYVHRIG
Sbjct  228  HVAHVINFDLPRAVDDYVHRIG  249



>ref|XP_003063379.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52515.1| predicted protein [Micromonas pusilla CCMP1545]
Length=513

 Score =   185 bits (470),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 9/136 (7%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKD-NDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRA  229
            FL VGRVGSS  LI Q++E+++   DK+S L+D++HA         K LTLVFVETKR A
Sbjct  267  FLTVGRVGSSHTLITQQIEYLRSYEDKKSMLMDLVHA--------VKGLTLVFVETKRGA  318

Query  228  DSLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVI  49
            D LE WL    FP+T+IHGDRTQQERE+AL++F++G TPILVATDVA+RGLDIPHV HVI
Sbjct  319  DQLEDWLSREGFPSTSIHGDRTQQEREYALKSFRSGRTPILVATDVAARGLDIPHVTHVI  378

Query  48   NFDLPNDIDDYVHRIG  1
            NFDLP+DIDDYVHRIG
Sbjct  379  NFDLPSDIDDYVHRIG  394



>ref|XP_007348077.1| DEAD-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD43720.1| DEAD-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=650

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q++E+V+DN+KRS LLD+LHAE      GK  LTL+FVETKR AD
Sbjct  400  FLSVGRVGSTSENITQKIEYVEDNEKRSILLDILHAE------GKNGLTLIFVETKRMAD  453

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             L  +L +NQFPAT+IHGDR+Q+ERE AL  F+ G TPI+VAT VA+RGLDIP+V HVIN
Sbjct  454  ILSDFLYANQFPATSIHGDRSQRERESALATFRQGRTPIMVATAVAARGLDIPNVTHVIN  513

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  514  YDLPSDIDDYVHRIG  528



>ref|XP_002954083.1| hypothetical protein VOLCADRAFT_82651 [Volvox carteri f. nagariensis]
 gb|EFJ44800.1| hypothetical protein VOLCADRAFT_82651 [Volvox carteri f. nagariensis]
Length=612

 Score =   187 bits (474),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 8/135 (6%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL VGRVGSSTDLIVQ +E+V  ++K++ LLD+        I   + LTLVFVETKR AD
Sbjct  370  FLTVGRVGSSTDLIVQHIEYVSSDEKQNTLLDL--------ISTVEGLTLVFVETKRGAD  421

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             LER L  NQ PAT+IHGDR+Q++RE ALR+FK+G TP++VATDVA+RGLDIPHV HVIN
Sbjct  422  ELERILTRNQLPATSIHGDRSQEQREMALRSFKSGKTPVMVATDVAARGLDIPHVTHVIN  481

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  482  YDLPKDIDDYVHRIG  496



>ref|XP_001401571.1| ATP-dependent RNA helicase ded1 [Aspergillus niger CBS 513.88]
 sp|A2QI25.1|DED1_ASPNC RecName: Full=ATP-dependent RNA helicase ded1 [Aspergillus niger 
CBS 513.88]
 emb|CAL00690.1| unnamed protein product [Aspergillus niger]
Length=678

 Score =   187 bits (475),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  410  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  463

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  464  SLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  523

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  524  YDLPTDIDDYVHRIG  538



>ref|XP_001821314.1| ATP-dependent RNA helicase ded1 [Aspergillus oryzae RIB40]
 sp|Q2UGK3.1|DED1_ASPOR RecName: Full=ATP-dependent RNA helicase ded1 [Aspergillus oryzae 
RIB40]
 dbj|BAE59312.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=675

 Score =   187 bits (474),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  409  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  462

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  463  SLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  522

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  523  YDLPTDIDDYVHRIG  537



>ref|XP_002377087.1| ATP dependent RNA helicase (Dbp1), putative [Aspergillus flavus 
NRRL3357]
 gb|EED53841.1| ATP dependent RNA helicase (Dbp1), putative [Aspergillus flavus 
NRRL3357]
Length=676

 Score =   187 bits (474),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  410  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  463

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  464  SLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  523

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  524  YDLPTDIDDYVHRIG  538



>gb|EIT78435.1| ATP-dependent RNA helicase [Aspergillus oryzae 3.042]
 gb|KDE82818.1| ATP-dependent RNA helicase [Aspergillus oryzae 100-8]
Length=652

 Score =   186 bits (473),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  386  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  439

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  440  SLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  499

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  500  YDLPTDIDDYVHRIG  514



>sp|C8V8H4.1|DED1_EMENI RecName: Full=ATP-dependent RNA helicase ded1 [Aspergillus nidulans 
FGSC A4]
 tpe|CBF77461.1| TPA: ATP-dependent RNA helicase ded1 (EC 3.6.1.-) [Source:UniProtKB/Swiss-Prot;Acc:P0C2M6] 
[Aspergillus nidulans FGSC A4]
Length=668

 Score =   186 bits (473),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  407  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTTGLTLIFVETKRMAD  460

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  461  ALSEFLINQRFPATAIHGDRTQRERERALEMFRSGRYPILVATAVAARGLDIPNVTHVIN  520

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  521  YDLPTDIDDYVHRIG  535



>gb|KDD72261.1| DEAD/DEAH box helicase, partial [Helicosporidium sp. ATCC 50920]
Length=390

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 7/135 (5%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGSST+LIVQ VE+V   DKR  +LD+L + +         LTLVFVETK+ AD
Sbjct  207  FLAVGRVGSSTELIVQHVEYVSGPDKRQMVLDLLQSLETG-------LTLVFVETKKGAD  259

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +LE +L  N  PAT+IHGDR+Q ERE ALR+F++G TP+LVATDVA+RGLDIPHV HVIN
Sbjct  260  ALEEFLHRNGLPATSIHGDRSQSEREAALRSFRSGRTPVLVATDVAARGLDIPHVTHVIN  319

Query  45   FDLPNDIDDYVHRIG  1
            FDLP DIDDYVHRIG
Sbjct  320  FDLPADIDDYVHRIG  334



>gb|EYE94909.1| DEAD-domain-containing protein [Aspergillus ruber CBS 135680]
Length=643

 Score =   186 bits (472),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I QRVE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  377  FLSVGRVGSTSENITQRVEYVEDHDKRSVLLDILHT------HGTTGLTLIFVETKRMAD  430

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HV+N
Sbjct  431  TLSDFLLNQRFPATAIHGDRTQRERERALDMFRSGRCPILVATAVAARGLDIPNVTHVVN  490

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  491  YDLPTDIDDYVHRIG  505



>dbj|GAA82684.1| ATP dependent RNA helicase [Aspergillus kawachii IFO 4308]
Length=676

 Score =   186 bits (472),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  410  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  463

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  464  SLSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  523

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  524  YDLPTDIDDYVHRIG  538



>dbj|GAD96414.1| ATP dependent RNA helicase (Dbp1), putative [Byssochlamys spectabilis 
No. 5]
Length=670

 Score =   186 bits (472),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I QRVE+V+D DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  408  FLSVGRVGSTSENITQRVEYVEDQDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  461

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SL  +L +  FPATAIHGDRTQ+ERE AL  F+ G  PILVAT VA+RGLDIP+V HV+N
Sbjct  462  SLSDFLINQSFPATAIHGDRTQRERERALEFFRNGRCPILVATAVAARGLDIPNVTHVVN  521

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  522  YDLPTDIDDYVHRIG  536



>ref|XP_001267256.1| ATP dependent RNA helicase (Dbp1), putative [Neosartorya fischeri 
NRRL 181]
 sp|A1CXK7.1|DED1_NEOFI RecName: Full=ATP-dependent RNA helicase ded1 [Neosartorya fischeri 
NRRL 181]
 gb|EAW25359.1| ATP dependent RNA helicase (Dbp1), putative [Neosartorya fischeri 
NRRL 181]
Length=676

 Score =   186 bits (472),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q+VE+V+D+DKRS LLD+LH       HG   LTL+FVETKR AD
Sbjct  413  FLSVGRVGSTSENITQKVEYVEDHDKRSVLLDILHT------HGTSGLTLIFVETKRMAD  466

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            +L  +L + +FPATAIHGDRTQ+ERE AL  F++G  PILVAT VA+RGLDIP+V HVIN
Sbjct  467  ALSDFLLNQRFPATAIHGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVIN  526

Query  45   FDLPNDIDDYVHRIG  1
            +DLP DIDDYVHRIG
Sbjct  527  YDLPTDIDDYVHRIG  541



>gb|AAR09926.1| similar to Drosophila melanogaster CG9748, partial [Drosophila 
yakuba]
Length=159

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FLAVGRVGS+++ I Q + +V + DKRSYLLD+L + +    + K +LTL+FVETK+ AD
Sbjct  15   FLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTLIFVETKKGAD  74

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
            SLE +L     P T+IHGDRTQ+ERE ALR F++G  PILVAT VA+RGLDIPHV HVIN
Sbjct  75   SLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVIN  134

Query  45   FDLPNDIDDYVHRIG  1
            FDLP+D+++YVHRIG
Sbjct  135  FDLPSDVEEYVHRIG  149



>gb|KEP52760.1| ATP-dependent RNA helicase ded1 [Rhizoctonia solani 123E]
Length=642

 Score =   185 bits (470),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = -2

Query  405  FLAVGRVGSSTDLIVQRVEFVKDNDKRSYLLDVLHAEKANEIHGKKALTLVFVETKRRAD  226
            FL+VGRVGS+++ I Q++E+V+D DKRS LLD+LH+E       K  LTLVFVETKR AD
Sbjct  385  FLSVGRVGSTSENITQKIEYVEDQDKRSVLLDILHSEP------KGGLTLVFVETKRMAD  438

Query  225  SLERWLCSNQFPATAIHGDRTQQEREHALRAFKTGGTPILVATDVASRGLDIPHVAHVIN  46
             L  +L +N+FPAT+IHGDRTQ+ERE AL  F++G TPI+VAT VA+RGLDIP+V HV+N
Sbjct  439  MLSEYLMTNRFPATSIHGDRTQRERELALSTFRSGRTPIMVATAVAARGLDIPNVTHVVN  498

Query  45   FDLPNDIDDYVHRIG  1
            +DLP+DIDDYVHRIG
Sbjct  499  YDLPSDIDDYVHRIG  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506499748756