BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15197_g2_i1 len=542 path=[554:0-541]

Length=542
                                                                      Score     E

ref|XP_006363449.1|  PREDICTED: uncharacterized protein LOC102588655  55.5    1e-06   
ref|XP_009628291.1|  PREDICTED: uncharacterized protein LOC104118692  54.7    3e-06   
ref|XP_009804677.1|  PREDICTED: uncharacterized protein LOC104249865  50.4    9e-05   



>ref|XP_006363449.1| PREDICTED: uncharacterized protein LOC102588655 [Solanum tuberosum]
Length=202

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (46%), Gaps = 8/159 (5%)
 Frame = -2

Query  541  VTLIQKACNNTADHEFCLDHLSKNPLVV--SASQEPLAIAAAIAQSGLDNAERTRKY-AM  371
            + L+ K C+   D   C+++L  NP V+  +A+ +PL  A AI QS +D ++ T  Y + 
Sbjct  38   IALVNKVCSGMKDKSSCINYLKSNPKVMAAAATSKPLEFALAILQSAVDQSKNTHSYLSK  97

Query  370  NKVARI-PAVKTAYADCATLLGSTALQLSVAASILKNPASLTEVGSSEVASECLLTSIDG  194
            +K  ++ P    AYA C T     A  L     ++K         +S+ +   L  ++D 
Sbjct  98   HKRGKLSPQAIEAYALCKTYWDEVASGLEGNLKVIKKDKGY----ASDTSDYDLKVTLDN  153

Query  193  VAGCMAKLGTLKVEDQYVMVSCKQVEVYSVAADSILTDL  77
               C   L   +++D  +       ++   AAD+IL  L
Sbjct  154  ATSCATGLANAQIQDPEIAKGLNNTQMAVGAADTILEGL  192



>ref|XP_009628291.1| PREDICTED: uncharacterized protein LOC104118692 [Nicotiana tomentosiformis]
Length=211

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = -2

Query  526  KACNNTADHEFCLDHLSKNPLVVSA-SQEPLAIAAAIAQSGLDNAERTRKY-AMNKVARI  353
            KAC+  +D  FC+++L  NP V++A + +PL  A AI QSG D A+ T  Y +  K  ++
Sbjct  56   KACSRASDKPFCMNYLKSNPKVMAATTSKPLDFALAIIQSGADQAKITHAYFSKPKGTKL  115

Query  352  -PAVKTAYADCATLLGSTALQLSVAASILKNPASLTEVGSSEVASECLLTSIDGVAGCMA  176
             P    AY  C       A  L  +   + +     +  + +     L  ++D  A C  
Sbjct  116  SPQAIKAYNHCKNHWSELASGLERSVKNITD----QQGYAYDTTDYDLKVNLDKAANCGR  171

Query  175  KLGTLKVEDQYVMVSCKQVEVYSVAADSILTDL  77
             L ++++ D     + K+V +  + AD+IL D+
Sbjct  172  ALESVRIYDPVFAEANKKVSLAVMGADAILVDV  204



>ref|XP_009804677.1| PREDICTED: uncharacterized protein LOC104249865 [Nicotiana sylvestris]
Length=210

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 7/153 (5%)
 Frame = -2

Query  535  LIQKACNNTADHEFCLDHLSKNPLVV-SASQEPLAIAAAIAQSGLDNAERTRKYAMNKVA  359
            LI KAC+   +   C+++L  NP V+ +A+ +PL  A AI QS +  A+    +      
Sbjct  41   LIDKACSTLTNKVLCMNYLKSNPKVMAAATSKPLDFALAIIQSAISEAKNIHSHLSKPRE  100

Query  358  RI--PAVKTAYADCATLLGSTALQLSVAASILKNPASLTEVGSSEVASECLLTSIDGVAG  185
            ++  PA++ AY  C T  G  A  L  +  I++         S++      + ++D    
Sbjct  101  KLSPPAIE-AYNFCKTQWGDVASGLEWSLKIIRKDKGYAPDTSTDYD---FVVNLDHATN  156

Query  184  CMAKLGTLKVEDQYVMVSCKQVEVYSVAADSIL  86
            C   L   K++D  +    ++V++    A++IL
Sbjct  157  CGTTLAQAKIQDPVIEKGKEKVQLVVGGANNIL  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520647172894