BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15167_g1_i2 len=3014 path=[3027:0-644 3707:645-3013]

Length=3014
                                                                      Score     E

ref|XP_006340475.1|  PREDICTED: uncharacterized protein LOC102579691   1104   0.0      
ref|XP_004237508.1|  PREDICTED: uncharacterized protein LOC101246046   1102   0.0      
ref|XP_011077071.1|  PREDICTED: uncharacterized protein LOC105161164   1093   0.0      
ref|XP_002268094.2|  PREDICTED: uncharacterized protein LOC100241547   1091   0.0      Vitis vinifera
ref|XP_010264001.1|  PREDICTED: uncharacterized protein LOC104602...   1075   0.0      
gb|KDP23754.1|  hypothetical protein JCGZ_23587                        1074   0.0      
gb|EYU39532.1|  hypothetical protein MIMGU_mgv1a001059mg               1073   0.0      
ref|XP_010264002.1|  PREDICTED: uncharacterized protein LOC104602...   1073   0.0      
ref|XP_010102182.1|  Pentatricopeptide repeat-containing protein       1057   0.0      
gb|KHG29467.1|  hypothetical protein F383_10624                        1055   0.0      
ref|XP_010043321.1|  PREDICTED: uncharacterized protein LOC104432558   1051   0.0      
gb|KCW85329.1|  hypothetical protein EUGRSUZ_B02168                    1051   0.0      
ref|XP_008443746.1|  PREDICTED: uncharacterized protein LOC103487...   1050   0.0      
ref|XP_006443293.1|  hypothetical protein CICLE_v10023441mg            1046   0.0      
gb|KDO52504.1|  hypothetical protein CISIN_1g002761mg                  1045   0.0      
ref|XP_006478983.1|  PREDICTED: uncharacterized protein LOC102630...   1045   0.0      
ref|XP_007030296.1|  Plastid transcriptionally active 3 isoform 1      1045   0.0      
ref|XP_002522027.1|  pentatricopeptide repeat-containing protein,...   1043   0.0      Ricinus communis
ref|XP_010549638.1|  PREDICTED: uncharacterized protein LOC104820754   1041   0.0      
ref|XP_007030297.1|  Plastid transcriptionally active 3 isoform 2      1040   0.0      
ref|XP_008812927.1|  PREDICTED: uncharacterized protein LOC103723700   1034   0.0      
ref|XP_010933205.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1033   0.0      
ref|XP_010674223.1|  PREDICTED: uncharacterized protein LOC104890...   1033   0.0      
ref|XP_007143992.1|  hypothetical protein PHAVU_007G119900g            1032   0.0      
ref|XP_010674225.1|  PREDICTED: uncharacterized protein LOC104890...   1031   0.0      
gb|KEH42973.1|  plastid transcriptionally active protein               1028   0.0      
ref|XP_011002015.1|  PREDICTED: uncharacterized protein LOC105109113   1026   0.0      
ref|XP_009401704.1|  PREDICTED: uncharacterized protein LOC103985662   1026   0.0      
ref|XP_006296937.1|  hypothetical protein CARUB_v10012929mg            1022   0.0      
ref|XP_002325363.1|  SAP domain-containing family protein              1021   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006408205.1|  hypothetical protein EUTSA_v10020015mg            1016   0.0      
ref|XP_003590907.1|  Pentatricopeptide repeat-containing protein       1015   0.0      
ref|NP_187076.2|  plastid transcriptionally active 3                   1014   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY21131.1|  BnaA01g33620D                                         1013   0.0      
emb|CDY29994.1|  BnaC01g40140D                                         1008   0.0      
gb|AAF26788.1|AC016829_12  hypothetical protein                        1006   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535382.1|  PREDICTED: uncharacterized protein LOC100802...   1004   0.0      
gb|KHN04962.1|  Pentatricopeptide repeat-containing protein, chlo...    998   0.0      
ref|XP_003555560.1|  PREDICTED: uncharacterized protein LOC100807...    996   0.0      
gb|KDO52505.1|  hypothetical protein CISIN_1g002761mg                   990   0.0      
gb|KCW85330.1|  hypothetical protein EUGRSUZ_B02168                     971   0.0      
ref|XP_008443747.1|  PREDICTED: uncharacterized protein LOC103487...    970   0.0      
ref|XP_008664904.1|  PREDICTED: uncharacterized protein LOC103643502    932   0.0      
ref|XP_003571848.1|  PREDICTED: uncharacterized protein LOC100838913    914   0.0      
gb|EEC67117.1|  hypothetical protein OsI_33922                          911   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT14191.1|  Pentatricopeptide repeat-containing protein             895   0.0      
ref|XP_010674224.1|  PREDICTED: uncharacterized protein LOC104890...    893   0.0      
ref|XP_004142596.1|  PREDICTED: uncharacterized protein LOC101209618    822   0.0      
gb|KGN66719.1|  hypothetical protein Csa_1G662830                       798   0.0      
ref|XP_007208364.1|  hypothetical protein PRUPE_ppa001139mg             783   0.0      
ref|XP_007208365.1|  hypothetical protein PRUPE_ppa001139mg             783   0.0      
ref|XP_008218372.1|  PREDICTED: uncharacterized protein LOC103318731    777   0.0      
ref|XP_009125001.1|  PREDICTED: uncharacterized protein LOC103850051    768   0.0      
gb|KFK37852.1|  hypothetical protein AALP_AA3G037600                    765   0.0      
ref|XP_010463904.1|  PREDICTED: uncharacterized protein LOC104744533    766   0.0      
ref|XP_002884436.1|  hypothetical protein ARALYDRAFT_477686             764   0.0      
ref|XP_010485796.1|  PREDICTED: uncharacterized protein LOC104764053    763   0.0      
ref|XP_006854340.1|  hypothetical protein AMTR_s00039p00135490          757   0.0      
ref|XP_009794336.1|  PREDICTED: uncharacterized protein LOC104241114    729   0.0      
gb|EPS69040.1|  hypothetical protein M569_05728                         728   0.0      
ref|XP_009602145.1|  PREDICTED: uncharacterized protein LOC104097292    703   0.0      
emb|CDP04259.1|  unnamed protein product                                659   0.0      
ref|XP_006662417.1|  PREDICTED: uncharacterized protein LOC102708836    697   0.0      
gb|AAM93724.1|  putative chloroplast RNA processing protein             687   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ16340.1|  hypothetical protein OsJ_31803                          685   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAN05531.1|  putative DNA binding domain containing protein          686   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417605.1|  PREDICTED: uncharacterized protein LOC104703294    501   6e-179   
ref|XP_004155705.1|  PREDICTED: pentatricopeptide repeat-containi...    476   4e-175   
gb|KHN14795.1|  hypothetical protein glysoja_020968                     527   5e-173   
ref|XP_009798510.1|  PREDICTED: pentatricopeptide repeat-containi...    387   4e-159   
ref|XP_009600164.1|  PREDICTED: pentatricopeptide repeat-containi...    385   6e-159   
ref|XP_004173593.1|  PREDICTED: uncharacterized LOC101209618            459   7e-149   
ref|XP_002960607.1|  hypothetical protein SELMODRAFT_164431             434   7e-144   
ref|XP_002969250.1|  hypothetical protein SELMODRAFT_170612             433   1e-143   
ref|XP_001759689.1|  predicted protein                                  444   6e-143   
emb|CDP21880.1|  unnamed protein product                                421   4e-134   
ref|XP_009798511.1|  PREDICTED: pentatricopeptide repeat-containi...    278   1e-126   
ref|XP_009600165.1|  PREDICTED: pentatricopeptide repeat-containi...    277   2e-126   
gb|EPS65951.1|  hypothetical protein M569_08824                         274   2e-119   
tpg|DAA49766.1|  TPA: hypothetical protein ZEAMMB73_347666              261   9e-107   
ref|XP_002467125.1|  hypothetical protein SORBIDRAFT_01g020030          264   8e-102   Sorghum bicolor [broomcorn]
ref|XP_003589452.1|  Pentatricopeptide repeat-containing protein        179   3e-89    
emb|CAN82532.1|  hypothetical protein VITISV_023135                     181   1e-78    Vitis vinifera
ref|NP_001064783.1|  Os10g0462800                                       253   1e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467124.1|  hypothetical protein SORBIDRAFT_01g020020          248   3e-72    Sorghum bicolor [broomcorn]
gb|KHN14796.1|  Putative pentatricopeptide repeat-containing protein    135   8e-59    
ref|XP_002862330.1|  hypothetical protein ARALYDRAFT_920889             196   3e-54    
gb|ACU17497.1|  unknown                                                 194   2e-52    Glycine max [soybeans]
tpg|DAA49765.1|  TPA: hypothetical protein ZEAMMB73_987620              162   1e-42    
ref|XP_004170609.1|  PREDICTED: pentatricopeptide repeat-containi...    131   7e-32    
ref|XP_010467961.1|  PREDICTED: uncharacterized protein LOC104747954  87.4    2e-31    
ref|XP_010451874.1|  PREDICTED: nuclear polyadenylated RNA-bindin...    125   1e-27    
gb|EEE51091.1|  hypothetical protein OsJ_31796                        91.7    2e-16    Oryza sativa Japonica Group [Japonica rice]
gb|AAM93720.1|  putative stress inducible protein                     88.6    4e-15    Oryza sativa Japonica Group [Japonica rice]
gb|ABB47762.1|  tetratricopeptide repeat, putative, expressed         88.2    4e-15    Oryza sativa Japonica Group [Japonica rice]
gb|AAM93727.1|  unknown protein                                       87.4    4e-15    Oryza sativa Japonica Group [Japonica rice]
gb|ABG66118.1|  PsbP family protein, expressed                        85.9    1e-14    Oryza sativa Japonica Group [Japonica rice]
gb|ABG66117.1|  PsbP family protein, expressed                        87.8    2e-14    Oryza sativa Japonica Group [Japonica rice]
gb|ABG66119.1|  PsbP family protein, expressed                        87.8    2e-14    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064776.1|  Os10g0461100                                     87.8    2e-14    Oryza sativa Japonica Group [Japonica rice]
gb|EAY78810.1|  hypothetical protein OsI_33913                        82.4    3e-14    Oryza sativa Indica Group [Indian rice]
gb|AAM93725.1|  hypothetical protein                                  82.0    5e-14    Oryza sativa Japonica Group [Japonica rice]
gb|AAM93702.1|  hypothetical protein                                  82.0    5e-14    Oryza sativa Japonica Group [Japonica rice]
gb|AAP54144.2|  PsbP family protein, expressed                        83.2    2e-13    Oryza sativa Japonica Group [Japonica rice]
emb|CDP17054.1|  unnamed protein product                              74.3    4e-10    
ref|XP_006383750.1|  hypothetical protein POPTR_0005s26680g           67.8    7e-09    
emb|CDY29990.1|  BnaC01g40180D                                        63.9    8e-09    
emb|CBI27486.3|  unnamed protein product                              68.9    1e-08    
ref|XP_008389961.1|  PREDICTED: putative pentatricopeptide repeat...  68.9    2e-08    
ref|XP_006417966.1|  hypothetical protein EUTSA_v10006755mg           68.6    3e-08    
ref|XP_008221377.1|  PREDICTED: putative pentatricopeptide repeat...  68.2    4e-08    
ref|XP_002273398.2|  PREDICTED: putative pentatricopeptide repeat...  68.2    4e-08    Vitis vinifera
gb|EPS67318.1|  hypothetical protein M569_07454                       66.6    5e-08    
ref|XP_002963827.1|  hypothetical protein SELMODRAFT_79421            66.6    8e-08    
ref|XP_008646443.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    9e-08    
gb|KFK42931.1|  hypothetical protein AALP_AA1G057100                  66.6    1e-07    
ref|XP_006470947.1|  PREDICTED: putative pentatricopeptide repeat...  66.6    1e-07    
ref|XP_010918547.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    1e-07    
ref|XP_004288209.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    1e-07    
ref|XP_002444001.1|  hypothetical protein SORBIDRAFT_07g005650        66.2    1e-07    Sorghum bicolor [broomcorn]
ref|XP_007224618.1|  hypothetical protein PRUPE_ppa026847mg           65.9    2e-07    
ref|XP_006838158.1|  hypothetical protein AMTR_s00106p00105070        65.5    2e-07    
ref|XP_010533956.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    2e-07    
ref|XP_010087216.1|  hypothetical protein L484_009725                 65.5    2e-07    
ref|XP_010259252.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    2e-07    
gb|KFK31216.1|  hypothetical protein AALP_AA6G083500                  64.7    4e-07    
ref|XP_001771925.1|  predicted protein                                49.7    5e-07    
ref|XP_006420675.1|  hypothetical protein CICLE_v10004591mg           64.3    5e-07    
ref|XP_011079534.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    6e-07    
ref|XP_008466646.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    6e-07    
ref|XP_002515260.1|  pentatricopeptide repeat-containing protein,...  63.9    7e-07    Ricinus communis
gb|EAY94432.1|  hypothetical protein OsI_16202                        61.2    7e-07    Oryza sativa Indica Group [Indian rice]
ref|XP_010528449.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-07    
ref|XP_006410275.1|  hypothetical protein EUTSA_v10016219mg           63.9    8e-07    
ref|XP_003632699.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    1e-06    
emb|CAE76009.1|  B1358B12.18                                          60.8    1e-06    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002971777.1|  hypothetical protein SELMODRAFT_96029            62.8    1e-06    
ref|XP_010491966.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-06    
ref|XP_008447846.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    2e-06    
ref|XP_004237977.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-06    
ref|XP_011090619.1|  PREDICTED: putative pentatricopeptide repeat...  62.4    2e-06    
ref|XP_006349790.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-06    
ref|XP_010108616.1|  hypothetical protein L484_000854                 62.4    2e-06    
ref|XP_010454089.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-06    
ref|XP_006386713.1|  hypothetical protein POPTR_0002s19470g           62.4    2e-06    
ref|XP_003580849.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06    
ref|XP_006653052.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-06    
emb|CAE03450.1|  OSJNBa0088H09.8                                      62.4    2e-06    Oryza sativa Japonica Group [Japonica rice]
gb|EEC67112.1|  hypothetical protein OsI_33911                        60.8    2e-06    Oryza sativa Indica Group [Indian rice]
gb|EAZ32470.1|  hypothetical protein OsJ_16686                        62.4    2e-06    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301519.2|  hypothetical protein POPTR_0002s19470g           62.4    2e-06    Populus trichocarpa [western balsam poplar]
ref|XP_010099493.1|  hypothetical protein L484_000446                 62.4    2e-06    
ref|XP_006342083.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-06    
ref|XP_011041010.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-06    
ref|NP_001054310.1|  Os04g0684500                                     62.4    2e-06    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86163.1|  H0913C04.4                                           62.4    2e-06    Oryza sativa [red rice]
ref|XP_002454820.1|  hypothetical protein SORBIDRAFT_04g038070        62.0    2e-06    Sorghum bicolor [broomcorn]
ref|NP_001105869.1|  pentatricopeptide repeat protein                 62.4    2e-06    Zea mays [maize]
ref|XP_008235960.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-06    
ref|XP_006653488.1|  PREDICTED: putative pentatricopeptide repeat...  54.3    2e-06    
ref|XP_004145582.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-06    
ref|XP_011042278.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    3e-06    
ref|XP_008381425.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    3e-06    
ref|XP_007033427.1|  Tetratricopeptide repeat (TPR)-like superfam...  61.6    3e-06    
ref|XP_002527150.1|  pentatricopeptide repeat-containing protein,...  62.0    3e-06    Ricinus communis
ref|XP_010440983.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-06    
ref|XP_004960011.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    3e-06    
emb|CBI36966.3|  unnamed protein product                              61.6    3e-06    
ref|XP_006826435.1|  hypothetical protein AMTR_s00004p00168920        61.6    3e-06    
ref|XP_010063125.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  48.1    3e-06    
ref|XP_007200313.1|  hypothetical protein PRUPE_ppa001249mg           61.6    3e-06    
ref|XP_004149490.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    4e-06    
ref|XP_010680035.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    4e-06    
ref|XP_006410274.1|  hypothetical protein EUTSA_v10016252mg           61.6    4e-06    
emb|CDY58113.1|  BnaA02g35150D                                        60.8    4e-06    
ref|XP_003580632.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-06    
ref|XP_002271180.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    5e-06    Vitis vinifera
ref|XP_003533421.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    5e-06    
ref|XP_010026088.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  61.2    5e-06    
ref|XP_002518803.1|  pentatricopeptide repeat-containing protein,...  61.2    5e-06    Ricinus communis
ref|XP_010029448.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-06    
ref|XP_009333596.1|  PREDICTED: uncharacterized protein LOC103926525  61.2    5e-06    
ref|XP_006293642.1|  hypothetical protein CARUB_v10022597mg           61.2    5e-06    
ref|XP_010424167.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    5e-06    
ref|XP_008365652.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-06    
ref|XP_010450873.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-06    
ref|XP_010469705.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-06    
ref|XP_009349918.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-06    
gb|EYU42756.1|  hypothetical protein MIMGU_mgv1a024236mg              60.5    6e-06    
ref|XP_009345921.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-06    
ref|XP_006373499.1|  hypothetical protein POPTR_0017s14300g           60.5    6e-06    
gb|KHN38886.1|  Pentatricopeptide repeat-containing protein           60.8    6e-06    
ref|XP_006338085.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-06    
gb|KDP31244.1|  hypothetical protein JCGZ_11620                       48.1    7e-06    
ref|XP_009363136.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    7e-06    
ref|XP_009349917.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    7e-06    
gb|KCW58308.1|  hypothetical protein EUGRSUZ_H00998                   60.5    7e-06    
ref|XP_002447352.1|  hypothetical protein SORBIDRAFT_06g033480        60.5    7e-06    Sorghum bicolor [broomcorn]
ref|XP_008794926.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    8e-06    
ref|XP_006450624.1|  hypothetical protein CICLE_v10007728mg           60.1    8e-06    
ref|XP_006287082.1|  hypothetical protein CARUB_v10000242mg           60.5    8e-06    
ref|XP_006845376.1|  hypothetical protein AMTR_s00019p00039970        47.0    8e-06    
ref|XP_004157129.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.5    8e-06    
gb|KCW58309.1|  hypothetical protein EUGRSUZ_H00998                   60.1    9e-06    
ref|XP_004253145.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    9e-06    
ref|XP_010418730.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    9e-06    
ref|XP_007208255.1|  hypothetical protein PRUPE_ppa016546mg           60.1    9e-06    
ref|XP_004156125.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  60.5    9e-06    
ref|XP_010692200.1|  PREDICTED: pentatricopeptide repeat-containi...  43.1    9e-06    
ref|NP_180698.1|  pentatricopeptide-repeat protein GUN1               60.5    9e-06    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510200.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    9e-06    
ref|XP_010240633.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    9e-06    
ref|XP_009126254.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    9e-06    
dbj|BAJ97477.1|  predicted protein                                    60.5    9e-06    
ref|XP_011099085.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-06    
ref|XP_010692201.1|  PREDICTED: pentatricopeptide repeat-containi...  43.1    9e-06    
ref|XP_010048296.1|  PREDICTED: pentatricopeptide repeat-containi...  44.7    9e-06    
ref|XP_010525903.1|  PREDICTED: pentatricopeptide repeat-containi...  48.9    1e-05    
ref|XP_008437970.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-05    
ref|XP_006405706.1|  hypothetical protein EUTSA_v10028323mg           60.1    1e-05    
ref|XP_011021152.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-05    
ref|XP_010267950.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    1e-05    
gb|KCW80548.1|  hypothetical protein EUGRSUZ_C01897                   44.7    1e-05    
ref|XP_011013222.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-05    
ref|XP_006444533.1|  hypothetical protein CICLE_v10018807mg           60.1    1e-05    
ref|XP_006492356.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    1e-05    
emb|CDY10802.1|  BnaA05g11340D                                        59.7    1e-05    
ref|XP_008452843.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    1e-05    
gb|KCW89260.1|  hypothetical protein EUGRSUZ_A01557                   59.7    1e-05    
gb|KFK25485.1|  hypothetical protein AALP_AA8G120600                  45.8    1e-05    
ref|XP_004298631.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    1e-05    
gb|EMT10625.1|  Pentatricopeptide repeat-containing protein           59.7    1e-05    
ref|XP_002532893.1|  pentatricopeptide repeat-containing protein,...  59.3    1e-05    Ricinus communis
gb|KDP42034.1|  hypothetical protein JCGZ_03097                       59.7    1e-05    
ref|XP_011088706.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  59.7    1e-05    
ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-05    
ref|XP_008233899.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-05    
ref|XP_002464340.1|  hypothetical protein SORBIDRAFT_01g016560        47.8    2e-05    Sorghum bicolor [broomcorn]
emb|CDY19091.1|  BnaA04g18310D                                        59.3    2e-05    
ref|XP_011032465.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    2e-05    
gb|EMS45043.1|  hypothetical protein TRIUR3_16364                     53.1    2e-05    
ref|XP_010247065.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-05    
ref|XP_004166285.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-05    
ref|XP_010278103.1|  PREDICTED: pentatricopeptide repeat-containi...  47.4    2e-05    
ref|XP_004135985.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-05    
ref|XP_009404774.1|  PREDICTED: pentatricopeptide repeat-containi...  43.5    2e-05    
ref|XP_010544975.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-05    
ref|XP_006444532.1|  hypothetical protein CICLE_v10018807mg           59.3    2e-05    
ref|XP_009606615.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-05    
gb|KDP23717.1|  hypothetical protein JCGZ_23550                       52.4    2e-05    
ref|XP_002320970.2|  hypothetical protein POPTR_0014s11380g           59.3    2e-05    Populus trichocarpa [western balsam poplar]
ref|XP_004144886.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-05    
emb|CDP13864.1|  unnamed protein product                              58.9    2e-05    
ref|XP_008442952.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    2e-05    
gb|KDO86953.1|  hypothetical protein CISIN_1g002814mg                 59.3    2e-05    
ref|XP_006659286.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-05    
ref|XP_004154721.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-05    
ref|XP_006422433.1|  hypothetical protein CICLE_v10027787mg           58.9    2e-05    
gb|KDO68326.1|  hypothetical protein CISIN_1g044873mg                 58.9    2e-05    
ref|XP_009144209.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-05    
ref|XP_010492851.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-05    
ref|XP_006282941.1|  hypothetical protein CARUB_v10007510mg           58.5    2e-05    
gb|KDP32849.1|  hypothetical protein JCGZ_12141                       58.2    2e-05    
ref|XP_006605878.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
ref|XP_009141167.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    3e-05    
ref|XP_009795490.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
ref|XP_010233879.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
gb|EYU46823.1|  hypothetical protein MIMGU_mgv1a001306mg              58.5    3e-05    
ref|XP_006384843.1|  hypothetical protein POPTR_0004s21560g           58.9    3e-05    
ref|XP_007051141.1|  S uncoupled 1                                    58.5    3e-05    
ref|XP_009409629.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
ref|XP_003572167.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    3e-05    
ref|XP_004500011.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
emb|CDP15351.1|  unnamed protein product                              58.5    3e-05    
gb|KHG14604.1|  hypothetical protein F383_16601                       58.5    3e-05    
gb|EYU43675.1|  hypothetical protein MIMGU_mgv1a006780mg              46.2    3e-05    
ref|XP_006476139.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
ref|XP_009379757.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-05    
ref|XP_006854727.1|  hypothetical protein AMTR_s00030p00239430        58.5    3e-05    
ref|XP_008221147.1|  PREDICTED: pentatricopeptide repeat-containi...  51.2    3e-05    
ref|XP_002881173.1|  pentatricopeptide repeat-containing protein      58.5    3e-05    
ref|XP_007225185.1|  hypothetical protein PRUPE_ppa002191mg           51.2    3e-05    
gb|KDO79718.1|  hypothetical protein CISIN_1g0066401mg                58.2    3e-05    
ref|XP_003555869.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-05    
ref|XP_006838473.1|  hypothetical protein AMTR_s00002p00150300        58.2    3e-05    
emb|CDP10983.1|  unnamed protein product                              58.2    3e-05    
ref|XP_008813367.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-05    
gb|EMT03271.1|  hypothetical protein F775_20965                       57.8    4e-05    
ref|NP_198689.1|  pentatricopeptide repeat-containing protein         58.2    4e-05    
ref|XP_010679413.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-05    
ref|XP_011075331.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-05    
ref|XP_001763946.1|  predicted protein                                40.8    4e-05    
ref|XP_002456972.1|  hypothetical protein SORBIDRAFT_03g046570        58.2    4e-05    
ref|XP_006649194.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-05    
gb|KDP28278.1|  hypothetical protein JCGZ_14049                       58.2    4e-05    
dbj|BAD23061.1|  UDP-glucoronosyl/UDP-glucosyl transferase family...  57.8    4e-05    
ref|XP_008370748.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-05    
gb|EEC74287.1|  hypothetical protein OsI_09537                        58.2    4e-05    
ref|XP_009629855.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-05    
ref|XP_008451469.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    5e-05    
ref|XP_008786296.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-05    
ref|XP_002866609.1|  pentatricopeptide repeat-containing protein      52.0    5e-05    
ref|XP_010557799.1|  PREDICTED: pentatricopeptide repeat-containi...  43.9    5e-05    
gb|AFW56956.1|  hypothetical protein ZEAMMB73_276172                  57.8    5e-05    
ref|XP_010679414.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-05    
ref|XP_009104313.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.8    5e-05    
ref|XP_004970535.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    5e-05    
emb|CDP04402.1|  unnamed protein product                              57.8    5e-05    
ref|XP_004288538.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-05    
ref|XP_009412775.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-05    
ref|XP_009365314.1|  PREDICTED: pentatricopeptide repeat-containi...  39.7    5e-05    
emb|CDX97167.1|  BnaC09g44580D                                        45.8    6e-05    
gb|EYU17558.1|  hypothetical protein MIMGU_mgv1a004143mg              57.4    6e-05    
ref|XP_004238390.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-05    
ref|XP_006486600.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    6e-05    
ref|XP_008663961.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.4    6e-05    
ref|XP_007036054.1|  Plastid transcriptionally active 2 isoform 1     55.8    6e-05    
emb|CDY53916.1|  BnaA07g38240D                                        57.4    6e-05    
ref|XP_006433856.1|  hypothetical protein CICLE_v10000867mg           57.0    6e-05    
ref|XP_002870827.1|  pentatricopeptide repeat-containing protein      57.4    6e-05    
ref|XP_008802687.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-05    
ref|XP_007031148.1|  Pentatricopeptide repeat (PPR-like) superfam...  43.5    6e-05    
gb|KHG30653.1|  hypothetical protein F383_05807                       57.4    6e-05    
gb|KCW90922.1|  hypothetical protein EUGRSUZ_A02953                   45.8    6e-05    
ref|XP_010523366.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
ref|XP_010063050.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  45.8    7e-05    
emb|CDP11481.1|  unnamed protein product                              57.0    7e-05    
ref|XP_004981676.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    7e-05    
ref|XP_010544768.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
ref|XP_009343763.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
ref|XP_010438517.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
gb|KDO81117.1|  hypothetical protein CISIN_1g009977mg                 57.0    7e-05    
ref|XP_006399727.1|  hypothetical protein EUTSA_v10015810mg           41.6    7e-05    
ref|XP_002307458.2|  pentatricopeptide repeat-containing family p...  57.0    7e-05    
emb|CDP08758.1|  unnamed protein product                              57.4    7e-05    
emb|CDY52015.1|  BnaC06g42950D                                        57.4    7e-05    
gb|EPS72235.1|  hypothetical protein M569_02522                       57.4    7e-05    
gb|KFK35353.1|  hypothetical protein AALP_AA5G273600                  57.4    7e-05    
ref|XP_010934122.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
ref|XP_008382431.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-05    
ref|XP_010248809.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-05    
ref|NP_188293.2|  pentatricopeptide repeat-containing protein         57.0    8e-05    
ref|XP_007205118.1|  hypothetical protein PRUPE_ppa004835mg           56.6    8e-05    
ref|XP_002979029.1|  hypothetical protein SELMODRAFT_109908           45.1    8e-05    
ref|XP_010490755.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-05    
ref|XP_002281336.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    8e-05    
emb|CBJ32428.1|  conserved unknown protein                            43.5    8e-05    
ref|XP_007031149.1|  Pentatricopeptide repeat (PPR-like) superfam...  43.5    8e-05    
ref|XP_007036056.1|  Plastid transcriptionally active 2 isoform 3     55.5    8e-05    
ref|XP_004501390.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    8e-05    
ref|XP_010550960.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    8e-05    
ref|XP_006841446.1|  hypothetical protein AMTR_s00003p00075520        57.0    8e-05    
ref|XP_010536170.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.0    8e-05    
ref|XP_011026579.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-05    
ref|XP_008218329.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-05    
ref|XP_004136721.1|  PREDICTED: putative pentatricopeptide repeat...  57.4    8e-05    
tpg|DAA55754.1|  TPA: hypothetical protein ZEAMMB73_281441            57.0    9e-05    
gb|KFK26088.1|  hypothetical protein AALP_AA8G201200                  56.6    9e-05    
ref|XP_009798874.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    9e-05    
ref|XP_011083426.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_010423808.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-04    
ref|XP_008443759.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_007036055.1|  Plastid transcriptionally active 2 isoform 2     55.1    1e-04    
ref|XP_008465224.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_010533992.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_003557148.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-04    
ref|XP_004972631.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_010248801.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_011089738.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
ref|XP_004136259.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
ref|XP_010678350.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    1e-04    
ref|XP_009397366.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
tpg|DAA55753.1|  TPA: hypothetical protein ZEAMMB73_281441            56.2    1e-04    
ref|XP_010266308.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
emb|CAN75614.1|  hypothetical protein VITISV_022293                   56.2    1e-04    
ref|XP_006585050.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    1e-04    
ref|XP_002283907.3|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
ref|XP_010660523.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
ref|XP_010942072.1|  PREDICTED: pentatricopeptide repeat-containi...  46.6    1e-04    
ref|XP_006845699.1|  hypothetical protein AMTR_s00019p00238660        56.2    1e-04    
gb|KHN07499.1|  Pentatricopeptide repeat-containing protein           55.5    1e-04    
ref|XP_010474606.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    1e-04    
ref|XP_009340504.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
ref|XP_008466175.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-04    
ref|XP_010547469.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-04    
gb|KCW46841.1|  hypothetical protein EUGRSUZ_K00651                   56.2    1e-04    
ref|XP_010090160.1|  hypothetical protein L484_027392                 56.2    1e-04    
ref|XP_002971480.1|  hypothetical protein SELMODRAFT_95907            56.2    1e-04    
gb|KHN28906.1|  Putative pentatricopeptide repeat-containing protein  56.2    1e-04    
ref|NP_196771.1|  pentatricopeptide repeat-containing protein         56.2    1e-04    
emb|CDY41899.1|  BnaC05g47050D                                        56.2    1e-04    
ref|XP_006351446.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-04    
ref|XP_006482334.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_009338086.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_009394893.1|  PREDICTED: putative pentatricopeptide repeat...  56.2    2e-04    
ref|XP_006389622.1|  hypothetical protein POPTR_0021s00720g           55.8    2e-04    
ref|XP_010914611.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-04    
gb|KDO58883.1|  hypothetical protein CISIN_1g048533mg                 55.8    2e-04    
ref|XP_008338591.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_008227881.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-04    
ref|XP_006660114.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    2e-04    
ref|XP_010419793.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-04    
ref|XP_008656237.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    2e-04    
ref|XP_006430873.1|  hypothetical protein CICLE_v10011342mg           55.8    2e-04    
ref|XP_008438280.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-04    
gb|KHG17652.1|  Pentatricopeptide repeat-containing, chloroplasti...  56.2    2e-04    
ref|XP_006287077.1|  hypothetical protein CARUB_v10000236mg           56.2    2e-04    
ref|XP_010436363.1|  PREDICTED: pentatricopeptide repeat-containi...  53.5    2e-04    
ref|XP_006585057.1|  PREDICTED: putative pentatricopeptide repeat...  55.8    2e-04    
emb|CDP11248.1|  unnamed protein product                              55.8    2e-04    
ref|XP_010319820.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_003613018.1|  Pentatricopeptide repeat-containing protein      56.2    2e-04    
ref|XP_011037108.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_008804688.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
gb|EMT27698.1|  Putative pentatricopeptide repeat-containing protein  55.8    2e-04    
ref|XP_008656236.1|  PREDICTED: pentatricopeptide repeat-containi...  50.4    2e-04    
ref|XP_007221553.1|  hypothetical protein PRUPE_ppa001263mg           55.8    2e-04    
ref|XP_002324819.2|  hypothetical protein POPTR_0018s00800g           55.8    2e-04    
ref|NP_001169662.1|  uncharacterized protein LOC100383543             43.1    2e-04    
ref|XP_002531694.1|  pentatricopeptide repeat-containing protein,...  55.8    2e-04    
ref|XP_008674497.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  55.8    2e-04    
ref|XP_010102224.1|  hypothetical protein L484_024505                 55.8    2e-04    
ref|XP_007030407.1|  Pentatricopeptide repeat (PPR-like) superfam...  55.5    2e-04    
ref|XP_006857744.1|  hypothetical protein AMTR_s00061p00191420        55.8    2e-04    
gb|KGN55422.1|  hypothetical protein Csa_4G651880                     55.5    2e-04    
emb|CEG67582.1|  hypothetical protein RMATCC62417_03990               43.1    2e-04    
gb|EAZ45510.1|  hypothetical protein OsJ_30168                        55.5    2e-04    
ref|XP_003540687.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    2e-04    
gb|KFK28124.1|  hypothetical protein AALP_AA8G475600                  49.7    2e-04    
emb|CEG67583.1|  hypothetical protein RMATCC62417_03990               43.1    2e-04    
ref|XP_002303899.2|  pentatricopeptide repeat-containing family p...  55.1    2e-04    
ref|XP_009620051.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    2e-04    
ref|XP_009408746.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    2e-04    
ref|XP_002279589.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    2e-04    
ref|XP_002890377.1|  pentatricopeptide repeat-containing protein      55.5    2e-04    
ref|XP_001769572.1|  predicted protein                                49.3    2e-04    
ref|XP_010055285.1|  PREDICTED: pentatricopeptide repeat-containi...  46.6    3e-04    
gb|KHG04533.1|  hypothetical protein F383_29163                       55.5    3e-04    
ref|XP_009121882.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    3e-04    
ref|XP_004960775.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    3e-04    
emb|CDY67116.1|  BnaCnng53650D                                        55.1    3e-04    
ref|XP_004504624.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    3e-04    
emb|CDX69708.1|  BnaA10g20570D                                        55.5    3e-04    
ref|XP_006657717.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    3e-04    
ref|XP_003620268.1|  Pentatricopeptide repeat-containing protein      55.1    3e-04    
ref|XP_002870994.1|  pentatricopeptide repeat-containing protein      55.1    3e-04    
ref|XP_004960777.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    3e-04    
ref|NP_001047566.1|  Os02g0644600                                     55.1    3e-04    
ref|XP_011016889.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    3e-04    
ref|XP_009623644.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    3e-04    
gb|EMT14890.1|  hypothetical protein F775_06965                       53.9    3e-04    
gb|KDP29434.1|  hypothetical protein JCGZ_18355                       54.7    3e-04    
gb|KFK37390.1|  hypothetical protein AALP_AA4G251100                  55.1    3e-04    
ref|XP_010055077.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    3e-04    
ref|XP_009353718.1|  PREDICTED: putative pentatricopeptide repeat...  55.1    3e-04    
ref|XP_007012050.1|  Tetratricopeptide repeat-like superfamily pr...  55.1    3e-04    
ref|XP_009365209.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    3e-04    
gb|EEC73689.1|  hypothetical protein OsI_08260                        55.1    3e-04    
ref|XP_004144813.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    4e-04    
ref|XP_010448044.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    4e-04    
gb|EPS68986.1|  hypothetical protein M569_05781                       54.7    4e-04    
gb|KEH44326.1|  PPR containing plant-like protein                     54.7    4e-04    
ref|XP_010658442.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    4e-04    
ref|XP_009124196.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
ref|XP_004137128.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    4e-04    
ref|XP_003630793.1|  Pentatricopeptide repeat-containing protein      54.7    4e-04    
ref|XP_007147622.1|  hypothetical protein PHAVU_006G140100g           55.1    4e-04    
ref|XP_003530995.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    4e-04    
ref|XP_004497161.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
gb|KCW71754.1|  hypothetical protein EUGRSUZ_E00255                   45.8    4e-04    
ref|XP_002962506.1|  hypothetical protein SELMODRAFT_450632           55.1    4e-04    
ref|XP_010100903.1|  hypothetical protein L484_009673                 54.7    4e-04    
ref|XP_011096896.1|  PREDICTED: pentatricopeptide repeat-containi...  41.6    4e-04    
ref|XP_008459029.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  55.1    4e-04    
ref|XP_004236781.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
ref|XP_011002445.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    4e-04    
ref|XP_002518478.1|  pentatricopeptide repeat-containing protein,...  54.7    4e-04    
ref|XP_008389018.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
ref|XP_009344001.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    4e-04    
gb|ABA95188.1|  salt-inducible protein, putative                      55.1    4e-04    
ref|XP_004168722.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
gb|KFK37389.1|  hypothetical protein AALP_AA4G251100                  54.7    4e-04    
emb|CBI28459.3|  unnamed protein product                              47.0    4e-04    
ref|XP_006361415.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
emb|CDY50755.1|  BnaAnng10620D                                        54.7    4e-04    
ref|XP_004290060.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    4e-04    
gb|KFK25884.1|  hypothetical protein AALP_AA8G174800                  54.3    4e-04    
gb|EEE52515.1|  hypothetical protein OsJ_34721                        54.7    5e-04    
ref|XP_007158351.1|  hypothetical protein PHAVU_002G145400g           54.7    5e-04    
ref|XP_003548443.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    5e-04    
ref|XP_002869309.1|  hypothetical protein ARALYDRAFT_491552           38.1    5e-04    
ref|XP_004140465.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    5e-04    
ref|XP_001754834.1|  predicted protein                                54.3    5e-04    
gb|KFK27815.1|  hypothetical protein AALP_AA8G433500                  54.3    5e-04    
ref|XP_002985098.1|  hypothetical protein SELMODRAFT_121399           54.3    5e-04    
gb|ABK25404.1|  unknown                                               53.1    5e-04    
ref|XP_004237169.1|  PREDICTED: putative pentatricopeptide repeat...  54.7    5e-04    
ref|XP_010269231.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    5e-04    
ref|XP_004236307.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    5e-04    



>ref|XP_006340475.1| PREDICTED: uncharacterized protein LOC102579691 [Solanum tuberosum]
Length=890

 Score =  1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/702 (83%), Positives = 639/702 (91%), Gaps = 4/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  181   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEEDCKVGDHSNALTIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATT HFNCLLSVQATCGIPE+AFATFENMEYG+ +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  241   ATTSHFNCLLSVQATCGIPEIAFATFENMEYGDDHMKPDTETYNWVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN+RTY LLVECF+KYCVVREAIRHFR LKNFEGG ++L+N+G
Sbjct  301   DVAELLGMMVEDHKRLQPNVRTYALLVECFTKYCVVREAIRHFRGLKNFEGGTQVLYNDG  360

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             KYGD LSLYLRALCREGRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  361   KYGDSLSLYLRALCREGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  420

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARYVAEGGLTG+RKRWVPRRGKTPLDPDA+G+IYSNP ETSFKQRC EE
Sbjct  421   EAELGYEIDYIARYVAEGGLTGDRKRWVPRRGKTPLDPDAQGFIYSNPRETSFKQRCFEE  480

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WR++HRKLL TL NEGP+ILG +SE DY+R+ ERL+K++KGPEQ ALKPKAASKMIVSEL
Sbjct  481   WRLHHRKLLKTLLNEGPSILGKISEYDYIRIEERLRKVIKGPEQSALKPKAASKMIVSEL  540

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  541   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  600

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEG+TEFWKRRFLGEG +EN  QQ E+ DLE P     D+ A D    EA+++E E++E
Sbjct  601   LHEGNTEFWKRRFLGEGLSENYGQQSEIIDLE-PTDVVDDNDAVDDIAKEAEDDEAEDDE  659

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrr--srI  2258
              ++ E EVEQTE+Q E+GDR K+KEV+ AKPLQMIGVQLLKDSD T+SS K  RR  SR+
Sbjct  660   AQDEEEEVEQTESQPEIGDR-KDKEVEAAKPLQMIGVQLLKDSDLTASSSKKSRRRLSRV  718

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
              A+DDDD+DW PLDIHEA  E+RKRK+FDV DMYTI D WGWTWEKE+KNK PRRWSQEW
Sbjct  719   AAVDDDDDDWFPLDIHEAFVELRKRKVFDVSDMYTITDAWGWTWEKEIKNKAPRRWSQEW  778

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVELGI++M+KVI LGGTPTIGDCA+ILRAA+RAPMPSAFL+ILQ THSLGYVFGSPLYD
Sbjct  779   EVELGIKVMTKVIELGGTPTIGDCAMILRAAVRAPMPSAFLRILQTTHSLGYVFGSPLYD  838

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             EI++LCLDL ELDAA+AIVADLETSGI VPDETLDRVISAR 
Sbjct  839   EIIILCLDLGELDAAIAIVADLETSGIKVPDETLDRVISARQ  880


 Score =   229 bits (585),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 137/177 (77%), Gaps = 8/177 (5%)
 Frame = +2

Query  116  MAALLTQLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAED  295
            MA L   LPF  KF   +P    T   R+ G V  +VSS  RRTR+KKQQ   Q KT  D
Sbjct  1    MAGLSIHLPFNSKFNLPIPY---TSISRSIGSVKASVSSQPRRTRRKKQQQ-HQLKTV-D  55

Query  296  DDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIV  475
            DDG    MASGTEKVLRLVFMEELMERAR+AD +GVS VIYDMIAAGL PGPRSFHGL+V
Sbjct  56   DDGS---MASGTEKVLRLVFMEELMERARNADSAGVSQVIYDMIAAGLSPGPRSFHGLVV  112

Query  476  SHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            SHVL+ D +GAMHALRRELSEGLRPLHETF+AL+RLFG+ GLATRGLEILAAME L 
Sbjct  113  SHVLHRDNDGAMHALRRELSEGLRPLHETFLALVRLFGANGLATRGLEILAAMEKLN  169



>ref|XP_004237508.1| PREDICTED: uncharacterized protein LOC101246046 [Solanum lycopersicum]
Length=891

 Score =  1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/702 (82%), Positives = 638/702 (91%), Gaps = 4/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  182   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEEDCKVGDHSNALTIAYEMEAAGRM  241

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATT HFNCLLSVQA+CGIPE+AFATFENMEYG+ +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  242   ATTSHFNCLLSVQASCGIPEIAFATFENMEYGDDHMKPDTETYNWVIQAYTRAESYDRVQ  301

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN+RTY LLVECF+KYCVVREAIRHFR LKNFEGG ++L+N+G
Sbjct  302   DVAELLGMMVEDHKRLQPNVRTYALLVECFTKYCVVREAIRHFRGLKNFEGGTQVLYNDG  361

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             KYGDPLSLYLRALCREGRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  362   KYGDPLSLYLRALCREGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  421

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARYVAEGGLTG+RKRWVPRRGKTPLDPDA+G+IYSNP ETSFKQRC EE
Sbjct  422   EAELGYEIDYIARYVAEGGLTGDRKRWVPRRGKTPLDPDAQGFIYSNPRETSFKQRCFEE  481

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WR++HRKLL TL NEGP+ILG VSE DY+R+ ERL+K++KGPEQ ALKPKAASKM+VSEL
Sbjct  482   WRLHHRKLLKTLLNEGPSILGKVSEYDYIRIEERLRKVIKGPEQSALKPKAASKMVVSEL  541

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  542   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  601

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEG+TEFWKRRFLGEG +EN  QQ E+ DLE P     D+ A D    +A+++E E++E
Sbjct  602   LHEGNTEFWKRRFLGEGLSENYGQQSEIIDLE-PTDVVDDNDAVDDITKDAEDDEAEDDE  660

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrr--srI  2258
              ++ E EVEQTE+Q E+ DR K+KEV+ AKPLQMIGVQLLKDSD T+SS K  RR  SR+
Sbjct  661   AQDEEEEVEQTESQPEISDR-KDKEVEAAKPLQMIGVQLLKDSDLTASSSKKSRRRLSRV  719

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
              A+DDDD+DW PLDIHEA  E+RKRK+FDV DMYTI D WGWTWEKE+KNK PRRWSQEW
Sbjct  720   AAVDDDDDDWFPLDIHEAFVELRKRKVFDVSDMYTITDAWGWTWEKEIKNKAPRRWSQEW  779

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M+KVI LGGTPTIGDCA+ILR+A+RAPMPSAFLKILQ THSLGYVFGSPLYD
Sbjct  780   EVELAIKVMTKVIELGGTPTIGDCAMILRSAVRAPMPSAFLKILQTTHSLGYVFGSPLYD  839

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             EI++LCLDL ELDAA+AIVADLETSGI VPDETLDRVISAR 
Sbjct  840   EIIILCLDLGELDAAIAIVADLETSGIKVPDETLDRVISARQ  881


 Score =   225 bits (573),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 138/178 (78%), Gaps = 9/178 (5%)
 Frame = +2

Query  116  MAALLTQLPFKLKFTTTVPLRQRTFPPRTAG-RVVVAVSSPQRRTRKKKQQAPSQPKTAE  292
            MA L   LPF  KF   +P    T   R+ G RV  +VSS  R+TR+KKQQ   Q KT  
Sbjct  1    MAGLSIHLPFNSKFNLPIPY---TSISRSIGSRVKASVSSQPRKTRRKKQQQ-HQLKTV-  55

Query  293  DDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLI  472
            DDDG    MASGTEKVLRLVFMEELMERAR+AD +GVS VIYDMIAAGL PGPRSFHGL+
Sbjct  56   DDDGS---MASGTEKVLRLVFMEELMERARNADSAGVSQVIYDMIAAGLSPGPRSFHGLV  112

Query  473  VSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            V+HVL+ D +GAMHALRRELSEGLRPLHETF+AL+RLFG+ GLATRGLEILAAME L 
Sbjct  113  VAHVLHRDNDGAMHALRRELSEGLRPLHETFLALVRLFGANGLATRGLEILAAMEKLN  170



>ref|XP_011077071.1| PREDICTED: uncharacterized protein LOC105161164 [Sesamum indicum]
Length=896

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/702 (80%), Positives = 625/702 (89%), Gaps = 10/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR  HLE AN+VF KGA+GGLRATD++YDLLIEEDCK GDHSNALTIAYEME AGRM
Sbjct  192   EELVRGGHLEAANRVFLKGAEGGLRATDELYDLLIEEDCKVGDHSNALTIAYEMEGAGRM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  252   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  311

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVED+KRLQPN+RTY LLVECF+KYCV +EAIRHFRALK FEGG ++LHNEG
Sbjct  312   DVAELLGMMVEDYKRLQPNVRTYALLVECFTKYCVTKEAIRHFRALKYFEGGTKILHNEG  371

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             +YGDPLSLYLRALCREGRIVELLEALE + KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  372   QYGDPLSLYLRALCREGRIVELLEALETLSKDNQQIPPRAMILSRKYRTLVSSWIEPLQE  431

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELG+E+DYIARY+AEGGLTGERKRWVPRRGKTPLDPDAEG+IYSNPMETSFKQRCLEE
Sbjct  432   EAELGHEVDYIARYIAEGGLTGERKRWVPRRGKTPLDPDAEGFIYSNPMETSFKQRCLEE  491

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKLL TLRNEGPA+LGNVSESDY+RV ERLKKI+KGPEQ +LKPKAASKMIVSEL
Sbjct  492   WKIHHRKLLKTLRNEGPAVLGNVSESDYIRVEERLKKIIKGPEQSSLKPKAASKMIVSEL  551

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  552   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  611

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFW+RRFLGEG NEN ++ LEV D ++        +    + D  D+  +E E+
Sbjct  612   LEEGNTEFWRRRFLGEGLNENHNKPLEVEDYDV--------LDASDDADVGDDVVKEAED  663

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ--TssskksrrrsrI  2258
             +E  E + E  + +++VGDRVK+KE + AKP QMIGVQLLKDS+   +SS K  ++ SR+
Sbjct  664   DEVDEEDEEVEQNESQVGDRVKDKEAEAAKPPQMIGVQLLKDSEHSSSSSRKSKKKSSRV  723

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
             +  DDDD+DW P DIHEA KEMRKRK+FDV DMYTIAD WGWTWEKE KNK PR+WSQEW
Sbjct  724   SMEDDDDDDWFPEDIHEAFKEMRKRKVFDVSDMYTIADAWGWTWEKEFKNKAPRKWSQEW  783

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EV+L I+IM+KVI LGGTPTIGDCA++LRAAIRAPMPSAFL+ILQ TH LGYVFGSPLYD
Sbjct  784   EVDLAIKIMTKVIELGGTPTIGDCAMVLRAAIRAPMPSAFLQILQTTHQLGYVFGSPLYD  843

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             EI+ LCLDL E+DAA+AIV DLETSGI VPDETLDRVISAR 
Sbjct  844   EIISLCLDLGEIDAAIAIVTDLETSGIKVPDETLDRVISARQ  885


 Score =   207 bits (528),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 127/181 (70%), Gaps = 8/181 (4%)
 Frame = +2

Query  119  AALLTQLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDD  298
            ++LL   PF L  T+T   R        A     ++S+ QR++R+KKQ        + DD
Sbjct  3    SSLLPYAPFSLSLTSTSTPRNAV---ALAAAPFASMSTTQRKSRRKKQPNQQNDLKSSDD  59

Query  299  DG-----GGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFH  463
            +G      G    S  EK+LRLVFMEELMERAR   +SGVS VIYDMIAAGL PGPRSFH
Sbjct  60   NGYTGTAEGNFTPSSAEKLLRLVFMEELMERARSGSISGVSDVIYDMIAAGLTPGPRSFH  119

Query  464  GLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GL+VSHVLN D EGAMHALRRELSEGLRPLHETF+ALIRLFGSKG ATRGLEILAAME L
Sbjct  120  GLVVSHVLNRDEEGAMHALRRELSEGLRPLHETFIALIRLFGSKGHATRGLEILAAMEKL  179

Query  644  K  646
             
Sbjct  180  N  180



>ref|XP_002268094.2| PREDICTED: uncharacterized protein LOC100241547 [Vitis vinifera]
 emb|CBI28656.3| unnamed protein product [Vitis vinifera]
Length=884

 Score =  1091 bits (2822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/702 (80%), Positives = 619/702 (88%), Gaps = 10/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR NHLE+ANKVF KGAKGGLRAT+++YDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  177   EELVRHNHLEDANKVFLKGAKGGLRATNELYDLLIEEDCKVGDHSNALTIAYEMEAAGRM  236

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATT+HFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  237   ATTYHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  296

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVEC +KYCVVREAIRHFRALKNFEGG ++LH+EG
Sbjct  297   DVAELLGMMVEDHKRLQPNVKTYALLVECLTKYCVVREAIRHFRALKNFEGGTKVLHDEG  356

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELL+ALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  357   NFGDPLSLYLRALCREGRIVELLDALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  416

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+AEGGLTG+RKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  417   EAELGYEIDYIARYIAEGGLTGDRKRWVPRRGKTPLDPDALGFIYSNPMETSFKQRCLED  476

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W++YHRKLL TLRNEG A LG VSESDY+RV ERL+KI+KGP+Q ALKPKAASKMIVSEL
Sbjct  477   WKMYHRKLLKTLRNEGLAALGEVSESDYIRVEERLRKIIKGPDQNALKPKAASKMIVSEL  536

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  537   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  596

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGE       + ++  + ELP            + D  ++  +E E+
Sbjct  597   LQEGNTEFWKRRFLGEDLTVGRGKPMDKENSELP--------DVLDDADIGEDTAKEVED  648

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             +E  E E E   T+++V DRVK+KEV+ AKPLQMIGVQLLKDSDQT+ + +  RR    A
Sbjct  649   DEADEEEEEVEPTESQVADRVKDKEVEAAKPLQMIGVQLLKDSDQTTPATRKSRRKLSRA  708

Query  2265  Mdddd--edWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +D   +DW PLDIHEA KEMR+RKIFDV DMYTIADVWGWTWEKELKNKPPR W+QEW
Sbjct  709   SMEDSDDDDWFPLDIHEAFKEMRERKIFDVSDMYTIADVWGWTWEKELKNKPPRSWTQEW  768

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGGTPTIGDCA+ILRAAIRAP+PSAFLK+LQ TH LGYVFGSPLY+
Sbjct  769   EVELAIKVMLKVIELGGTPTIGDCAMILRAAIRAPLPSAFLKVLQTTHKLGYVFGSPLYN  828

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             E+++LCLDL ELDAA+AIVAD+ETSGI VPDETLDRVISAR 
Sbjct  829   EVIILCLDLGELDAAIAIVADMETSGIAVPDETLDRVISARQ  870


 Score =   184 bits (467),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 122/179 (68%), Gaps = 16/179 (9%)
 Frame = +2

Query  116  MAALLT--QLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTA  289
            M++LLT   LPFK  + T          PR    +  A+SSP+   R ++++   QPK  
Sbjct  1    MSSLLTYAHLPFKSPYPTN---------PRRTLTLTSAISSPE--KRPRRKKKTKQPK--  47

Query  290  EDDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGL  469
             +D        S  EK LRL FMEELMERAR AD +GVS V YDM+AAGL PGPRSFHGL
Sbjct  48   -EDSFVAVTAVSAGEKALRLTFMEELMERARSADTAGVSEVFYDMVAAGLSPGPRSFHGL  106

Query  470  IVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            IVS VLN D EGAM +LRRELS GLRPLHETFVALIRLFGSKG ATRGLEILAAME L 
Sbjct  107  IVSTVLNGDDEGAMQSLRRELSAGLRPLHETFVALIRLFGSKGYATRGLEILAAMEKLN  165



>ref|XP_010264001.1| PREDICTED: uncharacterized protein LOC104602125 isoform X1 [Nelumbo 
nucifera]
Length=902

 Score =  1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/703 (80%), Positives = 624/703 (89%), Gaps = 11/703 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHL++ANKVF +GAKGGL+ATD++YDLLIEEDCKAGDHSNALTIAYEMEAAGRM
Sbjct  197   EELVRSNHLDDANKVFLRGAKGGLKATDELYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  256

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  257   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  316

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TYVLLVECF+KYCV+ EAIRHFRALKN  GGM++L+NEG
Sbjct  317   DVAELLGMMVEDHKRLQPNVKTYVLLVECFTKYCVIGEAIRHFRALKNIPGGMKVLYNEG  376

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGR+VELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  377   SFGDPLSLYLRALCREGRVVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  436

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLEE
Sbjct  437   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDALGFIYSNPIETSFKQRCLEE  496

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              ++YHRKLL TLRNEG A LG+ SESDYLRV ERLKKI+KGP+Q ALKPKAASKMIVSEL
Sbjct  497   SKMYHRKLLKTLRNEGIAALGDASESDYLRVEERLKKIIKGPDQNALKPKAASKMIVSEL  556

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  557   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  616

Query  1905  LHEGDTEFWKRRFLGEGFNEN-DSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             L +G+TEFWKRRFLGEG N N D    ++ D EL D+    DV +DV  +  D+E +EEE
Sbjct  617   LEDGNTEFWKRRFLGEGLNGNHDKPDDDIEDSELQDMLNDTDVVEDVAKEGEDDEVDEEE  676

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTsssk--ksrrrsr  2255
             EE E      +        DRVK+KE +  KPLQMIGVQLLKDS+QT+S+     ++ SR
Sbjct  677   EEVEQTESPVE--------DRVKDKETEAVKPLQMIGVQLLKDSEQTNSTARKSKKKVSR  728

Query  2256  ITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             I+  DDDD+DW P DIHEALK MR+RKIFDV+DMYTIAD WGWTWE+ELK +PPRRWSQE
Sbjct  729   ISVEDDDDDDWFPEDIHEALKVMRERKIFDVQDMYTIADAWGWTWERELKKRPPRRWSQE  788

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL +++M KVI LGGTPTIGDCA+ILRAAI+AP+PSAFLKIL+ THSLGY+FGSPLY
Sbjct  789   WEVELAMKVMQKVIELGGTPTIGDCAMILRAAIKAPLPSAFLKILRTTHSLGYIFGSPLY  848

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DEI+ LCLD+ ELDAA+AIVAD+ET+GI VPD+TLDRV+SAR 
Sbjct  849   DEIISLCLDIGELDAAIAIVADMETTGITVPDQTLDRVLSARQ  891


 Score =   167 bits (423),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRL FMEELMERAR  DV+GVS V+YDMIAAGL PGPRSFHGLIV+H L  D EGAM
Sbjct  81   EKGLRLSFMEELMERARSRDVAGVSEVMYDMIAAGLNPGPRSFHGLIVAHALIGDDEGAM  140

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             +LRRELS GLRP+HETF+ALIRLFGSKG ATRGLEILAAME L 
Sbjct  141  QSLRRELSAGLRPIHETFIALIRLFGSKGHATRGLEILAAMEKLN  185



>gb|KDP23754.1| hypothetical protein JCGZ_23587 [Jatropha curcas]
Length=890

 Score =  1074 bits (2777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/702 (78%), Positives = 625/702 (89%), Gaps = 3/702 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++ +LE+ANKVF KGAKGGL+ TD++YD LIEEDCK GDHSNAL I+YEMEAAGRM
Sbjct  178   EELVKNKYLEDANKVFLKGAKGGLKGTDELYDRLIEEDCKVGDHSNALEISYEMEAAGRM  237

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATF+NMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  238   ATTFHFNCLLSVQATCGIPEIAFATFKNMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  297

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN+RTY LL+ECF+KYCVVREAIRHFRAL+NFEGG ++LHNEG
Sbjct  298   DVAELLGMMVEDHKRLQPNVRTYALLIECFTKYCVVREAIRHFRALRNFEGGTKVLHNEG  357

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELLEALE M KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  358   NFGDPLSLYLRALCREGRIVELLEALETMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  417

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  418   EAELGYEIDYVARYIAEGGLTGERKRWVPRRGKTPLDPDAAGFIYSNPMETSFKQRCLED  477

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              +++HRKL  TL+NEGPA+LG+ SESDYLRV ERLKKI+KGP+Q  LKPKAASKM+VSEL
Sbjct  478   LKVHHRKLWRTLQNEGPAVLGDASESDYLRVVERLKKIIKGPDQNVLKPKAASKMVVSEL  537

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  538   KEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  597

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG N+N  + + +N  EL D     D A++  + + +++ E+EE 
Sbjct  598   LEEGNTEFWKRRFLGEGLNDNHVKPMNMNKSELSDTLDDIDAAEEDVEKDVEDDVEDEEA  657

Query  2085  eeeveveveqtetqaevGDR-VKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             +++ EVEVE  +T+++ GDR VK+KEV+  KPLQMIGVQLLKDSDQT+ + K  +R    
Sbjct  658   DDDEEVEVEVEQTESQEGDRVVKDKEVEAKKPLQMIGVQLLKDSDQTNRTSKKSKRRSAR  717

Query  2262  AMdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             A  +   DEDW P DI EA KE+R+RK+FDV+DMYTIAD WGWTWE+E+KN+PP++WSQE
Sbjct  718   ASLEDDADEDWFPEDIFEAFKELRERKVFDVQDMYTIADAWGWTWEREIKNRPPQKWSQE  777

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL I++M KVI LGGTPTIGDCA+ILRAAIRAPMPSAFLKILQ THSLGY FGSPLY
Sbjct  778   WEVELAIKVMLKVIELGGTPTIGDCAMILRAAIRAPMPSAFLKILQTTHSLGYAFGSPLY  837

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             +E++ LCLDL ELDAA+AIVAD+ET+GI VPD+TLDRVISAR
Sbjct  838   NEVISLCLDLGELDAAIAIVADMETTGITVPDQTLDRVISAR  879


 Score =   187 bits (474),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 121/177 (68%), Gaps = 13/177 (7%)
 Frame = +2

Query  116  MAALLTQLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAED  295
            + +LLT   FKL          R+FP +       A S+ + ++R+KKQQ   Q +  + 
Sbjct  3    IVSLLTPPLFKL----------RSFPSQNTVVYAAATSTAEPKSRRKKQQ---QQRLDKS  49

Query  296  DDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIV  475
            DD G     S  EK LR  FMEELMERAR+ D  GVS VIYDM+AAGL PGPRSFHGLIV
Sbjct  50   DDFGILGAVSAAEKNLRFSFMEELMERARNRDSVGVSDVIYDMVAAGLSPGPRSFHGLIV  109

Query  476  SHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            +H LN DVEGAM +LRRELS G+RPLHETF+ALIRLFG+KG ATR LEIL+AME L 
Sbjct  110  AHALNGDVEGAMQSLRRELSTGIRPLHETFIALIRLFGTKGHATRALEILSAMEKLN  166



>gb|EYU39532.1| hypothetical protein MIMGU_mgv1a001059mg [Erythranthe guttata]
Length=900

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/700 (79%), Positives = 624/700 (89%), Gaps = 5/700 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV+S+HLE+AN+VF KGA+GGLRATD++YDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  192   EELVKSSHLEDANRVFLKGAEGGLRATDELYDLLIEEDCKVGDHSNALTIAYEMEAAGRM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATT HFNCLLS QATCGIPE+AF+TFENMEYGEA+MKPDTE+YNWVIQA+TRAESYDRVQ
Sbjct  252   ATTSHFNCLLSCQATCGIPEIAFSTFENMEYGEAFMKPDTESYNWVIQAFTRAESYDRVQ  311

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVED+KRLQPN+RTY LLVECF+KYCV +EAIRHFR LKNFEGG  LLHN+G
Sbjct  312   DVAELLGMMVEDYKRLQPNVRTYALLVECFTKYCVTKEAIRHFRGLKNFEGGTVLLHNDG  371

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             ++GDPLSLYLRALCREGRIVEL++ALE M +DNQ IP RAMILSRKYRTLVSSWIEPLQE
Sbjct  372   QHGDPLSLYLRALCREGRIVELIDALETMERDNQQIPARAMILSRKYRTLVSSWIEPLQE  431

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELG+E+DY+AR++AEGGLTGERKRWVPRRGKTPLDPDA+G+IY++PME SFKQRCLEE
Sbjct  432   EAELGHEVDYVARFIAEGGLTGERKRWVPRRGKTPLDPDADGFIYNSPMENSFKQRCLEE  491

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WRI+HRKLL TL NEGPAILGNVSESDY RV ERLKKI+KGPEQ ALKPKAASKM+VSEL
Sbjct  492   WRIHHRKLLRTLWNEGPAILGNVSESDYNRVVERLKKIIKGPEQSALKPKAASKMVVSEL  551

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  552   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  611

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFW+RRFLGEG  EN ++ LEV D ++           DV DD  D+  +E E+
Sbjct  612   LEEGNTEFWRRRFLGEGLTENHNKPLEVEDYDV----LDVTDDADVGDDVGDDVAKEGED  667

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             +E  E + E  +T+  VGDR K+KE+ TAKPLQMIGVQLLKDSDQT+ S + +RRS   +
Sbjct  668   DEVDEEDEEVEQTEIRVGDRAKDKEIDTAKPLQMIGVQLLKDSDQTTRSSRKKRRSSRVS  727

Query  2265  M-ddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             M DDDD+DW P D+ EA KE+R+RK+FDVEDMYTIAD WGWTWEK+ KNK PRRWSQEWE
Sbjct  728   MEDDDDDDWFPEDLQEAFKELRERKVFDVEDMYTIADAWGWTWEKDFKNKAPRRWSQEWE  787

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I++M+KVI LGGTPTIGDCA++LRAAIRAPMPSAFL+ILQ TH LGYVFGSPLYDE
Sbjct  788   VELAIKLMTKVIELGGTPTIGDCAVVLRAAIRAPMPSAFLQILQTTHRLGYVFGSPLYDE  847

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             I+ LCLDL ELDA++AIVADLETSGI VPDETLDRVISAR
Sbjct  848   IISLCLDLGELDASIAIVADLETSGIKVPDETLDRVISAR  887


 Score =   212 bits (540),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 127/181 (70%), Gaps = 8/181 (4%)
 Frame = +2

Query  119  AALLTQLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDD  298
            ++LLT  PF L F +    R        A     ++SSPQR++R+KKQQ       + DD
Sbjct  3    SSLLTYAPFSLSFVSVSAPRNSV---AHAAAQFASISSPQRKSRRKKQQNQPNDLKSSDD  59

Query  299  DG-----GGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFH  463
             G      G    S  EK+LRLVFMEELMERAR   V GVS VIYDMIAAGL PGPRSFH
Sbjct  60   SGYSGGSDGNFTPSSAEKLLRLVFMEELMERARSGSVLGVSDVIYDMIAAGLTPGPRSFH  119

Query  464  GLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GL+VSHVLN D EGAMHALRR+LSEG+RPLHETF+AL+RLFGSKG ATRGLEILAAME L
Sbjct  120  GLVVSHVLNRDAEGAMHALRRQLSEGIRPLHETFLALVRLFGSKGHATRGLEILAAMEKL  179

Query  644  K  646
             
Sbjct  180  N  180



>ref|XP_010264002.1| PREDICTED: uncharacterized protein LOC104602125 isoform X2 [Nelumbo 
nucifera]
Length=765

 Score =  1073 bits (2774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/703 (80%), Positives = 624/703 (89%), Gaps = 11/703 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHL++ANKVF +GAKGGL+ATD++YDLLIEEDCKAGDHSNALTIAYEMEAAGRM
Sbjct  60    EELVRSNHLDDANKVFLRGAKGGLKATDELYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  119

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  120   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  179

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TYVLLVECF+KYCV+ EAIRHFRALKN  GGM++L+NEG
Sbjct  180   DVAELLGMMVEDHKRLQPNVKTYVLLVECFTKYCVIGEAIRHFRALKNIPGGMKVLYNEG  239

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGR+VELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  240   SFGDPLSLYLRALCREGRVVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  299

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLEE
Sbjct  300   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDALGFIYSNPIETSFKQRCLEE  359

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              ++YHRKLL TLRNEG A LG+ SESDYLRV ERLKKI+KGP+Q ALKPKAASKMIVSEL
Sbjct  360   SKMYHRKLLKTLRNEGIAALGDASESDYLRVEERLKKIIKGPDQNALKPKAASKMIVSEL  419

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  420   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  479

Query  1905  LHEGDTEFWKRRFLGEGFNEN-DSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             L +G+TEFWKRRFLGEG N N D    ++ D EL D+    DV +DV  +  D+E +EEE
Sbjct  480   LEDGNTEFWKRRFLGEGLNGNHDKPDDDIEDSELQDMLNDTDVVEDVAKEGEDDEVDEEE  539

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTsssk--ksrrrsr  2255
             EE E      +        DRVK+KE +  KPLQMIGVQLLKDS+QT+S+     ++ SR
Sbjct  540   EEVEQTESPVE--------DRVKDKETEAVKPLQMIGVQLLKDSEQTNSTARKSKKKVSR  591

Query  2256  ITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             I+  DDDD+DW P DIHEALK MR+RKIFDV+DMYTIAD WGWTWE+ELK +PPRRWSQE
Sbjct  592   ISVEDDDDDDWFPEDIHEALKVMRERKIFDVQDMYTIADAWGWTWERELKKRPPRRWSQE  651

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL +++M KVI LGGTPTIGDCA+ILRAAI+AP+PSAFLKIL+ THSLGY+FGSPLY
Sbjct  652   WEVELAMKVMQKVIELGGTPTIGDCAMILRAAIKAPLPSAFLKILRTTHSLGYIFGSPLY  711

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DEI+ LCLD+ ELDAA+AIVAD+ET+GI VPD+TLDRV+SAR 
Sbjct  712   DEIISLCLDIGELDAAIAIVADMETTGITVPDQTLDRVLSARQ  754


 Score = 80.1 bits (196),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  509  MHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            M +LRRELS GLRP+HETF+ALIRLFGSKG ATRGLEILAAME L 
Sbjct  3    MQSLRRELSAGLRPIHETFIALIRLFGSKGHATRGLEILAAMEKLN  48



>ref|XP_010102182.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
 gb|EXB93125.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
Length=895

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/707 (78%), Positives = 620/707 (88%), Gaps = 7/707 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF +GAKGGLRATD++YDL+I EDCKAGDHSNAL IAYEMEAAGRM
Sbjct  174   EELVRSNHLEDANKVFLRGAKGGLRATDEVYDLMIVEDCKAGDHSNALEIAYEMEAAGRM  233

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFN LLSVQATCGIPE+AF+TFENM+YGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  234   ATTFHFNWLLSVQATCGIPEIAFSTFENMQYGEEFMKPDTETYNWVIQAYTRAESYDRVQ  293

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLG+MVEDHKRLQPNM+T+ LLVECF+KYCV+ EAIRHFRAL+NFEGG  +LHNEG
Sbjct  294   DVAELLGIMVEDHKRLQPNMKTHALLVECFTKYCVIGEAIRHFRALRNFEGGTIVLHNEG  353

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELLEALEAM+KDNQ IPPRAM+LS+KYRTLVSSWIEPLQ+
Sbjct  354   NFGDPLSLYLRALCREGRIVELLEALEAMVKDNQPIPPRAMLLSKKYRTLVSSWIEPLQD  413

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+AEGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  414   EAELGYEIDYIARYIAEGGLTGERKRWVPRRGKTPLDPDAAGFIYSNPMETSFKQRCLED  473

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+ Y+RKLL TLRNEG A+LG+ SESDY+RV ERL KIV+GPEQ  LKPKAASKMIVSEL
Sbjct  474   WKTYNRKLLRTLRNEGIAVLGDASESDYIRVEERLLKIVRGPEQNVLKPKAASKMIVSEL  533

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLWIPPVEEEEEEVDE+LDELISRIK
Sbjct  534   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWIPPVEEEEEEVDEDLDELISRIK  593

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdved------deadee  2066
             L EG+TEFWKRRFLGEG N ++     +   E  DV+   D+ +D          +AD+ 
Sbjct  594   LQEGNTEFWKRRFLGEGLNGDNGNSTSMGRAEFADVDVDADIVEDSAKEVEDDEADADDN  653

Query  2067  eeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrr  2246
             +EEEEEEEEVE      +T+++  +RVKEK+V   KPLQMIGVQLLKDSD+T+ S K  R
Sbjct  654   DEEEEEEEEVEEVDVVEQTESQDAERVKEKQVAAKKPLQMIGVQLLKDSDETTPSSKKSR  713

Query  2247  rsrITAMd-dddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRR  2423
             R     ++ D D+DW P DI EA KE+RKRK+FDV+DMYT+AD WGWTWEK+L N+PPRR
Sbjct  714   RRASRVVEDDADDDWFPEDIFEAFKELRKRKVFDVDDMYTLADAWGWTWEKDLDNRPPRR  773

Query  2424  WSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             WSQEWEVEL I++M K+I LGGTPTIGDCA+ILRAAIRAP+PSAFLKILQ THSLGYVFG
Sbjct  774   WSQEWEVELAIKVMLKIIELGGTPTIGDCAMILRAAIRAPLPSAFLKILQTTHSLGYVFG  833

Query  2604  SPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             SPLYDEI+ LCLDL ELDAA+AIVADLET+ I VPDETLDRVI+AR 
Sbjct  834   SPLYDEIISLCLDLGELDAAIAIVADLETTSIAVPDETLDRVIAARQ  880


 Score =   164 bits (416),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = +2

Query  293  DDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLI  472
            DDD       S  EK LR  FMEELMERAR+ D +GVS VIYDM+AAGL PGPRSFHGLI
Sbjct  52   DDD-------SAAEKGLRFTFMEELMERARNRDAAGVSDVIYDMVAAGLTPGPRSFHGLI  104

Query  473  VSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            V+H L+ D E AM +LRRELS GLRPL ETFVALIR+FGSKG AT+G+EILAAME L 
Sbjct  105  VAHALSGDAEAAMQSLRRELSAGLRPLQETFVALIRMFGSKGRATKGMEILAAMEKLN  162



>gb|KHG29467.1| hypothetical protein F383_10624 [Gossypium arboreum]
Length=894

 Score =  1055 bits (2728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/707 (79%), Positives = 619/707 (88%), Gaps = 24/707 (3%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+AN VF KGAKGGLRAT+++YDL+IEEDCKAGDHSNAL IAYEMEAAGRM
Sbjct  184   EELVRNKYLEDANAVFLKGAKGGLRATNELYDLMIEEDCKAGDHSNALEIAYEMEAAGRM  243

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  244   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEEYMKPDTETYNWVIQAYTRAESYDRVQ  303

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYCVVREAIRHF ALKN+EGG  +LHNEG
Sbjct  304   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVVREAIRHFLALKNYEGGTIVLHNEG  363

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSL+LRALCREGR+VELL+ALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  364   NFDDPLSLFLRALCREGRVVELLQALEAMSKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  423

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLEE
Sbjct  424   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDATGFIYSNPMETSFKQRCLEE  483

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+IYHRKLL TL+NEG A LG+ +ESDY+RV ERL+KI+KGP+Q  LKPKAASKM+VSEL
Sbjct  484   WKIYHRKLLKTLQNEGLAALGDATESDYMRVVERLRKIIKGPDQNVLKPKAASKMVVSEL  543

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  544   KEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  603

Query  1905  LHEGDTEFWKRRFLGEGFNEN-----DSQQLEVNDLELPdvetvddvakdveddeadeee  2069
             L EG+TEFWKRRFLGEG N N     D  + E  D EL + + V+D AKD+E++E +EEE
Sbjct  604   LEEGNTEFWKRRFLGEGLNVNQVKLIDEDESEAADDELDESDVVEDAAKDIEEEEGEEEE  663

Query  2070  eeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTss--skksr  2243
             E E+ E +               DR+K+KEV+  KPLQMIGVQLLKDSDQT++   K  R
Sbjct  664   EVEQTESQEV-------------DRIKDKEVEAKKPLQMIGVQLLKDSDQTTTRSKKSRR  710

Query  2244  rrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRR  2423
             R SR++  DDDDEDW P DI EA +EMR RK+FDVEDMYTIAD WGWTWE+ELKNKPPRR
Sbjct  711   RSSRVSVEDDDDEDWFPEDIFEAFQEMRDRKVFDVEDMYTIADAWGWTWERELKNKPPRR  770

Query  2424  WSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             WSQEWEVEL I+    VI LGGTPTIGDCA+ILRAAI+AP+PSAFLKILQ THSLGYVFG
Sbjct  771   WSQEWEVELAIQ----VIELGGTPTIGDCAMILRAAIKAPVPSAFLKILQKTHSLGYVFG  826

Query  2604  SPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             SPLYDE++ LC+DL ELDAA+AIVADLET+GI VPD+TLDRVISAR 
Sbjct  827   SPLYDEVISLCIDLGELDAAIAIVADLETTGIAVPDQTLDRVISARQ  873


 Score =   175 bits (444),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 115/162 (71%), Gaps = 9/162 (6%)
 Frame = +2

Query  185  TFPPRTAGR--VVVAVSSPQRR---TRKKKQQAPSQPK---TAEDDDGGGALMASGTEKV  340
            + PP +  R  VV A  S Q+R   +R+KK+Q P + K    A      G+   S  EK 
Sbjct  12   SVPPLSGHRNAVVFATISTQKRKTSSRRKKRQ-PQENKDEGNATFSSSNGSTAVSALEKS  70

Query  341  LRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHAL  520
            LRL FMEELM++AR  D  GVS VIYDMIAAGL PGPRSFHGL+V+HVL  DVEGA+ AL
Sbjct  71   LRLTFMEELMQKARSRDTVGVSDVIYDMIAAGLTPGPRSFHGLVVAHVLTGDVEGALQAL  130

Query  521  RRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            RREL  G+RPLHET V+++RLFGSKGLAT+GLE+LAAME L 
Sbjct  131  RRELGVGVRPLHETLVSMVRLFGSKGLATKGLEVLAAMEKLN  172



>ref|XP_010043321.1| PREDICTED: uncharacterized protein LOC104432558 [Eucalyptus grandis]
Length=905

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/702 (78%), Positives = 606/702 (86%), Gaps = 9/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRS HLE+AN VF KG K GLRATD++YD LI+EDCK GDHSNAL I YEMEAAGRM
Sbjct  200   EELVRSKHLEDANDVFLKGGKNGLRATDELYDFLIQEDCKVGDHSNALEICYEMEAAGRM  259

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENME+GE YMKPDTE+YNWVIQAYTRAESYDRVQ
Sbjct  260   ATTFHFNCLLSVQATCGIPEIAFATFENMEFGEDYMKPDTESYNWVIQAYTRAESYDRVQ  319

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYCV+REAIRHFRAL+NFEGG ++LHNEG
Sbjct  320   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVMREAIRHFRALQNFEGGTKVLHNEG  379

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  380   NFGDPLSLYLRALCREGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  439

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY AEGGLTGERKRWVPRRGKTPLDPD  G+IYSNPMETSFKQRCLE+
Sbjct  440   EAELGYEIDYIARYEAEGGLTGERKRWVPRRGKTPLDPDVAGFIYSNPMETSFKQRCLED  499

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WR++HRKLL TL  EG A+LG+ SE DY+RV ERL+K +KGP+Q  LKPKAASKM VSEL
Sbjct  500   WRMHHRKLLKTLLYEGLAVLGDASEYDYIRVEERLRKTIKGPDQNVLKPKAASKMTVSEL  559

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQDLPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  560   KEELEAQDLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  619

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG + +  + +EV  +E+           D  D   D  ++ E+E
Sbjct  620   LEEGNTEFWKRRFLGEGMDRSQGKTIEVEQVEV-------SDLMDDVDAAEDAVKDVEDE  672

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             E + E EVEQTET+   G+RVK KE +  KPLQMIGVQLLKDSDQT++S K  RR    A
Sbjct  673   EGDEEEEVEQTETEIPDGERVKYKEAEAKKPLQMIGVQLLKDSDQTTTSTKKSRRKVSRA  732

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +   DEDW PLDI EA KE+R+RK+FDV DMYTIAD WGWTWE+ELK++PP+RWSQEW
Sbjct  733   SVEDDKDEDWFPLDIFEAFKELRERKVFDVSDMYTIADAWGWTWERELKSRPPQRWSQEW  792

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I+ M KVI LGG PTIGDCA+ILRAAIRAP+PSAFLKILQ THSLGYV GSPLYD
Sbjct  793   EVELAIKTMQKVIELGGQPTIGDCAMILRAAIRAPLPSAFLKILQTTHSLGYVLGSPLYD  852

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             EI+ LCLDL ELDAAVAIVAD+ET+GI VPD TLDRVISAR 
Sbjct  853   EIISLCLDLGELDAAVAIVADMETAGITVPDHTLDRVISARQ  894


 Score =   173 bits (439),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRL FMEELM RAR  DV+GVS VIYDMIAAGL PGPRSFHGL+VSHVLN DVEGAM
Sbjct  84   EKSLRLAFMEELMTRARGGDVAGVSEVIYDMIAAGLSPGPRSFHGLVVSHVLNGDVEGAM  143

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            H+LRRELS GLRP+HETF++LIRLFGSKG + RG+EILAAME L 
Sbjct  144  HSLRRELSAGLRPVHETFISLIRLFGSKGYSRRGMEILAAMEKLN  188



>gb|KCW85329.1| hypothetical protein EUGRSUZ_B02168 [Eucalyptus grandis]
Length=883

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/702 (78%), Positives = 606/702 (86%), Gaps = 9/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRS HLE+AN VF KG K GLRATD++YD LI+EDCK GDHSNAL I YEMEAAGRM
Sbjct  178   EELVRSKHLEDANDVFLKGGKNGLRATDELYDFLIQEDCKVGDHSNALEICYEMEAAGRM  237

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENME+GE YMKPDTE+YNWVIQAYTRAESYDRVQ
Sbjct  238   ATTFHFNCLLSVQATCGIPEIAFATFENMEFGEDYMKPDTESYNWVIQAYTRAESYDRVQ  297

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYCV+REAIRHFRAL+NFEGG ++LHNEG
Sbjct  298   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVMREAIRHFRALQNFEGGTKVLHNEG  357

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  358   NFGDPLSLYLRALCREGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  417

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY AEGGLTGERKRWVPRRGKTPLDPD  G+IYSNPMETSFKQRCLE+
Sbjct  418   EAELGYEIDYIARYEAEGGLTGERKRWVPRRGKTPLDPDVAGFIYSNPMETSFKQRCLED  477

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WR++HRKLL TL  EG A+LG+ SE DY+RV ERL+K +KGP+Q  LKPKAASKM VSEL
Sbjct  478   WRMHHRKLLKTLLYEGLAVLGDASEYDYIRVEERLRKTIKGPDQNVLKPKAASKMTVSEL  537

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQDLPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  538   KEELEAQDLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  597

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG + +  + +EV  +E+           D  D   D  ++ E+E
Sbjct  598   LEEGNTEFWKRRFLGEGMDRSQGKTIEVEQVEV-------SDLMDDVDAAEDAVKDVEDE  650

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             E + E EVEQTET+   G+RVK KE +  KPLQMIGVQLLKDSDQT++S K  RR    A
Sbjct  651   EGDEEEEVEQTETEIPDGERVKYKEAEAKKPLQMIGVQLLKDSDQTTTSTKKSRRKVSRA  710

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +   DEDW PLDI EA KE+R+RK+FDV DMYTIAD WGWTWE+ELK++PP+RWSQEW
Sbjct  711   SVEDDKDEDWFPLDIFEAFKELRERKVFDVSDMYTIADAWGWTWERELKSRPPQRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I+ M KVI LGG PTIGDCA+ILRAAIRAP+PSAFLKILQ THSLGYV GSPLYD
Sbjct  771   EVELAIKTMQKVIELGGQPTIGDCAMILRAAIRAPLPSAFLKILQTTHSLGYVLGSPLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             EI+ LCLDL ELDAAVAIVAD+ET+GI VPD TLDRVISAR 
Sbjct  831   EIISLCLDLGELDAAVAIVADMETAGITVPDHTLDRVISARQ  872


 Score =   174 bits (440),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRL FMEELM RAR  DV+GVS VIYDMIAAGL PGPRSFHGL+VSHVLN DVEGAM
Sbjct  62   EKSLRLAFMEELMTRARGGDVAGVSEVIYDMIAAGLSPGPRSFHGLVVSHVLNGDVEGAM  121

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            H+LRRELS GLRP+HETF++LIRLFGSKG + RG+EILAAME L 
Sbjct  122  HSLRRELSAGLRPVHETFISLIRLFGSKGYSRRGMEILAAMEKLN  166



>ref|XP_008443746.1| PREDICTED: uncharacterized protein LOC103487261 isoform X1 [Cucumis 
melo]
Length=899

 Score =  1050 bits (2715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/701 (77%), Positives = 610/701 (87%), Gaps = 11/701 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+ANKVF KGAK GLRATD+IYDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  180   EELVRNKYLEDANKVFLKGAKAGLRATDKIYDLMIEEDCKAGDHSNALEISYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  299

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPNMRTY LLVECF+KYCV+REAIRHFRALK F+GG + LHNEG
Sbjct  300   DVAELLGMMVEDHKRLQPNMRTYALLVECFTKYCVIREAIRHFRALKTFQGGTKALHNEG  359

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGR+++LLEALEAM +DNQ IPPRAMILSRKYR+LVSSWIEPLQE
Sbjct  360   NFGDPLSLYLRALCREGRVLDLLEALEAMARDNQQIPPRAMILSRKYRSLVSSWIEPLQE  419

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAE G+EIDYIARY+ EGGLTGERKRWVPR+GKTPLDPDA+G+IYSNPMETSFKQRCLE+
Sbjct  420   EAEHGFEIDYIARYIEEGGLTGERKRWVPRKGKTPLDPDADGFIYSNPMETSFKQRCLED  479

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W++YHRK+L TL+NEG   L + SE+DY RV E+LKKI+KGP+Q  LKPKAASKMIVSEL
Sbjct  480   WKMYHRKILKTLQNEGLVALRDASEADYHRVVEKLKKIIKGPDQNVLKPKAASKMIVSEL  539

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  540   KEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  599

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEG+TEFWKRRFLGEG + N+ +         P  +   D    ++D +  E+  +E E
Sbjct  600   LHEGNTEFWKRRFLGEGLDSNNVK---------PSEDDKSDSLDSLDDVDTIEDVAKEIE  650

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             EEE E E E  +T+ + G+RV +KEV+  KPLQMIGVQLLKD DQ +++ K  RR    A
Sbjct  651   EEEAEEEEEVEQTENQDGERVIKKEVEAKKPLQMIGVQLLKDVDQPTATSKKSRRRSSRA  710

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +   DEDW P DI EA KE++KRK+FDV DMYTIADVWGWTWE+ELKN+PPRRWSQEW
Sbjct  711   SLEDDRDEDWFPEDIFEAFKELQKRKVFDVSDMYTIADVWGWTWERELKNRPPRRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I+IM KVI LGGTPTIGDCA+ILRAAI+AP+PSAFLKILQ TH LGYVFGSPLYD
Sbjct  771   EVELAIKIMHKVIELGGTPTIGDCAMILRAAIKAPLPSAFLKILQTTHGLGYVFGSPLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             E++ LCLDL ELDAA+AIVADLET+GI+VPDETLDRVIS R
Sbjct  831   EVITLCLDLGELDAAIAIVADLETTGILVPDETLDRVISTR  871


 Score =   185 bits (470),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +2

Query  164  TVPLRQRTFPPRTAGRVVVAV-SSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKV  340
            T+P   R+F        + +V S+P +R RKK+Q    Q    +DDD      ++  E  
Sbjct  13   TLPYNHRSFSLNHGLLPIRSVLSAPDKRGRKKRQSRHQQQLQLKDDD------STSLENS  66

Query  341  LRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHAL  520
            LR  FMEELM+RAR+ D  GVS VIYDM+AAGL PGPRSFHGL+VSH LN D EGAM +L
Sbjct  67   LRFTFMEELMDRARNHDPLGVSDVIYDMVAAGLSPGPRSFHGLVVSHTLNGDTEGAMQSL  126

Query  521  RRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            RRELS GLRPLHETFVAL+RLFGSKGLA RGLEILAAME L 
Sbjct  127  RRELSSGLRPLHETFVALVRLFGSKGLANRGLEILAAMERLN  168



>ref|XP_006443293.1| hypothetical protein CICLE_v10023441mg [Citrus clementina]
 ref|XP_006478982.1| PREDICTED: uncharacterized protein LOC102630853 isoform X1 [Citrus 
sinensis]
 gb|ESR56533.1| hypothetical protein CICLE_v10023441mg [Citrus clementina]
Length=887

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/701 (78%), Positives = 612/701 (87%), Gaps = 6/701 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+ANKVF +GAKGGLRATD+IYDL+I EDCKAGDHSNAL IAYEMEAAGRM
Sbjct  181   EELVRNKYLEDANKVFLRGAKGGLRATDEIYDLMIAEDCKAGDHSNALEIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFN LLS QATCGIPEVAFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  241   ATTFHFNHLLSCQATCGIPEVAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMM EDHKRLQPN++TY LLVECF+KYC V EAIRHFRAL+N+EGG ++LHNEG
Sbjct  301   DVAELLGMMFEDHKRLQPNVKTYALLVECFTKYCAVTEAIRHFRALQNYEGGTKVLHNEG  360

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI+ELLEALEAM KDNQ +PPRAMILSRKYRTLVSSWIEPLQE
Sbjct  361   NFGDPLSLYLRALCREGRIIELLEALEAMAKDNQPVPPRAMILSRKYRTLVSSWIEPLQE  420

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY++EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  421   EAELGYEIDYIARYISEGGLTGERKRWVPRRGKTPLDPDAVGFIYSNPMETSFKQRCLED  480

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              + YHRKLL TL+NEGPA+LG+VSESDY+RV ERLKK++KGPEQ  LKPKAASKM+VSEL
Sbjct  481   GKKYHRKLLRTLQNEGPAVLGDVSESDYVRVEERLKKLIKGPEQHVLKPKAASKMVVSEL  540

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEEL+AQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRIK
Sbjct  541   KEELDAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIK  600

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG N    + +E+++ EL DV   D    +    + + +EE +EE
Sbjct  601   LEEGNTEFWKRRFLGEGLNGRHDKAVEMDESELSDVLDDDVTDVEYVAKDEEADEEADEE  660

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             EE  + E E  +      DRVKEK V+  KPLQMIGVQLLKDSDQT+++ K   +     
Sbjct  661   EEVEQAEPESQDV-----DRVKEKLVEAKKPLQMIGVQLLKDSDQTTTTSKRSMKRSSRM  715

Query  2265  Md-dddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             ++ DDDEDW P D  EA KEMRKRK+FDV DMYTIAD WGWTWE+E+KN+PP++WSQEWE
Sbjct  716   VEDDDDEDWFPEDPFEAFKEMRKRKVFDVSDMYTIADAWGWTWEREIKNRPPQKWSQEWE  775

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I+IM KVI LGG PTIGDCA+I+ AAIRAP+PSAFLKILQ THSLGYVFGSPLYDE
Sbjct  776   VELAIQIMLKVIELGGMPTIGDCAVIIHAAIRAPLPSAFLKILQKTHSLGYVFGSPLYDE  835

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAAVAIVAD+ET+GI VPD+TLDRVI+AR 
Sbjct  836   IISLCLDLGELDAAVAIVADMETTGIAVPDQTLDRVITARQ  876


 Score =   159 bits (401),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  317  MASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLD  496
            + S  E+ LRL+FMEELM+ AR+ D   V+ VIYDMIAAGL PGPRSFHGL+V++ LN D
Sbjct  60   VVSAAEQGLRLIFMEELMQHARNRDAPRVNDVIYDMIAAGLSPGPRSFHGLVVAYTLNGD  119

Query  497  VEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             EGAMH+L+RELS G+RPLHET +AL RLFGSKGLAT+GLEILAAME + 
Sbjct  120  HEGAMHSLKRELSTGVRPLHETLIALARLFGSKGLATKGLEILAAMEKIN  169



>gb|KDO52504.1| hypothetical protein CISIN_1g002761mg [Citrus sinensis]
Length=883

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/701 (78%), Positives = 611/701 (87%), Gaps = 10/701 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+ANKVF +GAKGGLRATD+IYDL+I EDCKAGDHSNAL IAYEMEAAGRM
Sbjct  181   EELVRNKYLEDANKVFLRGAKGGLRATDEIYDLMIAEDCKAGDHSNALEIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFN LLS QATCGIPEVAFATFENMEYGE YMKPDTETYN VIQAYTRAESYDRVQ
Sbjct  241   ATTFHFNHLLSCQATCGIPEVAFATFENMEYGEDYMKPDTETYNCVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYC V EAIRHFRAL+N+EGG ++LHNEG
Sbjct  301   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCAVTEAIRHFRALQNYEGGTKVLHNEG  360

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI+ELLEALEAM KDNQ +PPRAMILSRKYRTLVSSWIEPLQE
Sbjct  361   NFGDPLSLYLRALCREGRIIELLEALEAMAKDNQPVPPRAMILSRKYRTLVSSWIEPLQE  420

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY++EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  421   EAELGYEIDYIARYISEGGLTGERKRWVPRRGKTPLDPDAVGFIYSNPMETSFKQRCLED  480

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              + YHRKLL TL+NEGPA+LG+VSESDY+RV ERLKK++KGPEQ  LKPKAASKM+VSEL
Sbjct  481   GKKYHRKLLRTLQNEGPAVLGDVSESDYVRVEERLKKLIKGPEQHVLKPKAASKMVVSEL  540

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEEL+AQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRIK
Sbjct  541   KEELDAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIK  600

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG N    + +E+++ EL DV   D    +    + + +EEEE E
Sbjct  601   LEEGNTEFWKRRFLGEGLNGRHDKAVEMDESELSDVLDDDVTDVEYVAKDEEADEEEEVE  660

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             + E E +           DRVKEK V+  KPLQMIGVQLLKDSDQT+++ K   +     
Sbjct  661   QAEPESQDV---------DRVKEKLVEAKKPLQMIGVQLLKDSDQTTTTSKRSMKRSSRM  711

Query  2265  Md-dddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             ++ DDDEDW P D  EA KEMRKRK+FDV DMYTIAD WGWTWE+E+ N+PP++WSQEWE
Sbjct  712   VEDDDDEDWFPEDPFEAFKEMRKRKVFDVSDMYTIADAWGWTWEREITNRPPQKWSQEWE  771

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I+IM KVI LGGTPTIGDCA+I+RAAIRAP+PSAFLKILQ THSLGYVFGSPLYDE
Sbjct  772   VELAIQIMLKVIELGGTPTIGDCAVIIRAAIRAPLPSAFLKILQKTHSLGYVFGSPLYDE  831

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAAVAIVAD+ET+GI VPD+TLDRVI++R 
Sbjct  832   IISLCLDLGELDAAVAIVADMETTGIAVPDQTLDRVITSRQ  872


 Score =   159 bits (401),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  317  MASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLD  496
            + S  E+ LRL+FMEELM+ AR+ D   V+ VIYDMIAAGL PGPRSFHGL+V++ LN D
Sbjct  60   VVSAAEQGLRLIFMEELMQHARNRDAPRVNDVIYDMIAAGLSPGPRSFHGLVVAYTLNGD  119

Query  497  VEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             EGAMH+L+RELS G+RPLHET +AL RLFGSKGLAT+GLEILAAME + 
Sbjct  120  HEGAMHSLKRELSAGVRPLHETLIALARLFGSKGLATKGLEILAAMEKIN  169



>ref|XP_006478983.1| PREDICTED: uncharacterized protein LOC102630853 isoform X2 [Citrus 
sinensis]
Length=764

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/701 (78%), Positives = 612/701 (87%), Gaps = 6/701 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+ANKVF +GAKGGLRATD+IYDL+I EDCKAGDHSNAL IAYEMEAAGRM
Sbjct  58    EELVRNKYLEDANKVFLRGAKGGLRATDEIYDLMIAEDCKAGDHSNALEIAYEMEAAGRM  117

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFN LLS QATCGIPEVAFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  118   ATTFHFNHLLSCQATCGIPEVAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  177

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMM EDHKRLQPN++TY LLVECF+KYC V EAIRHFRAL+N+EGG ++LHNEG
Sbjct  178   DVAELLGMMFEDHKRLQPNVKTYALLVECFTKYCAVTEAIRHFRALQNYEGGTKVLHNEG  237

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI+ELLEALEAM KDNQ +PPRAMILSRKYRTLVSSWIEPLQE
Sbjct  238   NFGDPLSLYLRALCREGRIIELLEALEAMAKDNQPVPPRAMILSRKYRTLVSSWIEPLQE  297

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY++EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  298   EAELGYEIDYIARYISEGGLTGERKRWVPRRGKTPLDPDAVGFIYSNPMETSFKQRCLED  357

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              + YHRKLL TL+NEGPA+LG+VSESDY+RV ERLKK++KGPEQ  LKPKAASKM+VSEL
Sbjct  358   GKKYHRKLLRTLQNEGPAVLGDVSESDYVRVEERLKKLIKGPEQHVLKPKAASKMVVSEL  417

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEEL+AQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRIK
Sbjct  418   KEELDAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIK  477

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG N    + +E+++ EL DV   D    +    + + +EE +EE
Sbjct  478   LEEGNTEFWKRRFLGEGLNGRHDKAVEMDESELSDVLDDDVTDVEYVAKDEEADEEADEE  537

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             EE  + E E  +      DRVKEK V+  KPLQMIGVQLLKDSDQT+++ K   +     
Sbjct  538   EEVEQAEPESQDV-----DRVKEKLVEAKKPLQMIGVQLLKDSDQTTTTSKRSMKRSSRM  592

Query  2265  Md-dddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             ++ DDDEDW P D  EA KEMRKRK+FDV DMYTIAD WGWTWE+E+KN+PP++WSQEWE
Sbjct  593   VEDDDDEDWFPEDPFEAFKEMRKRKVFDVSDMYTIADAWGWTWEREIKNRPPQKWSQEWE  652

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I+IM KVI LGG PTIGDCA+I+ AAIRAP+PSAFLKILQ THSLGYVFGSPLYDE
Sbjct  653   VELAIQIMLKVIELGGMPTIGDCAVIIHAAIRAPLPSAFLKILQKTHSLGYVFGSPLYDE  712

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAAVAIVAD+ET+GI VPD+TLDRVI+AR 
Sbjct  713   IISLCLDLGELDAAVAIVADMETTGIAVPDQTLDRVITARQ  753


 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  509  MHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            MH+L+RELS G+RPLHET +AL RLFGSKGLAT+GLEILAAME + 
Sbjct  1    MHSLKRELSTGVRPLHETLIALARLFGSKGLATKGLEILAAMEKIN  46



>ref|XP_007030296.1| Plastid transcriptionally active 3 isoform 1 [Theobroma cacao]
 gb|EOY10798.1| Plastid transcriptionally active 3 isoform 1 [Theobroma cacao]
Length=905

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/707 (77%), Positives = 611/707 (86%), Gaps = 20/707 (3%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ ++E+AN VF KGAKGGLRAT+++YDL+IEEDCK GDHSNAL IAYEMEAAGRM
Sbjct  182   EELVRNKYMEDANNVFLKGAKGGLRATNELYDLMIEEDCKVGDHSNALEIAYEMEAAGRM  241

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  242   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEEYMKPDTETYNWVIQAYTRAESYDRVQ  301

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALK FEGG R+L NEG
Sbjct  302   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKKFEGGTRVLQNEG  361

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVELLEAL+AM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  362   NFDDPLSLYLRALCREGRIVELLEALQAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  421

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  422   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDAAGFIYSNPMETSFKQRCLED  481

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKLL TL+NEG A LG  SESDY+RV ERLKKI+KGP+Q  LKPKAASKMIVSEL
Sbjct  482   WKLHHRKLLKTLQNEGLAALGGASESDYVRVSERLKKIIKGPDQNVLKPKAASKMIVSEL  541

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRIK
Sbjct  542   KEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIK  601

Query  1905  LHEGDTEFWKRRFLGEGFNEN-----DSQQLEVNDLELPdvetvddvakdveddeadeee  2069
             L EG+TEFWKRRFLGE  N +     D  + E  D EL             +D +  E+ 
Sbjct  602   LEEGNTEFWKRRFLGEHLNVDHVKPIDEGESEPADDEL-------------DDGDVVEDA  648

Query  2070  eeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrr  2249
              ++ E++E + E E  + +++ GDR+K+KEV+  KPLQMIGVQLLKDSDQT++  K  RR
Sbjct  649   AKDIEDDEADEEEEGEQAESQEGDRIKDKEVEAKKPLQMIGVQLLKDSDQTTTRSKKSRR  708

Query  2250  srITAM--ddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRR  2423
                     DDDD+DW P DI EA +E+R+RK+FDVEDMYTIAD WGWTWEKELKNKPPR+
Sbjct  709   RSSRVSVEDDDDDDWFPEDIFEAFQELRERKVFDVEDMYTIADAWGWTWEKELKNKPPRK  768

Query  2424  WSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             WSQEWEVEL I++M KVI LGGTPT+GDCA+ILRAAI+APMPSAFLKILQ  HSLG+VFG
Sbjct  769   WSQEWEVELAIQVMQKVIELGGTPTVGDCAMILRAAIKAPMPSAFLKILQTAHSLGFVFG  828

Query  2604  SPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             SPLYDE++ +C+DL ELDAA+AIVADLET+GI VPD+TLDRVISAR 
Sbjct  829   SPLYDEVISICVDLGELDAAIAIVADLETAGIAVPDQTLDRVISARQ  875


 Score =   184 bits (466),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 117/159 (74%), Gaps = 9/159 (6%)
 Frame = +2

Query  191  PPRTAGR---VVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGG----GALMASGTEKVLRL  349
            PP +  R   V  AVS+P+R+   ++++  SQ K  +DDD           S  EK LRL
Sbjct  14   PPLSRHRNAVVYAAVSAPKRKPSPRRKKRQSQQK--KDDDNATLSSSNAAVSALEKSLRL  71

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
             FMEELM++AR  DV+GVS VIYDMIAAGL PGPRSFHGL+V+HVLN DVEGAM ALRRE
Sbjct  72   TFMEELMQKARSRDVAGVSDVIYDMIAAGLTPGPRSFHGLVVAHVLNGDVEGAMQALRRE  131

Query  530  LSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            L  G+RPLHET V++IRLFGSKGLAT+GLE+LAAME L 
Sbjct  132  LGVGVRPLHETLVSMIRLFGSKGLATKGLEVLAAMEKLN  170



>ref|XP_002522027.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40431.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=889

 Score =  1043 bits (2697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/704 (78%), Positives = 610/704 (87%), Gaps = 8/704 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++ ++E+ANKVF KGAKGGLRATD++YD +IEEDCK GDHSNAL IAYEMEAAGRM
Sbjct  178   EELVKNKYMEDANKVFLKGAKGGLRATDELYDYMIEEDCKVGDHSNALEIAYEMEAAGRM  237

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  238   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  297

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPN+RTY LLVECF+KYCVVREAIRHFRAL+NFEGG ++LH +
Sbjct  298   QDVAELLGMMVEDHKRLQPNVRTYALLVECFTKYCVVREAIRHFRALQNFEGGTKVLHYD  357

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGRIVELLEALEAM +DNQ IPPRAMILSRKYRTLVSSWIEPLQ
Sbjct  358   GNFGDPLSLYLRALCREGRIVELLEALEAMGRDNQPIPPRAMILSRKYRTLVSSWIEPLQ  417

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELGYEIDY+ARYVAEGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRC+E
Sbjct  418   EEAELGYEIDYVARYVAEGGLTGERKRWVPRRGKTPLDPDAAGFIYSNPMETSFKQRCIE  477

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+++HRKLL TL NEG A LG  SESDYLRV ERLKKI+KGP+Q  LKPKAASKM+VSE
Sbjct  478   DWKVHHRKLLRTLLNEGLAALGEASESDYLRVVERLKKIIKGPDQNVLKPKAASKMVVSE  537

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDE+ISRI
Sbjct  538   LKEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDEIISRI  597

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWKRRFLGEG N ++ Q + V   ELPDV    D  +D + +  DEE ++EE
Sbjct  598   KLEEGNTEFWKRRFLGEGLNGSNLQPMSVAKSELPDVLDDVDAIEDADKEVEDEEADDEE  657

Query  2082  eeeeveveveqtetqaevGDR-VKEKEVKTAKPLQMIGVQLLKDSDQ--Tssskksrrrs  2252
             E E      +         DR VKEKEV+  KPLQMIGVQLLKDSD   T S K  RR +
Sbjct  658   EAEAEVEVEQTENQDV---DRVVKEKEVEAKKPLQMIGVQLLKDSDHLTTRSKKSKRRSA  714

Query  2253  rITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQ  2432
             R +  DD D+DW P D  EA KE+R+RK+FDVEDMYTIADVWGWTWE+E+KN+PP++WSQ
Sbjct  715   RASVEDDADDDWFPEDPFEAFKELRERKVFDVEDMYTIADVWGWTWEREIKNRPPQKWSQ  774

Query  2433  EWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPL  2612
             EWEVEL I++M K   L GTPTIGDCA+ILRAAIRAPMPSAFLKILQ THSLGY FGSPL
Sbjct  775   EWEVELAIKLMLKA-QLSGTPTIGDCAMILRAAIRAPMPSAFLKILQTTHSLGYTFGSPL  833

Query  2613  YDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             YDE++ LCLD+ ELDAA+AIVADLE++GI VPD+TLDRVISAR 
Sbjct  834   YDEVISLCLDIGELDAAIAIVADLESTGITVPDQTLDRVISARQ  877


 Score =   174 bits (440),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  VVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVLRLVFMEELMERARDADV  394
            VV  ++ ++++R+KKQ    + +  ++D+     + +  EK LR  FMEELM+RAR+ D 
Sbjct  23   VVCSTTVEKKSRRKKQPHQQKQQLEKNDNSILPAVITAAEKTLRFNFMEELMDRARNRDA  82

Query  395  SGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVAL  574
             GVS VIYDM+AAGL PGPRSFHGLIV++ LN D+EGAM +LRRELS+G+RPLHETF+AL
Sbjct  83   VGVSDVIYDMVAAGLSPGPRSFHGLIVAYCLNGDIEGAMQSLRRELSQGIRPLHETFLAL  142

Query  575  IRLFGSKGLATRGLEILAAMENLK  646
            IRLFGSKG A+RGLEILAAME LK
Sbjct  143  IRLFGSKGHASRGLEILAAMEKLK  166



>ref|XP_010549638.1| PREDICTED: uncharacterized protein LOC104820754 [Tarenaya hassleriana]
Length=906

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/707 (78%), Positives = 613/707 (87%), Gaps = 7/707 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHL +AN VF KGA+ GLRATD+IYDL+IEEDCKAGDHSNAL IAYEMEAAGRM
Sbjct  184   EELMRTNHLVDANNVFLKGARAGLRATDRIYDLMIEEDCKAGDHSNALDIAYEMEAAGRM  243

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  244   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEDFMKPDTETYNWVIQAYTRAESYDRVQ  303

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYCVVREAIRHFR LKNFEGG ++LH EG
Sbjct  304   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVVREAIRHFRGLKNFEGGTKVLHCEG  363

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVEL+EAL+ M KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  364   SFGDPLSLYLRALCREGRIVELIEALDTMRKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  423

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLEE
Sbjct  424   EAELGYEIDYVARYIAEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPMETSFKQRCLEE  483

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
              RI+HRKLL TL NEGP +LG+ +ESDYLRV ERL+KI+KGPEQ  LKPKAASKMIVSEL
Sbjct  484   SRIHHRKLLRTLLNEGPIVLGDATESDYLRVVERLRKIIKGPEQNVLKPKAASKMIVSEL  543

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEE+DEELD LISRIK
Sbjct  544   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPVEEEEEEIDEELDALISRIK  603

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLE------VNDLELPdvetvddvakdveddeadee  2066
             L EG+TEFWKRRFLGEG+ +  ++  E       ++LE  +V  V     + +DDE +E+
Sbjct  604   LEEGNTEFWKRRFLGEGYIQPSAEPKETVESVATDELEHANVTEVVAEDAEADDDEGEED  663

Query  2067  eeeeeeeeeveveveqtetqaevGDRV-KEKEVKTAKPLQMIGVQLLKDSDQTssskksr  2243
             E+E+EEEEE E E  +       GD V K KE +  KPLQMIGVQLLKDSD+ SS+KK  
Sbjct  664   EDEDEEEEEGEEEEVEQTETRTEGDEVIKNKEAEAKKPLQMIGVQLLKDSDEASSTKKRG  723

Query  2244  rrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRR  2423
             RR+     +DDDEDW P D  EA KEMR+RK+FDV DMYTIADVWGWTWEK+LKNK PR+
Sbjct  724   RRTTRVVENDDDEDWFPEDPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDLKNKAPRK  783

Query  2424  WSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             WSQEWEVEL +E+M+KVI LGG PTIGDCA+ILR+AIRAPMPSAFLKILQ THSLGY FG
Sbjct  784   WSQEWEVELAMELMTKVIELGGIPTIGDCAMILRSAIRAPMPSAFLKILQNTHSLGYSFG  843

Query  2604  SPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             SPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI V  ETLD+VISAR 
Sbjct  844   SPLYDEIISLCLDLGELDAALAIVADMETTGITVHGETLDKVISARQ  890


 Score =   157 bits (398),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 113/172 (66%), Gaps = 11/172 (6%)
 Frame = +2

Query  140  PFKLKFTTTVPLRQRT---FPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGG  310
            PF   F    PLR+R+   FP R       + S+P+++ R++++Q       +       
Sbjct  9    PFPSNFYQ--PLRRRSAGVFPLR------CSTSAPEKKPRRRRKQKKRGDDDSSLSSSSA  60

Query  311  ALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLN  490
                S  E+ LRL FM+ELMERAR  D  G S VIYDM+AAGL PGPRSFHGL+V+H LN
Sbjct  61   GDAVSALERSLRLTFMDELMERARIRDAVGASEVIYDMVAAGLSPGPRSFHGLVVAHALN  120

Query  491  LDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             D EGAMH+LR+EL  G+RPL ET VAL+RLFGSKG ATRGLEILAAME L 
Sbjct  121  GDEEGAMHSLRKELCAGVRPLPETMVALVRLFGSKGNATRGLEILAAMEKLN  172



>ref|XP_007030297.1| Plastid transcriptionally active 3 isoform 2 [Theobroma cacao]
 gb|EOY10799.1| Plastid transcriptionally active 3 isoform 2 [Theobroma cacao]
Length=782

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/702 (76%), Positives = 611/702 (87%), Gaps = 10/702 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ ++E+AN VF KGAKGGLRAT+++YDL+IEEDCK GDHSNAL IAYEMEAAGRM
Sbjct  59    EELVRNKYMEDANNVFLKGAKGGLRATNELYDLMIEEDCKVGDHSNALEIAYEMEAAGRM  118

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  119   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEEYMKPDTETYNWVIQAYTRAESYDRVQ  178

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALK FEGG R+L NEG
Sbjct  179   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKKFEGGTRVLQNEG  238

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVELLEAL+AM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  239   NFDDPLSLYLRALCREGRIVELLEALQAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  298

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLE+
Sbjct  299   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDAAGFIYSNPMETSFKQRCLED  358

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKLL TL+NEG A LG  SESDY+RV ERLKKI+KGP+Q  LKPKAASKMIVSEL
Sbjct  359   WKLHHRKLLKTLQNEGLAALGGASESDYVRVSERLKKIIKGPDQNVLKPKAASKMIVSEL  418

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRIK
Sbjct  419   KEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIK  478

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGE  N +  + ++  + E            +++D +  E+  ++ E
Sbjct  479   LEEGNTEFWKRRFLGEHLNVDHVKPIDEGESE--------PADDELDDGDVVEDAAKDIE  530

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             ++E + E E  + +++ GDR+K+KEV+  KPLQMIGVQLLKDSDQT++  K  RR     
Sbjct  531   DDEADEEEEGEQAESQEGDRIKDKEVEAKKPLQMIGVQLLKDSDQTTTRSKKSRRRSSRV  590

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +  DD+DW P DI EA +E+R+RK+FDVEDMYTIAD WGWTWEKELKNKPPR+WSQEW
Sbjct  591   SVEDDDDDDWFPEDIFEAFQELRERKVFDVEDMYTIADAWGWTWEKELKNKPPRKWSQEW  650

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGGTPT+GDCA+ILRAAI+APMPSAFLKILQ  HSLG+VFGSPLYD
Sbjct  651   EVELAIQVMQKVIELGGTPTVGDCAMILRAAIKAPMPSAFLKILQTAHSLGFVFGSPLYD  710

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             E++ +C+DL ELDAA+AIVADLET+GI VPD+TLDRVISAR 
Sbjct  711   EVISICVDLGELDAAIAIVADLETAGIAVPDQTLDRVISARQ  752


 Score = 75.1 bits (183),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  509  MHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            M ALRREL  G+RPLHET V++IRLFGSKGLAT+GLE+LAAME L 
Sbjct  2    MQALRRELGVGVRPLHETLVSMIRLFGSKGLATKGLEVLAAMEKLN  47



>ref|XP_008812927.1| PREDICTED: uncharacterized protein LOC103723700 [Phoenix dactylifera]
Length=765

 Score =  1034 bits (2673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/703 (76%), Positives = 604/703 (86%), Gaps = 11/703 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++ HL++AN VF KGAKGGLRATD++YDLLIEEDCKAGDHSNALTIAYEMEAAGRM
Sbjct  58    EELVKNYHLDDANMVFLKGAKGGLRATDELYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  117

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVAFATFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  118   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  177

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPN++TY LLVECF+KYCVV+EAIRHFRALKNF GG ++L+NE
Sbjct  178   QDVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFPGGTKVLYNE  237

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGR VELLE LEAM KDNQ I PRAMILSRKYRTLVSSWIEPLQ
Sbjct  238   GNFGDPLSLYLRALCREGRAVELLEGLEAMAKDNQPIAPRAMILSRKYRTLVSSWIEPLQ  297

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G EIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPDA G+ YSNPMETSFKQRCLE
Sbjct  298   EEADMGSEIDYVARYIAEGGLTGERKRWVPRRGKTPLDPDAVGFAYSNPMETSFKQRCLE  357

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E++ YHRKLL TL NEGP  LG+VSE+D+LRV ERLKKI+KGPEQ  LKPKAASKMIVSE
Sbjct  358   EYKFYHRKLLKTLHNEGPEALGDVSETDFLRVVERLKKIIKGPEQNVLKPKAASKMIVSE  417

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTR VLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  418   LKEELEAQGLPIDGTRQVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEIDELISRI  477

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL +G+TEFWK RFLGE +N+   + +E  D   P            E D  ++   E E
Sbjct  478   KLEDGNTEFWKHRFLGESYNDVPDKDIESEDPNPP--------DMLDEVDAVEDVTIETE  529

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             E+E  E E    +T+++ GD +K+KEV+ AKPLQMIGVQLLKDSD+T++S +  RR    
Sbjct  530   EDEVDEEEEVVEQTESQAGDLIKDKEVERAKPLQMIGVQLLKDSDETTASSRKSRRKSTR  589

Query  2262  AMdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             A  +  DDEDW P D++EA K MR+R+IFDV+DM+TIAD WGWTWE+ELKNK PR+WSQE
Sbjct  590   ASVEDDDDEDWFPEDLNEAFKVMRERRIFDVQDMFTIADAWGWTWERELKNKMPRKWSQE  649

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL I+IM KVI LGG PTIGDCAIILRAAIRAP+PSAFL IL  THSLGYVFGSPLY
Sbjct  650   WEVELAIKIMHKVIELGGKPTIGDCAIILRAAIRAPLPSAFLTILHTTHSLGYVFGSPLY  709

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DE++ LCLDL E+ AA+AIVAD+ET+GI VPDETLD+V+S+R 
Sbjct  710   DEVISLCLDLGEIHAAIAIVADMETTGIKVPDETLDKVLSSRQ  752


 Score = 80.1 bits (196),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  509  MHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            M +LRRELS GLRPL ETFVALIRLFGSKG ATRGLEILAAME LK
Sbjct  1    MQSLRRELSAGLRPLQETFVALIRLFGSKGHATRGLEILAAMEKLK  46



>ref|XP_010933205.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105053651 
[Elaeis guineensis]
Length=887

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/703 (77%), Positives = 608/703 (86%), Gaps = 11/703 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV+++HL++AN VF KGA+GGLRATD++YDLLIEEDCKAGDHSNALTIAYEMEAAGRM
Sbjct  180   EELVKNHHLDDANTVFLKGAQGGLRATDELYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVAFATFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  240   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  299

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPN++TY LLVECF+KYCVVREAIRHFRALKNF GG ++L+NE
Sbjct  300   QDVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVVREAIRHFRALKNFPGGTKVLYNE  359

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALC EGR VELLEALEAM KDNQ I PRAMILSRKYRTLVSSWIEPLQ
Sbjct  360   GNFGDPLSLYLRALCCEGRAVELLEALEAMAKDNQPIAPRAMILSRKYRTLVSSWIEPLQ  419

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+AEGGLTGERKRWVPRRGK PLDPDA G+ YSNPMETSFKQRCLE
Sbjct  420   EEADVGFEIDYVARYIAEGGLTGERKRWVPRRGKAPLDPDAVGFAYSNPMETSFKQRCLE  479

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E+R+YHRKLL TL+NEGPA LG+VSE+D LRV ERLKKI+KGPEQ  LKPKAASKMIVSE
Sbjct  480   EYRLYHRKLLKTLQNEGPAALGDVSETDLLRVVERLKKIIKGPEQNVLKPKAASKMIVSE  539

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LPTDGTR VLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  540   LKEELEAQGLPTDGTRQVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRI  599

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWK RFLGE +N+   + +E  D   P            E D  ++   E E
Sbjct  600   KLEEGNTEFWKHRFLGESYNDVPDKDIESEDPNPP--------DMLDEVDAVEDVTIETE  651

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             E+E  + E    +T+++ GD +KEKEV+ AKPLQMIGVQLLKDSD+T++S +  RR    
Sbjct  652   EDEVDDEEEVVEQTESQAGDLIKEKEVERAKPLQMIGVQLLKDSDETTTSSRKLRRKATR  711

Query  2262  AMdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             A  +  DDEDW P D++EA K MR+RKIFDV+DM+TIAD WGWTWE+ELKNK PRRWSQE
Sbjct  712   ASVEDDDDEDWFPEDLNEAFKVMRERKIFDVQDMFTIADAWGWTWERELKNKMPRRWSQE  771

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL I+IM KVI LGG PTIGDCA+ILRAAIRAP PSAFL IL  THSLGYVFGSPLY
Sbjct  772   WEVELAIKIMHKVIELGGKPTIGDCAMILRAAIRAPXPSAFLTILHTTHSLGYVFGSPLY  831

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DE+++LCLDL E+ AA+AIVAD+ET+GI VPD+TLD+V+S+R 
Sbjct  832   DEVILLCLDLGEIHAAIAIVADMETTGIKVPDQTLDKVLSSRQ  874


 Score =   170 bits (430),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 108/148 (73%), Gaps = 4/148 (3%)
 Frame = +2

Query  203  AGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVLRLVFMEELMERAR  382
            A  V  A+S+ +R+ R+KK  + S   ++        +  S  E+ LR  FM+ELMERAR
Sbjct  25   AFSVFCAISTAERKGRRKKDSSSSSSPSSS----SLGVSVSAVERGLRFTFMQELMERAR  80

Query  383  DADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHET  562
              D +GVS VIYDMIAAGL PGPRSFHGLIVSH L+ D EGAM +LRRELS GLRPLHET
Sbjct  81   SRDPAGVSDVIYDMIAAGLTPGPRSFHGLIVSHTLSGDEEGAMQSLRRELSAGLRPLHET  140

Query  563  FVALIRLFGSKGLATRGLEILAAMENLK  646
            FVALIRL GSKG ATRGLEILAAME LK
Sbjct  141  FVALIRLLGSKGHATRGLEILAAMEKLK  168



>ref|XP_010674223.1| PREDICTED: uncharacterized protein LOC104890433 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=890

 Score =  1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/701 (78%), Positives = 622/701 (89%), Gaps = 2/701 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE ANKVF KGA+GGLRATD+IYDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  181   EELVRSNHLEFANKVFLKGAEGGLRATDEIYDLLIEEDCKYGDHSNALTIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQA CGIPE+A+ATFENME+GE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  241   ATTFHFNCLLSVQANCGIPEIAYATFENMEFGEDYMKPDTETYNWVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLG+MVEDHKRLQPN+RTY LLVECF+KYCV+REAIRHFRALK FEGG R+L+NEG
Sbjct  301   DVAELLGLMVEDHKRLQPNVRTYALLVECFTKYCVMREAIRHFRALKTFEGGTRVLYNEG  360

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI ELL+ALEAM +DNQ +PPRAMILSRKYRTLVSSWIEPLQE
Sbjct  361   NFGDPLSLYLRALCREGRIEELLDALEAMARDNQPMPPRAMILSRKYRTLVSSWIEPLQE  420

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY +EGGLTGERKRWVPRRGK PLDPDAEG+IYSNP+ETSFKQRCLEE
Sbjct  421   EAELGYEIDYIARYNSEGGLTGERKRWVPRRGKAPLDPDAEGFIYSNPVETSFKQRCLEE  480

Query  1545  WRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             W+I HRKLL  LRNEGPA LG N SESDY+RV ERLKK++KG E+  +KPKAASKM+VSE
Sbjct  481   WKIRHRKLLRHLRNEGPAALGPNASESDYVRVEERLKKMIKGREKNVVKPKAASKMVVSE  540

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQDLP DGTRNVLYQRVQKARRIN+SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  541   LKEELEAQDLPIDGTRNVLYQRVQKARRINISRGRPLWVPPVEEEEEEVDEEVDELISRI  600

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TE+WKRRFLGE    ++ + ++   LE P     D   +D    E +++E ++E
Sbjct  601   KLEEGNTEYWKRRFLGEQLIYDNMKPMDGQKLE-PGYIMDDAEIEDDTAKEIEDDEADDE  659

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             EE E EVEVEQ+E+Q  + DRVK KEV   KPLQMIG+QLLKD+DQ ++SKKS  RS + 
Sbjct  660   EEVEAEVEVEQSESQEGLVDRVKHKEVDAKKPLQMIGIQLLKDADQPTTSKKSTSRSSMA  719

Query  2262  AMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             A DDDD+DW PLD++EA +E+RKR IF+V+DMYTIADVWGWTWE+ELK++P RRWSQEWE
Sbjct  720   AEDDDDDDWFPLDLYEAFEELRKRNIFNVDDMYTIADVWGWTWERELKSRPLRRWSQEWE  779

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             V++ +++MSKVI LGG PTIGDCA+ILRAAI+AP+PSAFL IL ITHSLGY FGSPLYDE
Sbjct  780   VDMAMKVMSKVIELGGIPTIGDCAMILRAAIKAPLPSAFLTILHITHSLGYRFGSPLYDE  839

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAA+AIVADLETSGI VPDETLD+VI+AR 
Sbjct  840   IITLCLDLGELDAAIAIVADLETSGITVPDETLDKVIAARQ  880


 Score =   177 bits (450),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 112/147 (76%), Gaps = 11/147 (7%)
 Frame = +2

Query  206  GRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVLRLVFMEELMERARD  385
            G VV A+SSP+R++R+++Q     PK    +D   A  +S  EK LRL FMEELM RAR+
Sbjct  34   GIVVSAISSPERKSRRRRQ-----PK----EDTSTA--SSAAEKGLRLAFMEELMIRARN  82

Query  386  ADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETF  565
             D  GVS VIYDMI AGL PGPRS+HGL+V+HVLN D EGAM +LRRELS GL PLHETF
Sbjct  83   RDTIGVSDVIYDMIVAGLNPGPRSYHGLVVAHVLNSDEEGAMQSLRRELSVGLVPLHETF  142

Query  566  VALIRLFGSKGLATRGLEILAAMENLK  646
            +AL+RLFGSKG ATRGLEILAAME L 
Sbjct  143  LALVRLFGSKGHATRGLEILAAMEKLN  169



>ref|XP_007143992.1| hypothetical protein PHAVU_007G119900g [Phaseolus vulgaris]
 gb|ESW15986.1| hypothetical protein PHAVU_007G119900g [Phaseolus vulgaris]
Length=887

 Score =  1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/712 (76%), Positives = 615/712 (86%), Gaps = 3/712 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+RS HLE AN+VFFKGA  GL+ATD++YDLLI+EDCKAGDHSNAL IAYEMEAAGRM
Sbjct  172   EELIRSKHLEGANQVFFKGADIGLKATDEVYDLLIKEDCKAGDHSNALDIAYEMEAAGRM  231

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDT+TYNWVIQAYTRAESYDRVQ
Sbjct  232   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTDTYNWVIQAYTRAESYDRVQ  291

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVVREAIRHFRALK+FE G ++LH+EG
Sbjct  292   DVAELLGMMVEDHKRIQPNVKTHALLVECFTKYCVVREAIRHFRALKHFEEGTKVLHDEG  351

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVE+LEALE M KDNQ IP RAMILSRKYRTLVSSWIEPLQE
Sbjct  352   NHGDPLSLYLRALCREGRIVEMLEALEVMAKDNQLIPSRAMILSRKYRTLVSSWIEPLQE  411

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY+ EGGLTGERKRWVPRRGKTPLDPDA+G+IYSNPMETSFKQRCLEE
Sbjct  412   EAELGYEIDYIARYIEEGGLTGERKRWVPRRGKTPLDPDAQGFIYSNPMETSFKQRCLEE  471

Query  1545  WRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              R Y++KLL TL+ EG A+LG+ VSE DY+RV ERLKK++KGPEQ  LKPKAASKM+V E
Sbjct  472   LRDYNKKLLKTLQIEGLAVLGDGVSEYDYIRVKERLKKLIKGPEQNVLKPKAASKMLVFE  531

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLWIPPVEEEEEEVDEE+D LISRI
Sbjct  532   LKEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWIPPVEEEEEEVDEEVDALISRI  591

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWKRRFLGEG   +    ++    ++ +V    DV +D   D  D+E +EEE
Sbjct  592   KLQEGNTEFWKRRFLGEGLTGDQEMTMDAGKSDVSEVPDDIDVIEDAAKDIEDDEVDEEE  651

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrI  2258
             EE E   E  +     +V DR+K KEVK+ KPLQMIGVQL KDSDQ  + SKK ++ +R+
Sbjct  652   EEAEQVEEEVEPAENQDV-DRIKVKEVKSNKPLQMIGVQLFKDSDQPITRSKKFKKSARM  710

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
              A++DDD+DW PLD+ EA KEMRKRKIFDV DMYT+AD WGWTWE+ELKNKPPRRWSQEW
Sbjct  711   QAVNDDDDDWFPLDVFEAFKEMRKRKIFDVSDMYTLADAWGWTWERELKNKPPRRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGGTPTIGDCA+ILRAA+RAP+PSAFL ILQ TH LGY FGS LYD
Sbjct  771   EVELAIKVMQKVIELGGTPTIGDCAVILRAAVRAPLPSAFLTILQTTHGLGYKFGSSLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK*QSSK*II  2774
             EI+ LC+DL ELDAAVA+VADLET+GI+V D+TLDRVISA+ +   +S  +I
Sbjct  831   EIICLCVDLGELDAAVAVVADLETTGILVSDQTLDRVISAKQRIDNTSNGVI  882


 Score =   165 bits (417),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 16/161 (10%)
 Frame = +2

Query  164  TVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVL  343
            + P +   F PRT   V  AVS P++R RKKKQ        A+DD        S  E  L
Sbjct  16   SFPFKLNRFCPRTVT-VRAAVSVPEKRGRKKKQ--------AKDD-------QSAVENGL  59

Query  344  RLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALR  523
            R  FMEELM+RAR  D +GVS VIYDMIAAG+ PGPRSFHGL+VS+ LN   E AM +LR
Sbjct  60   RFSFMEELMDRARLRDSNGVSEVIYDMIAAGISPGPRSFHGLVVSNALNGHEEAAMESLR  119

Query  524  RELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            REL+ GLRP+HETF+AL+RLFGSKG A RGL+IL  M++L 
Sbjct  120  RELAAGLRPVHETFMALVRLFGSKGRANRGLQILGDMQDLN  160



>ref|XP_010674225.1| PREDICTED: uncharacterized protein LOC104890433 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=716

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/701 (78%), Positives = 622/701 (89%), Gaps = 2/701 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE ANKVF KGA+GGLRATD+IYDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  7     EELVRSNHLEFANKVFLKGAEGGLRATDEIYDLLIEEDCKYGDHSNALTIAYEMEAAGRM  66

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQA CGIPE+A+ATFENME+GE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  67    ATTFHFNCLLSVQANCGIPEIAYATFENMEFGEDYMKPDTETYNWVIQAYTRAESYDRVQ  126

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLG+MVEDHKRLQPN+RTY LLVECF+KYCV+REAIRHFRALK FEGG R+L+NEG
Sbjct  127   DVAELLGLMVEDHKRLQPNVRTYALLVECFTKYCVMREAIRHFRALKTFEGGTRVLYNEG  186

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI ELL+ALEAM +DNQ +PPRAMILSRKYRTLVSSWIEPLQE
Sbjct  187   NFGDPLSLYLRALCREGRIEELLDALEAMARDNQPMPPRAMILSRKYRTLVSSWIEPLQE  246

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY +EGGLTGERKRWVPRRGK PLDPDAEG+IYSNP+ETSFKQRCLEE
Sbjct  247   EAELGYEIDYIARYNSEGGLTGERKRWVPRRGKAPLDPDAEGFIYSNPVETSFKQRCLEE  306

Query  1545  WRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             W+I HRKLL  LRNEGPA LG N SESDY+RV ERLKK++KG E+  +KPKAASKM+VSE
Sbjct  307   WKIRHRKLLRHLRNEGPAALGPNASESDYVRVEERLKKMIKGREKNVVKPKAASKMVVSE  366

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQDLP DGTRNVLYQRVQKARRIN+SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  367   LKEELEAQDLPIDGTRNVLYQRVQKARRINISRGRPLWVPPVEEEEEEVDEEVDELISRI  426

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TE+WKRRFLGE    ++ + ++   LE P     D   +D    E +++E ++E
Sbjct  427   KLEEGNTEYWKRRFLGEQLIYDNMKPMDGQKLE-PGYIMDDAEIEDDTAKEIEDDEADDE  485

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             EE E EVEVEQ+E+Q  + DRVK KEV   KPLQMIG+QLLKD+DQ ++SKKS  RS + 
Sbjct  486   EEVEAEVEVEQSESQEGLVDRVKHKEVDAKKPLQMIGIQLLKDADQPTTSKKSTSRSSMA  545

Query  2262  AMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
             A DDDD+DW PLD++EA +E+RKR IF+V+DMYTIADVWGWTWE+ELK++P RRWSQEWE
Sbjct  546   AEDDDDDDWFPLDLYEAFEELRKRNIFNVDDMYTIADVWGWTWERELKSRPLRRWSQEWE  605

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             V++ +++MSKVI LGG PTIGDCA+ILRAAI+AP+PSAFL IL ITHSLGY FGSPLYDE
Sbjct  606   VDMAMKVMSKVIELGGIPTIGDCAMILRAAIKAPLPSAFLTILHITHSLGYRFGSPLYDE  665

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAA+AIVADLETSGI VPDETLD+VI+AR 
Sbjct  666   IITLCLDLGELDAAIAIVADLETSGITVPDETLDKVIAARQ  706



>gb|KEH42973.1| plastid transcriptionally active protein [Medicago truncatula]
Length=884

 Score =  1028 bits (2659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/703 (76%), Positives = 605/703 (86%), Gaps = 4/703 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLIEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  167   EELVRNKHLEDANKVFLKGAKGGLRATDELYDLLIEEDCKAGDHSNALEISYEMEAAGRM  226

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF TFENMEYGE YMKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  227   ATTFHFNCLLSVQATCGIPEIAFTTFENMEYGEDYMKPDTETYNWVIQAYTRADSYDRVQ  286

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVVREAIRHFRALKNFEGG ++LH +G
Sbjct  287   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVREAIRHFRALKNFEGGTKILHMDG  346

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI+++LEALEAM  DNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  347   NHGDPLSLYLRALCREGRIIDMLEALEAMANDNQQIPPRAMILSRKYRTLVSSWIEPLQE  406

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARYV EGGLTGERKRWVPR GKTPLDPDA+G+IYSNPMETSFKQRCLEE
Sbjct  407   EAELGYEIDYIARYVEEGGLTGERKRWVPRSGKTPLDPDADGFIYSNPMETSFKQRCLEE  466

Query  1545  WRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              ++YH+KLL  LR EG   LG+  SESDY+RV E LKKI+KGPEQ ALKPKAASKM+V+E
Sbjct  467   KKVYHKKLLKKLRYEGIVALGDGASESDYVRVIEWLKKIIKGPEQNALKPKAASKMLVNE  526

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+E EEEEVDEEL+ LISRI
Sbjct  527   LKEELEAQGLPIDGTRNVLYQRVQKARRINQSRGRPLWVPPIEVEEEEVDEELEALISRI  586

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TE+WKRRFLGEG N ++   ++  + E PDV+   DV  D   +  D+E +E+E
Sbjct  587   KLEEGNTEYWKRRFLGEGLNGDNGNAMDEGESESPDVQDYIDVVGDDAKEAEDDEADEDE  646

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ---Tssskksrrrs  2252
             EEE  ++E E  + + +  +R+KEKEV++ KPLQMIGVQLLKD ++   T      RR  
Sbjct  647   EEEVEQIEEEIAQVENQDVERIKEKEVESKKPLQMIGVQLLKDFNEPSATFKKSSRRRSR  706

Query  2253  rITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQ  2432
             R    DD D+DW PLDI EA KEMR R++FDV DMYT+AD WGWTWEKELKN+PP RWSQ
Sbjct  707   RNMVDDDADDDWFPLDIFEAFKEMRNRRVFDVSDMYTLADAWGWTWEKELKNRPPHRWSQ  766

Query  2433  EWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPL  2612
             EWEV+L I++M KVI LGGTPTIGDCA+ILRAAI AP+PSAFL ILQ TH LGY FG PL
Sbjct  767   EWEVDLAIKVMQKVIQLGGTPTIGDCAVILRAAISAPLPSAFLTILQTTHGLGYKFGRPL  826

Query  2613  YDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             YDE++ LCLDL ELDAAVA+VADLET+GI+V D+TLDRVISA+
Sbjct  827   YDEVISLCLDLGELDAAVAVVADLETTGILVSDQTLDRVISAK  869


 Score =   179 bits (454),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 115/163 (71%), Gaps = 16/163 (10%)
 Frame = +2

Query  158  TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEK  337
            +T +P +     PRT G V  A+SSP++RTRKKKQ         +DDD       +  E 
Sbjct  9    STYIPFKLNRLTPRT-GPVRAALSSPEKRTRKKKQ--------VKDDD-------TLLEN  52

Query  338  VLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHA  517
             LR  FMEELM RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+VS+ LN + + AM +
Sbjct  53   SLRFSFMEELMNRARNRDSTGVSQVMYDMIAAGLSPGPRSFHGLVVSYALNGNEQAAMDS  112

Query  518  LRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            LRREL  GLRP+HETFVAL+RLFGSKG +TRGLEIL AMENL 
Sbjct  113  LRRELGAGLRPIHETFVALVRLFGSKGHSTRGLEILGAMENLN  155



>ref|XP_011002015.1| PREDICTED: uncharacterized protein LOC105109113 [Populus euphratica]
Length=888

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/706 (76%), Positives = 607/706 (86%), Gaps = 11/706 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV+   +E+AN+VF KGA GGLRATD++YDL+IEEDCK GDHSNAL IAY ME AGRM
Sbjct  177   EELVKGRFMEDANRVFLKGANGGLRATDELYDLMIEEDCKVGDHSNALDIAYAMEEAGRM  236

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE++FATFENMEYGE YMKPDTE+YNWVIQAYTRAESYDRVQ
Sbjct  237   ATTFHFNCLLSVQATCGIPEISFATFENMEYGEDYMKPDTESYNWVIQAYTRAESYDRVQ  296

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECFSKYCVVREAIRHFRAL+ FEGG R+LHNEG
Sbjct  297   DVAELLGMMVEDHKRIQPNVKTYALLVECFSKYCVVREAIRHFRALRKFEGGTRVLHNEG  356

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             K+GDPLSLYLRALCREGRIV+LLEALEAM +DNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  357   KFGDPLSLYLRALCREGRIVDLLEALEAMAEDNQPIPPRAMILSRKYRTLVSSWIEPLQE  416

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYVAEGGLTGERKRWVPRRGKTPLDPD +G+IYSNPMETSFKQRCLE+
Sbjct  417   EAELGYEIDYVARYVAEGGLTGERKRWVPRRGKTPLDPDCDGFIYSNPMETSFKQRCLED  476

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+ +HRKLL  LRNEG A LG+ SESDYLRV E L+KI++GP++  LKPKAASKMIVSEL
Sbjct  477   WKAHHRKLLKMLRNEGLAALGDASESDYLRVEEILRKIIRGPDRNVLKPKAASKMIVSEL  536

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             K+ELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI+
Sbjct  537   KDELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIQ  596

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEGDTEFWKRRFLGEGFN N      V  +++   E  +++ +D +D++  +  +E E+
Sbjct  597   LHEGDTEFWKRRFLGEGFNGN-----HVKPVDMETSELPEELDEDEDDEDDVDVAKEVED  651

Query  2085  eeeveveveqtetqaevGDR----VKEKEVKTAKPLQMIGVQLLKDSDQTssskksr--r  2246
             EE  E    + E +   G      VK KE +  KPLQMIGVQLLKDSDQT+   K    R
Sbjct  652   EEADEEGEVEVEVEQTEGQDAERIVKAKEAEAKKPLQMIGVQLLKDSDQTTRMSKKSRRR  711

Query  2247  rsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRW  2426
              +R+   DDDD+DW P DI EA KEMR RK+FDVEDMYTIAD WGWTWE+E+K +P +RW
Sbjct  712   AARLAVADDDDDDWFPEDILEAFKEMRNRKVFDVEDMYTIADAWGWTWEREIKKRPLQRW  771

Query  2427  SQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGS  2606
             SQEWEVEL I++M KVI LGGTPTIGDCA+ILRAAIRAPMPSAFLKILQ THSLGY FGS
Sbjct  772   SQEWEVELAIQLMLKVIELGGTPTIGDCAMILRAAIRAPMPSAFLKILQTTHSLGYQFGS  831

Query  2607  PLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             PLYDEI+ LC+DL ELDAA+AIVADLET+GI VPD+TLDRVISA+ 
Sbjct  832   PLYDEIISLCIDLGELDAAIAIVADLETAGIAVPDQTLDRVISAKQ  877


 Score =   167 bits (422),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +2

Query  143  FKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMA  322
            F L   T +P + R   P   G V  + S+    T  KK +    PK   D+    +++ 
Sbjct  2    FLLSLQTPLPFKPRHSLPFKNGVVYASTSA----TAPKKSRRKKPPKQKSDNGSPLSVVF  57

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            S  EK LR  FMEELM RAR+ D +GVS VIYDMIAAGL PGPRSFHGLIV+H LN D E
Sbjct  58   SAEEKNLRFAFMEELMHRARNRDSNGVSDVIYDMIAAGLSPGPRSFHGLIVAHTLNGDHE  117

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            GAM +LRRELS G RPLHET +ALIRLFGSKG  TRGLE+LAAME L 
Sbjct  118  GAMQSLRRELSAGHRPLHETCIALIRLFGSKGFGTRGLELLAAMEKLN  165



>ref|XP_009401704.1| PREDICTED: uncharacterized protein LOC103985662 [Musa acuminata 
subsp. malaccensis]
Length=892

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/703 (76%), Positives = 604/703 (86%), Gaps = 11/703 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV ++HLE+AN VF KGAKGGLRATD++YDLLI+EDCKAGDHSNALTIAYEMEAAGRM
Sbjct  185   EELVCNHHLEDANTVFLKGAKGGLRATDELYDLLIKEDCKAGDHSNALTIAYEMEAAGRM  244

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQA CGIPE+AFATFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  245   ATTFHFNCLLSVQANCGIPEIAFATFENMEYGGEDYMKPDTETYNWVIQAYTRAESYDRV  304

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVED+KRLQPN++TY LLVECF+KYCVV+EAIRHFRALKN  GG R+L+NE
Sbjct  305   QDVAELLGMMVEDYKRLQPNVKTYALLVECFTKYCVVKEAIRHFRALKNLPGGTRVLYNE  364

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLY+RALC EGR VELLEALEAM KDNQ I PRAMILSRKYRTLVSSWIEPLQ
Sbjct  365   GNFGDPLSLYVRALCCEGRAVELLEALEAMAKDNQLIAPRAMILSRKYRTLVSSWIEPLQ  424

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDYIARYV EGGLTGERKRWVPRRGKTPLDPDA G+ YSNPMETSFKQ CLE
Sbjct  425   EEADVGFEIDYIARYVVEGGLTGERKRWVPRRGKTPLDPDALGFAYSNPMETSFKQCCLE  484

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             EW+IYHRKLL TLRNEGP+ LG+VSE+DY+RV ERLKKI+KGP+Q ALKPKAASKMIVSE
Sbjct  485   EWKIYHRKLLKTLRNEGPSALGDVSEADYIRVEERLKKIIKGPDQNALKPKAASKMIVSE  544

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQDLPTDGTR VLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRI
Sbjct  545   LKEELEAQDLPTDGTRQVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRI  604

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL +G+TE+WK RFLGE       + + V D EL             + D  ++  +E E
Sbjct  605   KLEDGNTEYWKLRFLGESLTNVHEKDIVVEDSEL--------HDILDDADALEDGTKEAE  656

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             E++  E E    +T+ + GD +K+K ++ AKPLQMIGVQLLKDS++T+ S K  RR    
Sbjct  657   EDDVDEEEEAVEQTENQEGDVIKDKVIERAKPLQMIGVQLLKDSEETAPSSKKSRRRVAR  716

Query  2262  AMdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQE  2435
             A  +   DEDW+P DIHEA K MR+RKIFDV DM+TIAD WGWTWE+ELKNK P +WSQE
Sbjct  717   ASIEDDADEDWLPEDIHEAFKVMRERKIFDVSDMFTIADAWGWTWERELKNKMPCKWSQE  776

Query  2436  WEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLY  2615
             WEVEL I+IM KVI LGGTPTIGDCA+ILRAAIRAPMPSAFL ILQ THSLGY FGSPLY
Sbjct  777   WEVELAIKIMQKVIELGGTPTIGDCAMILRAAIRAPMPSAFLTILQTTHSLGYAFGSPLY  836

Query  2616  DEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             +E+++LCLDL E+DAA+AIVAD+ET+GI V D+TLD+V+SAR+
Sbjct  837   NEVILLCLDLGEVDAAIAIVADMETTGIKVSDQTLDKVLSARH  879


 Score =   166 bits (421),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  308  GALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVL  487
            G L  S  EK LR  FMEELM RAR  D +GV+ VIYDM+AAGL PGPRSFHGL+VSH L
Sbjct  61   GGLSVSTVEKGLRFAFMEELMWRARSRDPAGVADVIYDMVAAGLSPGPRSFHGLVVSHTL  120

Query  488  NLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            + D EGAM +LRRELS GLRPLHETF+ALIRLFGS+G ATRGLEIL AME LK
Sbjct  121  SGDEEGAMQSLRRELSAGLRPLHETFIALIRLFGSRGHATRGLEILGAMEKLK  173



>ref|XP_006296937.1| hypothetical protein CARUB_v10012929mg [Capsella rubella]
 gb|EOA29835.1| hypothetical protein CARUB_v10012929mg [Capsella rubella]
Length=911

 Score =  1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/709 (75%), Positives = 615/709 (87%), Gaps = 9/709 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE+ANKVF KGA+GG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  185   EELMRTNHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEAAGRM  244

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA++TFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  245   ATTFHFNCLLSVQATCGIPEVAYSTFENMEYGEDFMKPDTETYNWVIQAYTRAESYDRVQ  304

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALKNFEGG  +L+N G
Sbjct  305   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTIVLYNAG  364

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             K+ DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  365   KFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  424

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+ EGGLTG+RKRWVPR+GKTPLDPDA G+IYSNP+ETSFKQRCLE+
Sbjct  425   EAELGYEIDYLARYIEEGGLTGDRKRWVPRKGKTPLDPDASGFIYSNPIETSFKQRCLED  484

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKLL TL++EG  +LG+ SESDY+RV ERL+ I++GP Q  LKPKAASKM+VSEL
Sbjct  485   WKIHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIRGPAQNLLKPKAASKMVVSEL  544

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  545   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  604

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEV--------NDLELPdvetvddvakdveddead  2060
             LHEGDTEFWKRRFLGEG  E   +  E         +++ + D     D  +D +++E  
Sbjct  605   LHEGDTEFWKRRFLGEGLIETSVESSETAETVATGESEITIKDAAKEADDDEDDDEEEEQ  664

Query  2061  eeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskks  2240
             E +E+++E EE EV V +TE +AE  D VK K  +  K LQMIGVQLLK+SD+ + +KK 
Sbjct  665   EGDEDDDENEEEEVVVAETENRAEGEDLVKNKAAEAKKHLQMIGVQLLKESDEANRTKKR  724

Query  2241  -rrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPP  2417
              +R SR+T  DD DEDW P D  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK P
Sbjct  725   GKRASRMTLEDDADEDWFPEDPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTP  784

Query  2418  RRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYV  2597
             R+WSQEWEVEL + +M+KVI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ THSLGY 
Sbjct  785   RKWSQEWEVELAMVLMTKVIELGGIPTIGDCAVILRAAVRAPMPSAFLKILQTTHSLGYS  844

Query  2598  FGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             FGSPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+T+D+VISAR 
Sbjct  845   FGSPLYDEIITLCLDLGELDAAIAIVADMETTGITVPDQTIDKVISARQ  893


 Score =   160 bits (405),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 113/158 (72%), Gaps = 7/158 (4%)
 Frame = +2

Query  188  FPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLV  352
             P R AG   +  ++S+P+++ R++++Q       A++DD    G     S  E+ LRL 
Sbjct  18   IPRRAAGLSSIRCSISAPEKKPRRRRKQKRGD--AADNDDSSSFGSGEAVSALERSLRLT  75

Query  353  FMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL  532
            FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL
Sbjct  76   FMDELMERARNRDSSGVSEVIYDMIAAGLAPGPRSFHGLVVAHALNGDEQGAMHSLRKEL  135

Query  533  SEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              G RPL ET +AL+RL GSKG ATRGLEILAAME L 
Sbjct  136  GAGQRPLPETMIALVRLSGSKGNATRGLEILAAMEKLN  173



>ref|XP_002325363.1| SAP domain-containing family protein [Populus trichocarpa]
 gb|EEE99744.1| SAP domain-containing family protein [Populus trichocarpa]
Length=887

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/701 (77%), Positives = 609/701 (87%), Gaps = 2/701 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV+   +E+AN+VF KGA GGLRATD++YDL+IEEDCK GDHSNAL IAY ME AGRM
Sbjct  177   EELVKGRFMEDANRVFLKGANGGLRATDELYDLMIEEDCKVGDHSNALDIAYAMEEAGRM  236

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE++FATFENMEYGE YMKPDTE+YNWVIQAYTRAESYDRVQ
Sbjct  237   ATTFHFNCLLSVQATCGIPEISFATFENMEYGEDYMKPDTESYNWVIQAYTRAESYDRVQ  296

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECFSKYCVVREAIRHFRAL+ FEGG + LHNEG
Sbjct  297   DVAELLGMMVEDHKRIQPNVKTYALLVECFSKYCVVREAIRHFRALRKFEGGTKALHNEG  356

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             K+GDPLSLYLRALCREGRIV+LLEALEAM +DNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  357   KFGDPLSLYLRALCREGRIVDLLEALEAMAEDNQPIPPRAMILSRKYRTLVSSWIEPLQE  416

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYVAEGGLTGERKRWVPRRGKTPLDPD +G+IYSNPMETS KQRCLE+
Sbjct  417   EAELGYEIDYVARYVAEGGLTGERKRWVPRRGKTPLDPDCDGFIYSNPMETSLKQRCLED  476

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+ +HRKLL  LRNEG A LG+ SESDYLRV ERL+KI++GP++  LKPKAASKMIVSEL
Sbjct  477   WKAHHRKLLKMLRNEGLAALGDASESDYLRVEERLRKIIRGPDRNVLKPKAASKMIVSEL  536

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             K+ELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI+
Sbjct  537   KDELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEVDELISRIQ  596

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEGDTEFWKRRFLGEGFN N  + +++   ELPD    D+   D + ++  +E E+EE 
Sbjct  597   LHEGDTEFWKRRFLGEGFNGNHVKPVDMETSELPDELDEDEDDDDDDVEDVAKEVEDEEA  656

Query  2085  eeeveveveqtetqaevGDR-VKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT  2261
             +EE EVEVE  +T+++  +R VK KE +  KPLQMIGVQLLKDSDQT+   K  RR    
Sbjct  657   DEEGEVEVEVEQTESQDAERIVKAKEAEAKKPLQMIGVQLLKDSDQTTRMSKKSRRRAAR  716

Query  2262  AMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
               DDDD+DW P DI EA KEMR RK+FDVEDMY IAD WGWTWE+E+K +P +RWSQEWE
Sbjct  717   LADDDDDDWFPEDILEAFKEMRNRKVFDVEDMYLIADAWGWTWEREIKKRPLQRWSQEWE  776

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I++M K   LGGTPTIGDCA+ILRAAIRAPMPSAFLKILQ THSLGY FGS LYDE
Sbjct  777   VELAIQLMLKA-KLGGTPTIGDCAMILRAAIRAPMPSAFLKILQTTHSLGYQFGSSLYDE  835

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LC+DL ELDAA+AIVADLET+GI VPD+TLDRVISA+ 
Sbjct  836   IISLCVDLGELDAAIAIVADLETAGIAVPDQTLDRVISAKQ  876


 Score =   169 bits (427),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +2

Query  143  FKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMA  322
            F L   T +P + R   P   G V  + S+    T  KK +    PK   D+    +++ 
Sbjct  2    FLLSLQTPLPFKPRHSLPSKNGVVYASTSA----TAPKKSRRKKPPKQKNDNGSPLSVVV  57

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            S  EK LR  FMEELM RAR+ D +GVS VIYDMIAAGL PGPRSFHGLIV+H LN D E
Sbjct  58   SAEEKNLRFAFMEELMHRARNRDSNGVSDVIYDMIAAGLSPGPRSFHGLIVAHTLNGDHE  117

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            GAM +LRRELS G RPLHET +ALIRLFGSKG  TRGLE+LAAME L 
Sbjct  118  GAMQSLRRELSAGHRPLHETCIALIRLFGSKGFGTRGLELLAAMEKLN  165



>ref|XP_006408205.1| hypothetical protein EUTSA_v10020015mg [Eutrema salsugineum]
 gb|ESQ49658.1| hypothetical protein EUTSA_v10020015mg [Eutrema salsugineum]
Length=912

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/705 (75%), Positives = 607/705 (86%), Gaps = 6/705 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE+ANKVF KGA+GG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  187   EELMRTNHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEAAGRM  246

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA++TFENMEYGE +MKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  247   ATTFHFNCLLSVQATCGIPEVAYSTFENMEYGEDFMKPDTETYNWVIQAYTRADSYDRVQ  306

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVV+EAIRHFRALKNFEGG  +LHN G
Sbjct  307   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVKEAIRHFRALKNFEGGTIVLHNAG  366

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL+EAL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  367   NFEDPLSLYLRALCREGRIVELIEALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  426

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCL++
Sbjct  427   EAELGYEIDYLARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQRCLDD  486

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP Q  LKPKAASKM+VSEL
Sbjct  487   WKIHHRKLLRTLQSEGLPVLGDASESDYIRVMERLRNIIKGPAQNLLKPKAASKMVVSEL  546

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  547   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELIRRIK  606

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLE----VNDLELPdvetvddvakdveddeadeeee  2072
             LHEGDTEFWKRRFLGEG  E  ++  E    V   E  +         + +DDE +EE+E
Sbjct  607   LHEGDTEFWKRRFLGEGLIETSAESKETAESVATGESENTIEDVVKEAEDDDDEEEEEQE  666

Query  2073  eeeeeeeveveveqtetqaevGDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskks-rr  2246
              +EE+EE E  V         G+ + + +   AK  LQMIGVQLLK+SD+ + +KK  +R
Sbjct  667   GDEEDEEEEEVVVAETENRAEGEDLVKNKAADAKKHLQMIGVQLLKESDEANRTKKRGKR  726

Query  2247  rsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRW  2426
              SR+T  DD DEDW P +  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PR+W
Sbjct  727   ASRMTLEDDADEDWFPEEPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDYKNKTPRKW  786

Query  2427  SQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGS  2606
             SQEWEVEL I +M+KVI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ THSLGY FGS
Sbjct  787   SQEWEVELAIVLMTKVIELGGIPTIGDCAVILRAAVRAPMPSAFLKILQTTHSLGYSFGS  846

Query  2607  PLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             PLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+TLD+VISAR
Sbjct  847   PLYDEIITLCLDLGELDAAIAIVADMETTGITVPDQTLDKVISAR  891


 Score =   163 bits (413),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 114/158 (72%), Gaps = 5/158 (3%)
 Frame = +2

Query  188  FPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLV  352
             P R AG   +  ++S+P+++ R++++Q   +   AE+DD    G     S  E+ LRL 
Sbjct  18   IPRRAAGCSSIRCSISAPEKKPRRRRKQQQKRGDGAENDDSSSFGSREAVSALERSLRLT  77

Query  353  FMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL  532
            FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL
Sbjct  78   FMDELMERARNRDTSGVSEVIYDMIAAGLSPGPRSFHGLVVAHALNGDEQGAMHSLRKEL  137

Query  533  SEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              G RPL ET +AL+RL GSKG ATRGLE+LAAME L 
Sbjct  138  GAGQRPLPETMIALVRLSGSKGNATRGLELLAAMEKLN  175



>ref|XP_003590907.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=2047

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/746 (71%), Positives = 605/746 (81%), Gaps = 47/746 (6%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLIEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  167   EELVRNKHLEDANKVFLKGAKGGLRATDELYDLLIEEDCKAGDHSNALEISYEMEAAGRM  226

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF TFENMEYGE YMKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  227   ATTFHFNCLLSVQATCGIPEIAFTTFENMEYGEDYMKPDTETYNWVIQAYTRADSYDRVQ  286

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVVREAIRHFRALKNFEGG ++LH +G
Sbjct  287   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVREAIRHFRALKNFEGGTKILHMDG  346

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRI+++LEALEAM  DNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  347   NHGDPLSLYLRALCREGRIIDMLEALEAMANDNQQIPPRAMILSRKYRTLVSSWIEPLQE  406

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARYV EGGLTGERKRWVPR GKTPLDPDA+G+IYSNPMETSFKQRCLEE
Sbjct  407   EAELGYEIDYIARYVEEGGLTGERKRWVPRSGKTPLDPDADGFIYSNPMETSFKQRCLEE  466

Query  1545  WRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              ++YH+KLL  LR EG   LG+  SESDY+RV E LKKI+KGPEQ ALKPKAASKM+V+E
Sbjct  467   KKVYHKKLLKKLRYEGIVALGDGASESDYVRVIEWLKKIIKGPEQNALKPKAASKMLVNE  526

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+E EEEEVDEEL+ LISRI
Sbjct  527   LKEELEAQGLPIDGTRNVLYQRVQKARRINQSRGRPLWVPPIEVEEEEVDEELEALISRI  586

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TE+WKRRFLGEG N ++   ++  + E PDV+   DV  D   +  D+E +E+E
Sbjct  587   KLEEGNTEYWKRRFLGEGLNGDNGNAMDEGESESPDVQDYIDVVGDDAKEAEDDEADEDE  646

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ---Tssskksrrrs  2252
             EEE  ++E E  + + +  +R+KEKEV++ KPLQMIGVQLLKD ++   T      RR  
Sbjct  647   EEEVEQIEEEIAQVENQDVERIKEKEVESKKPLQMIGVQLLKDFNEPSATFKKSSRRRSR  706

Query  2253  rITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQ  2432
             R    DD D+DW PLDI EA KEMR R++FDV DMYT+AD WGWTWEKELKN+PP RWSQ
Sbjct  707   RNMVDDDADDDWFPLDIFEAFKEMRNRRVFDVSDMYTLADAWGWTWEKELKNRPPHRWSQ  766

Query  2433  EWEVELGIEIMSK-------------------------------------------VIAL  2483
             EWEV+L I++M K                                           VI L
Sbjct  767   EWEVDLAIKVMQKATVANTPLDKLNKKEIVRAVILSMCKELKVGYVVRIKYGDNAAVIQL  826

Query  2484  GGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAA  2663
             GGTPTIGDCA+ILRAAI AP+PSAFL ILQ TH LGY FG PLYDE++ LCLDL ELDAA
Sbjct  827   GGTPTIGDCAVILRAAISAPLPSAFLTILQTTHGLGYKFGRPLYDEVISLCLDLGELDAA  886

Query  2664  VAIVADLETSGIMVPDETLDRVISAR  2741
             VA+VADLET+GI+V D+TLDRVISA+
Sbjct  887   VAVVADLETTGILVSDQTLDRVISAK  912


 Score =   183 bits (465),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 96/162 (59%), Positives = 115/162 (71%), Gaps = 16/162 (10%)
 Frame = +2

Query  158  TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEK  337
            +T +P +     PRT G V  A+SSP++RTRKKKQ         +DDD       +  E 
Sbjct  9    STYIPFKLNRLTPRT-GPVRAALSSPEKRTRKKKQ--------VKDDD-------TLLEN  52

Query  338  VLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHA  517
             LR  FMEELM RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+VS+ LN + + AM +
Sbjct  53   SLRFSFMEELMNRARNRDSTGVSQVMYDMIAAGLSPGPRSFHGLVVSYALNGNEQAAMDS  112

Query  518  LRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            LRREL  GLRP+HETFVAL+RLFGSKG +TRGLEIL AMENL
Sbjct  113  LRRELGAGLRPIHETFVALVRLFGSKGHSTRGLEILGAMENL  154



>ref|NP_187076.2| plastid transcriptionally active 3 [Arabidopsis thaliana]
 gb|AEE74058.1| plastid transcriptionally active 3 [Arabidopsis thaliana]
Length=910

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/708 (74%), Positives = 604/708 (85%), Gaps = 8/708 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R NHLE+ANKVF KGA+GG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  185   EELMRINHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEAAGRM  244

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  245   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPDTETYNWVIQAYTRAESYDRVQ  304

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALKNFEGG  +LHN G
Sbjct  305   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTVILHNAG  364

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  365   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  424

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLE+
Sbjct  425   EAELGYEIDYLARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQRCLED  484

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP    LKPKAASKM+VSEL
Sbjct  485   WKVHHRKLLRTLQSEGLPVLGDASESDYMRVVERLRNIIKGPALNLLKPKAASKMVVSEL  544

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+D+LI RIK
Sbjct  545   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDDLICRIK  604

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVN------DLELPdvetvddvakdveddeadee  2066
             LHEGDTEFWKRRFLGEG  E   +  E        + E    +   +   + +DDE ++E
Sbjct  605   LHEGDTEFWKRRFLGEGLIETSVESKETTESVVTGESEKAIEDISKEADNEEDDDEEEQE  664

Query  2067  eeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskks-  2240
              +E+++E E E  V         G+ + + +   AK  LQMIGVQLLK+SD+ + +KK  
Sbjct  665   GDEDDDENEEEEVVVPETENRAEGEDLVKNKAADAKKHLQMIGVQLLKESDEANRTKKRG  724

Query  2241  rrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPR  2420
             +R SR+T  DD DEDW P +  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PR
Sbjct  725   KRASRMTLEDDADEDWFPEEPFEAFKEMRERKVFDVADMYTIADVWGWTWEKDFKNKTPR  784

Query  2421  RWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVF  2600
             +WSQEWEVEL I +M+KVI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ THSLGY F
Sbjct  785   KWSQEWEVELAIVLMTKVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQTTHSLGYSF  844

Query  2601  GSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             GSPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+TLD+VISAR 
Sbjct  845   GSPLYDEIITLCLDLGELDAAIAIVADMETTGITVPDQTLDKVISARQ  892


 Score =   163 bits (413),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +2

Query  287  AEDDDG---GGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRS  457
            AE+DD    G     S  E+ LRL FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRS
Sbjct  51   AENDDSLSFGSGEAVSALERSLRLTFMDELMERARNRDTSGVSEVIYDMIAAGLSPGPRS  110

Query  458  FHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            FHGL+V+H LN D +GAMH+LR+EL  G RPL ET +AL+RL GSKG ATRGLEILAAME
Sbjct  111  FHGLVVAHALNGDEQGAMHSLRKELGAGQRPLPETMIALVRLSGSKGNATRGLEILAAME  170

Query  638  NLK  646
             LK
Sbjct  171  KLK  173



>emb|CDY21131.1| BnaA01g33620D [Brassica napus]
Length=907

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/711 (76%), Positives = 608/711 (86%), Gaps = 16/711 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+NHLE ANKVF KGAKGG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGR 
Sbjct  183   EELVRTNHLEEANKVFLKGAKGGMRATDQLYDLMIEEDCKAGDHSNALEISYEMEAAGRF  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRA+SYDRVQ
Sbjct  243   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEDFMKPNTETYNWVIQAYTRADSYDRVQ  302

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVV+EAIRHFRALKNFEGG ++LHN+G
Sbjct  303   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVKEAIRHFRALKNFEGGTKVLHNDG  362

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  363   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  422

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYV EGGLTG+RKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCL++
Sbjct  423   EAELGYEIDYLARYVEEGGLTGDRKRWVPRRGKTPLDPDAAGFIYSNPIETSFKQRCLDD  482

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP Q  LKPKAASKM+VSEL
Sbjct  483   WKVHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIKGPAQNLLKPKAASKMVVSEL  542

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  543   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  602

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEV----------NDLELPdvetvddvakdvedde  2054
             LHEGDTEFWKRRFLGEG  E  ++ +E           N  E       DD   D ED E
Sbjct  603   LHEGDTEFWKRRFLGEGLIETTAESIETDESVAAGGPENKTEDVAKGADDDEDDDEEDQE  662

Query  2055  adeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-Tsss  2231
              DEE++E EEEEE EV V + E +AE  D VK K     + LQMIGVQLLK+SD+ + + 
Sbjct  663   GDEEDDENEEEEEEEVVVAEPENRAEGEDLVKNKAADAKRHLQMIGVQLLKESDEASRTK  722

Query  2232  kksrrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNK  2411
             K+ +R SR+T  DD DEDW P +  EA KEMR+RK+FDV+DMYTIADVWGWTWEK+ KNK
Sbjct  723   KRGKRASRMTLEDDADEDWFPEEPFEAFKEMRERKVFDVKDMYTIADVWGWTWEKDFKNK  782

Query  2412  PPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLG  2591
              PRRWSQEWEVEL I     VI LGG PTIGDCA+ILRAAIRAPMPSAFLKILQ THSLG
Sbjct  783   TPRRWSQEWEVELAI-----VIELGGVPTIGDCAVILRAAIRAPMPSAFLKILQTTHSLG  837

Query  2592  YVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             Y FGSPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+TLD+VIS R 
Sbjct  838   YAFGSPLYDEIITLCLDLGELDAAIAIVADMETTGITVPDQTLDKVISVRQ  888


 Score =   156 bits (395),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = +2

Query  188  FPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLV  352
             P R AG      ++S+P+    KK ++   Q +  E++D    G +   S  E+ LRL 
Sbjct  18   IPRRAAGIPTTRCSISAPE----KKPRRRRKQIQKRENEDSSSFGSSEAVSALERSLRLT  73

Query  353  FMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL  532
            FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL
Sbjct  74   FMDELMERARNRDPSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQGAMHSLRKEL  133

Query  533  SEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              G RPL ET +AL+RL GSKG A RGLE+LAAME L 
Sbjct  134  GAGQRPLPETMIALVRLSGSKGNAQRGLELLAAMEKLN  171



>emb|CDY29994.1| BnaC01g40140D [Brassica napus]
Length=895

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/701 (75%), Positives = 604/701 (86%), Gaps = 9/701 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+NHLE ANKVF KGAKGG+RATD++YDL+IEEDCKAGDHSNAL I+YEMEAAGR 
Sbjct  184   EELVRTNHLEEANKVFLKGAKGGMRATDKLYDLMIEEDCKAGDHSNALEISYEMEAAGRF  243

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRA+SYDRVQ
Sbjct  244   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEDFMKPNTETYNWVIQAYTRADSYDRVQ  303

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVV+EAIRHFRALK FEGG ++LHN G
Sbjct  304   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVKEAIRHFRALKKFEGGTKVLHNAG  363

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  364   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  423

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYV EGGLTG+RKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCL++
Sbjct  424   EAELGYEIDYLARYVEEGGLTGDRKRWVPRRGKTPLDPDAAGFIYSNPIETSFKQRCLDD  483

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKL  TL++EG  +LG+ +ESDY+RV ERL+ I+KGP Q  LKPKAASKM+VSEL
Sbjct  484   WKVHHRKLFRTLQSEGLPVLGDATESDYMRVMERLRNIIKGPAQNLLKPKAASKMVVSEL  543

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  544   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  603

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEGDTEFWKRRFLGEG  E  +  +E ++         DD   D E++E + +E+++E 
Sbjct  604   LHEGDTEFWKRRFLGEGLIETTADSIETDE---SVAAGADDDEDDDEEEEQEGDEDDDEN  660

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskks-rrrsrIT  2261
             EEE EV V + E +AE  D VK K     + LQMIGVQLLK+SD+ + +KK  +R SR+T
Sbjct  661   EEEEEVVVAEPENRAEGQDLVKNKAADAKRHLQMIGVQLLKESDEANRTKKRGKRASRMT  720

Query  2262  AMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWE  2441
               DD DEDW P +  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PRRWSQEWE
Sbjct  721   LEDDADEDWFPEEPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTPRRWSQEWE  780

Query  2442  VELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDE  2621
             VEL I     VI LGG PTIGDCA+ILRAAIRAP+PSAFLKILQ THSLGY FGSPLYDE
Sbjct  781   VELAI-----VIELGGVPTIGDCAVILRAAIRAPVPSAFLKILQTTHSLGYAFGSPLYDE  835

Query  2622  IVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             I+ LCLDL ELDAA+AIVAD+ET+GI VPD+TLD+VISAR 
Sbjct  836   IITLCLDLGELDAAIAIVADMETTGITVPDQTLDKVISARQ  876


 Score =   157 bits (398),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 104/154 (68%), Gaps = 3/154 (2%)
 Frame = +2

Query  194  PRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLVFMEE  364
            PR A   V +         KK ++   Q +  E++D    G +   S  E+ LRL FM+E
Sbjct  19   PRRAAGFVASTRCSISALEKKPRRRRKQIQKRENEDSSSFGSSEAVSALERSLRLTFMDE  78

Query  365  LMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGL  544
            LMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL  G 
Sbjct  79   LMERARNRDTSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQGAMHSLRKELGAGQ  138

Query  545  RPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            RPL ET +AL+RL GSKG A RGLE+LAAME L 
Sbjct  139  RPLPETMIALVRLSGSKGNAQRGLELLAAMEKLN  172



>gb|AAF26788.1|AC016829_12 hypothetical protein [Arabidopsis thaliana]
Length=913

 Score =  1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/711 (74%), Positives = 604/711 (85%), Gaps = 11/711 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R NHLE+ANKVF KGA+GG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  185   EELMRINHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEAAGRM  244

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEA-YMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE  +MKPDTETYNWVIQAYTRAESYDRV
Sbjct  245   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEGLFMKPDTETYNWVIQAYTRAESYDRV  304

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALKNFEGG  +LHN 
Sbjct  305   QDVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTVILHNA  364

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQ
Sbjct  365   GNFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQ  424

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELGYEIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLE
Sbjct  425   EEAELGYEIDYLARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQRCLE  484

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+++HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP    LKPKAASKM+VSE
Sbjct  485   DWKVHHRKLLRTLQSEGLPVLGDASESDYMRVVERLRNIIKGPALNLLKPKAASKMVVSE  544

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+D+LI RI
Sbjct  545   LKEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDDLICRI  604

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVN------DLELPdvetvddvakdveddeade  2063
             KLHEGDTEFWKRRFLGEG  E   +  E        + E    +   +   + +DDE ++
Sbjct  605   KLHEGDTEFWKRRFLGEGLIETSVESKETTESVVTGESEKAIEDISKEADNEEDDDEEEQ  664

Query  2064  eeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskks  2240
             E +E+++E E E  V         G+ + + +   AK  LQMIGVQLLK+SD+ + +KK 
Sbjct  665   EGDEDDDENEEEEVVVPETENRAEGEDLVKNKAADAKKHLQMIGVQLLKESDEANRTKKR  724

Query  2241  -rrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPP  2417
              +R SR+T  DD DEDW P +  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK P
Sbjct  725   GKRASRMTLEDDADEDWFPEEPFEAFKEMRERKVFDVADMYTIADVWGWTWEKDFKNKTP  784

Query  2418  RRWSQEWEVELGIEIMSK--VIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLG  2591
             R+WSQEWEVEL I +M+K  VI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ THSLG
Sbjct  785   RKWSQEWEVELAIVLMTKAGVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQTTHSLG  844

Query  2592  YVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             Y FGSPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+TLD+VISAR 
Sbjct  845   YSFGSPLYDEIITLCLDLGELDAAIAIVADMETTGITVPDQTLDKVISARQ  895


 Score =   163 bits (412),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +2

Query  287  AEDDDG---GGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRS  457
            AE+DD    G     S  E+ LRL FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRS
Sbjct  51   AENDDSLSFGSGEAVSALERSLRLTFMDELMERARNRDTSGVSEVIYDMIAAGLSPGPRS  110

Query  458  FHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            FHGL+V+H LN D +GAMH+LR+EL  G RPL ET +AL+RL GSKG ATRGLEILAAME
Sbjct  111  FHGLVVAHALNGDEQGAMHSLRKELGAGQRPLPETMIALVRLSGSKGNATRGLEILAAME  170

Query  638  NLK  646
             LK
Sbjct  171  KLK  173



>ref|XP_003535382.1| PREDICTED: uncharacterized protein LOC100802355 isoform X1 [Glycine 
max]
Length=887

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/715 (75%), Positives = 616/715 (86%), Gaps = 3/715 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+AN+VF KGAKGGL+ATD++YDLLI+EDCK GDHSNAL IAYEMEAAGRM
Sbjct  172   EELVRNMHLEDANEVFLKGAKGGLKATDEVYDLLIQEDCKVGDHSNALDIAYEMEAAGRM  231

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  232   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  291

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN +T+ LLVECF+KYCVVREAIRHFRALKNFEGG+ +LHNEG
Sbjct  292   DVAELLGMMVEDHKRIQPNAKTHALLVECFTKYCVVREAIRHFRALKNFEGGIEVLHNEG  351

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVE+LEALEAM KDNQ IP RAMILSRKYRTLVSSWIEPLQE
Sbjct  352   NHGDPLSLYLRALCREGRIVEMLEALEAMAKDNQPIPSRAMILSRKYRTLVSSWIEPLQE  411

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAE+GYEIDYI+RY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRC+EE
Sbjct  412   EAEIGYEIDYISRYIDEGGLTGERKRWVPRRGKTPLDPDAHGFIYSNPMETSFKQRCMEE  471

Query  1545  WRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              +++++KLL TL+NEG A LG +VSE DY+RV ERLKK++KGPEQ  LKPKAASKM+VSE
Sbjct  472   LKLHNKKLLKTLQNEGLAALGDDVSEFDYIRVQERLKKLMKGPEQNVLKPKAASKMLVSE  531

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEEL+AQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELD LISRI
Sbjct  532   LKEELDAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDALISRI  591

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWKRRFLGEG N +     +    ++P+V    D  +D   +  D+E ++EE
Sbjct  592   KLEEGNTEFWKRRFLGEGLNGDQEMPTDAVQSDVPEVLDDVDAIEDAAKEVEDDEADDEE  651

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrI  2258
             EE E   E  +     +V +R+KEKEV+  +PLQMIGVQLLKD DQ T++SKK +R  R+
Sbjct  652   EEAEQAEEEVEPAENQDV-NRIKEKEVEAKRPLQMIGVQLLKDIDQPTATSKKFKRSRRV  710

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
                DDDD+DW+PL++ EA KEMRKRKIFDV DMYT+AD WGWTWE+ELKNKPPRRWSQE 
Sbjct  711   QVEDDDDDDWLPLNLFEAFKEMRKRKIFDVSDMYTLADAWGWTWERELKNKPPRRWSQER  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGG PTIGDCA+ILRAAIRAP+PSAFL ILQ TH+LG+ FGSPLYD
Sbjct  771   EVELAIKVMHKVIELGGRPTIGDCAMILRAAIRAPLPSAFLTILQTTHALGFKFGSPLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK*QSSK*IIHQS  2783
             E + LC+DL ELDAAVA+VADLET+GI V D TLDRVISA+ +   +S  +I  +
Sbjct  831   ETISLCVDLGELDAAVAVVADLETTGISVSDHTLDRVISAKQRIDNTSNGVIRDA  885


 Score =   180 bits (456),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 122/178 (69%), Gaps = 19/178 (11%)
 Frame = +2

Query  116  MAALLTQLPFKLKF-TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAE  292
            M++L+  LP+   +     P +   F PR A  V  AVS+P +R RKKKQ        ++
Sbjct  1    MSSLI--LPYTYTYGYARFPFKLNRFSPR-AVTVRAAVSAPDKRGRKKKQ--------SK  49

Query  293  DDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLI  472
            DD+       S  E  LR  FMEELM+RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+
Sbjct  50   DDE-------SAVENGLRFSFMEELMDRARNRDSNGVSEVMYDMIAAGLSPGPRSFHGLV  102

Query  473  VSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            VSH LN D E AM +LRREL+ GLRP+HETF+ALIRLFGSKG ATRGLEILAAME L 
Sbjct  103  VSHALNGDEEAAMESLRRELAAGLRPVHETFLALIRLFGSKGRATRGLEILAAMEKLN  160



>gb|KHN04962.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=887

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/712 (76%), Positives = 618/712 (87%), Gaps = 3/712 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV + HLE+AN+VF KGAKGGL+ATD++YDLLIEEDCKAGDHSNAL IAYEMEAAGRM
Sbjct  172   EELVWNKHLEDANEVFLKGAKGGLKATDEVYDLLIEEDCKAGDHSNALDIAYEMEAAGRM  231

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  232   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  291

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN +T+ LLVECF+KYCVVREAIRHFRALKNFEGG+++LHNEG
Sbjct  292   DVAELLGMMVEDHKRIQPNAKTHALLVECFTKYCVVREAIRHFRALKNFEGGIKVLHNEG  351

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVE+LEALEAM KDNQ IP RAMILSRKYRTLVSSWIEPLQE
Sbjct  352   NHGDPLSLYLRALCREGRIVEMLEALEAMAKDNQPIPSRAMILSRKYRTLVSSWIEPLQE  411

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYI+RY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLEE
Sbjct  412   EAELGYEIDYISRYIDEGGLTGERKRWVPRRGKTPLDPDAHGFIYSNPMETSFKQRCLEE  471

Query  1545  WRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              +++++KLL TL+NEG A LG+ VSESDY+RV ERLKK++KGPEQ  LKPKAASKM+VSE
Sbjct  472   LKLHNKKLLKTLQNEGLAALGDGVSESDYIRVQERLKKLIKGPEQNVLKPKAASKMLVSE  531

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEEL+AQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELD LIS I
Sbjct  532   LKEELDAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDALISHI  591

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWKRRFLGEG N +     +  + E+P+V    D  +D   +  D+E +++E
Sbjct  592   KLEEGNTEFWKRRFLGEGLNGDQEMPTDAAESEVPEVLDDVDAIEDAAKEVEDDEADDDE  651

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrI  2258
             EE E   E  +     +V +R+KEKEV+  +PLQMIGVQLLKD DQ T++SKK +R  ++
Sbjct  652   EEAEQAEEEVEPAENQDV-NRIKEKEVEAKRPLQMIGVQLLKDIDQPTATSKKFKRSRKV  710

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
                DDDD+DW+PLD+ EA +EMRKRKIFDV DMYT+AD WGWTWE+ELK KPPRRWSQEW
Sbjct  711   QVEDDDDDDWLPLDLFEAFEEMRKRKIFDVSDMYTLADAWGWTWERELKKKPPRRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGG PTIGDCA+ILRAAIRAP+PSAFL ILQ THSLG+ FGSPLYD
Sbjct  771   EVELAIKVMQKVIELGGRPTIGDCAMILRAAIRAPLPSAFLTILQTTHSLGFKFGSPLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK*QSSK*II  2774
             EI+ LC+DL ELDAAVA+VADLET+GI V D TLDRVISA+ +   +S  +I
Sbjct  831   EIISLCVDLGELDAAVAVVADLETTGISVSDLTLDRVISAKQRIDNTSNGVI  882


 Score =   186 bits (472),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 122/178 (69%), Gaps = 19/178 (11%)
 Frame = +2

Query  116  MAALLTQLPFKLKF-TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAE  292
            M++L+  LP+   +     P +   F PRT   V  AVSSP +R RKKKQ        A+
Sbjct  1    MSSLI--LPYTYTYGYARFPFKLNRFSPRTVT-VRAAVSSPDKRGRKKKQ--------AK  49

Query  293  DDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLI  472
            DDD       S  E  LR  FMEELM+RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+
Sbjct  50   DDD-------SAVENGLRFSFMEELMDRARNRDSNGVSEVMYDMIAAGLSPGPRSFHGLV  102

Query  473  VSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            VSH LN D E AM +LRREL+ GLRP+HETF+ALIRLFGSKG ATRGLEILAAME L 
Sbjct  103  VSHALNGDEEAAMESLRRELAAGLRPVHETFLALIRLFGSKGRATRGLEILAAMEKLN  160



>ref|XP_003555560.1| PREDICTED: uncharacterized protein LOC100807191 isoform X1 [Glycine 
max]
Length=887

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/712 (76%), Positives = 617/712 (87%), Gaps = 3/712 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV + HLE+AN+VF KGAKGGL+ATD++YDLLIEEDCKAGDHSNAL IAYEMEAAGRM
Sbjct  172   EELVWNKHLEDANEVFLKGAKGGLKATDEVYDLLIEEDCKAGDHSNALDIAYEMEAAGRM  231

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  232   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  291

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN +T+ LLVECF+KYCVVREAIRHFRALKNFEGG+++LHNEG
Sbjct  292   DVAELLGMMVEDHKRIQPNAKTHALLVECFTKYCVVREAIRHFRALKNFEGGIKVLHNEG  351

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVE+LEALEAM KDNQ IP RAMILSRKYRTLVSSWIEPLQE
Sbjct  352   NHGDPLSLYLRALCREGRIVEMLEALEAMAKDNQPIPSRAMILSRKYRTLVSSWIEPLQE  411

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYI+RY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRCLEE
Sbjct  412   EAELGYEIDYISRYIDEGGLTGERKRWVPRRGKTPLDPDAHGFIYSNPMETSFKQRCLEE  471

Query  1545  WRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
              +++++KLL TL+NEG A LG+ VSESDY+RV ERLKK++KGPEQ  LKPKAASKM+VSE
Sbjct  472   LKLHNKKLLKTLQNEGLAALGDGVSESDYIRVQERLKKLIKGPEQNVLKPKAASKMLVSE  531

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEEL+AQ LP DG RNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELD LIS I
Sbjct  532   LKEELDAQGLPIDGNRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDALISHI  591

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL EG+TEFWKRRFLGEG N +     +  + E+P+V    D  +D   +  D+E +++E
Sbjct  592   KLEEGNTEFWKRRFLGEGLNGDQEMPTDAAESEVPEVLDDVDAIEDAAKEVEDDEADDDE  651

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrI  2258
             EE E   E  +     +V +R+KEKEV+  +PLQMIGVQLLKD DQ T++SKK +R  ++
Sbjct  652   EEAEQAEEEVEPAENQDV-NRIKEKEVEAKRPLQMIGVQLLKDIDQPTATSKKFKRSRKV  710

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
                DDDD+DW+PLD+ EA +EMRKRKIFDV DMYT+AD WGWTWE+ELK KPPRRWSQEW
Sbjct  711   QVEDDDDDDWLPLDLFEAFEEMRKRKIFDVSDMYTLADAWGWTWERELKKKPPRRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I++M KVI LGG PTIGDCA+ILRAAIRAP+PSAFL ILQ THSLG+ FGSPLYD
Sbjct  771   EVELAIKVMQKVIELGGRPTIGDCAMILRAAIRAPLPSAFLTILQTTHSLGFKFGSPLYD  830

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK*QSSK*II  2774
             EI+ LC+DL ELDAAVA+VADLET+GI V D TLDRVISA+ +   +S  +I
Sbjct  831   EIISLCVDLGELDAAVAVVADLETTGISVSDLTLDRVISAKQRIDNTSNGVI  882


 Score =   186 bits (473),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 122/178 (69%), Gaps = 19/178 (11%)
 Frame = +2

Query  116  MAALLTQLPFKLKF-TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAE  292
            M++L+  LP+   +     P +   F PRT   V  AVSSP +R RKKKQ        A+
Sbjct  1    MSSLI--LPYTYTYGYARFPFKLNRFSPRTVT-VRAAVSSPDKRGRKKKQ--------AK  49

Query  293  DDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLI  472
            DDD       S  E  LR  FMEELM+RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+
Sbjct  50   DDD-------SAVENGLRFSFMEELMDRARNRDSNGVSEVMYDMIAAGLSPGPRSFHGLV  102

Query  473  VSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            VSH LN D E AM +LRREL+ GLRP+HETF+ALIRLFGSKG ATRGLEILAAME L 
Sbjct  103  VSHALNGDEEAAMESLRRELAAGLRPVHETFLALIRLFGSKGRATRGLEILAAMEKLN  160



>gb|KDO52505.1| hypothetical protein CISIN_1g002761mg [Citrus sinensis]
Length=670

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/668 (78%), Positives = 580/668 (87%), Gaps = 10/668 (1%)
 Frame = +3

Query  744   LIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENMEYGE  923
             +I EDCKAGDHSNAL IAYEMEAAGRMATTFHFN LLS QATCGIPEVAFATFENMEYGE
Sbjct  1     MIAEDCKAGDHSNALEIAYEMEAAGRMATTFHFNHLLSCQATCGIPEVAFATFENMEYGE  60

Query  924   AYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKY  1103
              YMKPDTETYN VIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPN++TY LLVECF+KY
Sbjct  61    DYMKPDTETYNCVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNVKTYALLVECFTKY  120

Query  1104  CVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDN  1283
             C V EAIRHFRAL+N+EGG ++LHNEG +GDPLSLYLRALCREGRI+ELLEALEAM KDN
Sbjct  121   CAVTEAIRHFRALQNYEGGTKVLHNEGNFGDPLSLYLRALCREGRIIELLEALEAMAKDN  180

Query  1284  QTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGK  1463
             Q +PPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARY++EGGLTGERKRWVPRRGK
Sbjct  181   QPVPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYISEGGLTGERKRWVPRRGK  240

Query  1464  TPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWE  1643
             TPLDPDA G+IYSNPMETSFKQRCLE+ + YHRKLL TL+NEGPA+LG+VSESDY+RV E
Sbjct  241   TPLDPDAVGFIYSNPMETSFKQRCLEDGKKYHRKLLRTLQNEGPAVLGDVSESDYVRVEE  300

Query  1644  RLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRG  1823
             RLKK++KGPEQ  LKPKAASKM+VSELKEEL+AQ LPTDGTRNVLYQRVQKARRIN SRG
Sbjct  301   RLKKLIKGPEQHVLKPKAASKMVVSELKEELDAQGLPTDGTRNVLYQRVQKARRINRSRG  360

Query  1824  RPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLEL  2003
             RPLW+PPVEEEEEEVDEE+DELISRIKL EG+TEFWKRRFLGEG N    + +E+++ EL
Sbjct  361   RPLWVPPVEEEEEEVDEEVDELISRIKLEEGNTEFWKRRFLGEGLNGRHDKAVEMDESEL  420

Query  2004  PdvetvddvakdveddeadeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQ  2183
              DV   D    +    + + +EEEE E+ E E +           DRVKEK V+  KPLQ
Sbjct  421   SDVLDDDVTDVEYVAKDEEADEEEEVEQAEPESQDV---------DRVKEKLVEAKKPLQ  471

Query  2184  MIGVQLLKDSDQTssskksrrrsrITAMd-dddedWIPLDIHEALKEMRKRKIFDVEDMY  2360
             MIGVQLLKDSDQT+++ K   +     ++ DDDEDW P D  EA KEMRKRK+FDV DMY
Sbjct  472   MIGVQLLKDSDQTTTTSKRSMKRSSRMVEDDDDEDWFPEDPFEAFKEMRKRKVFDVSDMY  531

Query  2361  TIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRA  2540
             TIAD WGWTWE+E+ N+PP++WSQEWEVEL I+IM KVI LGGTPTIGDCA+I+RAAIRA
Sbjct  532   TIADAWGWTWEREITNRPPQKWSQEWEVELAIQIMLKVIELGGTPTIGDCAVIIRAAIRA  591

Query  2541  PMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETL  2720
             P+PSAFLKILQ THSLGYVFGSPLYDEI+ LCLDL ELDAAVAIVAD+ET+GI VPD+TL
Sbjct  592   PLPSAFLKILQKTHSLGYVFGSPLYDEIISLCLDLGELDAAVAIVADMETTGIAVPDQTL  651

Query  2721  DRVISARN  2744
             DRVI++R 
Sbjct  652   DRVITSRQ  659



>gb|KCW85330.1| hypothetical protein EUGRSUZ_B02168 [Eucalyptus grandis]
Length=845

 Score =   971 bits (2511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/655 (78%), Positives = 564/655 (86%), Gaps = 9/655 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRS HLE+AN VF KG K GLRATD++YD LI+EDCK GDHSNAL I YEMEAAGRM
Sbjct  178   EELVRSKHLEDANDVFLKGGKNGLRATDELYDFLIQEDCKVGDHSNALEICYEMEAAGRM  237

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENME+GE YMKPDTE+YNWVIQAYTRAESYDRVQ
Sbjct  238   ATTFHFNCLLSVQATCGIPEIAFATFENMEFGEDYMKPDTESYNWVIQAYTRAESYDRVQ  297

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN++TY LLVECF+KYCV+REAIRHFRAL+NFEGG ++LHNEG
Sbjct  298   DVAELLGMMVEDHKRLQPNVKTYALLVECFTKYCVMREAIRHFRALQNFEGGTKVLHNEG  357

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQE
Sbjct  358   NFGDPLSLYLRALCREGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQE  417

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDYIARY AEGGLTGERKRWVPRRGKTPLDPD  G+IYSNPMETSFKQRCLE+
Sbjct  418   EAELGYEIDYIARYEAEGGLTGERKRWVPRRGKTPLDPDVAGFIYSNPMETSFKQRCLED  477

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             WR++HRKLL TL  EG A+LG+ SE DY+RV ERL+K +KGP+Q  LKPKAASKM VSEL
Sbjct  478   WRMHHRKLLKTLLYEGLAVLGDASEYDYIRVEERLRKTIKGPDQNVLKPKAASKMTVSEL  537

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQDLPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  538   KEELEAQDLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  597

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             L EG+TEFWKRRFLGEG + +  + +EV  +E+           D  D   D  ++ E+E
Sbjct  598   LEEGNTEFWKRRFLGEGMDRSQGKTIEVEQVEV-------SDLMDDVDAAEDAVKDVEDE  650

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             E + E EVEQTET+   G+RVK KE +  KPLQMIGVQLLKDSDQT++S K  RR    A
Sbjct  651   EGDEEEEVEQTETEIPDGERVKYKEAEAKKPLQMIGVQLLKDSDQTTTSTKKSRRKVSRA  710

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +   DEDW PLDI EA KE+R+RK+FDV DMYTIAD WGWTWE+ELK++PP+RWSQEW
Sbjct  711   SVEDDKDEDWFPLDIFEAFKELRERKVFDVSDMYTIADAWGWTWERELKSRPPQRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             EVEL I+ M KVI LGG PTIGDCA+ILRAAIRAP+PSAFLKILQ THSLGYV G
Sbjct  771   EVELAIKTMQKVIELGGQPTIGDCAMILRAAIRAPLPSAFLKILQTTHSLGYVLG  825


 Score =   174 bits (440),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRL FMEELM RAR  DV+GVS VIYDMIAAGL PGPRSFHGL+VSHVLN DVEGAM
Sbjct  62   EKSLRLAFMEELMTRARGGDVAGVSEVIYDMIAAGLSPGPRSFHGLVVSHVLNGDVEGAM  121

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            H+LRRELS GLRP+HETF++LIRLFGSKG + RG+EILAAME L 
Sbjct  122  HSLRRELSAGLRPVHETFISLIRLFGSKGYSRRGMEILAAMEKLN  166



>ref|XP_008443747.1| PREDICTED: uncharacterized protein LOC103487261 isoform X2 [Cucumis 
melo]
Length=847

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/658 (77%), Positives = 568/658 (86%), Gaps = 11/658 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ +LE+ANKVF KGAK GLRATD+IYDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  180   EELVRNKYLEDANKVFLKGAKAGLRATDKIYDLMIEEDCKAGDHSNALEISYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  299

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPNMRTY LLVECF+KYCV+REAIRHFRALK F+GG + LHNEG
Sbjct  300   DVAELLGMMVEDHKRLQPNMRTYALLVECFTKYCVIREAIRHFRALKTFQGGTKALHNEG  359

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGR+++LLEALEAM +DNQ IPPRAMILSRKYR+LVSSWIEPLQE
Sbjct  360   NFGDPLSLYLRALCREGRVLDLLEALEAMARDNQQIPPRAMILSRKYRSLVSSWIEPLQE  419

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAE G+EIDYIARY+ EGGLTGERKRWVPR+GKTPLDPDA+G+IYSNPMETSFKQRCLE+
Sbjct  420   EAEHGFEIDYIARYIEEGGLTGERKRWVPRKGKTPLDPDADGFIYSNPMETSFKQRCLED  479

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W++YHRK+L TL+NEG   L + SE+DY RV E+LKKI+KGP+Q  LKPKAASKMIVSEL
Sbjct  480   WKMYHRKILKTLQNEGLVALRDASEADYHRVVEKLKKIIKGPDQNVLKPKAASKMIVSEL  539

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIK
Sbjct  540   KEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIK  599

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeee  2084
             LHEG+TEFWKRRFLGEG + N+ +         P  +   D    ++D +  E+  +E E
Sbjct  600   LHEGNTEFWKRRFLGEGLDSNNVK---------PSEDDKSDSLDSLDDVDTIEDVAKEIE  650

Query  2085  eeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITA  2264
             EEE E E E  +T+ + G+RV +KEV+  KPLQMIGVQLLKD DQ +++ K  RR    A
Sbjct  651   EEEAEEEEEVEQTENQDGERVIKKEVEAKKPLQMIGVQLLKDVDQPTATSKKSRRRSSRA  710

Query  2265  Mdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
               +   DEDW P DI EA KE++KRK+FDV DMYTIADVWGWTWE+ELKN+PPRRWSQEW
Sbjct  711   SLEDDRDEDWFPEDIFEAFKELQKRKVFDVSDMYTIADVWGWTWERELKNRPPRRWSQEW  770

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPL  2612
             EVEL I+IM KVI LGGTPTIGDCA+ILRAAI+AP+PSAFLKILQ TH LGYVFG  L
Sbjct  771   EVELAIKIMHKVIELGGTPTIGDCAMILRAAIKAPLPSAFLKILQTTHGLGYVFGRTL  828


 Score =   185 bits (470),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +2

Query  164  TVPLRQRTFPPRTAGRVVVAV-SSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKV  340
            T+P   R+F        + +V S+P +R RKK+Q    Q    +DDD      ++  E  
Sbjct  13   TLPYNHRSFSLNHGLLPIRSVLSAPDKRGRKKRQSRHQQQLQLKDDD------STSLENS  66

Query  341  LRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHAL  520
            LR  FMEELM+RAR+ D  GVS VIYDM+AAGL PGPRSFHGL+VSH LN D EGAM +L
Sbjct  67   LRFTFMEELMDRARNHDPLGVSDVIYDMVAAGLSPGPRSFHGLVVSHTLNGDTEGAMQSL  126

Query  521  RRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            RRELS GLRPLHETFVAL+RLFGSKGLA RGLEILAAME L 
Sbjct  127  RRELSSGLRPLHETFVALVRLFGSKGLANRGLEILAAMERLN  168



>ref|XP_008664904.1| PREDICTED: uncharacterized protein LOC103643502 [Zea mays]
Length=889

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/704 (71%), Positives = 583/704 (83%), Gaps = 15/704 (2%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++++LE+AN VF KGAKGGLR TD IYDLLIEEDCKAGDHSNALT+AY+MEA GRM
Sbjct  183   EELVKNHYLEDANTVFLKGAKGGLRGTDDIYDLLIEEDCKAGDHSNALTVAYQMEAYGRM  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVAFATFENMEYG E YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  243   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGGEDYMKPDTESYNWVIQAFTRATSYDRA  302

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KYC+V E+IRHFRAL+   GG  +L+NE
Sbjct  303   ADVAELLGMMVEDHKRIQPNARTYALLVECFTKYCMVNESIRHFRALQRIPGGTEVLYNE  362

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR VELLEALEAM  DNQ+I PRAMIL+RKYRTLVSSWIEPLQ
Sbjct  363   GNCGDPLSLYLRSLCLDGRPVELLEALEAMANDNQSIAPRAMILNRKYRTLVSSWIEPLQ  422

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFKQRC E
Sbjct  423   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKQRCFE  482

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  483   ELKLYHRKLLITLRNEGPGILGDVSEEDVRRVIERLKKLVVGPKKNVVKPKAASKMVVSE  542

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+PP  E+EEEVDE+LDELISRI
Sbjct  543   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGVPLWVPP-VEDEEEVDEDLDELISRI  601

Query  1902  KLHEGDTEFWKRRFLGEGFN---ENDSQQLEVNDLELPdvetvddvakdveddeadeeee  2072
             K  +G+TEFWKRRFLGE  N   E DS++      +  D++   +   D +DDE D+E  
Sbjct  602   KPEDGNTEFWKRRFLGETRNYLCEEDSKE------DGQDLDDELEDDDDNDDDEDDDESV  655

Query  2073  eeeeeeeveveveqtetqaevGDRVKEKEVKTAK-PLQMIGVQLLKDSDQTssskksrrr  2249
             +E EE+E++ E    +T+ +VGD  K+K  K     LQMIGVQLLKD ++T  S K  +R
Sbjct  656   KEAEEDEIDDEEVVEQTENQVGDDTKDKPAKEPNHHLQMIGVQLLKDIERTPVSSKKLKR  715

Query  2250  srITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWS  2429
                    DDDEDW P D  EA K MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WS
Sbjct  716   M---PEIDDDEDWFPEDPIEAFKVMREERMFDVSDMYTTADAWGWTWEREIKNKMPRKWS  772

Query  2430  QEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSP  2609
             QEWEVEL I+IM KVI LGGTPTIGDCAIILRAA+RAP+PSAF+ ILQ THSLGY FGSP
Sbjct  773   QEWEVELAIKIMHKVIELGGTPTIGDCAIILRAAMRAPLPSAFIPILQTTHSLGYKFGSP  832

Query  2610  LYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             LYDE+V+LCLDLEE+DAA+A+VA++ET G+ VPDETLD+V++++
Sbjct  833   LYDEVVLLCLDLEEIDAAIAVVAEMETCGVKVPDETLDKVLASK  876


 Score =   156 bits (394),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRLVF+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFHGL+ +HVL  + EGAM
Sbjct  67   EKGLRLVFLEQLAERARAADATGVADTIYDMVAAGLSPGPRSFHGLVAAHVLAGNAEGAM  126

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             +LRRELS G+RPLHETFVAL+R+F  KGL+TRG+EILAAME  K
Sbjct  127  QSLRRELSSGVRPLHETFVALVRVFAKKGLSTRGMEILAAMERYK  171



>ref|XP_003571848.1| PREDICTED: uncharacterized protein LOC100838913 [Brachypodium 
distachyon]
Length=885

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/705 (69%), Positives = 578/705 (82%), Gaps = 18/705 (3%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+++LE+AN VF KGAKGGL+ TD++YDLLIEEDCKAGDHSNALT+AY+MEAAGRM
Sbjct  183   EELVRNHYLEDANTVFLKGAKGGLQGTDELYDLLIEEDCKAGDHSNALTVAYQMEAAGRM  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AF+T+ENMEYG E YMKPDTE+YNWVIQA+TRA ++DR 
Sbjct  243   ATTFHFNCLLSVQATCGIPEIAFSTYENMEYGGEDYMKPDTESYNWVIQAFTRASAHDRA  302

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVED+KR+QPN RTY LLVECF+KYC+V EAIRHFRAL+   GG  +L+NE
Sbjct  303   PDVAELLGMMVEDYKRIQPNARTYALLVECFTKYCMVNEAIRHFRALRRIPGGTTVLYNE  362

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELL+ALEAM  DNQTI PRAMIL+RKYRTLVSSWIEPLQ
Sbjct  363   GNCGDPLSLYLRSLCLDGRADELLDALEAMADDNQTIAPRAMILNRKYRTLVSSWIEPLQ  422

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFK RC E
Sbjct  423   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKLRCFE  482

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHR+LL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  483   ELKLYHRRLLITLRNEGPGILGDVSEDDVRRVVERLKKLVVGPKKNVVKPKAASKMVVSE  542

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDG R VLYQRVQKARRIN SRG PLW+PP  E++EEVDEELDE+ISRI
Sbjct  543   LKIELEAQGLPTDGNRQVLYQRVQKARRINRSRGIPLWVPP-VEDDEEVDEELDEMISRI  601

Query  1902  KLHEGDTEFWKRRFLGEGFN---ENDSQQLEVNDLELPdvetvddvakdveddeadeeee  2072
             KL +G+TEFWKRRFLGE  N   E DS++ + +         +DD   D +DD+ D+  +
Sbjct  602   KLEDGNTEFWKRRFLGETRNHLCEEDSKEEDPD---------LDDELDDDDDDDDDDSAK  652

Query  2073  eeeeeeeveveveqtetqaevGDRVKEKEVKTA-KPLQMIGVQLLKDSDQTssskksrrr  2249
             E +E+E  + EV +        D  K+K  K   + LQMIGVQLLKD ++TS S K  ++
Sbjct  653   EADEDEIYDEEVAERTQNQAGDDETKDKPAKGPNQHLQMIGVQLLKDLEKTSVSTKKLKK  712

Query  2250  srITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWS  2429
                    DDDEDW P D  EA K MR+ ++FDV DMYT AD WGWTWE+E+K K PR+WS
Sbjct  713   ---IPEIDDDEDWFPEDPIEAFKVMRETRMFDVSDMYTTADAWGWTWEREIKKKMPRKWS  769

Query  2430  QEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSP  2609
             QEWEVEL I+IM+KVI LGGTPTIGDCAIILRAA++AP+PS F+ ILQ TH+LG+ FGSP
Sbjct  770   QEWEVELAIKIMNKVIQLGGTPTIGDCAIILRAAMKAPVPSTFMTILQTTHNLGHKFGSP  829

Query  2610  LYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             LYDE+++LCLDLEE+DAA+A+VA++ET+GI V DETLDRV+SA+ 
Sbjct  830   LYDEVILLCLDLEEIDAAIAVVAEMETNGIKVLDETLDRVLSAKQ  874


 Score =   139 bits (349),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 105/153 (69%), Gaps = 0/153 (0%)
 Frame = +2

Query  188  FPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVLRLVFMEEL  367
            FP  T  R   A +S  R +   +++   + +  E   G  +  A   EK LRL F+E+L
Sbjct  19   FPLTTTVRFHRASNSHTRTSALAERRRSRRRRLPEGSGGDRSSAAGAVEKGLRLAFLEQL  78

Query  368  MERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLR  547
            +ERAR AD +GV+  IYDM+AAGL PGPRSFHGL+ +H L+ D EGAM +LRRELS G+R
Sbjct  79   VERARAADAAGVADTIYDMVAAGLSPGPRSFHGLVAAHALSGDAEGAMQSLRRELSSGVR  138

Query  548  PLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            PLHETFVAL+R+F  KGL+TR +EILAAME  K
Sbjct  139  PLHETFVALVRVFAKKGLSTRAMEILAAMERYK  171



>gb|EEC67117.1| hypothetical protein OsI_33922 [Oryza sativa Indica Group]
Length=836

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/708 (70%), Positives = 578/708 (82%), Gaps = 10/708 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV +N+LE+AN VF KG +GGL+ TD+IYDLLIEEDCKAGDHSNALT+AY+MEA+GRM
Sbjct  129   EELVNNNYLEDANTVFLKGTEGGLQGTDEIYDLLIEEDCKAGDHSNALTVAYKMEASGRM  188

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  189   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEGYMKPDTESYNWVIQAFTRATSYDRA  248

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KY +V EAIRHFRAL+   GG ++L+NE
Sbjct  249   GDVAELLGMMVEDHKRIQPNARTYALLVECFTKYSMVNEAIRHFRALRRIPGGTKVLYNE  308

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELLEALEAM  D QTI PRAMIL+RKYRTLVS+WIEPLQ
Sbjct  309   GNCGDPLSLYLRSLCLDGRADELLEALEAMSNDGQTIAPRAMILNRKYRTLVSTWIEPLQ  368

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFKQRC E
Sbjct  369   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKQRCFE  428

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  429   ELKLYHRKLLITLRNEGPGILGDVSEDDVRRVIERLKKLVVGPKKNVVKPKAASKMVVSE  488

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+ P  E+EEEVDEELDELISRI
Sbjct  489   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWV-PPVEDEEEVDEELDELISRI  547

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeee  2081
             KL +G+TEFWKRRFLGE  N       E  + E       D++  D +D++ D+++  + 
Sbjct  548   KLEDGNTEFWKRRFLGETRN----YLCEEVNDEEDADLDDDELDDDDDDEDDDDDDTTKG  603

Query  2082  eeeeveveveqtetqaevGDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskksrrrsrI  2258
             EE+E++ E    +T+ + GD  K+K  K  K  LQMIGVQLLKD ++TS S K  +R   
Sbjct  604   EEDEIDEEDAVEQTENQAGDETKDKPSKGPKQHLQMIGVQLLKDLEKTSVSSKKSKR---  660

Query  2259  TAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEW  2438
                 DDDEDW P D  EA K MR+ ++FDV DMYT AD WGWTWE+E KNK PR+WSQEW
Sbjct  661   VPEIDDDEDWFPEDPIEAFKVMRETRLFDVSDMYTTADAWGWTWERERKNKMPRKWSQEW  720

Query  2439  EVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYD  2618
             EVEL I+IM KVI LGGTPTIGDCAIILRAA+R P+PSAF+ ILQ THSLGY FGSPLYD
Sbjct  721   EVELAIKIMHKVIDLGGTPTIGDCAIILRAAMRVPLPSAFMTILQTTHSLGYKFGSPLYD  780

Query  2619  EIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK*QSS  2762
             E ++LCLDLEE+DAA+A+VA++ET+GI VPDETLD+V++A+     S+
Sbjct  781   EAILLCLDLEEIDAAIAVVAEMETNGIKVPDETLDKVLAAKQSGGNSA  828


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  500  EGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            E  M +LRRELS G+RPLHETFVAL+R+F  KGLATRG+EILAAME  K
Sbjct  69   EIWMQSLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERYK  117



>gb|EMT14191.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=898

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/720 (67%), Positives = 575/720 (80%), Gaps = 34/720 (5%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+++LE+AN VF KGAKGGL+ TD +YDLLIEEDCKAGDHSNALT+AY+MEAAGRM
Sbjct  180   EELVRNHYLEDANTVFLKGAKGGLQGTDDLYDLLIEEDCKAGDHSNALTVAYQMEAAGRM  239

Query  825   ATTFHFNCLLSVQ---------------ATCGIPEVAFATFENMEYG-EAYMKPDTETYN  956
             ATTFHFNCLLSVQ               ATCGIPE+AF+T+ENMEYG E YMKPDTE+YN
Sbjct  240   ATTFHFNCLLSVQGLMLMLGLFSKFPLQATCGIPEIAFSTYENMEYGGEDYMKPDTESYN  299

Query  957   WVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFR  1136
             WVIQA+TRA S+DR  DVAELLGMMVED+KR+QPN RTY LLVECF+KYC+V EAIRHFR
Sbjct  300   WVIQAFTRATSHDRAPDVAELLGMMVEDYKRVQPNARTYALLVECFTKYCMVNEAIRHFR  359

Query  1137  ALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILS  1316
             AL+   GG ++L+N G  GDPLSLYLR+LC +GR  ELLEALEAM  DNQTI PRAMIL+
Sbjct  360   ALRRIPGGTKVLYNAGNCGDPLSLYLRSLCLDGRADELLEALEAMADDNQTIAPRAMILN  419

Query  1317  RKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYI  1496
             RKYRTLVSSWIEPLQEEA++G++IDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ 
Sbjct  420   RKYRTLVSSWIEPLQEEADVGFDIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFA  479

Query  1497  YSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQ  1676
             YSNP+ETSFK RC EE ++YHR+LL TLRNEGP ILG+VSE D  RV ERLKK+V GP++
Sbjct  480   YSNPIETSFKLRCFEELKLYHRRLLITLRNEGPGILGDVSEDDVRRVVERLKKLVVGPKK  539

Query  1677  KALKPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveee  1856
               +KPKAASKM+V+ELK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+ P  E+
Sbjct  540   NVVKPKAASKMVVAELKIELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWV-PPVED  598

Query  1857  eeevdeeldelISRIKLHEGDTEFWKRRFLGEGFN---ENDSQQLEVNDLELPdvetvdd  2027
             +E VDEELDE+ISRIKL +G+TEFWKRRFLGE  N   E DS++              DD
Sbjct  599   DEVVDEELDEMISRIKLEDGNTEFWKRRFLGETRNHLCEEDSKEDPDF----------DD  648

Query  2028  vakdveddeadeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTA-KPLQMIGVQLL  2204
                + +DD+ D++  +E +E+E++ EV          D  K+K  K   + LQMIGVQLL
Sbjct  649   ELDEDDDDDDDDDSAKEADEDEIDDEVIDRTENQAGDDETKDKPAKGPNQHLQMIGVQLL  708

Query  2205  KDSDQTssskksrrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGW  2384
             KD ++TS S K  ++       DDDEDW P D  EA K MR+ ++F+V DMYT AD WGW
Sbjct  709   KDLEKTSGSTKKLKK---IPEIDDDEDWFPEDPIEAFKVMRETRMFNVADMYTTADAWGW  765

Query  2385  TWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLK  2564
             TWE+ELK K PRRWSQEWEVEL I+IM+KVI LGG+PTIGDCAIILRAA+RAP+PSAF+ 
Sbjct  766   TWERELKKKMPRRWSQEWEVELAIKIMNKVIELGGSPTIGDCAIILRAAMRAPVPSAFIT  825

Query  2565  ILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             ILQ THSLG+ FGSPLYDE+++LCLDLEE+DAA+A+VA++ET+GI V DETLDRV++A+ 
Sbjct  826   ILQTTHSLGHKFGSPLYDEVILLCLDLEEMDAAIAVVAEMETNGIKVLDETLDRVLAAKQ  885


 Score =   150 bits (378),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRL F+E+L ERAR AD  GV+  IYDM+AAGL PGPRSFHGL+ +H L  D EGAM
Sbjct  64   EKGLRLAFLEQLAERARAADALGVADTIYDMVAAGLSPGPRSFHGLVAAHALAGDAEGAM  123

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              LRRELS G+RPLHETFVAL+R+F  KGL+TR +EILAAME  K
Sbjct  124  QTLRRELSSGVRPLHETFVALVRVFAKKGLSTRAMEILAAMERYK  168



>ref|XP_010674224.1| PREDICTED: uncharacterized protein LOC104890433 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=760

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/675 (73%), Positives = 568/675 (84%), Gaps = 14/675 (2%)
 Frame = +3

Query  723   TDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATF  902
             +D IYD+++          + L +A+ + +    A            A CGIPE+A+ATF
Sbjct  89    SDVIYDMIVAGLNPGPRSYHGLVVAHVLNSDEEGA------------ANCGIPEIAYATF  136

Query  903   ENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLL  1082
             ENME+GE YMKPDTETYNWVIQAYTRAESYDRVQDVAELLG+MVEDHKRLQPN+RTY LL
Sbjct  137   ENMEFGEDYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGLMVEDHKRLQPNVRTYALL  196

Query  1083  VECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLEAL  1262
             VECF+KYCV+REAIRHFRALK FEGG R+L+NEG +GDPLSLYLRALCREGRI ELL+AL
Sbjct  197   VECFTKYCVMREAIRHFRALKTFEGGTRVLYNEGNFGDPLSLYLRALCREGRIEELLDAL  256

Query  1263  EAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGERKR  1442
             EAM +DNQ +PPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARY +EGGLTGERKR
Sbjct  257   EAMARDNQPMPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYNSEGGLTGERKR  316

Query  1443  WVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILG-NVSE  1619
             WVPRRGK PLDPDAEG+IYSNP+ETSFKQRCLEEW+I HRKLL  LRNEGPA LG N SE
Sbjct  317   WVPRRGKAPLDPDAEGFIYSNPVETSFKQRCLEEWKIRHRKLLRHLRNEGPAALGPNASE  376

Query  1620  SDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKA  1799
             SDY+RV ERLKK++KG E+  +KPKAASKM+VSELKEELEAQDLP DGTRNVLYQRVQKA
Sbjct  377   SDYVRVEERLKKMIKGREKNVVKPKAASKMVVSELKEELEAQDLPIDGTRNVLYQRVQKA  436

Query  1800  RRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQQ  1979
             RRIN+SRGRPLW+PPVEEEEEEVDEE+DELISRIKL EG+TE+WKRRFLGE    ++ + 
Sbjct  437   RRINISRGRPLWVPPVEEEEEEVDEEVDELISRIKLEEGNTEYWKRRFLGEQLIYDNMKP  496

Query  1980  LEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveveveqtetqaevGDRVKEKE  2159
             ++   LE P     D   +D    E +++E ++EEE E EVEVEQ+E+Q  + DRVK KE
Sbjct  497   MDGQKLE-PGYIMDDAEIEDDTAKEIEDDEADDEEEVEAEVEVEQSESQEGLVDRVKHKE  555

Query  2160  VKTAKPLQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEALKEMRKRKI  2339
             V   KPLQMIG+QLLKD+DQ ++SKKS  RS + A DDDD+DW PLD++EA +E+RKR I
Sbjct  556   VDAKKPLQMIGIQLLKDADQPTTSKKSTSRSSMAAEDDDDDDWFPLDLYEAFEELRKRNI  615

Query  2340  FDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAII  2519
             F+V+DMYTIADVWGWTWE+ELK++P RRWSQEWEV++ +++MSKVI LGG PTIGDCA+I
Sbjct  616   FNVDDMYTIADVWGWTWERELKSRPLRRWSQEWEVDMAMKVMSKVIELGGIPTIGDCAMI  675

Query  2520  LRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGI  2699
             LRAAI+AP+PSAFL IL ITHSLGY FGSPLYDEI+ LCLDL ELDAA+AIVADLETSGI
Sbjct  676   LRAAIKAPLPSAFLTILHITHSLGYRFGSPLYDEIITLCLDLGELDAAIAIVADLETSGI  735

Query  2700  MVPDETLDRVISARN  2744
              VPDETLD+VI+AR 
Sbjct  736   TVPDETLDKVIAARQ  750


 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 11/104 (11%)
 Frame = +2

Query  206  GRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKVLRLVFMEELMERARD  385
            G VV A+SSP+R++R+++Q     PK    +D   A  +S  EK LRL FMEELM RAR+
Sbjct  34   GIVVSAISSPERKSRRRRQ-----PK----EDTSTA--SSAAEKGLRLAFMEELMIRARN  82

Query  386  ADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHA  517
             D  GVS VIYDMI AGL PGPRS+HGL+V+HVLN D EGA + 
Sbjct  83   RDTIGVSDVIYDMIVAGLNPGPRSYHGLVVAHVLNSDEEGAANC  126



>ref|XP_004142596.1| PREDICTED: uncharacterized protein LOC101209618 [Cucumis sativus]
Length=1177

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/583 (75%), Positives = 494/583 (85%), Gaps = 11/583 (2%)
 Frame = +3

Query  999   VQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHN  1178
             VQDVAELLGMMVEDHKRLQPNMRTY LLVECF+KYCV+REAIRHFRAL+ FEGG   LHN
Sbjct  576   VQDVAELLGMMVEDHKRLQPNMRTYALLVECFTKYCVIREAIRHFRALRTFEGGTTALHN  635

Query  1179  EGKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPL  1358
             EG +GDPLSLYLRALCREGR+VELLEALEAM +DNQ IPPRAMILSRKYR+LVSSWIEPL
Sbjct  636   EGNFGDPLSLYLRALCREGRVVELLEALEAMARDNQQIPPRAMILSRKYRSLVSSWIEPL  695

Query  1359  QEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCL  1538
             QEEAE G+EIDYIARY+ EGGLTGERKRWVPR+GKTPLDPDA+G+IYSNPMETSFKQRCL
Sbjct  696   QEEAEHGFEIDYIARYIEEGGLTGERKRWVPRKGKTPLDPDADGFIYSNPMETSFKQRCL  755

Query  1539  EEWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVS  1718
             E+W++YHRK+L TL+NEG   L + SE+DY RV ERL+KI+KGP+Q  LKPKAASKMIVS
Sbjct  756   EDWKMYHRKILKTLQNEGLVALRDASEADYHRVVERLRKIIKGPDQNVLKPKAASKMIVS  815

Query  1719  ELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISR  1898
             ELKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISR
Sbjct  816   ELKEELEAQGLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISR  875

Query  1899  IKLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeee  2078
             IKLHEG+TEFWKRRFLGEG   N+ +         P  +   D    ++D +  E+  +E
Sbjct  876   IKLHEGNTEFWKRRFLGEGLYSNNVK---------PSEDDKSDPLDSLDDVDTIEDVAKE  926

Query  2079  eeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrI  2258
              EEEE E E E  +T+ + G+RV +KEV+  KPLQMIGVQLLKD DQ +++ K  RR   
Sbjct  927   IEEEEAEEEEEVEQTENQDGERVIKKEVEAKKPLQMIGVQLLKDVDQPTTTSKKSRRRSS  986

Query  2259  TAMdd--ddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQ  2432
              A  +   DEDW P DI EA KE++KRK+FDV DMYTIADVWGWTWE+ELKN+PPRRWSQ
Sbjct  987   RASLEDDRDEDWFPEDIFEAFKELQKRKVFDVSDMYTIADVWGWTWERELKNRPPRRWSQ  1046

Query  2433  EWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPL  2612
             EWEVEL I+IM KVI LGG PTIGDCA+ILRAAI+AP+PSAFLKILQ TH LGYVFGSPL
Sbjct  1047  EWEVELAIKIMHKVIELGGIPTIGDCAMILRAAIKAPLPSAFLKILQTTHGLGYVFGSPL  1106

Query  2613  YDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISAR  2741
             YDE++ LCLDL ELDAA+AIVADLET+GI+V DETLDRVISAR
Sbjct  1107  YDEVITLCLDLGELDAAIAIVADLETTGILVHDETLDRVISAR  1149


 Score =   183 bits (464),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  645  KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
            +ELVRS +LE+ANKVF KGAK GLRATD+IYDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  180  EELVRSKYLEDANKVFLKGAKAGLRATDKIYDLMIEEDCKAGDHSNALEISYEMEAAGRM  239

Query  825  ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNW  959
            ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE Y+   T    W
Sbjct  240  ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEGYIVLPTNQVPW  284


 Score =   180 bits (456),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 113/162 (70%), Gaps = 7/162 (4%)
 Frame = +2

Query  164  TVPLRQRTFPPRTAGRVVVAV-SSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEKV  340
            T+P   R+F        + +V S+P +R RKK+Q    Q    +D+D      ++  E  
Sbjct  13   TLPSNHRSFSLNHGLLPIRSVLSAPDKRGRKKRQSRHQQQLQPKDND------STSLENS  66

Query  341  LRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHAL  520
            LR  FMEELM+RAR+ D  GVS VIYDM+AAGL PGPRSFHGL+VSH LN D EGAM +L
Sbjct  67   LRFTFMEELMDRARNHDPLGVSDVIYDMVAAGLSPGPRSFHGLVVSHTLNGDTEGAMQSL  126

Query  521  RRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            RRELS GL PLHETFVAL+RLFGSKGLA RGLEILAAME L 
Sbjct  127  RRELSAGLLPLHETFVALVRLFGSKGLANRGLEILAAMEKLN  168



>gb|KGN66719.1| hypothetical protein Csa_1G662830 [Cucumis sativus]
Length=593

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/575 (75%), Positives = 486/575 (85%), Gaps = 11/575 (2%)
 Frame = +3

Query  1026  MMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLS  1205
             MMVEDHKRLQPNMRTY LLVECF+KYCV+REAIRHFRAL+ FEGG   LHNEG +GDPLS
Sbjct  1     MMVEDHKRLQPNMRTYALLVECFTKYCVIREAIRHFRALRTFEGGTTALHNEGNFGDPLS  60

Query  1206  LYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYE  1385
             LYLRALCREGR+VELLEALEAM +DNQ IPPRAMILSRKYR+LVSSWIEPLQEEAE G+E
Sbjct  61    LYLRALCREGRVVELLEALEAMARDNQQIPPRAMILSRKYRSLVSSWIEPLQEEAEHGFE  120

Query  1386  IDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRK  1565
             IDYIARY+ EGGLTGERKRWVPR+GKTPLDPDA+G+IYSNPMETSFKQRCLE+W++YHRK
Sbjct  121   IDYIARYIEEGGLTGERKRWVPRKGKTPLDPDADGFIYSNPMETSFKQRCLEDWKMYHRK  180

Query  1566  LLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQ  1745
             +L TL+NEG   L + SE+DY RV ERL+KI+KGP+Q  LKPKAASKMIVSELKEELEAQ
Sbjct  181   ILKTLQNEGLVALRDASEADYHRVVERLRKIIKGPDQNVLKPKAASKMIVSELKEELEAQ  240

Query  1746  DLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTE  1925
              LP DGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIKLHEG+TE
Sbjct  241   GLPIDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIKLHEGNTE  300

Query  1926  FWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveve  2105
             FWKRRFLGEG   N+ +         P  +   D    ++D +  E+  +E EEEE E E
Sbjct  301   FWKRRFLGEGLYSNNVK---------PSEDDKSDPLDSLDDVDTIEDVAKEIEEEEAEEE  351

Query  2106  veqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITAM--dddd  2279
              E  +T+ + G+RV +KEV+  KPLQMIGVQLLKD DQ +++ K  RR    A   DD D
Sbjct  352   EEVEQTENQDGERVIKKEVEAKKPLQMIGVQLLKDVDQPTTTSKKSRRRSSRASLEDDRD  411

Query  2280  edWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIE  2459
             EDW P DI EA KE++KRK+FDV DMYTIADVWGWTWE+ELKN+PPRRWSQEWEVEL I+
Sbjct  412   EDWFPEDIFEAFKELQKRKVFDVSDMYTIADVWGWTWERELKNRPPRRWSQEWEVELAIK  471

Query  2460  IMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCL  2639
             IM KVI LGG PTIGDCA+ILRAAI+AP+PSAFLKILQ TH LGYVFGSPLYDE++ LCL
Sbjct  472   IMHKVIELGGIPTIGDCAMILRAAIKAPLPSAFLKILQTTHGLGYVFGSPLYDEVITLCL  531

Query  2640  DLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DL ELDAA+AIVADLET+GI+V DETLDRVISAR 
Sbjct  532   DLGELDAAIAIVADLETTGILVHDETLDRVISARQ  566



>ref|XP_007208364.1| hypothetical protein PRUPE_ppa001139mg [Prunus persica]
 gb|EMJ09563.1| hypothetical protein PRUPE_ppa001139mg [Prunus persica]
Length=780

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/451 (85%), Positives = 421/451 (93%), Gaps = 1/451 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLI EDCK GDHSNAL IAYEMEAAGRM
Sbjct  180   EELVRTRHLEDANKVFLKGAKGGLRATDEVYDLLIVEDCKVGDHSNALDIAYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  299

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPNM+T+ LLVECF+KYCVVREAIRHFRALK FEGG + LHNE
Sbjct  300   QDVAELLGMMVEDHKRLQPNMKTHALLVECFTKYCVVREAIRHFRALKTFEGGTKALHNE  359

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGRI+ELLEALEAM +DNQTIPPRAMILSRKYRTLVSSWIEPLQ
Sbjct  360   GNFGDPLSLYLRALCREGRILELLEALEAMAEDNQTIPPRAMILSRKYRTLVSSWIEPLQ  419

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELG+EIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPD EG+IYSNPME SFKQRCLE
Sbjct  420   EEAELGHEIDYMARYIAEGGLTGERKRWVPRRGKTPLDPDVEGFIYSNPMENSFKQRCLE  479

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+I+HRKLL TLRNEG A LG+ SESDY+RV  RL+KI+KGP+Q  LKPKAASKM+VSE
Sbjct  480   DWKIHHRKLLRTLRNEGVAALGDASESDYIRVEMRLRKIIKGPDQNVLKPKAASKMVVSE  539

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  540   LKEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEIDELISRI  599

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVND  1994
             KL EG+TEFWKRRFLGEGF+ +  + ++V+D
Sbjct  600   KLEEGNTEFWKRRFLGEGFSSDQEKAVDVSD  630


 Score =   239 bits (611),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +3

Query  2334  KIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCA  2513
              +FDV DMYT+AD WGWTWE+ELKN+PPRRWSQ+WEV+L I++M K   LGGTPTIGDCA
Sbjct  643   NVFDVSDMYTLADAWGWTWERELKNRPPRRWSQDWEVQLAIKVMLKA-KLGGTPTIGDCA  701

Query  2514  IILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETS  2693
             +ILRAAIRAP+PSAFLKILQ TH+LGYVFGSPLYDEI+ LCLDL E+DAAVAIVAD+ET+
Sbjct  702   VILRAAIRAPLPSAFLKILQTTHTLGYVFGSPLYDEIISLCLDLGEVDAAVAIVADMETT  761

Query  2694  GIMVPDETLDRVISAR  2741
             GI VPDETLDRVISAR
Sbjct  762   GITVPDETLDRVISAR  777


 Score =   168 bits (425),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  296  DDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIV  475
            D+   +  +S  EK LR  FMEELM RAR+ D +GVS VIYDM+AAGL PGPRSFHGLIV
Sbjct  52   DNDSSSPSSSAAEKSLRFTFMEELMGRARNRDANGVSDVIYDMVAAGLTPGPRSFHGLIV  111

Query  476  SHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            +H LN D E AM +LRRELS GLRPLHETF+ALIRLFGSKG ATRGLEILAAME L
Sbjct  112  AHALNGDTEAAMQSLRRELSSGLRPLHETFIALIRLFGSKGRATRGLEILAAMEKL  167



>ref|XP_007208365.1| hypothetical protein PRUPE_ppa001139mg [Prunus persica]
 gb|EMJ09564.1| hypothetical protein PRUPE_ppa001139mg [Prunus persica]
Length=897

 Score =   783 bits (2023),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 385/451 (85%), Positives = 421/451 (93%), Gaps = 1/451 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLI EDCK GDHSNAL IAYEMEAAGRM
Sbjct  180   EELVRTRHLEDANKVFLKGAKGGLRATDEVYDLLIVEDCKVGDHSNALDIAYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  299

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPNM+T+ LLVECF+KYCVVREAIRHFRALK FEGG + LHNE
Sbjct  300   QDVAELLGMMVEDHKRLQPNMKTHALLVECFTKYCVVREAIRHFRALKTFEGGTKALHNE  359

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGRI+ELLEALEAM +DNQTIPPRAMILSRKYRTLVSSWIEPLQ
Sbjct  360   GNFGDPLSLYLRALCREGRILELLEALEAMAEDNQTIPPRAMILSRKYRTLVSSWIEPLQ  419

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELG+EIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPD EG+IYSNPME SFKQRCLE
Sbjct  420   EEAELGHEIDYMARYIAEGGLTGERKRWVPRRGKTPLDPDVEGFIYSNPMENSFKQRCLE  479

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+I+HRKLL TLRNEG A LG+ SESDY+RV  RL+KI+KGP+Q  LKPKAASKM+VSE
Sbjct  480   DWKIHHRKLLRTLRNEGVAALGDASESDYIRVEMRLRKIIKGPDQNVLKPKAASKMVVSE  539

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  540   LKEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEIDELISRI  599

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVND  1994
             KL EG+TEFWKRRFLGEGF+ +  + ++V+D
Sbjct  600   KLEEGNTEFWKRRFLGEGFSSDQEKAVDVSD  630


 Score =   168 bits (426),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  296  DDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIV  475
            D+   +  +S  EK LR  FMEELM RAR+ D +GVS VIYDM+AAGL PGPRSFHGLIV
Sbjct  52   DNDSSSPSSSAAEKSLRFTFMEELMGRARNRDANGVSDVIYDMVAAGLTPGPRSFHGLIV  111

Query  476  SHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            +H LN D E AM +LRRELS GLRPLHETF+ALIRLFGSKG ATRGLEILAAME L
Sbjct  112  AHALNGDTEAAMQSLRRELSSGLRPLHETFIALIRLFGSKGRATRGLEILAAMEKL  167


 Score =   297 bits (760),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT--AMddddedWIPLDIHEA  2312
             +RVKEKE++  KPLQMIGVQLLKDSDQTS++ K  RR R    A DD+D+DW PLDI EA
Sbjct  693   ERVKEKEIEAKKPLQMIGVQLLKDSDQTSTTSKKSRRRRSRVSAEDDNDDDWFPLDIFEA  752

Query  2313  LKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGT  2492
              KE+R RK+FDV DMYT+AD WGWTWE+ELKN+PPRRWSQ+WEV+L I++M K   LGGT
Sbjct  753   FKELRNRKVFDVSDMYTLADAWGWTWERELKNRPPRRWSQDWEVQLAIKVMLKA-KLGGT  811

Query  2493  PTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAI  2672
             PTIGDCA+ILRAAIRAP+PSAFLKILQ TH+LGYVFGSPLYDEI+ LCLDL E+DAAVAI
Sbjct  812   PTIGDCAVILRAAIRAPLPSAFLKILQTTHTLGYVFGSPLYDEIISLCLDLGEVDAAVAI  871

Query  2673  VADLETSGIMVPDETLDRVISAR  2741
             VAD+ET+GI VPDETLDRVISAR
Sbjct  872   VADMETTGITVPDETLDRVISAR  894



>ref|XP_008218372.1| PREDICTED: uncharacterized protein LOC103318731 [Prunus mume]
Length=899

 Score =   777 bits (2006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 380/451 (84%), Positives = 420/451 (93%), Gaps = 1/451 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLI EDCK GDHSNAL IAYEMEAAGRM
Sbjct  180   EELVRTRHLEDANKVFLKGAKGGLRATDEVYDLLIVEDCKVGDHSNALDIAYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYG E YMKPDTETYNWVIQAYTRAESYDRV
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGGEEYMKPDTETYNWVIQAYTRAESYDRV  299

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPNM+T+ LLVECF+KYCVVREAIRHFRALK FEGG + LHN+
Sbjct  300   QDVAELLGMMVEDHKRLQPNMKTHALLVECFTKYCVVREAIRHFRALKTFEGGTKALHND  359

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGRI+ELLEALEAM +DNQTIPPRAMILSRKYRTLVSSWIEPLQ
Sbjct  360   GNFGDPLSLYLRALCREGRILELLEALEAMAEDNQTIPPRAMILSRKYRTLVSSWIEPLQ  419

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELG+EIDY+ARY+AEGGLTGERKRWVPRRGKTPLDPD EG+IYSNPMETSFKQRCL+
Sbjct  420   EEAELGHEIDYMARYIAEGGLTGERKRWVPRRGKTPLDPDVEGFIYSNPMETSFKQRCLD  479

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+++HRKLL TL+NEG   LG+ SESDY+RV  RL+KI+KGP+Q  LKPKAASKM+VSE
Sbjct  480   DWKVHHRKLLRTLQNEGVTALGDASESDYIRVEMRLRKIIKGPDQNVLKPKAASKMVVSE  539

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEE+DELISRI
Sbjct  540   LKEELEAQGLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEEIDELISRI  599

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVND  1994
             KL EG+TEFWKRRFLGEG + +  + ++V+D
Sbjct  600   KLEEGNTEFWKRRFLGEGVSSDQEKAVDVSD  630


 Score =   167 bits (424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LR  FMEELM RAR+ D +GVS VIYDM+AAGL PGPRSFHGLIV+H LN D E AM
Sbjct  64   EKSLRFTFMEELMGRARNRDANGVSDVIYDMVAAGLTPGPRSFHGLIVAHALNGDTEAAM  123

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
             +LRRELS GLRPLHETF+ALIRLFGSKG ATRGLEILAAME L
Sbjct  124  QSLRRELSSGLRPLHETFIALIRLFGSKGRATRGLEILAAMEKL  167


 Score =   306 bits (784),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrIT--AMddddedWIPLDIHEA  2312
             +RVKEKE++  KPLQMIGVQLLKDSDQTS++ K  RR R    A DD+D+DW PLDI EA
Sbjct  694   ERVKEKEIEAKKPLQMIGVQLLKDSDQTSTTSKKSRRRRSRVSAEDDNDDDWFPLDIFEA  753

Query  2313  LKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGT  2492
              KE+R RK+FDV DMYT+AD WGWTWE+ELKN+PPRRWSQ+WEVEL I++M KVI LGGT
Sbjct  754   FKELRNRKVFDVSDMYTLADAWGWTWERELKNRPPRRWSQDWEVELAIKVMLKVIELGGT  813

Query  2493  PTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAI  2672
             PTIGDCA+ILRAAIRAP+PSAFLKILQ TH+LGYVFGSPLYDEI+ LCLDL E+DAAVAI
Sbjct  814   PTIGDCAVILRAAIRAPLPSAFLKILQTTHTLGYVFGSPLYDEIISLCLDLGEVDAAVAI  873

Query  2673  VADLETSGIMVPDETLDRVISAR  2741
             VAD+ET+GI VPDETLDRVISAR
Sbjct  874   VADMETTGITVPDETLDRVISAR  896



>ref|XP_009125001.1| PREDICTED: uncharacterized protein LOC103850051 [Brassica rapa]
Length=910

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/450 (82%), Positives = 418/450 (93%), Gaps = 0/450 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVR+NHLE ANKVF KGAKGG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGR 
Sbjct  183   EELVRTNHLEEANKVFLKGAKGGMRATDQLYDLMIEEDCKAGDHSNALEISYEMEAAGRF  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRA+SYDRVQ
Sbjct  243   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEDFMKPNTETYNWVIQAYTRADSYDRVQ  302

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVV+EAIRHFRALKNFEGG ++LHN+G
Sbjct  303   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVKEAIRHFRALKNFEGGTKVLHNDG  362

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  363   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  422

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYV EGGLTG+RKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCL++
Sbjct  423   EAELGYEIDYLARYVEEGGLTGDRKRWVPRRGKTPLDPDAAGFIYSNPIETSFKQRCLDD  482

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+++HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP Q  LKPKAASKM+VSEL
Sbjct  483   WKVHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIKGPAQNLLKPKAASKMVVSEL  542

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  543   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  602

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEVND  1994
             LHEGDTEFWKRRFLGEG  E  ++ +E ++
Sbjct  603   LHEGDTEFWKRRFLGEGLIETTAESIETDE  632


 Score =   283 bits (725),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrITAMddddedWIPLDIHEAL  2315
             D VK K     + LQMIGVQLLK+SD+ + + K+ +R SR+T  DD DEDW P +  EA 
Sbjct  689   DLVKNKAADAKRHLQMIGVQLLKESDEASRTKKRGKRASRMTLEDDADEDWFPEEPFEAF  748

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             KEMR+RK+FDV+DMYTIADVWGWTWEK+ KNK PRRWSQEWEVEL I +MSKVI LGG P
Sbjct  749   KEMRERKVFDVKDMYTIADVWGWTWEKDFKNKTPRRWSQEWEVELAIVLMSKVIELGGVP  808

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCA+ILRAAIRAPMPSAFLKILQ  HSLGY FGSPLYDEI+ LCLDL ELDAA+AIV
Sbjct  809   TIGDCAVILRAAIRAPMPSAFLKILQTIHSLGYAFGSPLYDEIITLCLDLGELDAAIAIV  868

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             AD+ET+GI VPD+TLD+VIS R 
Sbjct  869   ADMETTGITVPDQTLDKVISVRQ  891


 Score =   156 bits (395),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = +2

Query  188  FPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLV  352
             P R AG      ++S+P+    KK ++   Q +  E++D    G +   S  E+ LRL 
Sbjct  18   IPRRAAGIPTTRCSISAPE----KKPRRRRKQIQKRENEDSSSFGSSEAVSALERSLRLT  73

Query  353  FMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL  532
            FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL
Sbjct  74   FMDELMERARNRDPSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQGAMHSLRKEL  133

Query  533  SEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              G RPL ET +AL+RL GSKG A RGLE+LAAME L 
Sbjct  134  GAGQRPLPETMIALVRLSGSKGNAQRGLELLAAMEKLN  171



>gb|KFK37852.1| hypothetical protein AALP_AA3G037600 [Arabis alpina]
Length=915

 Score =   765 bits (1976),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 371/448 (83%), Positives = 413/448 (92%), Gaps = 0/448 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE ANKVF KGA+GG+RATDQ+YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  187   EELMRTNHLEEANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEAAGRM  246

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  247   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPDTETYNWVIQAYTRADSYDRVQ  306

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++T+ LLVECF+KYCVV+EAIRHFRALK FEGG  +LHN G
Sbjct  307   DVAELLGMMVEDHKRVQPNVKTHALLVECFTKYCVVKEAIRHFRALKRFEGGTIVLHNAG  366

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             K+ DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  367   KFDDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  426

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARYV EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLE+
Sbjct  427   EAELGYEIDYLARYVEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQRCLED  486

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKLL TL++EG  +LG  SESDY+RV ERL+ I+KGP    LKPKAASKM+VSEL
Sbjct  487   WKIHHRKLLRTLQSEGLPVLGEASESDYMRVMERLRNIIKGPALNLLKPKAASKMVVSEL  546

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  547   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELIRRIK  606

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEV  1988
             LHEGDTEFWKRRFLGEG  E  ++  E+
Sbjct  607   LHEGDTEFWKRRFLGEGLIETSAETKEI  634


 Score =   164 bits (416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 115/158 (73%), Gaps = 5/158 (3%)
 Frame = +2

Query  188  FPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRLV  352
             P RTAG   +  ++S+P+++ R++K+Q   +   AE++D    G     S  E+ LRL 
Sbjct  18   IPRRTAGFSSIRCSISAPEKKPRRRKKQQQKRGDGAENEDSSIFGSGEAVSALERSLRLT  77

Query  353  FMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL  532
            FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL
Sbjct  78   FMDELMERARNRDTSGVSEVIYDMIAAGLSPGPRSFHGLVVAHALNGDEQGAMHSLRKEL  137

Query  533  SEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
              G RPL ET +AL+RL GSKG ATRGLE+LAAME L 
Sbjct  138  GAGQRPLPETMIALVRLSGSKGNATRGLEVLAAMEKLN  175


 Score =   283 bits (723),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskks-rrrsrITAMddddedWIPLDIHEAL  2315
             D VK K     + LQMIGVQLLK+SD+ + +KK  +R SR+T  DD DEDW P D  EA 
Sbjct  694   DLVKNKAADAQRHLQMIGVQLLKESDEANRTKKRGKRASRMTLEDDADEDWFPEDPFEAF  753

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             KEMR RK+FDV DMYTIADVWGWTWEK+ KNK PR+WSQEWEVEL I +M+KV  LGG P
Sbjct  754   KEMRARKVFDVSDMYTIADVWGWTWEKDYKNKTPRKWSQEWEVELAIVLMTKVTELGGIP  813

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCA+ILRAAIRAPMPSAFLKILQ THSLGY FGSPLYDEI+ LCLDL ELDAA+AIV
Sbjct  814   TIGDCAVILRAAIRAPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDLGELDAAIAIV  873

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             AD+ET+GI VPD+TLD+VISAR 
Sbjct  874   ADMETTGITVPDQTLDKVISARQ  896



>ref|XP_010463904.1| PREDICTED: uncharacterized protein LOC104744533 [Camelina sativa]
Length=914

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/448 (82%), Positives = 414/448 (92%), Gaps = 0/448 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE+ANKVF KGA+GG+RATD++YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  186   EELMRTNHLEDANKVFLKGARGGMRATDELYDLMIEEDCKAGDHSNALDISYEMEAAGRM  245

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRAESYDRVQ
Sbjct  246   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPNTETYNWVIQAYTRAESYDRVQ  305

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALK FEGG  +LHN G
Sbjct  306   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKKFEGGTVVLHNAG  365

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  366   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  425

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+ EGGLTGERKRWVPR+GKTPLDPDA G+IYSNP+ETSFKQRCLE+
Sbjct  426   EAELGYEIDYLARYIEEGGLTGERKRWVPRKGKTPLDPDASGFIYSNPIETSFKQRCLED  485

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKL  TL++EG  +LG+VSESDY+RV ERL+ I++GP Q  LKPKAASKM+VSEL
Sbjct  486   WKIHHRKLYRTLQSEGLPVLGDVSESDYMRVMERLRNIIRGPAQNLLKPKAASKMVVSEL  545

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  546   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  605

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEV  1988
             LHEGDTEFWKRRFLGEGF E   +  E 
Sbjct  606   LHEGDTEFWKRRFLGEGFIETSVESKET  633


 Score =   285 bits (730),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskks-rrrsrITAMddddedWIPLDIHEAL  2315
             D VK K  +  K LQMIGVQLLK+SD+ + +KK  +R SR+T  DD DEDW P D  EA 
Sbjct  694   DLVKNKAAEAKKHLQMIGVQLLKESDEANRTKKRGKRASRMTLEDDADEDWFPEDPFEAF  753

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PR+WSQEWEVEL I +M+KVI LGG P
Sbjct  754   KEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTPRKWSQEWEVELAIVLMTKVIELGGIP  813

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCA+ILRAA+RAPMPSAFLKILQ THSLGY FGSPLYDEI+ LCLDL ELDAA+AIV
Sbjct  814   TIGDCAVILRAALRAPMPSAFLKILQTTHSLGYAFGSPLYDEIITLCLDLGELDAAIAIV  873

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             AD+ET+GI VPD+T+D+VISAR 
Sbjct  874   ADMETTGIAVPDQTIDKVISARQ  896


 Score =   157 bits (398),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            S  E+ LRL FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +
Sbjct  67   SALERSLRLTFMDELMERARNRDTSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQ  126

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GAMH+LR+EL  G RPL ET +AL+RL GSKG ATRGLEILAAME L
Sbjct  127  GAMHSLRKELGAGQRPLPETMIALVRLSGSKGNATRGLEILAAMEKL  173



>ref|XP_002884436.1| hypothetical protein ARALYDRAFT_477686 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60695.1| hypothetical protein ARALYDRAFT_477686 [Arabidopsis lyrata subsp. 
lyrata]
Length=914

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/451 (82%), Positives = 414/451 (92%), Gaps = 1/451 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R NHLE+ANKVF KGA+GG+RAT+ +YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  185   EELMRINHLEDANKVFLKGARGGMRATNHLYDLMIEEDCKAGDHSNALEISYEMEAAGRM  244

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEA-YMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE  +MKPDTETYNWVIQAYTRAESYDRV
Sbjct  245   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEGLFMKPDTETYNWVIQAYTRAESYDRV  304

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALKNFEGG  +LHN 
Sbjct  305   QDVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTTILHNA  364

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             GK+ DPLSLYLRALCREGRIVEL++AL+AM KD+Q IPPRAMI+SRKYRTLVSSWIEPLQ
Sbjct  365   GKFEDPLSLYLRALCREGRIVELIDALDAMRKDSQPIPPRAMIMSRKYRTLVSSWIEPLQ  424

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELGYEIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNP+ETSFKQRCLE
Sbjct  425   EEAELGYEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQRCLE  484

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             +W+I+HRKLL TL++EG  +LG+ SESDY+RV ERL+ I+KGP Q  LKPKAASKM+VSE
Sbjct  485   DWKIHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIKGPAQNLLKPKAASKMVVSE  544

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+D+LI RI
Sbjct  545   LKEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDDLICRI  604

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVND  1994
             KLHEGDTEFWKRRFLGEG  E   +  E  +
Sbjct  605   KLHEGDTEFWKRRFLGEGLIETSVESKETTE  635


 Score =   277 bits (709),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = +3

Query  2145  VKEKEVKTAKPLQMIGVQLLKDSDQTssskks-rrrsrITAMddddedWIPLDIHEALKE  2321
             VK K     K LQMIGVQLLK+SD+ + +KK  +R SR+T  DD DEDW P D  EA KE
Sbjct  694   VKNKAADAKKHLQMIGVQLLKESDEANRTKKRGKRASRMTLEDDADEDWFPEDPFEAFKE  753

Query  2322  MRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSK--VIALGGTP  2495
             MR+RK+FDV DMYTIADVWGWTWEK+ KN+ PR+WSQEWEVEL I +M+K  VI LGG P
Sbjct  754   MRERKVFDVSDMYTIADVWGWTWEKDFKNRTPRKWSQEWEVELAIVLMTKARVIELGGIP  813

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCA+ILRAA+RAPMPSAFLKILQ THSLGY FGSPLYDEI+ LCLD+ ELDAA+AIV
Sbjct  814   TIGDCAVILRAALRAPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDIGELDAAIAIV  873

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             AD+ET+GI VPD+TLD+VISAR 
Sbjct  874   ADMETTGITVPDQTLDKVISARQ  896


 Score =   159 bits (403),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  185  TFPPRTAG--RVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDG---GGALMASGTEKVLRL  349
            T P R AG   +  ++S+P+++ R++++Q       AE+D     G     S  E+ LRL
Sbjct  17   TIPRRAAGLSSIRCSISAPEKKPRRRRKQKRGD--GAENDSSLSFGSGDAVSALERSLRL  74

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
             FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D  GAMH+LR+E
Sbjct  75   TFMDELMERARNRDTSGVSEVIYDMIAAGLSPGPRSFHGLVVAHALNGDEHGAMHSLRKE  134

Query  530  LSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            L  G RPL ET +AL+RL GSKG ATRGLEILAAME L 
Sbjct  135  LGAGQRPLPETMIALVRLSGSKGNATRGLEILAAMEKLN  173



>ref|XP_010485796.1| PREDICTED: uncharacterized protein LOC104764053 [Camelina sativa]
Length=913

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 413/448 (92%), Gaps = 0/448 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE+ANKVF KGA+GG+RATD++YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  186   EELMRTNHLEDANKVFLKGARGGMRATDELYDLMIEEDCKAGDHSNALDISYEMEAAGRM  245

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRAESYDRVQ
Sbjct  246   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPNTETYNWVIQAYTRAESYDRVQ  305

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALK FEGG  +LHN G
Sbjct  306   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKKFEGGTVVLHNAG  365

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQ 
Sbjct  366   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQA  425

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEE  1544
             EAELGYEIDY+ARY+ EGGLTGERKRWVPR+GKTPLDPDA G+IYSNP+ETSFKQRCLE+
Sbjct  426   EAELGYEIDYLARYIEEGGLTGERKRWVPRKGKTPLDPDASGFIYSNPIETSFKQRCLED  485

Query  1545  WRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSEL  1724
             W+I+HRKL  TL++EG  +LG+VSESDY+RV ERL+ I++GP Q  LKPKAASKM+VSEL
Sbjct  486   WKIHHRKLYRTLQSEGLPVLGDVSESDYMRVMERLRNIIRGPAQNLLKPKAASKMVVSEL  545

Query  1725  KEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIK  1904
             KEELEAQ LP DGTRNVLYQRVQKARRIN SRGRPLW+PP+EEEEEEVDEE+DELI RIK
Sbjct  546   KEELEAQGLPIDGTRNVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIK  605

Query  1905  LHEGDTEFWKRRFLGEGFNENDSQQLEV  1988
             LHEGDTEFWKRRFLGEGF E   +  E 
Sbjct  606   LHEGDTEFWKRRFLGEGFIETSVESKET  633


 Score =   283 bits (725),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskks-rrrsrITAMddddedWIPLDIHEAL  2315
             D VK K  +  K LQMIGVQLLK+SD+ + +KK  +R SR+T  DD DEDW P D  EA 
Sbjct  693   DLVKNKAAEAKKHLQMIGVQLLKESDEANRTKKRGKRASRMTLEDDADEDWFPEDPFEAF  752

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PR+WSQEWEVEL I +M+KVI LGG P
Sbjct  753   KEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTPRKWSQEWEVELAIVLMTKVIELGGVP  812

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCA+ILRAA+R PMPSAFLKILQ THSLGY FGSPLYDEI+ LCLDL ELDAA+AIV
Sbjct  813   TIGDCAVILRAALRGPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDLGELDAAIAIV  872

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             AD+ET+GI VPD+T+D+VISAR 
Sbjct  873   ADMETTGIAVPDQTIDKVISARQ  895


 Score =   156 bits (395),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            S  E+ LRL FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +
Sbjct  67   SALERSLRLTFMDELMERARNRDTSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQ  126

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            GAMH+LR+EL  G RPL ET  AL+RL GSKG ATRGLEILAAME L 
Sbjct  127  GAMHSLRKELGAGQRPLPETMTALVRLSGSKGNATRGLEILAAMEKLN  174



>ref|XP_006854340.1| hypothetical protein AMTR_s00039p00135490 [Amborella trichopoda]
 gb|ERN15807.1| hypothetical protein AMTR_s00039p00135490 [Amborella trichopoda]
Length=870

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/453 (83%), Positives = 417/453 (92%), Gaps = 1/453 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+ HL+NANKVF +GA+GGLRATD++YDLLIEEDCKAGDHSNALT+AYEMEAAGRM
Sbjct  168   EELIRNGHLDNANKVFLRGAEGGLRATDELYDLLIEEDCKAGDHSNALTVAYEMEAAGRM  227

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E +MKPDTE+YNWVIQAYTRAESYDRV
Sbjct  228   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEDFMKPDTESYNWVIQAYTRAESYDRV  287

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             QDVAELLGMMVEDHKRLQPN+RTY LLVECF+KYCV++EAIRHFRALKNFEGG R+L NE
Sbjct  288   QDVAELLGMMVEDHKRLQPNVRTYALLVECFTKYCVLKEAIRHFRALKNFEGGTRVLCNE  347

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G +GDPLSLYLRALCREGRIVELLEALEAM KDNQ I PRAMILS+KYRTLVSSWIEPLQ
Sbjct  348   GNFGDPLSLYLRALCREGRIVELLEALEAMAKDNQPITPRAMILSKKYRTLVSSWIEPLQ  407

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEAELG+E+DYIARY+AEGGLT ERKRWVPRRGKTPLDPDA G+ YSNPMETS+KQRCLE
Sbjct  408   EEAELGFEVDYIARYIAEGGLTAERKRWVPRRGKTPLDPDAIGFAYSNPMETSYKQRCLE  467

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
               ++++RKLL  L+ EG A LG+VSE+DY RV ERLKK++KGP+Q ALKPKAASKMIVSE
Sbjct  468   NLKVHNRKLLKKLKYEGRAALGDVSEADYARVVERLKKVIKGPDQTALKPKAASKMIVSE  527

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LKEELEAQ LPTDGTR VLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDE ISRI
Sbjct  528   LKEELEAQGLPTDGTRQVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDEWISRI  587

Query  1902  KLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLE  2000
             +L EG+TEFW+RRFLGEG      +++E+ DL+
Sbjct  588   RLEEGNTEFWRRRFLGEGLGSVPDKKIELEDLD  620


 Score =   261 bits (667),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +3

Query  2175  PLQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVED  2354
             PLQMIGVQLLKDS Q  +S++SRRR R    DDDD+DW P D+ EA KE+R+R+IFDV D
Sbjct  670   PLQMIGVQLLKDS-QLPTSRRSRRRVRPMVEDDDDDDWFPEDLQEAFKELRERRIFDVSD  728

Query  2355  MYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAI  2534
             MYTIADVWGWTWE+ELK K P RWSQE EVEL I+IM KVI LGG PTIGDCA+ILRAAI
Sbjct  729   MYTIADVWGWTWERELKAKFPERWSQEREVELAIKIMHKVIELGGKPTIGDCAMILRAAI  788

Query  2535  RAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDE  2714
             RAP+P+AFL ILQ THSL YVFGSPLYDE++  CLDL ELDAAVAI+ADLET+GI VPDE
Sbjct  789   RAPLPAAFLTILQTTHSLDYVFGSPLYDEVITHCLDLGELDAAVAIIADLETTGIKVPDE  848

Query  2715  TLDRVISARN  2744
             TLD+V++A+ 
Sbjct  849   TLDKVLAAQQ  858


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  341  LRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHAL  520
            LR  FME LM+RAR  D +G + V+ DM+AAGL PGPRSFHGLIVS VLN D EGAM +L
Sbjct  55   LRFAFMEALMDRARAGDAAGTAEVLRDMVAAGLSPGPRSFHGLIVSQVLNGDEEGAMQSL  114

Query  521  RRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            R ELS G RPLHETF+ALI LFGSKGL+ +G EILAAME L 
Sbjct  115  RMELSAGHRPLHETFIALIHLFGSKGLSVKGQEILAAMEKLN  156



>ref|XP_009794336.1| PREDICTED: uncharacterized protein LOC104241114, partial [Nicotiana 
sylvestris]
Length=524

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/515 (81%), Positives = 453/515 (88%), Gaps = 4/515 (1%)
 Frame = +3

Query  1209  YLRALC-REGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYE  1385
             YL+ LC   GRIVELLEALEAM KDNQ IPPRAMILSRKYRTLVSSWIEPLQEEAELGYE
Sbjct  1     YLKKLCFTPGRIVELLEALEAMAKDNQPIPPRAMILSRKYRTLVSSWIEPLQEEAELGYE  60

Query  1386  IDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRK  1565
             IDYIARYVAEGGLTG+RKRWVPRRGKTPLDPDAEG+IYSNP ETSFKQRCLEEWR++HRK
Sbjct  61    IDYIARYVAEGGLTGDRKRWVPRRGKTPLDPDAEGFIYSNPRETSFKQRCLEEWRLHHRK  120

Query  1566  LLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQ  1745
             LL TL NEGP+ILG +SESDY+R+ ERL+KI+KGPEQ ALKPKAASKMIVSELKEELEAQ
Sbjct  121   LLKTLHNEGPSILGKISESDYIRLVERLRKIIKGPEQNALKPKAASKMIVSELKEELEAQ  180

Query  1746  DLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTE  1925
              LPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIKLHEG+TE
Sbjct  181   GLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIKLHEGNTE  240

Query  1926  FWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveve  2105
             FWKRRFLGEG NEN  QQ E+ DLE  DV    D A D    EA+++E E++E ++ E E
Sbjct  241   FWKRRFLGEGLNENHVQQSEIIDLEPTDVVDDTDDAVDDISKEAEDDEAEDDEAQDEEEE  300

Query  2106  veqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTs--sskksrrrsrITAMdddd  2279
             VEQ E+Q EVGDR K+KEV+ AKPLQMIGVQLLKDSDQT+  S K  RR SR+ A+DDDD
Sbjct  301   VEQAESQPEVGDR-KDKEVEAAKPLQMIGVQLLKDSDQTASSSRKSRRRLSRVAAVDDDD  359

Query  2280  edWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIE  2459
             +DW PLDI EA  EMRKR IFDV DMYTI D WGWTWEKE+KNK P+RWSQEWEVELGI+
Sbjct  360   DDWFPLDIQEAFVEMRKRNIFDVSDMYTITDAWGWTWEKEIKNKAPQRWSQEWEVELGIK  419

Query  2460  IMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCL  2639
             +M+KVI LGGTPTIGDCA+ILRAA+RAPMPSAFL ILQ THSLGYVFGSPLYDEI+ LCL
Sbjct  420   VMTKVIELGGTPTIGDCAVILRAAVRAPMPSAFLNILQTTHSLGYVFGSPLYDEIITLCL  479

Query  2640  DLEELDAAVAIVADLETSGIMVPDETLDRVISARN  2744
             DL ELDAA+AIVADLETSGI VPDETLDRVISAR 
Sbjct  480   DLGELDAAIAIVADLETSGIKVPDETLDRVISARQ  514



>gb|EPS69040.1| hypothetical protein M569_05728, partial [Genlisea aurea]
Length=561

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/564 (72%), Positives = 460/564 (82%), Gaps = 12/564 (2%)
 Frame = +3

Query  1077  LLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLE  1256
             LLVECF+KYCV +EAIRHFRALKN EGG ++LHN G++GDPLSLYLRALCREGR+VELLE
Sbjct  1     LLVECFTKYCVTKEAIRHFRALKNIEGGAQVLHNNGQHGDPLSLYLRALCREGRVVELLE  60

Query  1257  ALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGER  1436
             ALE MLKDNQ IPPRAMILSR YRTLVSSWIEPLQEEAE+G E+DYI+RY+AEGGLTGER
Sbjct  61    ALETMLKDNQQIPPRAMILSRNYRTLVSSWIEPLQEEAEIGREVDYISRYIAEGGLTGER  120

Query  1437  KRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILGNVS  1616
             KRWVPRRGKTPLDPDAEG+IYSNPMETSFK+RCLEEW+I+HRKLL  LRNEGPA+LGNVS
Sbjct  121   KRWVPRRGKTPLDPDAEGFIYSNPMETSFKRRCLEEWKIHHRKLLKFLRNEGPAVLGNVS  180

Query  1617  ESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQK  1796
             ESDY+RV ERLKKI++GPEQ +LKPKAASKM VSEL+EELEAQDLPTDGTRNVLYQRVQK
Sbjct  181   ESDYVRVEERLKKIIRGPEQSSLKPKAASKMTVSELREELEAQDLPTDGTRNVLYQRVQK  240

Query  1797  ARRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQ  1976
             ARRIN SRGRPLW+PPVEE EEEVDEELD LI RIK  EG+TEFWKRRFLGE  N   S 
Sbjct  241   ARRINRSRGRPLWVPPVEEAEEEVDEELDGLIGRIKTEEGNTEFWKRRFLGEDVNGIQSS  300

Query  1977  QLEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveveveqtetqaevGDRV--K  2150
              L+   ++    +          D   D    E++E +E E E+EQ E+Q E GDRV  K
Sbjct  301   PLKTEYID----DAYVIDDDADTDYAEDVAAVEDDEVDEEEEEIEQPESQPETGDRVIIK  356

Query  2151  EKEVKTAKPLQMIGVQLLKDSDQ-----TssskksrrrsrITAMddddedWIPLDIHEAL  2315
             +KE   +KP  MIGVQLLKDS +     +S     R   +   +DDDDEDW P DIHEA 
Sbjct  357   DKEDNPSKPPLMIGVQLLKDSGESTTTSSSKKSPRRSTRKYVEVDDDDEDWFPEDIHEAF  416

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             KEMR RK+FDVEDMYTIAD WGWTWEKELKN+ PRRWSQEWE ELG+ +M+KVI LGG P
Sbjct  417   KEMRNRKVFDVEDMYTIADAWGWTWEKELKNRAPRRWSQEWEAELGVRVMNKVIELGGKP  476

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDC ++LRAAIRAP P  FL+I+Q TH LGYVFG+PLYDEI+ LCLDL E+DAAVA+ 
Sbjct  477   TIGDCGMVLRAAIRAPSPWLFLQIVQTTHGLGYVFGNPLYDEILRLCLDLGEVDAAVAMA  536

Query  2676  ADLETSGIMVPDETLDRVI-SARN  2744
             A+LET+GI VP ETLD VI SAR 
Sbjct  537   AELETNGIEVPSETLDSVIVSARQ  560



>ref|XP_009602145.1| PREDICTED: uncharacterized protein LOC104097292 [Nicotiana tomentosiformis]
Length=503

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/494 (81%), Positives = 437/494 (88%), Gaps = 3/494 (1%)
 Frame = +3

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWV  1448
             M KDNQ IPPRAM+LSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTG+RKRWV
Sbjct  1     MAKDNQPIPPRAMLLSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGDRKRWV  60

Query  1449  PRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILGNVSESDY  1628
             PRRGKTPLDPDAEG+IYSNP ETSFKQRCL EWR++HRKLL TL NEGP+ILG +SESDY
Sbjct  61    PRRGKTPLDPDAEGFIYSNPRETSFKQRCLGEWRLHHRKLLKTLHNEGPSILGKISESDY  120

Query  1629  LRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRI  1808
             +R+ ERL+KI+KGPEQ ALKPKAASKMIVSELKEELEAQ LPTDGTRNVLYQRVQKARRI
Sbjct  121   IRLVERLRKIIKGPEQNALKPKAASKMIVSELKEELEAQGLPTDGTRNVLYQRVQKARRI  180

Query  1809  NLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQQLEV  1988
             N SRGRPLW+PPVEEEEEEVDEELDELISRIKLHEG+TEFWKRRFLGEG NEN  QQ E+
Sbjct  181   NRSRGRPLWVPPVEEEEEEVDEELDELISRIKLHEGNTEFWKRRFLGEGLNENHGQQSEI  240

Query  1989  NDLELPdvetvddvakdveddeadeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKT  2168
              DLE  DV    D A D    EA+++E E+EE ++ E EVEQTE+Q EVGDR K+KEV+ 
Sbjct  241   IDLEPTDVVDDTDDAVDDISKEAEDDEAEDEEAQDEEEEVEQTESQPEVGDR-KDKEVEA  299

Query  2169  AKPLQMIGVQLLKDSDQTs--sskksrrrsrITAMddddedWIPLDIHEALKEMRKRKIF  2342
             AKPLQMIGVQLLKDSDQT+  S K  RR SR+ A+DDDD+DW PLDI EA  EMRKR IF
Sbjct  300   AKPLQMIGVQLLKDSDQTASSSRKSRRRISRVAAVDDDDDDWFPLDIQEAFVEMRKRNIF  359

Query  2343  DVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIIL  2522
             DV DMYTI D WGWTWEKE+KNKPP+RWSQEWEVELGI++M+KVI LGGTPTIGDCA+IL
Sbjct  360   DVSDMYTITDAWGWTWEKEIKNKPPQRWSQEWEVELGIKVMTKVIELGGTPTIGDCAVIL  419

Query  2523  RAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIM  2702
             RAA+RAPMPSAFL ILQ THSLGYVFGSPLYDEI+ LCLDL ELDAA+AIVADLETSG+ 
Sbjct  420   RAAVRAPMPSAFLNILQTTHSLGYVFGSPLYDEIITLCLDLGELDAAIAIVADLETSGVK  479

Query  2703  VPDETLDRVISARN  2744
             VPDETLDRVISAR 
Sbjct  480   VPDETLDRVISARQ  493



>emb|CDP04259.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   659 bits (1701),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 312/375 (83%), Positives = 338/375 (90%), Gaps = 23/375 (6%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+RSNHLE+ANKVF KGA+GGLRATD++YDL+I+EDCK GDH NALTIAYEME+AGRM
Sbjct  192   EELIRSNHLEDANKVFLKGAEGGLRATDELYDLIIQEDCKVGDHENALTIAYEMESAGRM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE YMKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  252   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEDYMKPDTETYNWVIQAYTRADSYDRVQ  311

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPN+RTY LLVECF+KYCVVREAIRHFRALKNFEGG ++LHN+G
Sbjct  312   DVAELLGMMVEDHKRLQPNVRTYALLVECFTKYCVVREAIRHFRALKNFEGGTKVLHNDG  371

Query  1185  KYGDPLSLYLRALCREG-----------------------RIVELLEALEAMLKDNQTIP  1295
              YGDPLSLYLRALCREG                       RIVELLEALEAM KDN  IP
Sbjct  372   NYGDPLSLYLRALCREGMFFLFAFFFSISYCYSLSSRKMRRIVELLEALEAMEKDNVPIP  431

Query  1296  PRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLD  1475
             PRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARY+AEGGLTGERKRWVPRRGKTPLD
Sbjct  432   PRAMILSRKYRTLVSSWIEPLQEEAELGYEIDYIARYIAEGGLTGERKRWVPRRGKTPLD  491

Query  1476  PDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKK  1655
             PDA+G+IYSNPMETSFKQRCLEEW+I+HRKLL TL NEGPA+LGNVSES+Y+RV ERLKK
Sbjct  492   PDADGFIYSNPMETSFKQRCLEEWKIHHRKLLKTLHNEGPAVLGNVSESEYIRVEERLKK  551

Query  1656  IVKGPEQKALKPKAA  1700
             I+KGPEQ ALKPKAA
Sbjct  552   IIKGPEQNALKPKAA  566


 Score =   198 bits (504),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 137/183 (75%), Gaps = 9/183 (5%)
 Frame = +2

Query  116  MAALL---TQLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKT  286
            MA+LL   T LP     +++ P      P +T+       SSP+R  RK++QQ   Q   
Sbjct  1    MASLLLLPTHLPSNFYESSSNPF---PLPHKTSVVSASVSSSPKRTRRKRQQQQRRQQYI  57

Query  287  AEDDDGG-GAL--MASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRS  457
             ED++G  GAL  +AS  EKVLRLVFM+ELMERAR+ADVSGVS VIYDMIAAGL PGPRS
Sbjct  58   GEDENGSSGALVSIASSAEKVLRLVFMDELMERARNADVSGVSDVIYDMIAAGLSPGPRS  117

Query  458  FHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            FHGLIVS+VLN D EGAMHALRRELSEGLRPLHETFVAL+RLFGSKGL+ RGLEILAAME
Sbjct  118  FHGLIVSNVLNRDEEGAMHALRRELSEGLRPLHETFVALVRLFGSKGLSARGLEILAAME  177

Query  638  NLK  646
             L 
Sbjct  178  KLN  180



>ref|XP_006662417.1| PREDICTED: uncharacterized protein LOC102708836 [Oryza brachyantha]
Length=825

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 389/440 (88%), Gaps = 2/440 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++N+LE+AN VF KG +GGLR TD+IYDLLIEEDCKAGDHSNALT+AY+MEA GRM
Sbjct  119   EELVKNNYLEDANTVFLKGTEGGLRGTDEIYDLLIEEDCKAGDHSNALTVAYKMEADGRM  178

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTE+YNWVIQA+TRA+SYDR 
Sbjct  179   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEDYMKPDTESYNWVIQAFTRAKSYDRA  238

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KYC+V EAIRHFRAL+   GG ++L+NE
Sbjct  239   ADVAELLGMMVEDHKRIQPNARTYALLVECFTKYCMVNEAIRHFRALRRIPGGTKVLYNE  298

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELLEALEAM  D QTI PRAMIL+RKYRTLVS+WIEPLQ
Sbjct  299   GNCGDPLSLYLRSLCLDGRADELLEALEAMANDGQTIAPRAMILNRKYRTLVSTWIEPLQ  358

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+E SFKQRC E
Sbjct  359   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIEISFKQRCFE  418

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  419   ELKLYHRKLLITLRNEGPGILGDVSEDDVRRVVERLKKLVVGPKKNVVKPKAASKMVVSE  478

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+PP  E+EEEVDE++DELISRI
Sbjct  479   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWVPP-VEDEEEVDEDIDELISRI  537

Query  1902  KLHEGDTEFWKRRFLGEGFN  1961
             KL +G+TEFWKRRFLGE  N
Sbjct  538   KLEDGNTEFWKRRFLGETRN  557


 Score =   256 bits (653),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 161/203 (79%), Gaps = 4/203 (2%)
 Frame = +3

Query  2139  DRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEAL  2315
             D  K+K  K  K  LQM+GVQLLKD ++T  S K  +R       DDDEDW P D  EA 
Sbjct  611   DETKDKPSKGPKQYLQMLGVQLLKDLEKTPVSSKKLKR---VPEIDDDEDWFPEDPIEAF  667

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTP  2495
             K MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGG P
Sbjct  668   KVMRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIELGGNP  727

Query  2496  TIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIV  2675
             TIGDCAIILRAA+RAP+PSAF+ ILQ THSLGY FGS LYDE+++LCLDLEE+DAA+A+V
Sbjct  728   TIGDCAIILRAAMRAPIPSAFMTILQTTHSLGYKFGSSLYDEVILLCLDLEEIDAAIAVV  787

Query  2676  ADLETSGIMVPDETLDRVISARN  2744
             A++ET+GI VPDETLD+V++A+ 
Sbjct  788   AEMETNGIKVPDETLDKVLAAKQ  810


 Score =   135 bits (339),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  335  KVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMH  514
            K LRL F+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFHGL+ +HVL  D EGAM 
Sbjct  4    KGLRLAFLEQLAERARAADAAGVADAIYDMVAAGLSPGPRSFHGLVAAHVLAGDAEGAMQ  63

Query  515  ALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            +LRRELS G+RPLHETFVAL+R+F  KGLATRG+EILAAME  K
Sbjct  64   SLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERYK  107



>gb|AAM93724.1| putative chloroplast RNA processing protein [Oryza sativa Japonica 
Group]
Length=730

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 387/440 (88%), Gaps = 2/440 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV +N+LE+AN VF KG +GGL+ TD+IYDLLIEEDCKAGDHSNALT+AY+MEA+GRM
Sbjct  192   EELVNNNYLEDANTVFLKGTEGGLQGTDEIYDLLIEEDCKAGDHSNALTVAYKMEASGRM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  252   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEGYMKPDTESYNWVIQAFTRATSYDRA  311

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KY +V EAIRHFRAL+   GG ++L+NE
Sbjct  312   GDVAELLGMMVEDHKRIQPNARTYALLVECFTKYSMVNEAIRHFRALRRIPGGTKVLYNE  371

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELLEALEAM  D QTI PRAMIL+RKYRTLVS+WIEPLQ
Sbjct  372   GNCGDPLSLYLRSLCLDGRADELLEALEAMSNDGQTIAPRAMILNRKYRTLVSTWIEPLQ  431

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFKQRC E
Sbjct  432   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKQRCFE  491

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  492   ELKLYHRKLLITLRNEGPGILGDVSEDDVRRVIERLKKLVVGPKKNVVKPKAASKMVVSE  551

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+ P  E+EEEVDEELDELISRI
Sbjct  552   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWV-PPVEDEEEVDEELDELISRI  610

Query  1902  KLHEGDTEFWKRRFLGEGFN  1961
             KL +G+TEFWKRRFLGE  N
Sbjct  611   KLEDGNTEFWKRRFLGETRN  630


 Score =   139 bits (349),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +2

Query  290  EDDDGGG--ALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFH  463
            E   GGG  +  A   EK LRL F+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFH
Sbjct  60   EGSGGGGDRSAAAGAVEKGLRLAFLEQLAERARAADAAGVADAIYDMVAAGLSPGPRSFH  119

Query  464  GLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GL+ +HVL  D EGAM +LRRELS G+RPLHETFVAL+R+F  KGLATRG+EILAAME  
Sbjct  120  GLVAAHVLAGDAEGAMQSLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERY  179

Query  644  K  646
            K
Sbjct  180  K  180



>gb|EAZ16340.1| hypothetical protein OsJ_31803 [Oryza sativa Japonica Group]
Length=764

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 387/440 (88%), Gaps = 2/440 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV +N+LE+AN VF KG +GGL+ TD+IYDLLIEEDCKAGDHSNALT+AY+MEA+GRM
Sbjct  58    EELVNNNYLEDANTVFLKGTEGGLQGTDEIYDLLIEEDCKAGDHSNALTVAYKMEASGRM  117

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  118   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEGYMKPDTESYNWVIQAFTRATSYDRA  177

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KY +V EAIRHFRAL+   GG ++L+NE
Sbjct  178   GDVAELLGMMVEDHKRIQPNARTYALLVECFTKYSMVNEAIRHFRALRRIPGGTKVLYNE  237

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELLEALEAM  D QTI PRAMIL+RKYRTLVS+WIEPLQ
Sbjct  238   GNCGDPLSLYLRSLCLDGRADELLEALEAMSNDGQTIAPRAMILNRKYRTLVSTWIEPLQ  297

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFKQRC E
Sbjct  298   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKQRCFE  357

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  358   ELKLYHRKLLITLRNEGPGILGDVSEDDVRRVIERLKKLVVGPKKNVVKPKAASKMVVSE  417

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+ P  E+EEEVDEELDELISRI
Sbjct  418   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWV-PPVEDEEEVDEELDELISRI  476

Query  1902  KLHEGDTEFWKRRFLGEGFN  1961
             KL +G+TEFWKRRFLGE  N
Sbjct  477   KLEDGNTEFWKRRFLGETRN  496


 Score =   258 bits (658),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 4/210 (2%)
 Frame = +3

Query  2136  GDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEA  2312
             GD  K+K  K  K  LQMIGVQLLKD ++TS S K  +R       DDDEDW P D  EA
Sbjct  550   GDETKDKPSKGPKQHLQMIGVQLLKDLEKTSVSSKKSKR---VPEIDDDEDWFPEDPIEA  606

Query  2313  LKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGT  2492
              K MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGGT
Sbjct  607   FKVMRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIDLGGT  666

Query  2493  PTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAI  2672
             PTIGDCAIILRAA+R P+PSAF+ ILQ THSLGY FGSPLYDE ++LCLDLEE+DAA+A+
Sbjct  667   PTIGDCAIILRAAMRVPLPSAFMTILQTTHSLGYKFGSPLYDEAILLCLDLEEIDAAIAV  726

Query  2673  VADLETSGIMVPDETLDRVISARNKK*QSS  2762
             VA++ET+GI VPDETLD+V++A+     S+
Sbjct  727   VAEMETNGIKVPDETLDKVLAAKQSGGNSA  756


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  509  MHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            M +LRRELS G+RPLHETFVAL+R+F  KGLATRG+EILAAME  K
Sbjct  1    MQSLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERYK  46



>gb|AAN05531.1| putative DNA binding domain containing protein [Oryza sativa 
Japonica Group]
 gb|AAP54158.1| SAP domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=898

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 387/440 (88%), Gaps = 2/440 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV +N+LE+AN VF KG +GGL+ TD+IYDLLIEEDCKAGDHSNALT+AY+MEA+GRM
Sbjct  192   EELVNNNYLEDANTVFLKGTEGGLQGTDEIYDLLIEEDCKAGDHSNALTVAYKMEASGRM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYG-EAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYG E YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  252   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEGYMKPDTESYNWVIQAFTRATSYDRA  311

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
              DVAELLGMMVEDHKR+QPN RTY LLVECF+KY +V EAIRHFRAL+   GG ++L+NE
Sbjct  312   GDVAELLGMMVEDHKRIQPNARTYALLVECFTKYSMVNEAIRHFRALRRIPGGTKVLYNE  371

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQ  1361
             G  GDPLSLYLR+LC +GR  ELLEALEAM  D QTI PRAMIL+RKYRTLVS+WIEPLQ
Sbjct  372   GNCGDPLSLYLRSLCLDGRADELLEALEAMSNDGQTIAPRAMILNRKYRTLVSTWIEPLQ  431

Query  1362  EEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLE  1541
             EEA++G+EIDY+ARY+ EGGLTGERKRWVPRRGKTPLDPD  G+ YSNP+ETSFKQRC E
Sbjct  432   EEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNPIETSFKQRCFE  491

Query  1542  EWRIYHRKLLNTLRNEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSE  1721
             E ++YHRKLL TLRNEGP ILG+VSE D  RV ERLKK+V GP++  +KPKAASKM+VSE
Sbjct  492   ELKLYHRKLLITLRNEGPGILGDVSEDDVRRVIERLKKLVVGPKKNVVKPKAASKMVVSE  551

Query  1722  LKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRI  1901
             LK ELEAQ LPTDGTR VLYQRVQKARRIN SRG PLW+ P  E+EEEVDEELDELISRI
Sbjct  552   LKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWV-PPVEDEEEVDEELDELISRI  610

Query  1902  KLHEGDTEFWKRRFLGEGFN  1961
             KL +G+TEFWKRRFLGE  N
Sbjct  611   KLEDGNTEFWKRRFLGETRN  630


 Score =   258 bits (658),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 4/210 (2%)
 Frame = +3

Query  2136  GDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEA  2312
             GD  K+K  K  K  LQMIGVQLLKD ++TS S K  +R       DDDEDW P D  EA
Sbjct  684   GDETKDKPSKGPKQHLQMIGVQLLKDLEKTSVSSKKSKR---VPEIDDDEDWFPEDPIEA  740

Query  2313  LKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGT  2492
              K MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGGT
Sbjct  741   FKVMRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIDLGGT  800

Query  2493  PTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAI  2672
             PTIGDCAIILRAA+R P+PSAF+ ILQ THSLGY FGSPLYDE ++LCLDLEE+DAA+A+
Sbjct  801   PTIGDCAIILRAAMRVPLPSAFMTILQTTHSLGYKFGSPLYDEAILLCLDLEEIDAAIAV  860

Query  2673  VADLETSGIMVPDETLDRVISARNKK*QSS  2762
             VA++ET+GI VPDETLD+V++A+     S+
Sbjct  861   VAEMETNGIKVPDETLDKVLAAKQSGGNSA  890


 Score =   139 bits (349),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +2

Query  290  EDDDGGG--ALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFH  463
            E   GGG  +  A   EK LRL F+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFH
Sbjct  60   EGSGGGGDRSAAAGAVEKGLRLAFLEQLAERARAADAAGVADAIYDMVAAGLSPGPRSFH  119

Query  464  GLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GL+ +HVL  D EGAM +LRRELS G+RPLHETFVAL+R+F  KGLATRG+EILAAME  
Sbjct  120  GLVAAHVLAGDAEGAMQSLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERY  179

Query  644  K  646
            K
Sbjct  180  K  180



>ref|XP_010417605.1| PREDICTED: uncharacterized protein LOC104703294 [Camelina sativa]
Length=770

 Score =   501 bits (1289),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+R+NHLE+ANKVF KGA+GG+RATD++YDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  186   EELMRTNHLEDANKVFLKGARGGMRATDELYDLMIEEDCKAGDHSNALDISYEMEAAGRM  245

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPEVA+ATFENMEYGE +MKP+TETYNWVIQAYTRAESYDRVQ
Sbjct  246   ATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPNTETYNWVIQAYTRAESYDRVQ  305

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVV+EAIRHFRALK FEGG  +LHN G
Sbjct  306   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVKEAIRHFRALKKFEGGTVVLHNAG  365

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              + DPLSLYLRALCREGRIVEL++AL+AM KDNQ IPPRAMI+SRKYRTLVSSWIEPLQE
Sbjct  366   NFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPIPPRAMIMSRKYRTLVSSWIEPLQE  425

Query  1365  EAELGYEIDYIARYVAEGGLTGERKRWV  1448
             EAELGYEIDY+ARY+ EGGLTGERKRWV
Sbjct  426   EAELGYEIDYLARYIEEGGLTGERKRWV  453


 Score =   157 bits (397),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            S  E+ LRL FM+ELMERAR+ D SGVS VIYDMIAAGL PGPRSFHGL+V+H LN D +
Sbjct  67   SALERSLRLTFMDELMERARNRDTSGVSEVIYDMIAAGLTPGPRSFHGLVVAHALNGDEQ  126

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GAMH+LR+EL  G RPL ET +AL+RL GSKG ATRGLEILAAME L
Sbjct  127  GAMHSLRKELGAGQRPLPETMIALVRLSGSKGNATRGLEILAAMEKL  173


 Score =   312 bits (799),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 224/294 (76%), Gaps = 7/294 (2%)
 Frame = +3

Query  1890  ISRIKLHEGDTEFWKRRFLGEGFNEND------SQQLEVNDLELPdvetvddvakdvedd  2051
             I RIKLHEGDTEFWKRRFLGEGF E        ++ +   + E    +   +   D +DD
Sbjct  461   ICRIKLHEGDTEFWKRRFLGEGFIETSVESKETAETIATGESENTSKDVAKEADDDEDDD  520

Query  2052  eadeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTsss  2231
             + +E +E+++E EE EV V +TE +AE  D VK K  +  K LQMIGVQLLK+SD+ + +
Sbjct  521   DEEEGDEDDDENEEEEVVVAETENRAEGEDLVKNKAAEAKKHLQMIGVQLLKESDEANRT  580

Query  2232  kks-rrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKN  2408
             KK  +R SR+T  DD DEDW P D  EA KEMR+RK+FDV DMYTIADVWGWTWEK+ KN
Sbjct  581   KKRGKRASRMTLEDDADEDWFPEDPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDFKN  640

Query  2409  KPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSL  2588
             K PR+WSQEWEVEL I +M+KVI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ THSL
Sbjct  641   KTPRKWSQEWEVELAIVLMTKVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQTTHSL  700

Query  2589  GYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK  2750
             GY FGSPLYDEI+ LCLDL ELDAA+AIVAD+ET+GI VPD+T+D+VISAR   
Sbjct  701   GYAFGSPLYDEIITLCLDLGELDAAIAIVADMETTGIAVPDQTIDKVISARQSN  754



>ref|XP_004155705.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like 
[Cucumis sativus]
Length=501

 Score =   476 bits (1226),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 221/251 (88%), Positives = 237/251 (94%), Gaps = 0/251 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRS +LE+ANKVF KGAK GLRATD+IYDL+IEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  180   EELVRSKYLEDANKVFLKGAKAGLRATDKIYDLMIEEDCKAGDHSNALEISYEMEAAGRM  239

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AF+TFENMEYGE YMKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  240   ATTFHFNCLLSVQATCGIPEIAFSTFENMEYGEDYMKPDTETYNWVIQAYTRAESYDRVQ  299

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKRLQPNMRTY LLVECF+KYCV+REAIRHFRAL+ FEGG   LHNEG
Sbjct  300   DVAELLGMMVEDHKRLQPNMRTYALLVECFTKYCVIREAIRHFRALRTFEGGTTALHNEG  359

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
              +GDPLSLYLRALCREGR+VELLEALEAM +DNQ IPPRAMILSRKYR+LVSSWIEPLQE
Sbjct  360   NFGDPLSLYLRALCREGRVVELLEALEAMARDNQQIPPRAMILSRKYRSLVSSWIEPLQE  419

Query  1365  EAELGYEIDYI  1397
             EAE G+EIDYI
Sbjct  420   EAEHGFEIDYI  430


 Score =   169 bits (428),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 113/168 (67%), Gaps = 19/168 (11%)
 Frame = +2

Query  164  TVPLRQRTF-------PPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMA  322
            T+P   R+F       P R+   V+ A     R+ R+ + Q   QPK   D+D      +
Sbjct  13   TLPSNHRSFSLNHGLLPIRS---VLSAPDKRGRKKRRSRHQQQLQPK---DND------S  60

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            +  E  LR  FMEELM+RARD D  GVS VIYDM+AAGL PGPRSFHGL+VSH LN D E
Sbjct  61   TSLENSLRFTFMEELMDRARDHDPLGVSDVIYDMVAAGLSPGPRSFHGLVVSHTLNGDTE  120

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            GAM +LRRELS GL PLHETFVAL+RLFGSKGLA RGLEILAAME L 
Sbjct  121  GAMQSLRRELSAGLLPLHETFVALVRLFGSKGLANRGLEILAAMEKLN  168



>gb|KHN14795.1| hypothetical protein glysoja_020968 [Glycine soja]
Length=505

 Score =   527 bits (1357),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 317/462 (69%), Positives = 375/462 (81%), Gaps = 3/462 (1%)
 Frame = +3

Query  1404  YVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLR  1583
             Y+ EGGLTGERKRWVPRRGKTPLDPDA G+IYSNPMETSFKQRC+EE +++++KLL TL+
Sbjct  43    YIDEGGLTGERKRWVPRRGKTPLDPDAHGFIYSNPMETSFKQRCMEELKLHNKKLLKTLQ  102

Query  1584  NEGPAILGN-VSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTD  1760
             NEG A LG+ VSE DY+RV ERLKK++KGPEQ  LKPKAASKM+VSELKEEL+AQ LP D
Sbjct  103   NEGLAALGDDVSEFDYIRVQERLKKLMKGPEQNVLKPKAASKMLVSELKEELDAQGLPID  162

Query  1761  GTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRR  1940
             GTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELD LISRIKL EG+TEFWKRR
Sbjct  163   GTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDALISRIKLEEGNTEFWKRR  222

Query  1941  FLGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveveveqte  2120
             FLGEG N +     +    ++P+V    D  +D   +  D+E ++EEEE E   E  +  
Sbjct  223   FLGEGLNGDQEMPTDAVQSDVPEVLDDVDAIEDAAKEVEDDEADDEEEEAEQAEEEVEPA  282

Query  2121  tqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQ-TssskksrrrsrITAMddddedWIPL  2297
                +V +R+KEKEV+  +PLQMIGVQLLKD DQ T++SKK +R  R+   DDDD+DW+PL
Sbjct  283   ENQDV-NRIKEKEVEAKRPLQMIGVQLLKDIDQPTATSKKFKRSRRVQVEDDDDDDWLPL  341

Query  2298  DIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVI  2477
             ++ EA KEMRKRKIFDV DMYT+AD WGWTWE+ELKNKPPRRWSQE EVEL I++M KVI
Sbjct  342   NLFEAFKEMRKRKIFDVSDMYTLADAWGWTWERELKNKPPRRWSQEREVELAIKVMHKVI  401

Query  2478  ALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELD  2657
              LGG PTIGDCA+ILRAAIRAP+PSAFL ILQ TH+LG+ FGSPLYDE + LC+DL ELD
Sbjct  402   ELGGRPTIGDCAMILRAAIRAPLPSAFLTILQTTHALGFKFGSPLYDETISLCVDLGELD  461

Query  2658  AAVAIVADLETSGIMVPDETLDRVISARNKK*QSSK*IIHQS  2783
             AAVA+VADLET+GI V D TLDRVISA+ +   +S  +I  +
Sbjct  462   AAVAVVADLETTGISVSDHTLDRVISAKQRIDNTSNGVIRDA  503



>ref|XP_009798510.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
isoform X1 [Nicotiana sylvestris]
Length=381

 Score =   387 bits (993),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIE+DCK GDHSNALTIAYEMEAAGRM
Sbjct  182   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEQDCKVGDHSNALTIAYEMEAAGRM  241

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  242   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDHMKPDTETYNWVIQAYTRAESYDRVQ  301

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN+RTY LLVECF+KYCVVREAIRHFR LKNFEGG ++L+N+G
Sbjct  302   DVAELLGMMVEDHKRVQPNVRTYALLVECFTKYCVVREAIRHFRGLKNFEGGTQVLYNDG  361

Query  1185  KYGDPLSLYLRALCREG  1235
             KYGDPLSLYLRALCREG
Sbjct  362   KYGDPLSLYLRALCREG  378


 Score =   205 bits (522),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  137  LPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSS-PQRRTRKKKQQAPSQPKTAEDDDGGGA  313
            LPF  KFT  +P       P  +  +  +VSS P++  R+K+ Q         +DDG   
Sbjct  9    LPFNSKFTLPIP------RPSISRSIKASVSSQPRKTRRRKQTQQQQHQLKTAEDDGS--  60

Query  314  LMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNL  493
             MASGTEKVLRLVFMEELMERAR+AD  GVS VIYDMIAAGL PGPRSFHG +VSHVLN 
Sbjct  61   -MASGTEKVLRLVFMEELMERARNADSKGVSQVIYDMIAAGLSPGPRSFHGFVVSHVLNR  119

Query  494  DVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            D +GAMHALRRELSEGLRPLHETF+AL+RLFG+KGLATRGLEILAAME LK
Sbjct  120  DNDGAMHALRRELSEGLRPLHETFLALVRLFGAKGLATRGLEILAAMEKLK  170



>ref|XP_009600164.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
isoform X1 [Nicotiana tomentosiformis]
Length=380

 Score =   385 bits (989),  Expect(2) = 6e-159, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIE+DCK GDHSNALTIAYEMEAAGRM
Sbjct  181   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEQDCKVGDHSNALTIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             A+TFHFNCLLSVQATCGIPE+AFATFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  241   ASTFHFNCLLSVQATCGIPEIAFATFENMEYGEDHMKPDTETYNWVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             DVAELLGMMVEDHKR+QPN++TY LLVECF+KYCVVREAIRHFR LKNFEGG+++L+N+G
Sbjct  301   DVAELLGMMVEDHKRVQPNVKTYALLVECFTKYCVVREAIRHFRGLKNFEGGIQVLYNDG  360

Query  1185  KYGDPLSLYLRALCREG  1235
             KYGDPLSLYLRALCREG
Sbjct  361   KYGDPLSLYLRALCREG  377


 Score =   206 bits (524),  Expect(2) = 6e-159, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = +2

Query  137  LPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGAL  316
            LPF  KFT  +P       P  +  +  +VSS  R+TR++KQ    Q     +DDG    
Sbjct  9    LPFNSKFTLPIP------RPSISRSIKASVSSQPRKTRRRKQTQQQQQLKTAEDDGS---  59

Query  317  MASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLD  496
            MASGTEKVLRLVFMEELMERAR+AD  GVS VIYDMIAAGL PGPRSFHG +VSHVLN D
Sbjct  60   MASGTEKVLRLVFMEELMERARNADSKGVSQVIYDMIAAGLSPGPRSFHGFVVSHVLNRD  119

Query  497  VEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             +GAMHALRRELSEGLRPLHETF+AL+RLFG+KGLATRGLEILAAME LK
Sbjct  120  NDGAMHALRRELSEGLRPLHETFLALVRLFGAKGLATRGLEILAAMEKLK  169



>ref|XP_004173593.1| PREDICTED: uncharacterized LOC101209618, partial [Cucumis sativus]
Length=378

 Score =   459 bits (1182),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 313/387 (81%), Gaps = 11/387 (3%)
 Frame = +3

Query  1404  YVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCLEEWRIYHRKLLNTLR  1583
             Y+ EGGLTGERKRWVPR+GKTPLDPDA+G+IYSNPMETSFKQRCLE+W++YHRK+L TL+
Sbjct  1     YIEEGGLTGERKRWVPRKGKTPLDPDADGFIYSNPMETSFKQRCLEDWKMYHRKILKTLQ  60

Query  1584  NEGPAILGNVSESDYLRVWERLKKIVKGPEQKALKPKAASKMIVSELKEELEAQDLPTDG  1763
             NEG   L + SE+DY RV ERL+KI+KGP+Q  LKPKAASKMIVSELKEELEAQ LP DG
Sbjct  61    NEGLVALRDASEADYHRVVERLRKIIKGPDQNVLKPKAASKMIVSELKEELEAQGLPIDG  120

Query  1764  TRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldelISRIKLHEGDTEFWKRRF  1943
             TRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEEVDEELDELISRIKLHEG+TEFWKRRF
Sbjct  121   TRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEEVDEELDELISRIKLHEGNTEFWKRRF  180

Query  1944  LGEGFNENDSQQLEVNDLELPdvetvddvakdveddeadeeeeeeeeeeeveveveqtet  2123
             LGEG   N+ +         P  +   D    ++D +  E+  +E EEEE E E E  +T
Sbjct  181   LGEGLYSNNVK---------PSEDDKSDPLDSLDDVDTIEDVAKEIEEEEAEEEEEVEQT  231

Query  2124  qaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITAM--ddddedWIPL  2297
             + + G+RV +KEV+  KPLQMIGVQLLKD DQ +++ K  RR    A   DD DEDW P 
Sbjct  232   ENQDGERVIKKEVEAKKPLQMIGVQLLKDVDQPTTTSKKSRRRSSRASLEDDRDEDWFPE  291

Query  2298  DIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVI  2477
             DI EA KE++KRK+FDV DMYTIADVWGWTWE+ELKN+PPRRWSQEWEVEL I+IM KVI
Sbjct  292   DIFEAFKELQKRKVFDVSDMYTIADVWGWTWERELKNRPPRRWSQEWEVELAIKIMHKVI  351

Query  2478  ALGGTPTIGDCAIILRAAIRAPMPSAF  2558
              LGG PTIGDCA+ILRAAI+AP+PSAF
Sbjct  352   ELGGIPTIGDCAMILRAAIKAPLPSAF  378



>ref|XP_002960607.1| hypothetical protein SELMODRAFT_164431 [Selaginella moellendorffii]
 gb|EFJ38146.1| hypothetical protein SELMODRAFT_164431 [Selaginella moellendorffii]
Length=810

 Score =   434 bits (1115),  Expect(2) = 7e-144, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 314/445 (71%), Gaps = 9/445 (2%)
 Frame = +3

Query  639   T*KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG  818
             T +EL  + +L  AN +F KGA GG RA++ +YD+L+EE+CK G H  A+ I   ME+ G
Sbjct  119   TCEELFNAGYLNEANDLFMKGANGGFRASEHLYDILVEENCKTGKHGVAINILRSMESRG  178

Query  819   RMATTFHFNCLLSVQATCGIPEVAFATFENMEY----GEAYMKPDTETYNWVIQAYTRAE  986
             R+ATTFH+NCLL  Q     P++A  TFE M+Y         KPDTE++N +IQA TR +
Sbjct  179   RLATTFHYNCLLLAQGNANFPDIAEDTFEEMQYLRRESIPDTKPDTESFNLMIQAQTRCD  238

Query  987   SYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL-KNFEGGM  1163
             + +RV +V  L+G M E + +++PN RTY L+VEC+ K+  + EA+RHFRAL K F G +
Sbjct  239   NGERVHEVIVLIGHMTELYPQVKPNARTYALIVECYVKFNFMDEAMRHFRALTKLFPGSL  298

Query  1164  RLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSS  1343
              +LH +GK+GDPLSL +R+LC EGRIV+L+E L+ ML++   + PRAM ++RK RTLVSS
Sbjct  299   HVLHCDGKHGDPLSLLIRSLCLEGRIVQLVEVLDLMLQEGLKLTPRAMFMNRKGRTLVSS  358

Query  1344  WIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTP--LDPDAEGYIYSNPMET  1517
             WIEP+QEEA++G EID++ARY+AEGGLTG R+RW P   K P  + PD +GY +S P+E 
Sbjct  359   WIEPMQEEADIGCEIDFVARYIAEGGLTGTRRRWTPAARKDPNRILPDYDGYRFSPPVEK  418

Query  1518  SFKQRCLEEWRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKK-IVKGPEQKALKP  1691
             S+KQ C  + + Y RKL++ L+ EG   LG N  E +Y  + ERLKK  V+       KP
Sbjct  419   SYKQYCSIKRQEYKRKLIHLLQFEGVYALGENAREEEYTAILERLKKENVRKRLSDVRKP  478

Query  1692  KAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevd  1871
             KAASK+ V+E+KEELEAQ LPTDG R +LYQRVQKARRINL++G PLW+PP EE  EEVD
Sbjct  479   KAASKLSVAEMKEELEAQGLPTDGNRRLLYQRVQKARRINLAKGAPLWMPPEEETIEEVD  538

Query  1872  eeldelISRIKLHEGDTEFWKRRFL  1946
             EE + ++++I L     ++ ++ F+
Sbjct  539   EEFETVLAKIDLRNPRQQYRRKCFI  563


 Score =   107 bits (268),  Expect(2) = 7e-144, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = +2

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            +  EK LR  F+E LME AR  ++ GV  V+ +M   GL PGPRSFHGL+ ++    DVE
Sbjct  2    NAEEKELRFYFLESLMENARSGNIDGVEEVMSEMDVVGLKPGPRSFHGLVAAYAQANDVE  61

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            GA+ ALR+E++ G  PL ETFVA+ RL G  GL  R  +IL A+E
Sbjct  62   GALQALRKEIASGETPLQETFVAVARLLGRAGLRDRAEKILGAIE  106


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  2286  WIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIM  2465
             + PL + E   E+   K FD  +M  I ++WGWTWE++L+ +PP  W+++ EVEL I+++
Sbjct  660   YKPLTLEEKRAELAAMK-FDFREMDEIEEIWGWTWERDLQAQPPEIWTRKREVELSIQLL  718

Query  2466  SKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDL  2645
              KV+ LGG+PT+ DCA+++R A++ P P + + +++ +H  G+ FGS LY++ VM CL +
Sbjct  719   DKVLELGGSPTLSDCAMLVRNAMKLPWPESVVTLIRKSHKCGHKFGSKLYEDAVMSCLSV  778

Query  2646  EELDAAVAIVADLETSGIMVPDETLDRVI  2732
             +E DAA+AI+ D+E SG+  P+E L RV+
Sbjct  779   QENDAAIAILTDMEESGVSTPNELLGRVL  807



>ref|XP_002969250.1| hypothetical protein SELMODRAFT_170612 [Selaginella moellendorffii]
 gb|EFJ29338.1| hypothetical protein SELMODRAFT_170612 [Selaginella moellendorffii]
Length=810

 Score =   433 bits (1113),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 314/445 (71%), Gaps = 9/445 (2%)
 Frame = +3

Query  639   T*KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG  818
             T +EL  + +L  AN +F KGA GG RA++ +YD+L+EE+CK G H  A+ I   ME+ G
Sbjct  119   TCEELFNAGYLNEANDLFMKGANGGFRASEHLYDILVEENCKTGKHGVAINILRSMESRG  178

Query  819   RMATTFHFNCLLSVQATCGIPEVAFATFENMEY----GEAYMKPDTETYNWVIQAYTRAE  986
             R+ATTFH+NCLL  Q     P++A  TFE M+Y         KPDTE++N +IQA TR +
Sbjct  179   RLATTFHYNCLLLAQGNANFPDIAEDTFEEMQYLRRESIPDTKPDTESFNLMIQAQTRCD  238

Query  987   SYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL-KNFEGGM  1163
             + +RV +V  L+G M E + +++PN RTY L+VEC+ K+  + EA+RHFRAL K F G +
Sbjct  239   NGERVHEVIVLIGHMTELYPQVKPNARTYALIVECYVKFNFMDEAMRHFRALTKLFPGSL  298

Query  1164  RLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSS  1343
              +LH +GK+GDPLSL +R+LC EGRIV+L+E L+ ML++   + PRAM ++RK RTLVSS
Sbjct  299   HVLHCDGKHGDPLSLLIRSLCLEGRIVQLVEVLDLMLQEGLKLTPRAMFMNRKGRTLVSS  358

Query  1344  WIEPLQEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTP--LDPDAEGYIYSNPMET  1517
             WIEP+QEEA++G EID++ARY+AEGGLTG R+RW P   K P  + PD +GY +S P+E 
Sbjct  359   WIEPIQEEADIGCEIDFVARYIAEGGLTGTRRRWTPAARKDPNRILPDYDGYRFSPPVEK  418

Query  1518  SFKQRCLEEWRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKK-IVKGPEQKALKP  1691
             S+KQ C  + + Y RKL++ L+ EG   LG N  E +Y  + ERLKK  V+       KP
Sbjct  419   SYKQYCSIKRQEYKRKLIHLLQFEGVYALGENAREEEYTAILERLKKENVRKRLSDVRKP  478

Query  1692  KAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevd  1871
             KAASK+ V+E+KEELEAQ LPTDG R +LYQRVQKARRINL++G PLW+PP EE  EEVD
Sbjct  479   KAASKLSVAEMKEELEAQGLPTDGNRRLLYQRVQKARRINLAKGAPLWMPPEEETIEEVD  538

Query  1872  eeldelISRIKLHEGDTEFWKRRFL  1946
             EE + ++++I L     ++ ++ F+
Sbjct  539   EEFETVLAKIDLRNPRQQYRRKCFI  563


 Score =   107 bits (268),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = +2

Query  323  SGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE  502
            +  EK LR  F+E LME AR  ++ GV  V+ +M   GL PGPRSFHGL+ ++    DVE
Sbjct  2    NAEEKELRFYFLESLMENARSGNIDGVEEVMSEMDVVGLKPGPRSFHGLVAAYAQANDVE  61

Query  503  GAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            GA+ ALR+E++ G  PL ETFVA+ RL G  GL  R  +IL A+E
Sbjct  62   GALQALRKEIASGETPLQETFVAVARLLGRAGLRDRAEKILGAIE  106


 Score =   148 bits (373),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  2286  WIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIM  2465
             + PL + E   E+   K FD  +M  I ++WGWTWE++L+ +PP  W+++ EVEL I+++
Sbjct  660   YKPLTLEEKRAELAAMK-FDFREMDEIEEIWGWTWERDLQAQPPEIWTRKREVELSIQLL  718

Query  2466  SKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDL  2645
              KV+ LGG+PT+ DCA+++R A++ P P + + +++ +H  G+ FGS LY++ VM CL +
Sbjct  719   DKVLELGGSPTLSDCAMLVRNAMKLPWPESVVTLIRKSHKCGHKFGSKLYEDAVMSCLSV  778

Query  2646  EELDAAVAIVADLETSGIMVPDETLDRVI  2732
             +E DAA+AI+ D+E SG+  P+E L RV+
Sbjct  779   QENDAAIAILTDMEESGVSTPNELLGRVL  807



>ref|XP_001759689.1| predicted protein [Physcomitrella patens]
 gb|EDQ75601.1| predicted protein [Physcomitrella patens]
Length=803

 Score =   444 bits (1143),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 231/440 (53%), Positives = 314/440 (71%), Gaps = 5/440 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+ +++L+ AN+V+ +G +GGLR TD ++D ++E +   GDH+N +++   ME  GRM
Sbjct  111   EELLNNSYLQEANEVYIEGLEGGLRGTDVLFDRIVEANSIIGDHANCISVLRLMEYGGRM  170

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             +TTFH+NCLL  Q    +P++   TFE M+YG   MKPDTE+YNWV+Q+Y R +  DR Q
Sbjct  171   STTFHYNCLLRAQCMADVPDIIAMTFETMQYGRDEMKPDTESYNWVLQSYVRHKFGDRCQ  230

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE-  1181
             +V +LLG MVEDHKR+QPN RTY LLVECFSKY    EA+RHFRAL    G    L NE 
Sbjct  231   EVIDLLGEMVEDHKRVQPNQRTYALLVECFSKYDHFNEAVRHFRALVRNPGSTTFLFNEG  290

Query  1182  -GKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPL  1358
              G+  DPLSLY+R LC EGR  +L+E LE+M++DNQ +P RA++++++ RTLVSSWIEPL
Sbjct  291   HGRDTDPLSLYIRGLCLEGRAGDLVEVLESMVRDNQPLPARALLVNKRGRTLVSSWIEPL  350

Query  1359  QEEAELGYEIDYIARYVAEGGLTGERKRWVPRRGKTPLDPDAEGYIYSNPMETSFKQRCL  1538
             Q+E +LGY+IDY+AR++AEGG  G RKR+    G      D +G+ Y+ P+E S+K    
Sbjct  351   QQEPDLGYDIDYVARFLAEGGGDGTRKRFTDSVGGRFKAVDDDGFAYAAPLEVSYKSFLT  410

Query  1539  EEWRIYHRKLLNTLRNEGPAILG-NVSESDYLRVWERLKKIVKGPEQKAL-KPKAASKMI  1712
                + Y+ +LL  LR EG   LG   +E+D  RV ERLKK  +G     + KPKAASKM+
Sbjct  411   HMRKNYNLRLLRKLRLEGVRALGPGATEADLHRVIERLKKDTRGDVGYQIRKPKAASKML  470

Query  1713  VSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeeevdeeldel-  1889
             VSELK+ELEAQ LPT+GTR VLYQRVQKARRIN +RGRPLW+PP E+E +E  +E  ++ 
Sbjct  471   VSELKDELEAQGLPTEGTRPVLYQRVQKARRINKARGRPLWVPPTEDELDERHDEEIDMF  530

Query  1890  ISRIKLHEGDTEFWKRRFLG  1949
             + R+ L   ++EFW++RF+G
Sbjct  531   MERLTLKNENSEFWRKRFIG  550


 Score = 94.0 bits (232),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +2

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
            +F+E +ME+AR ADV GV   +  M  AGL  GPR+++GL V++  + D EGA+ AL++ 
Sbjct  1    MFLEAIMEKARKADVEGVEEALTGMSLAGLDAGPRAYYGLTVAYARSGDPEGAVQALKKA  60

Query  530  LSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            +  G+ PL E+ +A +RL+GS G   RG EILAAME L 
Sbjct  61   VQAGVNPLPESMLACVRLYGSTGQPQRGKEILAAMEKLN  99


 Score =   162 bits (409),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 119/192 (62%), Gaps = 9/192 (5%)
 Frame = +3

Query  2157  EVKTAKPLQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEALKEMRKRK  2336
             E    +P +M+ +QLLK+  +            +   D +  +W+ L + E +  M++R 
Sbjct  602   EEDVGEPPEMLAMQLLKNKKE--------EVPVVKEEDREGSEWLGLTLDEKITFMKERG  653

Query  2337  IFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAI  2516
             + D    YTIADVWGWTWE+E++++ P  WSQE EV+L IEIM KV ALGG PTI D  I
Sbjct  654   M-DESAFYTIADVWGWTWEQEIRDRVPEDWSQEKEVQLAIEIMLKVQALGGIPTINDMGI  712

Query  2517  ILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSG  2696
             ++RAA+R P P A + +LQ +H LGY FGS LY E V LCL L E DAA+ I++D+E  G
Sbjct  713   LVRAAMRTPWPEALVSLLQHSHKLGYAFGSKLYAEAVRLCLSLGEKDAAINIISDMEDMG  772

Query  2697  IMVPDETLDRVI  2732
             +  P + L  V+
Sbjct  773   VAAPPDLLTDVL  784



>emb|CDP21880.1| unnamed protein product, partial [Coffea canephora]
Length=359

 Score =   421 bits (1081),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 267/357 (75%), Positives = 296/357 (83%), Gaps = 9/357 (3%)
 Frame = +3

Query  1686  KPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeee  1865
             KPKAASKM+VSELKEELEAQDLPTDGTRNVLYQRVQKARRIN SRGRPLW+PPVEEEEEE
Sbjct  1     KPKAASKMLVSELKEELEAQDLPTDGTRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEE  60

Query  1866  vdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELPdvetvddvakdve  2045
             VDEELD+LISRIKL EG+TEFWKRRFLGEG NEN  + +E N  E+ DV    DV  DV 
Sbjct  61    VDEELDKLISRIKLEEGNTEFWKRRFLGEGLNENHIKSMEENSSEIIDVADEGDVVDDVA  120

Query  2046  ddeadeeeeeeeeeeeveveveqtetqaevGDRVKEKEVKTAKPLQMIGVQLLKDSDQTs  2225
              +  D+E ++EEEE E     E         D+VKEKEV+  KPLQMIGVQLLKDSDQT+
Sbjct  121   KENEDDEADDEEEEVEQSESQEVV-------DQVKEKEVEVVKPLQMIGVQLLKDSDQTT  173

Query  2226  sskksr--rrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYTIADVWGWTWEKE  2399
             SS +    + SR++  +DDDEDW PLDIHEA KEMR R++FDV DMYTIADVWGWTWEKE
Sbjct  174   SSSRKSRRKTSRVSVENDDDEDWFPLDIHEAFKEMRNRRVFDVSDMYTIADVWGWTWEKE  233

Query  2400  LKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQIT  2579
             LKNK PRRWSQEWEVEL ++IM+KVI LGGTPTIGDCA+ILRAAIRAPMPSAFLK+LQ T
Sbjct  234   LKNKAPRRWSQEWEVELAVKIMTKVIELGGTPTIGDCAMILRAAIRAPMPSAFLKMLQAT  293

Query  2580  HSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK  2750
             H+LGY FGSPLYDEI+ LCLDL ELDAAVAIVADLET+GI VPDETLDRVIS R  K
Sbjct  294   HNLGYFFGSPLYDEIISLCLDLGELDAAVAIVADLETTGIKVPDETLDRVISTRQMK  350



>ref|XP_009798511.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X2 [Nicotiana sylvestris]
Length=323

 Score =   278 bits (712),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIE+DCK GDHSNALTIAYEMEAAGRM
Sbjct  182   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEQDCKVGDHSNALTIAYEMEAAGRM  241

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  242   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDHMKPDTETYNWVIQAYTRAESYDRVQ  301

Query  1005  DVAELLGMMVEDHKRLQPN  1061
             DVAELLGMMVEDHKR+QPN
Sbjct  302   DVAELLGMMVEDHKRVQPN  320


 Score =   205 bits (521),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  137  LPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSS-PQRRTRKKKQQAPSQPKTAEDDDGGGA  313
            LPF  KFT  +P       P  +  +  +VSS P++  R+K+ Q         +DDG   
Sbjct  9    LPFNSKFTLPIP------RPSISRSIKASVSSQPRKTRRRKQTQQQQHQLKTAEDDGS--  60

Query  314  LMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNL  493
             MASGTEKVLRLVFMEELMERAR+AD  GVS VIYDMIAAGL PGPRSFHG +VSHVLN 
Sbjct  61   -MASGTEKVLRLVFMEELMERARNADSKGVSQVIYDMIAAGLSPGPRSFHGFVVSHVLNR  119

Query  494  DVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            D +GAMHALRRELSEGLRPLHETF+AL+RLFG+KGLATRGLEILAAME LK
Sbjct  120  DNDGAMHALRRELSEGLRPLHETFLALVRLFGAKGLATRGLEILAAMEKLK  170



>ref|XP_009600165.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X2 [Nicotiana tomentosiformis]
Length=322

 Score =   277 bits (709),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELVRSNHLE+ANKVF KGA+GGLRATD+IYDLLIE+DCK GDHSNALTIAYEMEAAGRM
Sbjct  181   EELVRSNHLEDANKVFLKGAEGGLRATDEIYDLLIEQDCKVGDHSNALTIAYEMEAAGRM  240

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             A+TFHFNCLLSVQATCGIPE+AFATFENMEYGE +MKPDTETYNWVIQAYTRAESYDRVQ
Sbjct  241   ASTFHFNCLLSVQATCGIPEIAFATFENMEYGEDHMKPDTETYNWVIQAYTRAESYDRVQ  300

Query  1005  DVAELLGMMVEDHKRLQPN  1061
             DVAELLGMMVEDHKR+QPN
Sbjct  301   DVAELLGMMVEDHKRVQPN  319


 Score =   206 bits (523),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = +2

Query  137  LPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGAL  316
            LPF  KFT  +P       P  +  +  +VSS  R+TR++KQ    Q     +DDG    
Sbjct  9    LPFNSKFTLPIP------RPSISRSIKASVSSQPRKTRRRKQTQQQQQLKTAEDDGS---  59

Query  317  MASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLD  496
            MASGTEKVLRLVFMEELMERAR+AD  GVS VIYDMIAAGL PGPRSFHG +VSHVLN D
Sbjct  60   MASGTEKVLRLVFMEELMERARNADSKGVSQVIYDMIAAGLSPGPRSFHGFVVSHVLNRD  119

Query  497  VEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             +GAMHALRRELSEGLRPLHETF+AL+RLFG+KGLATRGLEILAAME LK
Sbjct  120  NDGAMHALRRELSEGLRPLHETFLALVRLFGAKGLATRGLEILAAMEKLK  169



>gb|EPS65951.1| hypothetical protein M569_08824, partial [Genlisea aurea]
Length=326

 Score =   274 bits (700),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +EL+++ HLE+ANKVF KGA+GGLRATD +YDL+IEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  184   EELIKNGHLEDANKVFLKGAEGGLRATDYLYDLIIEEDCKVGDHSNALTIAYEMEAAGRM  243

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
             ATTFHFNCLLSVQATCGIPE+AFATFENMEYGE +MKPDTETYNWVIQAYTRA+SYDRVQ
Sbjct  244   ATTFHFNCLLSVQATCGIPEIAFATFENMEYGEDFMKPDTETYNWVIQAYTRADSYDRVQ  303

Query  1005  DVAELLGMMVEDHKRLQPNMRTY  1073
             DVAELLGMMVED+KRLQPN+RTY
Sbjct  304   DVAELLGMMVEDYKRLQPNVRTY  326


 Score =   186 bits (472),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  VVAVSSPQRRTRKKKQQA-PSQPKTAEDD---DGG-GALMASGTEKVLRLVFMEELMERA  379
              ++S+P+ R R+KK Q+ P + K+A+ D   DG  G+   S  EK+LRLVFM+ELM +A
Sbjct  24   CASLSAPRGRARRKKNQSQPGELKSADSDGYGDGNEGSFAPSSAEKLLRLVFMDELMVQA  83

Query  380  RDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHE  559
            R    +GVS VIYDMIAAGL PGPRSFHGL+VSHV+N D EGAMHALRRELSEGLRPLHE
Sbjct  84   RKGSSAGVSNVIYDMIAAGLTPGPRSFHGLVVSHVVNRDEEGAMHALRRELSEGLRPLHE  143

Query  560  TFVALIRLFGSKGLATRGLEILAAMENLK  646
            TFVA+IRLFGSKG +T G +ILAAME L 
Sbjct  144  TFVAVIRLFGSKGHSTWGSDILAAMEKLN  172



>tpg|DAA49766.1| TPA: hypothetical protein ZEAMMB73_347666 [Zea mays]
Length=327

 Score =   261 bits (667),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++++LE+AN VF KGAKGGLR TD IYDLLIEEDCKAGDHSNALT+AY+MEA GRM
Sbjct  183   EELVKNHYLEDANTVFLKGAKGGLRGTDDIYDLLIEEDCKAGDHSNALTVAYQMEAYGRM  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEY-GEAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVAFATFENMEY GE YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  243   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGGEDYMKPDTESYNWVIQAFTRATSYDRA  302

Query  1002  QDVAELLGMMVEDHKRLQPNMRTY  1073
              DVAELLGMMVEDHKR+QPN RTY
Sbjct  303   ADVAELLGMMVEDHKRIQPNARTY  326


 Score =   156 bits (395),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  332  EKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAM  511
            EK LRLVF+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFHGL+ +HVL  + EGAM
Sbjct  67   EKGLRLVFLEQLAERARAADATGVADTIYDMVAAGLSPGPRSFHGLVAAHVLAGNAEGAM  126

Query  512  HALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
             +LRRELS G+RPLHETFVAL+R+F  KGL+TRG+EILAAME  K
Sbjct  127  QSLRRELSSGVRPLHETFVALVRVFAKKGLSTRGMEILAAMERYK  171



>ref|XP_002467125.1| hypothetical protein SORBIDRAFT_01g020030 [Sorghum bicolor]
 gb|EER94123.1| hypothetical protein SORBIDRAFT_01g020030 [Sorghum bicolor]
Length=327

 Score =   264 bits (674),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             +ELV++++LE+AN VF KGAKGGLR TD+IYDLLIEEDCKAGDHSNALT+AY+MEA+GRM
Sbjct  183   EELVKNHYLEDANTVFLKGAKGGLRGTDEIYDLLIEEDCKAGDHSNALTVAYQMEASGRM  242

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEY-GEAYMKPDTETYNWVIQAYTRAESYDRV  1001
             ATTFHFNCLLSVQATCGIPEVAFATFENMEY GE YMKPDTE+YNWVIQA+TRA SYDR 
Sbjct  243   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGGEDYMKPDTESYNWVIQAFTRATSYDRA  302

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYV  1076
              DVAELLGMMVEDHKR+QPN RTY 
Sbjct  303   ADVAELLGMMVEDHKRIQPNARTYA  327


 Score =   137 bits (345),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = +2

Query  299  DGGGA-----LMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFH  463
            +GGGA       A   EK LRL F+E+L ERAR AD +GV+  IYDM+AAGL PGPRSFH
Sbjct  51   EGGGAGGDRSAAAGAVEKGLRLAFLEQLAERARAADAAGVADTIYDMVAAGLSPGPRSFH  110

Query  464  GLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENL  643
            GL+ +HVL  + EGAM +LRRELS G+RPLHETFVAL+R+F  KGL+TRG+EILAAME  
Sbjct  111  GLVAAHVLAGNAEGAMQSLRRELSSGVRPLHETFVALVRVFAKKGLSTRGMEILAAMERY  170

Query  644  K  646
            K
Sbjct  171  K  171



>ref|XP_003589452.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=271

 Score =   179 bits (455),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 115/163 (71%), Gaps = 16/163 (10%)
 Frame = +2

Query  158  TTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTAEDDDGGGALMASGTEK  337
            +T +P +     PRT G V  A+SSP++RTRKKKQ         +DDD       +  E 
Sbjct  9    STYIPFKLNRLTPRT-GPVRAALSSPEKRTRKKKQ--------VKDDD-------TLLEN  52

Query  338  VLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHA  517
             LR  FMEELM RAR+ D +GVS V+YDMIAAGL PGPRSFHGL+VS+ LN + + AM +
Sbjct  53   SLRFSFMEELMNRARNRDSTGVSQVMYDMIAAGLSPGPRSFHGLVVSYALNGNEQAAMDS  112

Query  518  LRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            LRREL  GLRP+HETFVAL+RLFGSKG +TRGLEIL AMENL 
Sbjct  113  LRRELGAGLRPIHETFVALVRLFGSKGHSTRGLEILGAMENLN  155


 Score =   179 bits (455),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  645  KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
            +ELVR+ HLE+ANKVF KGAKGGLRATD++YDLLIEEDCKAGDHSNAL I+YEMEAAGRM
Sbjct  167  EELVRNKHLEDANKVFLKGAKGGLRATDELYDLLIEEDCKAGDHSNALEISYEMEAAGRM  226

Query  825  ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEA  926
            ATTFHFNCLLSVQATCGIPE+AF TFENMEYGE 
Sbjct  227  ATTFHFNCLLSVQATCGIPEIAFTTFENMEYGEG  260



>emb|CAN82532.1| hypothetical protein VITISV_023135 [Vitis vinifera]
Length=298

 Score =   181 bits (458),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 122/179 (68%), Gaps = 16/179 (9%)
 Frame = +2

Query  116  MAALLT--QLPFKLKFTTTVPLRQRTFPPRTAGRVVVAVSSPQRRTRKKKQQAPSQPKTA  289
            M +LLT   LPFK  + T          PR    +  A+SSP++R R+KK+    QPK  
Sbjct  1    MXSLLTYAHLPFKSPYPTN---------PRRTLTLTSAISSPEKRPRRKKKT--KQPK--  47

Query  290  EDDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGL  469
             +D        S  EK LRL FMEELME AR AD +GVS V YDM+AAGL PGPRSFHGL
Sbjct  48   -EDSFVAVTAVSAGEKALRLTFMEELMEXARSADTAGVSEVFYDMVAAGLSPGPRSFHGL  106

Query  470  IVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLK  646
            IVS VLN D EGAM +LRRELS GLRPLHETFVALIRLFGSKG ATRGLEILAAME L 
Sbjct  107  IVSTVLNGDDEGAMQSLRRELSAGLRPLHETFVALIRLFGSKGYATRGLEILAAMEKLN  165


 Score =   143 bits (360),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 4/90 (4%)
 Frame = +3

Query  645  KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
            +ELVR NHLE+ANKVF KGAKGGLRAT+++YDLLIEEDCK GDHSNALTIAYEMEAAGRM
Sbjct  177  EELVRHNHLEDANKVFLKGAKGGLRATNELYDLLIEEDCKVGDHSNALTIAYEMEAAGRM  236

Query  825  ATTFHFNCLLSVQAT---CG-IPEVAFATF  902
            ATT+HFNCLLSVQ T   CG +P   F  F
Sbjct  237  ATTYHFNCLLSVQYTNDLCGKLPTKPFIDF  266



>ref|NP_001064783.1| Os10g0462800 [Oryza sativa Japonica Group]
 dbj|BAF26697.1| Os10g0462800, partial [Oryza sativa Japonica Group]
Length=216

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 4/210 (2%)
 Frame = +3

Query  2136  GDRVKEKEVKTAKP-LQMIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEA  2312
             GD  K+K  K  K  LQMIGVQLLKD ++TS S K  +R       DDDEDW P D  EA
Sbjct  2     GDETKDKPSKGPKQHLQMIGVQLLKDLEKTSVSSKKSKR---VPEIDDDEDWFPEDPIEA  58

Query  2313  LKEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGT  2492
              K MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGGT
Sbjct  59    FKVMRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIDLGGT  118

Query  2493  PTIGDCAIILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAI  2672
             PTIGDCAIILRAA+R P+PSAF+ ILQ THSLGY FGSPLYDE ++LCLDLEE+DAA+A+
Sbjct  119   PTIGDCAIILRAAMRVPLPSAFMTILQTTHSLGYKFGSPLYDEAILLCLDLEEIDAAIAV  178

Query  2673  VADLETSGIMVPDETLDRVISARNKK*QSS  2762
             VA++ET+GI VPDETLD+V++A+     S+
Sbjct  179   VAEMETNGIKVPDETLDKVLAAKQSGGNSA  208



>ref|XP_002467124.1| hypothetical protein SORBIDRAFT_01g020020 [Sorghum bicolor]
 gb|EER94122.1| hypothetical protein SORBIDRAFT_01g020020 [Sorghum bicolor]
Length=196

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  2184  MIGVQLLKDSDQTssskksrrrsrITAMddddedWIPLDIHEALKEMRKRKIFDVEDMYT  2363
             MIGVQLLKD ++T  S K  +R       DDDEDW P D  EA K MR+ ++FDV DMYT
Sbjct  1     MIGVQLLKDLEKTPVSSKKLKR---MPEIDDDEDWFPEDPIEAFKVMREERMFDVSDMYT  57

Query  2364  IADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAP  2543
              AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGGTPTIGDCAIILRAA+RAP
Sbjct  58    TADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIELGGTPTIGDCAIILRAAMRAP  117

Query  2544  MPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLD  2723
             +PSAF+ ILQ THSLGY FGSPLYDE+V+LCLDLEE+DAA+A+VA++ET G  VPDETLD
Sbjct  118   LPSAFIPILQTTHSLGYKFGSPLYDEVVLLCLDLEEIDAAIAVVAEMETCGFKVPDETLD  177

Query  2724  RVISARN  2744
             +V++++ 
Sbjct  178   KVLASKQ  184



>gb|KHN14796.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=190

 Score =   135 bits (341),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  645  KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
            +ELVR+ HLE+AN+VF KGAKGGL+ATD++YDLLI+EDCK GDHSNAL IAYEMEAAGRM
Sbjct  87   EELVRNMHLEDANEVFLKGAKGGLKATDEVYDLLIQEDCKVGDHSNALDIAYEMEAAGRM  146

Query  825  ATTFHFNCLLSVQAT  869
            ATTFHFNCLLSVQ T
Sbjct  147  ATTFHFNCLLSVQVT  161


 Score =   122 bits (305),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGL  601
            MIAAGL PGPRSFHGL+VSH LN D E AM +LRREL+ GLRP+HETF+ALIRLFGSKG 
Sbjct  1    MIAAGLSPGPRSFHGLVVSHALNGDEEAAMESLRRELAAGLRPVHETFLALIRLFGSKGR  60

Query  602  ATRGLEILAAMENLK  646
            ATRGLEILAAME L 
Sbjct  61   ATRGLEILAAMEKLN  75



>ref|XP_002862330.1| hypothetical protein ARALYDRAFT_920889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38588.1| hypothetical protein ARALYDRAFT_920889 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  2394  KELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTIGDCAIILRAAIRAPMPSAFLKILQ  2573
             K  KN+ PR+WSQEWEVEL I +M+KVI LGG PTIGDCA+ILRAA+RAPMPSAFLKILQ
Sbjct  3     KGFKNRTPRKWSQEWEVELAIVLMTKVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQ  62

Query  2574  ITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETSGIMVPDETLDRVISARNKK  2750
              THSLGY FGSPLYDEI+ LCLD+ ELDAA+AIVAD+ET+GI VPD+TLD+VISAR   
Sbjct  63    TTHSLGYSFGSPLYDEIITLCLDIGELDAAIAIVADMETTGITVPDQTLDKVISARQSN  121



>gb|ACU17497.1| unknown [Glycine max]
Length=213

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +3

Query  1509  METSFKQRCLEEWRIYHRKLLNTLRNEGPAILGN-VSESDYLRVWERLKKIVKGPEQKAL  1685
             METSFKQRCLEE +++++KLL TL+NEG A LG+ VSESDY+RV ERLKK++KGPEQ  L
Sbjct  1     METSFKQRCLEELKLHNKKLLKTLQNEGLAALGDGVSESDYIRVQERLKKLIKGPEQNVL  60

Query  1686  KPKAASKMIVSELKEELEAQDLPTDGTRNVLYQRVQKARRINLSRGRPLWIPPveeeeee  1865
             KPKAASKM+VSELKEEL+AQ LP DG RNVLYQRVQKARRIN SRGRPLW+PPVEEEEEE
Sbjct  61    KPKAASKMLVSELKEELDAQGLPIDGNRNVLYQRVQKARRINRSRGRPLWVPPVEEEEEE  120

Query  1866  vdeeldelISRIKLHEGDTEFWKRRFLGEGFNENDSQQLEVNDLELP  2006
             VDEELD LIS IKL EG+TEFWKRRFLGEG N +     +  + E+P
Sbjct  121   VDEELDALISHIKLEEGNTEFWKRRFLGEGLNGDQEMPTDAAESEVP  167



>tpg|DAA49765.1| TPA: hypothetical protein ZEAMMB73_987620, partial [Zea mays]
Length=94

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  2322  MRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKVIALGGTPTI  2501
             MR+ ++FDV DMYT AD WGWTWE+E+KNK PR+WSQEWEVEL I+IM KVI LGGTPTI
Sbjct  1     MREERMFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIELGGTPTI  60

Query  2502  GDCAIILRAAIRAPMPSAFLKILQITHSLGYVFG  2603
             GDCAIILRAA+RAP+PSAF+ ILQ THSLGY FG
Sbjct  61    GDCAIILRAAMRAPLPSAFIPILQTTHSLGYKFG  94



>ref|XP_004170609.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like 
[Cucumis sativus]
Length=104

 Score =   131 bits (330),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  2514  IILRAAIRAPMPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVAIVADLETS  2693
             +ILRAAI+AP+PSAFLKILQ TH LGYVFGSPLYDE++ LCLDL ELDAA+AIVADLET+
Sbjct  1     MILRAAIKAPLPSAFLKILQTTHGLGYVFGSPLYDEVITLCLDLGELDAAIAIVADLETT  60

Query  2694  GIMVPDETLDRVISAR  2741
             GI+V DETLDRVISAR
Sbjct  61    GILVHDETLDRVISAR  76



>ref|XP_010467961.1| PREDICTED: uncharacterized protein LOC104747954 [Camelina sativa]
Length=120

 Score = 87.4 bits (215),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 5/74 (7%)
 Frame = +2

Query  368  MERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRREL--SEG  541
            MER R+ D S V   IYD+IAAGL PGPRSFHGL+V+H LN D +GAMH+LR+EL   +G
Sbjct  1    MERPRNRDTSEV---IYDLIAAGLSPGPRSFHGLVVAHALNGDEQGAMHSLRKELGAGQG  57

Query  542  LRPLHETFVALIRL  583
             RPL ET +AL+ L
Sbjct  58   QRPLPETVIALVPL  71


 Score = 79.3 bits (194),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  645  KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDH  776
            +EL+R+NHLE+ANKVF KGA+GG+RATDQ++DL+IEEDCKA DH
Sbjct  73   EELMRTNHLEDANKVFLKGARGGMRATDQLFDLMIEEDCKAVDH  116



>ref|XP_010451874.1| PREDICTED: nuclear polyadenylated RNA-binding protein 3-like 
[Camelina sativa]
Length=271

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +3

Query  2139  DRVKEKEVKTAKPLQMIGVQLLKDSDQTssskk-srrrsrITAMddddedWIPLDIHEAL  2315
             D V  K  +  K LQMIGVQLLK+SD+ + +KK  +R SR+T  DD DEDW P D  EA 
Sbjct  153   DLVNNKAAEAKKHLQMIGVQLLKESDEANRTKKPGKRASRMTLEDDADEDWFPEDPFEAF  212

Query  2316  KEMRKRKIFDVEDMYTIADVWGWTWEKELKNKPPRRWSQEWEVELGIEIMSKV  2474
             KEMR+RK+FDV DMYTIADVWGWTWEK+ KNK PR+WSQEWEVEL I +M+K 
Sbjct  213   KEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTPRKWSQEWEVELAIVLMTKA  265



>gb|EEE51091.1| hypothetical protein OsJ_31796 [Oryza sativa Japonica Group]
Length=357

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAMENLK-GTCAKQPSGKCQ  682
            T+G+EILAAME  K G C +  + K +
Sbjct  121  TKGMEILAAMERYKYGICKEGRASKVK  147



>gb|AAM93720.1| putative stress inducible protein [Oryza sativa Japonica Group]
Length=380

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131



>gb|ABB47762.1| tetratricopeptide repeat, putative, expressed [Oryza sativa Japonica 
Group]
Length=381

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131



>gb|AAM93727.1| unknown protein [Oryza sativa Japonica Group]
Length=296

 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131



>gb|ABG66118.1| PsbP family protein, expressed [Oryza sativa Japonica Group]
Length=323

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PLH  FVAL+ +F    LA
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGVHPLHGNFVALVHVFAKNDLA  120

Query  605  TRGLEILAAME  637
            TR +EILA ME
Sbjct  121  TRCMEILATME  131



>gb|ABG66117.1| PsbP family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG92867.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01549.1| unnamed protein product [Oryza sativa Japonica Group]
Length=523

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +2

Query  359  EELMERARDADVSGVS----GVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGA-MHALR  523
            +EL E+ R  D S       G +  M+    YP    +    +      + + A M +LR
Sbjct  236  KELQEQVRSGDASATEYFELGAV--MLRRKFYPAAIKYLQQAIQKWDRDEQDLAQMQSLR  293

Query  524  RELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            RELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  294  RELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  331



>gb|ABG66119.1| PsbP family protein, expressed [Oryza sativa Japonica Group]
Length=536

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +2

Query  359  EELMERARDADVSGVS----GVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGA-MHALR  523
            +EL E+ R  D S       G +  M+    YP    +    +      + + A M +LR
Sbjct  235  KELQEQVRSGDASATEYFELGAV--MLRRKFYPAAIKYLQQAIQKWDRDEQDLAQMQSLR  292

Query  524  RELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            RELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  293  RELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  330



>ref|NP_001064776.1| Os10g0461100 [Oryza sativa Japonica Group]
 gb|ABG66116.1| PsbP family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF26690.1| Os10g0461100 [Oryza sativa Japonica Group]
Length=537

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL E FVAL+ +F    L 
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRENFVALVHVFAKNDLT  120

Query  605  TRGLEILAAME  637
            T+G+EILAAME
Sbjct  121  TKGMEILAAME  131


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 50/101 (50%), Gaps = 13/101 (13%)
 Frame = +2

Query  359  EELMERARDADVSGVS----GVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVE----GAMH  514
            +EL E+ R  D S       G +  M+    YP    +   +   +   D +      M 
Sbjct  236  KELQEQVRSGDASATEYFELGAV--MLRRKFYPAAIKY---LQQAIQKWDRDEQDLAQMQ  290

Query  515  ALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            +LRRELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  291  SLRRELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  331



>gb|EAY78810.1| hypothetical protein OsI_33913 [Oryza sativa Indica Group]
Length=159

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 52/79 (66%), Gaps = 4/79 (5%)
 Frame = +2

Query  425  IAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLA  604
            +AAG  PGPRSFHGL++S     + EGAM +LRRELS G+ PL   FVAL+ +F    LA
Sbjct  65   VAAGRSPGPRSFHGLVLSG----NAEGAMQSLRRELSSGMHPLRGNFVALVHVFAKNDLA  120

Query  605  TRGLEILAAMENLKGTCAK  661
            TR +EILA ME  K    K
Sbjct  121  TRCMEILATMERYKHNIRK  139



>gb|AAM93725.1| hypothetical protein [Oryza sativa Japonica Group]
Length=160

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 21/119 (18%)
 Frame = +2

Query  281  KTAEDDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSF  460
            + +E   G  + +A   EK  RL ++++  ERAR A  +GV+G +YDM+AA L P     
Sbjct  47   RRSEGGAGDRSAVAGVVEKGPRLAYLQQYEERARAAGFTGVAGTVYDMVAAMLSP-----  101

Query  461  HGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
                            M +LRRELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  102  ----------------MQSLRRELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  144



>gb|AAM93702.1| hypothetical protein [Oryza sativa Japonica Group]
Length=160

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 21/119 (18%)
 Frame = +2

Query  281  KTAEDDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSF  460
            + +E   G  + +A   EK  RL ++++  ERAR A  +GV+G +YDM+AA L P     
Sbjct  47   RRSEGGAGDRSAVAGVVEKGPRLAYLQQYEERARAAGFTGVAGTVYDMVAAMLSP-----  101

Query  461  HGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
                            M +LRRELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  102  ----------------MQSLRRELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  144



>gb|AAP54144.2| PsbP family protein, expressed [Oryza sativa Japonica Group]
Length=352

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 21/117 (18%)
 Frame = +2

Query  287  AEDDDGGGALMASGTEKVLRLVFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHG  466
            +E   G  + +A   EK  RL ++++  ERAR A  +GV+G +YDM+AA L P       
Sbjct  49   SEGGAGDRSAVAGVVEKGPRLAYLQQYEERARAAGFTGVAGTVYDMVAAMLSP-------  101

Query  467  LIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
                          M +LRRELS G+ PLH  FVAL+ +F    LATR +EILA ME
Sbjct  102  --------------MQSLRRELSSGVHPLHGNFVALVHVFAKNDLATRCMEILATME  144



>emb|CDP17054.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 74.3 bits (181),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 129/301 (43%), Gaps = 32/301 (11%)
 Frame = +3

Query  564   LWH*FVCLVQKVLLREA*KFWQQWKT*KELV-RSNHLENANKVFFKGAKGGLRATDQIYD  740
             LW    CL +++L R   +    + T  +      H++ A  +  +     +      Y 
Sbjct  310   LWDTARCLFKEMLFRGIDQDIYTYNTLLDAACNGGHVDAAFDIMSEMPAKNISPNQVTYS  369

Query  741   LLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENMEYG  920
              +I    K G    AL + +EM+ AG       +N LL++ A+ G  E A    E ME  
Sbjct  370   TIIRGCAKVGKLDRALNLFHEMKHAGMRLDRVSYNTLLAIYASLGRFEEALTVAEEME--  427

Query  921   EAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSK  1100
                +K D  TYN ++  + +   YD+V+   EL   M  D+  L PN+ TY  L+  +SK
Sbjct  428   SMGIKKDVVTYNALLDGFGKQGMYDKVK---ELFSRMKADN--LSPNLLTYSTLISVYSK  482

Query  1101  YCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEAML  1274
               + REAI+ ++  K           +G   D +  S  + ALC++G +      L+ M+
Sbjct  483   GGLYREAIQVYKEFK----------RQGVKADVVFYSKLIDALCKKGLVGSSALLLDEMM  532

Query  1275  KDNQTIPPRAMILSRKYRTLVSSWI------EPLQEEAELGYEIDYIARYVAEGGLTGER  1436
               N+ I P  +     Y ++++++        PLQ + +    +   A  VAE     E 
Sbjct  533   --NEGIQPNVV----TYNSIINAFGWSMPTEYPLQSDQQTESSLSIAAANVAESKPDAEN  586

Query  1437  K  1439
             K
Sbjct  587   K  587



>ref|XP_006383750.1| hypothetical protein POPTR_0005s26680g [Populus trichocarpa]
 gb|ERP61547.1| hypothetical protein POPTR_0005s26680g [Populus trichocarpa]
Length=446

 Score = 67.8 bits (164),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 85/181 (47%), Gaps = 13/181 (7%)
 Frame = +3

Query  675   NANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLL  854
             +A +VF      G++     Y ++I+  C+ G    A  +  EM  AG    +  FN L+
Sbjct  182   DAERVFGDMKMSGIKPNVDTYSIVIDSLCRCGQTKRAHDVFAEMLDAGCHPNSIIFNSLM  241

Query  855   SVQATCGIPEVAFATFENME-YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
              + A  G  E     +  M+ +G    +PD  TYN++++ + + E+    +DV  +L +M
Sbjct  242   RIHAEAGRTEKVLQLYNQMKRFG---CEPDMVTYNFLLETHCKDENR---EDVKRMLILM  295

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
             +E  K   PN  T+  L+ C +K+  V    R +  +K F+ G     N G Y   + ++
Sbjct  296   IE--KGCAPNASTFNTLIVCVAKFGNVNAVHRIYDIMKEFKYG----PNAGTYNTLMKMH  349

Query  1212  L  1214
             +
Sbjct  350   V  350


 Score = 22.7 bits (47),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 15/28 (54%), Gaps = 0/28 (0%)
 Frame = +2

Query  557  ETFVALIRLFGSKGLATRGLEILAAMEN  640
            ETF+ L+R +   GLA   +     ME+
Sbjct  115  ETFLILMRRYVRAGLAAEAIHAFNRMED  142



>emb|CDY29990.1| BnaC01g40180D [Brassica napus]
Length=42

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  2544  MPSAFLKILQITHSLGYVFGSPLYDEIVMLCLDLEELDAAVA  2669
             MPS  LKILQ THSL Y FGS L DEI+  CLDL ELDAA+A
Sbjct  1     MPSVLLKILQTTHSLAYSFGSLLCDEIITFCLDLGELDAAIA  42



>emb|CBI27486.3| unnamed protein product [Vitis vinifera]
Length=509

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 109/254 (43%), Gaps = 41/254 (16%)
 Frame = +3

Query  690   FFKG-AKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQA  866
             FFK     G++ +   Y+++I+  CK GD   A ++  +M+ AG       +N L+    
Sbjct  43    FFKDMGAAGIKRSVFTYNIMIDYLCKEGDLEMARSLFTQMKEAGFTPDIVTYNSLIDGHG  102

Query  867   TCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHK  1046
               G+ +     FE M+  +A   PD  TYN +I  + +   ++R+    E L  M  +  
Sbjct  103   KLGLLDECICIFEQMK--DADCDPDVITYNALINCFCK---FERMPKAFEFLHEMKANG-  156

Query  1047  RLQPNMRTYVLLVECFSKYCVVREAIRHFRALK----------------------NFEGG  1160
              L+PN+ TY   ++ F K  +++EAI+ F  ++                      N    
Sbjct  157   -LKPNVVTYSTFIDAFCKEGMLQEAIKFFVDMRRVALTPNEFTYTSLIDANCKAGNLAEA  215

Query  1161  MRLLHNEGKYGDPLSL-----YLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKY  1325
             ++L+    + G  L++      L  LC EGR+ E  E   AML  N  + P        Y
Sbjct  216   LKLVEEILQAGIKLNVVTYTALLDGLCEEGRMKEAEEVFRAML--NAGVAPN----QETY  269

Query  1326  RTLVSSWIEPLQEE  1367
               LV  +I+  + E
Sbjct  270   TALVHGFIKAKEME  283



>ref|XP_008389961.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Malus domestica]
Length=796

 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 98/202 (49%), Gaps = 16/202 (8%)
 Frame = +3

Query  675   NANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCL  851
             N ++ FFK   G G+  +   Y+++I   CK GD   A  +  +M+  G       +N L
Sbjct  278   NLSRKFFKDMLGAGINPSVFTYNIMIGYMCKEGDLDTASCLFAQMKRMGLTPDVVTYNSL  337

Query  852   LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
             +      G+ + +   FE M+  +A  +PDT T+N +I    +   +DR+      L  M
Sbjct  338   IDGYGKVGLLDDSVCIFEEMK--DADCEPDTITFNSLINCCCK---FDRMPQALNFLREM  392

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
               ++  L+PN+ TY  L++ F K  +++EA++ F  +K     + LL NE  Y    +  
Sbjct  393   --NNNGLKPNVITYSTLIDAFCKEGMMQEAVKIFMDMKR----VGLLPNEFTY----TSL  442

Query  1212  LRALCREGRIVELLEALEAMLK  1277
             + A C+ G + E L+    ML+
Sbjct  443   IDANCKXGNLSEALKLKSEMLQ  464



>ref|XP_006417966.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum]
 gb|ESQ36319.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum]
Length=895

 Score = 68.6 bits (166),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 100/207 (48%), Gaps = 27/207 (13%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG  ++ALT+  EM+  G       +N L+S+ A  G  E A    + M 
Sbjct  385   YSTVIDGYAKAGRFNDALTLFGEMKYLGIPLDRVSYNTLVSIYAKLGRFEEALDIVKEM-  443

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDV-AELLGMMVEDHKRLQPNMRTYVLLVEC  1091
                A ++ D  TYN ++  Y + E YD V+ V AE+        +R+ PN+ TY  L++ 
Sbjct  444   -AAAGIRKDAVTYNALLGGYGKHEKYDEVKSVFAEM------KQERVLPNLLTYSTLIDV  496

Query  1092  FSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALE  1265
             +SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  L+
Sbjct  497   YSKGGLYKEAMEIFREFKSV--GLR--------ADVVLYSALIDALCKNGLVESAVSLLD  546

Query  1266  AMLKDNQTIPPRAMILSRKYRTLVSSW  1346
              M K+   I P  +     Y +++ ++
Sbjct  547   EMTKEG--ISPNVVT----YNSMIDAF  567



>ref|XP_008221377.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Prunus mume]
Length=768

 Score = 68.2 bits (165),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 102/207 (49%), Gaps = 16/207 (8%)
 Frame = +3

Query  675   NANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCL  851
             N ++ FFK   G G+  +   Y+++I   CK GD   A  +  +M+  G       +N L
Sbjct  250   NFSRKFFKDMLGAGITPSVFTYNIMIGYLCKEGDLDTASCLFAQMKRMGLTPDIVTYNSL  309

Query  852   LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
             +      GI + +F  FE M+  +A  +PD  T+N +I    +   +D++ +    L  M
Sbjct  310   IDGYGKVGILDNSFCIFEEMK--DAGCEPDVITFNSLINCCCK---FDKMPEALNFLREM  364

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
               ++K L+PN+ TY  L++ F K  +++EA++ F  +K     + L  NE  Y    +  
Sbjct  365   --NNKGLKPNVITYSTLIDAFCKEGMMQEAVKIFMDMKR----VGLSPNEFTY----TSL  414

Query  1212  LRALCREGRIVELLEALEAMLKDNQTI  1292
             + A C+ G + E L+  + M ++  ++
Sbjct  415   IDANCKAGNLSEALKLKKEMFQEGISL  441



>ref|XP_002273398.2| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Vitis vinifera]
 ref|XP_010654720.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Vitis vinifera]
 ref|XP_010654723.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Vitis vinifera]
 ref|XP_010654728.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Vitis vinifera]
Length=755

 Score = 68.2 bits (165),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 109/254 (43%), Gaps = 41/254 (16%)
 Frame = +3

Query  690   FFKG-AKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQA  866
             FFK     G++ +   Y+++I+  CK GD   A ++  +M+ AG       +N L+    
Sbjct  242   FFKDMGAAGIKRSVFTYNIMIDYLCKEGDLEMARSLFTQMKEAGFTPDIVTYNSLIDGHG  301

Query  867   TCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHK  1046
               G+ +     FE M+  +A   PD  TYN +I  + +   ++R+    E L  M  +  
Sbjct  302   KLGLLDECICIFEQMK--DADCDPDVITYNALINCFCK---FERMPKAFEFLHEMKANG-  355

Query  1047  RLQPNMRTYVLLVECFSKYCVVREAIRHFRALK----------------------NFEGG  1160
              L+PN+ TY   ++ F K  +++EAI+ F  ++                      N    
Sbjct  356   -LKPNVVTYSTFIDAFCKEGMLQEAIKFFVDMRRVALTPNEFTYTSLIDANCKAGNLAEA  414

Query  1161  MRLLHNEGKYGDPLSL-----YLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKY  1325
             ++L+    + G  L++      L  LC EGR+ E  E   AML  N  + P        Y
Sbjct  415   LKLVEEILQAGIKLNVVTYTALLDGLCEEGRMKEAEEVFRAML--NAGVAPN----QETY  468

Query  1326  RTLVSSWIEPLQEE  1367
               LV  +I+  + E
Sbjct  469   TALVHGFIKAKEME  482



>gb|EPS67318.1| hypothetical protein M569_07454, partial [Genlisea aurea]
Length=375

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 68/143 (48%), Gaps = 7/143 (5%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R+ +L  A ++F +    G       Y ++++  CKAG    A+ I +EME+ G + T+F
Sbjct  107   RAPNLPKAREIFREMVNSGCSPDIVTYGIMVDVLCKAGRTDEAIEIIHEMESVGCLPTSF  166

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              +  L+         E A  TF  ME     +KPD   YN +I A+ + E +     V +
Sbjct  167   IYTALIHAYGIQNRIEDAIDTFFRMERN--LVKPDVAVYNALISAFCKVEKFRNAYKVID  224

Query  1017  LLGMMVEDHKRLQPNMRTYVLLV  1085
              +       KR+ PN RT+ +L+
Sbjct  225   EM-----HRKRVSPNSRTFNILI  242



>ref|XP_002963827.1| hypothetical protein SELMODRAFT_79421 [Selaginella moellendorffii]
 gb|EFJ35698.1| hypothetical protein SELMODRAFT_79421 [Selaginella moellendorffii]
Length=616

 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 91/209 (44%), Gaps = 17/209 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             LV+S H     KV+      G       + +LI  +CKAG    AL     ++       
Sbjct  37    LVKSGHHFRTGKVYKDLLHSGCSPNLVTFKILIRGNCKAGQAMRALEFLRALDEFSVAPD  96

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              + FN L+      G P+ A   FENME   + +KP+  TYN VI    ++ + ++ +  
Sbjct  97    VYIFNVLIHGLFKDGNPDQAVKLFENME--SSRVKPEIVTYNTVISGLCKSGNLEKAR--  152

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              ELL  M+    +  P++ TY  L+  F +   +REA      +K            G  
Sbjct  153   -ELLEEMIRKGGKSAPDIVTYNTLINAFYRASRIREACAFREKMK----------AAGIN  201

Query  1191  GDPLS--LYLRALCREGRIVELLEALEAM  1271
              D L+  + +  +C++G + E LE L+ M
Sbjct  202   PDVLTCNILVSGICKDGDVEEALEILDGM  230



>ref|XP_008646443.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Zea mays]
 gb|AFW74127.1| hypothetical protein ZEAMMB73_460696 [Zea mays]
Length=581

 Score = 66.2 bits (160),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 96/207 (46%), Gaps = 15/207 (7%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R+     A +VF + A+ GL AT  +Y+ ++    KAGD + A  I   M+AAG    
Sbjct  153   LARARMTATARRVFDEMARAGLAATTHVYNAMLHVCLKAGDAAQAEAIVTRMDAAGVTLD  212

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F +N ++++    G+   A    + M+  +  ++PDT T+N  I    +     RV++ 
Sbjct  213   RFSYNTVIALYCRKGMGYEAMCARDRMD--KEGIRPDTVTWNSSIHGLCKE---GRVKEA  267

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
             A+L   MV    +  P+  TY  L++ + +   V EA++    L+       +L     Y
Sbjct  268   AQLFTEMVA--AQATPDNVTYTTLIDGYCRAGNVEEAVK----LRGRMEAAGMLPGVATY  321

Query  1191  GDPLSLYLRALCREGRIVELLEALEAM  1271
                 +  LR LC +G + E+   L  M
Sbjct  322   ----NAILRKLCEDGNMKEVHRLLHEM  344



>gb|KFK42931.1| hypothetical protein AALP_AA1G057100 [Arabis alpina]
Length=871

 Score = 66.6 bits (161),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 98/206 (48%), Gaps = 25/206 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG  ++AL++  EM+  G       +N LLS+ A  G  E A    + M 
Sbjct  361   YSTVIDGYAKAGRFNDALSLFGEMKYLGIPLDRVSYNTLLSIFAKLGKFEEALDIVKEM-  419

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                A ++ D  TYN ++  Y +   YD V+ V      M ++H  + PN+ TY  L++ +
Sbjct  420   -ASAGIRKDAVTYNALLGGYGKQGRYDEVKSV---FAEMKQEH--VLPNLLTYSTLIDVY  473

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  L+ 
Sbjct  474   SKGGLYKEAMEIFREFKSV--GLR--------ADVVLYSALIDALCKNGLVESAVSLLDE  523

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSW  1346
             M K+   I P  +     Y +++ S+
Sbjct  524   MTKEG--ISPNVVT----YNSMIDSF  543



>ref|XP_006470947.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150-like [Citrus sinensis]
Length=1236

 Score = 66.6 bits (161),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 98/206 (48%), Gaps = 16/206 (8%)
 Frame = +3

Query  675   NANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCL  851
             N +  FF+   G G+  +   ++++I+  CK GD   A +  + M+  G M     +N L
Sbjct  252   NLSIKFFRDMVGAGIAPSVFTFNIMIDYMCKEGDMDTARSFFHNMKQRGLMPDIVTYNTL  311

Query  852   LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
             +      G+ + +   FE M+  +A  KPD  TYN +I  + +   ++R+    E    M
Sbjct  312   IDGYGKIGLLDESLCIFEEMK--DAGCKPDVITYNALINCFCK---FERMHRAFEFFREM  366

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
                +  L+PN+ TY  L++   K  ++++AI+ F  ++     + L  NE  +    +  
Sbjct  367   --RNNELKPNVVTYSTLIDALCKEGMIQQAIKFFVDMRR----VGLKPNEFTF----TSL  416

Query  1212  LRALCREGRIVELLEALEAMLKDNQT  1289
             + A C+ G + E L+    ML++  T
Sbjct  417   IDAKCKIGNLDEALKLANEMLQEADT  442



>ref|XP_010918547.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Elaeis guineensis]
 ref|XP_010918548.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Elaeis guineensis]
 ref|XP_010918549.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Elaeis guineensis]
 ref|XP_010918550.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Elaeis guineensis]
 ref|XP_010918552.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Elaeis guineensis]
Length=811

 Score = 55.1 bits (131),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 102/229 (45%), Gaps = 35/229 (15%)
 Frame = +3

Query  687   VFFKGAK-GGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             V+FK  K  GL     +Y++ I+  CK G+ ++A+ +  EM+  G +    HF  L++  
Sbjct  378   VYFKRFKDSGLYLDKILYNIAIDVHCKLGNMNDAVQLFQEMKCQGLIPDRIHFTNLINGY  437

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G    A   F +M   ++ ++PD  TYN +   + R      V++  +LL  M++  
Sbjct  438   CRKGEMYNAHKVFTDMV--KSNVEPDLVTYNILSTGFCRN---GLVKEAFDLLKYMLD--  490

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE---------GKYGD  1196
             + ++P+  TY +++    +   ++EA   F++L+  E G RL+            G   +
Sbjct  491   RGIEPDAITYSMIIVSLCRGGKLKEATVLFKSLEGREIGQRLVLFSTMVCGYLECGSTKE  550

Query  1197  PLSLYLRA------------------LCREGRIVELLEALEAMLKDNQT  1289
               +L++R                   LCREG +       E MLK + T
Sbjct  551   AYALFIRVSKQGHLVDEIACSKLISELCREGDVERASMVFELMLKMDVT  599


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/80 (23%), Positives = 35/80 (44%), Gaps = 0/80 (0%)
 Frame = +2

Query  377  ARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLH  556
             R+  +     V+ DM    + P   S+  LI  +  + ++   +      +S+G+RP H
Sbjct  298  CREVKLQEAEKVLEDMARQNVLPDMFSYKCLIRGYCASNNLLRVLDLYEEMISKGIRPDH  357

Query  557  ETFVALIRLFGSKGLATRGL  616
                 L++ F   G+A+  L
Sbjct  358  VIVSLLLQCFCKVGMASEAL  377



>ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Fragaria vesca subsp. vesca]
Length=589

 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 95/214 (44%), Gaps = 21/214 (10%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
              LV+   +    KV+ K  KGG+      Y++LI   CK+GD   A  +  EME      
Sbjct  173   SLVKDRLISMVWKVYKKMIKGGVVPNIHTYNVLIHACCKSGDIEKAEGLVSEMELRCVFP  232

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
               F FN L+S+ +  G+   A      ME   A + PD  TYN ++  + R     R+ +
Sbjct  233   DLFTFNTLISLYSKTGMHYEALCVQSRMEL--AGVSPDMVTYNSLMYGFCRE---GRMTE  287

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
               +L      D K   PN  TY  L++ + +   + EA+R    +K          ++G 
Sbjct  288   AVKLF----RDIKGCVPNHITYTTLIDGYCRVNDLEEALRLCEVMK----------SKGL  333

Query  1188  YGDPLSL--YLRALCREGRIVELLEALEAMLKDN  1283
             Y   ++    LR LC+EGR+ +  + L  M + N
Sbjct  334   YPGVVTYNSILRKLCQEGRMRDANKLLNEMSEKN  367



>ref|XP_002444001.1| hypothetical protein SORBIDRAFT_07g005650 [Sorghum bicolor]
 gb|EES13496.1| hypothetical protein SORBIDRAFT_07g005650 [Sorghum bicolor]
Length=824

 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 79/154 (51%), Gaps = 8/154 (5%)
 Frame = +3

Query  687   VFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             V+F+  +  GL     +Y++ ++  CK G+ + A+ +  EM A G +    H+ CL++  
Sbjct  390   VYFQKFRDLGLHLDGVLYNITMDAYCKLGNMNEAVKLLNEMMAGGLVPDKIHYTCLINGY  449

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G  E A+  FE M   +A +KPD  TYN +   Y+R  +  +V D   LL  MV+  
Sbjct  450   CLKGETENAWQVFEQML--KANIKPDVVTYNILASGYSRNGAVIKVYD---LLEHMVD--  502

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
             + L+PN  TY + + CF +   + EA   F  L+
Sbjct  503   QGLEPNSLTYGVAIACFCREGNLSEAEVLFNILE  536



>ref|XP_007224618.1| hypothetical protein PRUPE_ppa026847mg [Prunus persica]
 gb|EMJ25817.1| hypothetical protein PRUPE_ppa026847mg [Prunus persica]
Length=628

 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 99/203 (49%), Gaps = 16/203 (8%)
 Frame = +3

Query  675   NANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCL  851
             N ++ FFK   G G+  +   Y+++I   CK GD   A  +  +M+  G       +N L
Sbjct  91    NFSRKFFKDMLGAGITPSVFTYNIMIGYMCKEGDLDTASCLFAQMKRMGLTPDIVTYNSL  150

Query  852   LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
             +      G  + +F  FE M+  +A  +PD  T+N +I    +   +D++ +    L  M
Sbjct  151   IDGYGKVGTLDNSFCIFEEMK--DAGCEPDVITFNSLINCCCK---FDKMPEALNFLREM  205

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
               ++K L+PN+ TY  L++ F K  +++EA++ F  +K     + L  NE  Y    +  
Sbjct  206   --NNKGLKPNVITYSTLIDAFCKEGMMQEAVKIFMDMKR----VGLSPNEFTY----TSL  255

Query  1212  LRALCREGRIVELLEALEAMLKD  1280
             + A C+ G + E L+  + M ++
Sbjct  256   IDANCKAGNLSEALKLKKEMFQE  278



>ref|XP_006838158.1| hypothetical protein AMTR_s00106p00105070 [Amborella trichopoda]
 gb|ERN00727.1| hypothetical protein AMTR_s00106p00105070 [Amborella trichopoda]
Length=757

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 107/252 (42%), Gaps = 44/252 (17%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
             +L +S+  + + K+F       +  T   Y+++I+  CK GD   A  +  +M+  G   
Sbjct  230   KLSKSSRGDMSRKIFVDMIAARITPTVFTYNIVIDVMCKEGDLRTARAMLLQMKEMGCSP  289

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                 +N L++     G  ++  AT    E  E  +KPD  TYN +I  + +   Y+ +  
Sbjct  290   DIVTYNTLINGYGKLG--QLVEATHAFSELKEVGIKPDAITYNALIDCHCK---YNELCK  344

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                  G M  +   ++PN+ T+  L++   K  ++REAI+ F  ++ F     LL NE  
Sbjct  345   AFGFFGEMRRNG--VKPNVVTFSTLIDALCKEGMMREAIKFFVDMRVF----GLLPNEFT  398

Query  1188  YGDPLSLYLRA-------------------------------LCREGRIVELLEALEAML  1274
             Y   +  Y +A                               LC+EG+++E  E   AML
Sbjct  399   YTCLIDGYCKAGNLFEALKLVDEMVLVGLNLNVVTYAALVDRLCKEGKVLEAEEVFRAML  458

Query  1275  KDNQTIPPRAMI  1310
             K N  + P  +I
Sbjct  459   KSN--VAPNCLI  468



>ref|XP_010533956.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Tarenaya hassleriana]
Length=886

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   K G    AL +  EM   G       +N LLSV A  G  E A    + ME
Sbjct  364   YSTVIDGYAKVGRFDEALNLVGEMRFLGIALDRVSYNTLLSVYAKLGKFEEALDVLKEME  423

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
             +    ++ D  TYN ++  Y +   YD+V++  E +       + L PN+ TY  L++ +
Sbjct  424   F--VGIRKDVVTYNALLGGYGKQGEYDKVKNAFEEM-----KWEGLSPNLLTYSTLIDVY  476

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+           G   D +  S  + ALC+ G +   +  L+ 
Sbjct  477   SKGGLYKEAMEVFREFKSV----------GLKADVVLYSALIDALCKNGLVESAVSLLDE  526

Query  1269  MLKD  1280
             M K+
Sbjct  527   MTKE  530



>ref|XP_010087216.1| hypothetical protein L484_009725 [Morus notabilis]
 gb|EXB28566.1| hypothetical protein L484_009725 [Morus notabilis]
Length=871

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 103/221 (47%), Gaps = 27/221 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL +  EM+          +N LLS+ A  G  E A    + ME
Sbjct  369   YSTMIDGYAKAGRLEDALNLFNEMKYLAIGLDRVLYNTLLSIYAKLGRFEEALKVCKEME  428

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + +  D  +YN ++  Y +   YD V+ + +    M  DH  + PN+ TY  L++ +
Sbjct  429   --SSGIVRDVVSYNALLGGYGKQGKYDEVKRMYQ---DMKADH--VSPNLLTYSTLIDVY  481

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  + REA+  FR  K  + G++   +L++E          + ALC+ G +   +  L+
Sbjct  482   SKGGLYREAMEVFREFK--QAGLKADVVLYSE---------LINALCKNGMVESAVSLLD  530

Query  1266  AMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEI  1388
              M K+   I P  +     Y +++ ++  P   ++ LG  I
Sbjct  531   EMTKEG--IMPNVIT----YNSIIDAFGRPATADSALGAAI  565



>ref|XP_010259252.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Nelumbo nucifera]
Length=867

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 95/218 (44%), Gaps = 23/218 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM+  G       +N LLS+ A  G  E A      ME
Sbjct  361   YSTMIDGYAKAGKLEEALNLFNEMKFVGIGLDRVSYNTLLSIYAKLGRFEEALGICREME  420

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + +K D  TYN ++  Y +   YD+V++V E +       + + PN+ TY  L++ +
Sbjct  421   --GSGIKKDAVTYNALLGGYGKQGKYDKVKEVFEEM-----KAENVTPNVLTYSTLIDAY  473

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY---LRALCREGRIVELLEALE  1265
             SK  + ++A+  FR  K           +GK    + LY   +  LC+ G +   +  L+
Sbjct  474   SKGGMHKDAMDIFREFK-----------QGKLKADVVLYSALIDTLCKNGLVESAVGLLD  522

Query  1266  AMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELG  1379
              M +    I P  +  +        S     QE+A+ G
Sbjct  523   EMTRGG--IQPNVVTYNSIIDAFGRSATGQFQEDADDG  558



>gb|KFK31216.1| hypothetical protein AALP_AA6G083500 [Arabis alpina]
Length=859

 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 85/193 (44%), Gaps = 21/193 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A   F  M 
Sbjct  354   YSTVIDGFAKAGRFDEALNLFDEMRYLGIALDRVSYNTLLSIYTKLGRSEEALDVFREM-  412

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V++V      M  +H  + PN+ TY  L++ +
Sbjct  413   -ASVGIKKDVVTYNALLGGYGKQRKYDEVKNV---FAEMKREH--VSPNLLTYSTLIDVY  466

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K    G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  467   SKGGLYKEAMEIFREFKRV--GLR--------ADVVLYSALIDALCKNGLVGSAVTLIDE  516

Query  1269  MLKDNQTIPPRAM  1307
             M K+   I P  +
Sbjct  517   MTKEG--ISPNVV  527



>ref|XP_001771925.1| predicted protein [Physcomitrella patens]
 gb|EDQ63186.1| predicted protein [Physcomitrella patens]
Length=831

 Score = 49.7 bits (117),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/233 (21%), Positives = 95/233 (41%), Gaps = 20/233 (9%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R   +E A + F +         D IY+ +I   CKAG+   A  I   ME  G  AT  
Sbjct  274   RLGDVEAAERWFQRALSENWHHNDVIYNNIIHAYCKAGNMERAEAIMTAMEEQGLEATLG  333

Query  837   HFNCLLSVQATCGIPEVAFATFENMEY-GEAYMKPDTETYNWVIQAYTRAESYDRVQDVA  1013
              +N L+     C   +     F  ++   E  + P   +Y  +I  Y++    D+   ++
Sbjct  334   LYNMLMDGYVHCRAVDKCLNVFRRLKARTETGLSPTVVSYGCLINLYSKLGKMDKALQIS  393

Query  1014  ELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYG  1193
               +     + + ++ N +TY ++++ + +      A   F  + N   G++        G
Sbjct  394   NEM-----EDQGIKHNRKTYSMIIDGYVQLGDTANAFSVFEDMSN--AGIK------PDG  440

Query  1194  DPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWIE  1352
                ++ + A C+ G++   LE L  M  ++   PP      R Y  ++  +++
Sbjct  441   ITYNILMNAFCKNGQMNRALELLARM--ESGDCPPTL----RTYTIIIDGFMK  487


 Score = 34.7 bits (78),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKG  598
            M AAG+ P   S+  LI ++ +  D+ GA+  +    +EG+ P   T+  +I  +G  G
Sbjct  218  MRAAGIEPNVHSYTNLIHAYAVAQDLRGAIACVEEMEAEGVSPNAATYSVIISGYGRLG  276



>ref|XP_006420675.1| hypothetical protein CICLE_v10004591mg [Citrus clementina]
 gb|ESR33915.1| hypothetical protein CICLE_v10004591mg [Citrus clementina]
Length=599

 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 98/206 (48%), Gaps = 16/206 (8%)
 Frame = +3

Query  675   NANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCL  851
             N +  FF+   G G+  +   ++++I+  CK GD   A +  + M+  G M     +N L
Sbjct  93    NLSIKFFRDMVGAGIAPSVFTFNIMIDYMCKEGDMDTARSFFHNMKQRGLMPDIVTYNTL  152

Query  852   LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMM  1031
             +      G+ + +   FE M+  +A  KPD  TYN +I  + +   ++R+    E    M
Sbjct  153   IDGYGKIGLLDESLCIFEEMK--DAGCKPDVITYNALINCFCK---FERMHRAFEFFREM  207

Query  1032  VEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLY  1211
                +  L+PN+ TY  L++   K  ++++AI+ F  ++     + L  NE  +    +  
Sbjct  208   --RNNELKPNVVTYSTLIDALCKEGMIQQAIKFFVDMRR----VGLKPNEFTF----TSL  257

Query  1212  LRALCREGRIVELLEALEAMLKDNQT  1289
             + A C+ G + E L+    ML++  T
Sbjct  258   IDAKCKIGNLDEALKLANEMLQEADT  283



>ref|XP_011079534.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Sesamum indicum]
Length=856

 Score = 64.3 bits (155),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 86/182 (47%), Gaps = 19/182 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I    K+G    AL +  EM+ AG       +N LL++ A+ G  + AFA  + ME
Sbjct  362   YSTMIRGCAKSGRLDRALNLFNEMKFAGIKLDRVSYNTLLAIYASLGRFDEAFAVGKEME  421

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  + +   YD+V+   EL   M ++H  L PN+ TY  L+  +
Sbjct  422   --SIGIKKDVVTYNALLDGFGKQGMYDKVK---ELFAEMKKEH--LSPNLLTYSTLISVY  474

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  +R  K            G   D +  S  + ALC++G +      L+ 
Sbjct  475   SKGGLYKEAMEVYREFK----------RHGLKADVVFYSKLIDALCKKGLVESSAFLLDE  524

Query  1269  ML  1274
             M+
Sbjct  525   MM  526



>ref|XP_008466646.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466653.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466660.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466666.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466674.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466680.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
 ref|XP_008466686.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Cucumis melo]
Length=787

 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 110/262 (42%), Gaps = 42/262 (16%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +S + +   K F      G+  +   Y+++I+  CK GD  NA  +  +M   G    
Sbjct  265   LSKSGNGQLVRKFFNDMIGAGIAPSVFTYNVMIDYLCKEGDLENARRLFVQMREMGLSPD  324

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD-  1007
                +N L+      G  E A + F  M+  +    PD  TYN +I  Y + E   R  + 
Sbjct  325   VVTYNSLIDGYGKVGSLEEAVSFFNEMK--DVGCVPDIITYNGLINCYCKFEKMPRAFEY  382

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK--------------  1145
              +E+       +  L+PN+ TY  L++ F K  +++ A++ F  +K              
Sbjct  383   FSEM------KNNGLKPNVVTYSTLIDAFCKEGMMQGAVKLFVDMKRAGLLPNEFTYTSL  436

Query  1146  --------NFEGGMRLLHNEGKYGDPLSLY-----LRALCREGRIVELLEALEAMLKDNQ  1286
                     N     +LL++  + G  L++      +  LC +GR++E  E   +MLKD  
Sbjct  437   IDANCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALVDGLCEDGRMIEAEEVFRSMLKDG-  495

Query  1287  TIPPRAMILSRKYRTLVSSWIE  1352
              I P   +    Y  LV  +I+
Sbjct  496   -ISPNQQV----YTALVHGYIK  512



>ref|XP_002515260.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF47244.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=878

 Score = 63.9 bits (154),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 86/184 (47%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   K G   +AL +  EM+  G       +N LLSV A  G  E A    + ME
Sbjct  369   YSTMIDGYAKVGRLDDALNMFNEMKFLGVGLDRVSYNTLLSVYAKLGRFEQALDVCKEME  428

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                A ++ D  TYN ++  Y +   YD V+ V E +        R+ PN+ TY  L++ +
Sbjct  429   --NAGIRKDVVTYNALLAGYGKQYRYDEVRRVFEEM-----KRGRVSPNLLTYSTLIDVY  481

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K  + G++         D +  S  + ALC+ G +   +  L+ 
Sbjct  482   SKGGLYKEAMEVFREFK--QAGLK--------ADVVLYSALIDALCKNGLVESSVTLLDE  531

Query  1269  MLKD  1280
             M K+
Sbjct  532   MTKE  535



>gb|EAY94432.1| hypothetical protein OsI_16202 [Oryza sativa Indica Group]
 gb|EAZ30997.1| hypothetical protein OsJ_15079 [Oryza sativa Japonica Group]
Length=485

 Score = 61.2 bits (147),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/198 (24%), Positives = 80/198 (40%), Gaps = 36/198 (18%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   +E+A  VF K    G++    ++ +LI+  CK GD    L +  EM   G    
Sbjct  196   LCRVGRIEDARGVFEKMCGRGMKPNAVVFTILIDAHCKKGDAETMLELHREMRERGVRPD  255

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYD-----  995
                +N +  V   C   ++  A+   +E   A ++PDT TY  +I  Y + E  D     
Sbjct  256   AVTYNAI--VNGLCRARDLKSASGIVVEMRSAGLRPDTVTYTTLIDGYCKEEELDMAMEI  313

Query  996   ---------------------------RVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                                        R  D   +LG M+E    L+P+  TY ++++ F
Sbjct  314   KQNMVAEGVGLDEVTYTALISGLSKAGRSADAERVLGEMME--AGLEPDNTTYTMVIDAF  371

Query  1095  SKYCVVREAIRHFRALKN  1148
              +   V+  +R  + ++N
Sbjct  372   CRKGDVKTGLRLLKEMQN  389


 Score = 22.3 bits (46),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (47%), Gaps = 3/77 (4%)
 Frame = +2

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
            V M +L+   R  +++    V  +M + G+     SF+ +I       D++GA    RR 
Sbjct  121  VLMRDLV---RLGELASAQNVFDEMQSRGVRRTVVSFNTMISGMCRAGDLDGAETLHRRM  177

Query  530  LSEGLRPLHETFVALIR  580
               G+ P   T+ ALI+
Sbjct  178  SEAGVTPDVYTYGALIQ  194



>ref|XP_010528449.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Tarenaya hassleriana]
Length=604

 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 21/202 (10%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
              LV+    +   K+F K  K G+ A   +Y++L+    +AGD   A  +  EME  G   
Sbjct  177   SLVKERSTDTVWKIFKKMVKSGVVANIHLYNVLVHACAEAGDVEKAEKLLSEMEEKGVFP  236

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
               F +N L+ +    G+   A +  + ME   + + PD  TYN +I  + R     R+++
Sbjct  237   DLFTYNTLIVLYCKKGMHYEALSVQDRME--RSGIAPDIVTYNSLIHGFCRE---GRMRE  291

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL--KNFEGGMRLLHNE  1181
                L      + K + PN  TY  L++ + +   + EA+R    +  K F  G+ + +N 
Sbjct  292   AVRLF----REIKGIVPNHVTYTTLIDGYCRVNDMDEALRLHEVMEGKGFSPGI-VSYNS  346

Query  1182  GKYGDPLSLYLRALCREGRIVE  1247
                       LR LC +GRI E
Sbjct  347   ---------ILRKLCEDGRIRE  359



>ref|XP_006410275.1| hypothetical protein EUTSA_v10016219mg [Eutrema salsugineum]
 gb|ESQ51728.1| hypothetical protein EUTSA_v10016219mg [Eutrema salsugineum]
Length=885

 Score = 63.9 bits (154),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  +M+  G       +N LLS+  T G  + A      M 
Sbjct  380   YSTVIDGFAKAGRFDEALNLFDQMKYLGIALDRVSYNTLLSIYTTLGRSKEALDILREM-  438

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V++V      M  DH  + PN+ TY  L++ +
Sbjct  439   -ASVGIKKDVVTYNALLGGYGKQRKYDEVKNV---FAEMKRDH--VLPNLLTYSTLIDVY  492

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  +  
Sbjct  493   SKGGLYKEAMEIFREFKSV--GLR--------ADVVLYSALIDALCKNGLVSSAVSLIGE  542

Query  1269  MLKD  1280
             M K+
Sbjct  543   MTKE  546



>ref|XP_003632699.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial [Vitis vinifera]
Length=819

 Score = 63.5 bits (153),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 73/165 (44%), Gaps = 23/165 (14%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +  ++E A +V  K  + GL      ++ ++   C+ GD + A T   +MEA G    
Sbjct  367   LCKEGNMEKAEEVLKKFLENGLAPVGVFFNTIVNGYCQVGDINKAYTTIEKMEAVGLRPN  426

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMK--------PDTETYNWVIQAYTRAE  986
                +N L+            F   +NME  E  +K        P+ ETYN +I  Y R+ 
Sbjct  427   HVTYNSLVK----------KFCEMKNMEEAEKCIKKMVEKGVLPNVETYNTLIDGYGRSC  476

Query  987   SYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREA  1121
              +DR   + E +     + K L+PN+ +Y  L+ C  K   + EA
Sbjct  477   LFDRCFQILEEM-----EKKGLKPNVISYGCLINCLCKDANILEA  516



>emb|CAE76009.1| B1358B12.18 [Oryza sativa Japonica Group]
 emb|CAH67636.1| B0812A04.6 [Oryza sativa Indica Group]
Length=609

 Score = 60.8 bits (146),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/198 (24%), Positives = 80/198 (40%), Gaps = 36/198 (18%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   +E+A  VF K    G++    ++ +LI+  CK GD    L +  EM   G    
Sbjct  320   LCRVGRIEDARGVFEKMCGRGMKPNAVVFTILIDAHCKKGDAETMLELHREMRERGVRPD  379

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYD-----  995
                +N +  V   C   ++  A+   +E   A ++PDT TY  +I  Y + E  D     
Sbjct  380   AVTYNAI--VNGLCRARDLKSASGIVVEMRSAGLRPDTVTYTTLIDGYCKEEELDMAMEI  437

Query  996   ---------------------------RVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                                        R  D   +LG M+E    L+P+  TY ++++ F
Sbjct  438   KQNMVAEGVGLDEVTYTALISGLSKAGRSADAERVLGEMME--AGLEPDNTTYTMVIDAF  495

Query  1095  SKYCVVREAIRHFRALKN  1148
              +   V+  +R  + ++N
Sbjct  496   CRKGDVKTGLRLLKEMQN  513


 Score = 21.9 bits (45),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (47%), Gaps = 3/77 (4%)
 Frame = +2

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
            V M +L+   R  +++    V  +M + G+     SF+ +I       D++GA    RR 
Sbjct  245  VLMRDLV---RLGELASAQNVFDEMQSRGVRRTVVSFNTMISGMCRAGDLDGAETLHRRM  301

Query  530  LSEGLRPLHETFVALIR  580
               G+ P   T+ ALI+
Sbjct  302  SEAGVTPDVYTYGALIQ  318



>ref|XP_002971777.1| hypothetical protein SELMODRAFT_96029 [Selaginella moellendorffii]
 gb|EFJ27526.1| hypothetical protein SELMODRAFT_96029 [Selaginella moellendorffii]
Length=556

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 91/210 (43%), Gaps = 18/210 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             LV+S H     KV+      G       + +LI  +CKAG  + AL     ++       
Sbjct  37    LVKSGHQFRTGKVYKDLLHSGCSPNLVTFKILIRGNCKAGQATRALEFLRALDEFSVAPD  96

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              + FN L+      G P+ A   FENME   + + PD  TYN VI    ++ + ++ +  
Sbjct  97    VYIFNFLIHGLFKDGNPDQAVKLFENME--SSRVNPDIFTYNTVISGLCKSGNLEKAR--  152

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVEC-FSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
              ELL  M+    +  P++ TY  L+     K   V EA+           GM+L    G 
Sbjct  153   -ELLEEMIRRGGKSAPDIVTYNTLINAGICKDGDVEEALEILD-------GMKL---AGP  201

Query  1188  YGDPLSL--YLRALCREGRIVELLEALEAM  1271
               D ++    + ALC  GR+VE  E L+ M
Sbjct  202   APDVITYNSIIHALCVAGRVVEAAEILKTM  231



>ref|XP_010491966.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial-like [Camelina sativa]
Length=817

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 91/211 (43%), Gaps = 19/211 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   +E A ++  +    GL   + IY+ +I+  C+AGD   A      ME  G    
Sbjct  367   LCKEGKVEKAEEILGREMGKGLVPNEVIYNTMIDGYCRAGDVVGARMKIEVMEEQGMKPD  426

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +NCL  ++  C + E+A A  E  +     + P  ETYN +I  Y R   +D+  D+
Sbjct  427   HLAYNCL--IRRFCEVGEMANAEQEVNKMKLKGLSPSVETYNILIGGYGRKGEFDKCFDI  484

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREA--IRHFRALKNFEGGMRLLHNEG  1184
              + +     + K + PN+ +Y  L+ C  K   + EA  ++     +     +R+ +   
Sbjct  485   LKEM-----EDKGMMPNVVSYGTLINCLCKGSKLLEAEIVKRDMEDRGVSPNVRIYN---  536

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLK  1277
                    + +   C +G+I E     E MLK
Sbjct  537   -------MLINGCCSKGKIEEAFRLSEEMLK  560



>ref|XP_008447846.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Cucumis melo]
 ref|XP_008447848.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Cucumis melo]
 ref|XP_008447849.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Cucumis melo]
 ref|XP_008447850.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Cucumis melo]
 ref|XP_008447851.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Cucumis melo]
Length=873

 Score = 62.8 bits (151),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 99/213 (46%), Gaps = 16/213 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L    +LENA +VF K ++ G +  +    +L+   C+AG HSN + +  EM ++G    
Sbjct  161   LCEMGYLENAREVFDKMSEKGCKPNEFSLGILVRGYCRAGLHSNGIDLLDEMRSSGAFPN  220

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N ++S     G  E A    E M   E  + PDT T+N  I A  ++    ++ + 
Sbjct  221   RVAYNTVISSLCGEGQTEEAEKLVEKMR--EVGLSPDTVTFNCRIAALCKS---GQILEA  275

Query  1011  AELL-GMMVEDHKRL-QPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
             + +   M +++   L +PN  TY L++E F    +  EA   F ++K  E       N  
Sbjct  276   SRIFRDMQIDEEMGLPKPNTVTYNLMLEGFCSEGMFEEARAIFDSMKISE-----TLNLK  330

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLKDN  1283
              Y    +++L  L R G+++E    L  M + N
Sbjct  331   SY----NIWLLGLVRSGKLLEARLILNEMAEKN  359



>ref|XP_004237977.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 
[Solanum lycopersicum]
Length=511

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 89/188 (47%), Gaps = 17/188 (9%)
 Frame = +3

Query  714   LRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA--TTFHFNCLLSVQATCGIPEV  887
             L+    I+++L++  CK GD   A  +  EM  + R++      ++ L+     CG  + 
Sbjct  196   LKPNTCIFNILVKYHCKKGDVDAAFVVVEEMRKS-RVSHPNLITYSTLMDGLCRCGRLQD  254

Query  888   AFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMR  1067
             A   FE M   +  + PD  TYN +I A+ RA   DR +++   +G M ++    QPN+ 
Sbjct  255   ALDLFEKM-LAKDQIPPDALTYNILINAFCRAGKVDRARNI---IGFMRKNG--CQPNIV  308

Query  1068  TYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVE  1247
              Y  L+  F K   V +A   F  +K    G+ L  +   Y    +  + + CR G++ E
Sbjct  309   NYTALMNGFCKEGRVEDAKEVFHEMK----GVGLKPDVVGY----TTLINSFCRAGKVDE  360

Query  1248  LLEALEAM  1271
              +E L+ M
Sbjct  361   GIELLDEM  368



>ref|XP_011090619.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090620.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090621.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090622.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
Length=754

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 118/284 (42%), Gaps = 48/284 (17%)
 Frame = +3

Query  576   FVCLVQKVLLREA*KFWQQWKT*KELVRSNH----LENANKV--------FFKGAKG-GL  716
             F  LV+  +L EA + + Q KT K + R+      L   +KV        FF    G G+
Sbjct  188   FSVLVELGMLEEARESFLQMKTFKVIPRARSCNVLLHKFSKVADGVLVKKFFSDMCGAGI  247

Query  717   RATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFA  896
               +   ++++I   CK GD   A ++   M+  G       +N L+      G    A  
Sbjct  248   VPSIFTFNIMISFYCKEGDLKAARSMFMRMKDMGVSPDVVTYNSLIDGHGKLGELSEAVC  307

Query  897   TFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYV  1076
              +E M+  EA   PD  TYN +I  + +   Y ++    + L  M E  + ++PN  TY 
Sbjct  308   MYEEMK--EAECLPDIITYNILINCFCK---YGKMPLAFQFLREMKE--RCIKPNDVTYS  360

Query  1077  LLVECFSKYCVVREAIRHFRALK----------------------NFEGGMRLLHNEGKY  1190
               V+ F K  ++++AI+ F  ++                      N +  ++ L    + 
Sbjct  361   TFVDAFCKEGMLQQAIKFFVDMRRVGLTPNEFTYTSLIDANFKMGNIDDALKFLKEMLEA  420

Query  1191  GDPLSL-----YLRALCREGRIVELLEALEAMLKDNQTIPPRAM  1307
             G  L++      L  LC EG+I E  E   AMLKD   +P   M
Sbjct  421   GLKLNIVTYTALLNGLCEEGKIKEAEEVFNAMLKDG-VVPNEKM  463



>ref|XP_006349790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial-like [Solanum tuberosum]
Length=808

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/220 (26%), Positives = 103/220 (47%), Gaps = 17/220 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R + + ++  ++ +  K G++  +    +L+   CK G    A  I  +M   G   T
Sbjct  316   LSRCDDVNSSLALYEEVVKTGVKLNEYTSSVLLNSLCKKGKTDKAAEILKKMMGNGLTPT  375

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                FN +LS     G  E A+ T + ME   + +KP   T+N +I  +        +++ 
Sbjct  376   DVLFNTILSGYCKEGNMEKAYLTIDEMEI--SGVKPSCVTFNTLITKFCE---LGMMEEA  430

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              E L  M+E  K + PN++TY +L++ + +    RE +R F  L+  E    L  N   Y
Sbjct  431   NEWLRKMLE--KSVSPNVQTYNILIDGYGRK---REFVRCFEILEEMENN-GLNPNVITY  484

Query  1191  GDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMI  1310
             G      + +LC++GR++E    L  M+  ++ + P A +
Sbjct  485   GS----LINSLCKDGRLLEADVVLSDMI--SRGVKPNAQV  518



>ref|XP_010108616.1| hypothetical protein L484_000854 [Morus notabilis]
 gb|EXC19798.1| hypothetical protein L484_000854 [Morus notabilis]
Length=789

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   ++ + K F      G+  +   Y+++I   CK GD   A ++  EM+  G +  
Sbjct  264   LSKLGKVDMSRKFFKDMVAAGIAPSVFTYNIMINYLCKEGDMDEARSLFEEMKHRGLIPD  323

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L+      G  + A   FE M+  +   +PD  T+N +I  + +++   R  + 
Sbjct  324   IVTYNSLIDGFGKVGNMDEAICIFEKMK--DVGCEPDIITFNALINCFGKSQRLPRALEF  381

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
                L     +H  L+PN+ TY  L++ F K  ++REA++ F  ++     + L  NE  Y
Sbjct  382   LHEL----RNHG-LKPNVVTYSTLIDAFCKEGMMREALKFFVDMRR----VGLFPNEYTY  432

Query  1191  GDPLSLYLRALCREGRIVELLEALEAMLK  1277
                    + A C+ G + E L+    ML+
Sbjct  433   TS----LVDANCKAGNLTEALKLTNEMLQ  457



>ref|XP_010454089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like 
[Camelina sativa]
Length=507

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 97/215 (45%), Gaps = 28/215 (13%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG---  818
             L+ S  ++ A K+        GL     I+++L++  CK GD  +A  +  EM+  G   
Sbjct  171   LIDSGEVDLARKLLLYAKHNLGLLPNTCIFNILVKHHCKNGDIDSAFRVVEEMKRCGISY  230

Query  819   --RMATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESY  992
                +  +   NCL +   +    + A   FE M   E +  PD  T+N +I  + R+   
Sbjct  231   PDSITYSTLINCLFAHSRS----KEAMELFEVMISKEGF-SPDPVTFNVIINGFCRSGEV  285

Query  993   DRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLL  1172
             +R + + + +           PN+  Y  L+  +S+   V+EA R FR +K  + G++L 
Sbjct  286   ERAKMILDFM-----KKNGCNPNVYNYSALMNGYSREGKVQEAKRIFREVK--QNGLKL-  337

Query  1173  HNEGKYGDPL--SLYLRALCREGRIVELLEALEAM  1271
                    D +  + ++  LCR G+I E L+ L  M
Sbjct  338   -------DTVGYTTFMNCLCRNGQIDEALKLLGEM  365



>ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa]
 gb|ERP64510.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa]
Length=873

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 94/214 (44%), Gaps = 25/214 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +A  +  EM+  G       +N LLS+ A  G  E A      ME
Sbjct  372   YSTMIDGYAKAGRLDDARNLFNEMKFLGISLDRVSYNTLLSIYAKLGRFEEAMDVCREME  431

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V+ V E +       + + PN+ TY  L++ +
Sbjct  432   --NSGIRKDVVTYNALLGGYGKQYKYDVVRKVFEEM-----KARHVSPNLLTYSTLIDVY  484

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + REA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  485   SKGGLYREAMDVFREFK----------KAGLKADVVLYSALIDALCKNGLVESAVSLLDE  534

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEA  1370
             M K+   I P  +     Y +++ ++  P   E+
Sbjct  535   MTKEG--IRPNVVT----YNSIIDAFGRPATTES  562



>ref|XP_003580849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
 ref|XP_010240631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
 ref|XP_010240632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
Length=904

 Score = 58.5 bits (140),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/213 (28%), Positives = 95/213 (45%), Gaps = 13/213 (6%)
 Frame = +3

Query  678   ANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLS  857
             A + F K  +GGL+    IY+ L+   CK+G   +AL +  EM        TF +N L+ 
Sbjct  638   AFEYFTKIKEGGLKLDVYIYETLLRACCKSGRMQSALAVTREMSTQKIARNTFVYNILID  697

Query  858   VQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVE  1037
               A  G    A    + M+  E  + P+  TY   I A  +A    R Q V E +  +  
Sbjct  698   GWARRGDVWEAADLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAQKVIEEMADV--  753

Query  1038  DHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL-SLYL  1214
                 L+PN++TY  L++ ++K  +   A++ F  +K   G   L  +E  Y   + SL  
Sbjct  754   ---GLKPNLKTYTTLIKGWAKASLPDRALKSFEEMK-LAG---LKPDEAAYHCLVTSLLS  806

Query  1215  RALCREGRI-VELLEALEAMLKDNQTIPPRAMI  1310
             RA   EG     +L     M +++ T+  R  +
Sbjct  807   RATVMEGSTYTGILSICREMFENDLTVDMRTAV  839


 Score = 23.5 bits (49),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I    +  D++ A++ L      G  P   T+ ALI     K    R +
Sbjct  545  MQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYNALIHGLIKKNQVERAV  604

Query  617  EILAAM  634
             +L  M
Sbjct  605  SVLNKM  610


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  K GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  489   FIHLHDFANAFSIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPS  548

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A    + M    +   P   TYN +I    +    +R   V
Sbjct  549   NRAFRPIIEGFAVAGDMKRALNILDLMR--RSGCAPTVMTYNALIHGLIKKNQVERAVSV  606

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
                + +       + PN  TY +++  ++    + +A  +F  +K  EGG++L       
Sbjct  607   LNKMSI-----AGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIK--EGGLKL-------  652

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q I     +    Y  L+  W
Sbjct  653   --DVYIYETLLRACCKSGRMQSALAVTREM--STQKIARNTFV----YNILIDGW  699



>ref|XP_006653052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Oryza brachyantha]
Length=901

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 96/235 (41%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  + GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  484   FIHLHDFANAFAIFEEMIRSGLQPDRTIYNLLIEAFCKMGNMDRAICILEKMQKERMQLS  543

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M    +   P   TYN +I    R    +R   V
Sbjct  544   NRAFRPIIEGFAVAGDMKSALDTLDLMRRSGS--APTVMTYNALIHGLVRKHQVERAISV  601

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    V +A  +F  +K  E G++L       
Sbjct  602   LDKMSI-----AGITPNEHTYTIIMRGYAANGDVGKAFEYFTKIK--EAGLKL-------  647

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  648   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTYI----YNILIDGW  694



>emb|CAE03450.1| OSJNBa0088H09.8 [Oryza sativa Japonica Group]
Length=905

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  + GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  488   FIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERMQPS  547

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M        P   TYN +I    R     R   V
Sbjct  548   NRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCV--PTVMTYNALIHGLVRKHKVQRAVSV  605

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  606   LDKMSI-----AGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  651

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  652   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  698


 Score = 52.0 bits (123),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S  +  A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF 
Sbjct  631   SGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFI  690

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R + V E 
Sbjct  691   YNILIDGWARRGDVWEAEDLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAEKVIE-  747

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
                MV+    L+PN++TY  L++ +++  +   A++ F  +K
Sbjct  748   --EMVD--VGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  785


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I  + +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  544  MQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAV  603

Query  617  EILAAM  634
             +L  M
Sbjct  604  SVLDKM  609



>gb|EEC67112.1| hypothetical protein OsI_33911 [Oryza sativa Indica Group]
Length=291

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  497  VEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAMENLKGTCAKQPSG  673
            +  AM +LRRELS G+ PL   FVAL+ +F    LATR +EILA ME  K    K   G
Sbjct  37   ITSAMQSLRRELSSGMHPLRGNFVALVHVFAKNDLATRCMEILATMERYKHNIRKASEG  95



>gb|EAZ32470.1| hypothetical protein OsJ_16686 [Oryza sativa Japonica Group]
Length=879

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  + GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  462   FIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERMQPS  521

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M        P   TYN +I    R     R   V
Sbjct  522   NRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCV--PTVMTYNALIHGLVRKHKVQRAVSV  579

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  580   LDKMSI-----AGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  625

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  626   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  672


 Score = 51.6 bits (122),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S  +  A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF 
Sbjct  605   SGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFI  664

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R + V E 
Sbjct  665   YNILIDGWARRGDVWEAEDLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAEKVIE-  721

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
                MV+    L+PN++TY  L++ +++  +   A++ F  +K
Sbjct  722   --EMVD--VGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  759


 Score = 23.9 bits (50),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I  + +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  518  MQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAV  577

Query  617  EILAAM  634
             +L  M
Sbjct  578  SVLDKM  583



>ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa]
 gb|EEE80792.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa]
Length=864

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 94/214 (44%), Gaps = 25/214 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +A  +  EM+  G       +N LLS+ A  G  E A      ME
Sbjct  372   YSTMIDGYAKAGRLDDARNLFNEMKFLGISLDRVSYNTLLSIYAKLGRFEEAMDVCREME  431

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V+ V E +       + + PN+ TY  L++ +
Sbjct  432   --NSGIRKDVVTYNALLGGYGKQYKYDVVRKVFEEM-----KARHVSPNLLTYSTLIDVY  484

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + REA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  485   SKGGLYREAMDVFREFK----------KAGLKADVVLYSALIDALCKNGLVESAVSLLDE  534

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEA  1370
             M K+   I P  +     Y +++ ++  P   E+
Sbjct  535   MTKEG--IRPNVVT----YNSIIDAFGRPATTES  562



>ref|XP_010099493.1| hypothetical protein L484_000446 [Morus notabilis]
 gb|EXC44867.1| hypothetical protein L484_000446 [Morus notabilis]
Length=789

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   ++ + K F      G+  +   Y+++I   CK GD   A ++  EM+  G +  
Sbjct  264   LSKLGKVDMSRKFFKDMVAAGIAPSVFTYNIMINYLCKEGDMDEARSLFEEMKHRGLIPD  323

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L+      G  + A   FE M+  +   +PD  T+N +I  + +++   R  + 
Sbjct  324   IVTYNSLIDGFGKVGNMDEAICIFEKMK--DVGCEPDIITFNALINCFGKSQRLPRALEF  381

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
                L     +H  L+PN+ TY  L++ F K  ++REA++ F  ++     + L  NE  Y
Sbjct  382   LHEL----RNHG-LKPNVVTYSTLIDAFCKEGMMREALKFFVDMRR----VGLFPNEYTY  432

Query  1191  GDPLSLYLRALCREGRIVELLEALEAMLK  1277
                    + A C+ G + E L+    ML+
Sbjct  433   TS----LVDANCKAGNLTEALKLTNEMLQ  457



>ref|XP_006342083.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20300, 
mitochondrial-like [Solanum tuberosum]
Length=549

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (43%), Gaps = 7/163 (4%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R+ ++  A ++F      G++     Y ++I+  C++G  + A  +  EM   G      
Sbjct  279   RAGNISEAERIFRDMKDAGVQPNVYTYSIVIDALCRSGQTTRAYDVFSEMIDVGCQPNAI  338

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              FN L+ V    G  E     +  M+       PD  TYN++I A+ R E+ D    V  
Sbjct  339   TFNNLMRVHVKAGRTEKVLQVYNQMK--RLSCSPDVITYNFLIDAHCRDENRDEALKVVN  396

Query  1017  LLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
             ++       KR +PN  T+  +  C +K   V  A R +  +K
Sbjct  397   VMA-----KKRCEPNASTFNPIFRCIAKARDVNAAHRLYAKMK  434



>ref|XP_011041010.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Populus euphratica]
Length=876

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 81/184 (44%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   NAL +  EM+          +N LLS+ A  G  + A      ME
Sbjct  374   YSTMIDGYAKAGRFDNALNLFNEMKFLCISLDRVSYNTLLSIYAKLGRFQEALEVCREME  433

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  ++ D  TYN ++  Y +   YD V+ V E +        R+ PN+ TY  L++ +
Sbjct  434   --NCGIRKDVVTYNALLGGYGKQCKYDEVRRVFEEM-----KAGRISPNLLTYSTLIDVY  486

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + REA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  487   SKGGLYREAMDVFREFK----------KAGLKADVVLYSAVIDALCKNGLVESAVSLLDE  536

Query  1269  MLKD  1280
             M K+
Sbjct  537   MTKE  540



>ref|NP_001054310.1| Os04g0684500 [Oryza sativa Japonica Group]
 dbj|BAF16224.1| Os04g0684500 [Oryza sativa Japonica Group]
Length=901

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  + GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  484   FIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERMQPS  543

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M        P   TYN +I    R     R   V
Sbjct  544   NRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCV--PTVMTYNALIHGLVRKHKVQRAVSV  601

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  602   LDKMSI-----AGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  647

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  648   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  694


 Score = 51.6 bits (122),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S  +  A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF 
Sbjct  627   SGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFI  686

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R + V E 
Sbjct  687   YNILIDGWARRGDVWEAEDLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAEKVIE-  743

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
                MV+    L+PN++TY  L++ +++  +   A++ F  +K
Sbjct  744   --EMVD--VGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  781


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I  + +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  540  MQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAV  599

Query  617  EILAAM  634
             +L  M
Sbjct  600  SVLDKM  605



>emb|CAJ86163.1| H0913C04.4 [Oryza sativa Indica Group]
 gb|EAY96108.1| hypothetical protein OsI_17985 [Oryza sativa Indica Group]
Length=900

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  + GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  483   FIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERMQPS  542

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M        P   TYN +I    R     R   V
Sbjct  543   NRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCV--PTVMTYNALIHGLVRKHKVQRAVSV  600

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  601   LDKMSI-----AGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  646

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  647   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  693


 Score = 51.6 bits (122),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S  +  A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF 
Sbjct  626   SGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFI  685

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R + V E 
Sbjct  686   YNILIDGWARRGDVWEAEDLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAEKVIE-  742

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
                MV+    L+PN++TY  L++ +++  +   A++ F  +K
Sbjct  743   --EMVD--VGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  780


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I  + +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  539  MQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAV  598

Query  617  EILAAM  634
             +L  M
Sbjct  599  SVLDKM  604



>ref|XP_002454820.1| hypothetical protein SORBIDRAFT_04g038070 [Sorghum bicolor]
 gb|EES07796.1| hypothetical protein SORBIDRAFT_04g038070 [Sorghum bicolor]
Length=600

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 97/207 (47%), Gaps = 15/207 (7%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R+     A +VF + A+ GL  +  +Y+ ++    KAGD + A  +   M+AAG    
Sbjct  159   LARARMTATARRVFDEMARAGLAVSTHVYNAMLHVCLKAGDAARAEALVTRMDAAGVPLD  218

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F +N ++++    G+   A    + M+  +  ++ DT T+N +I    +   Y RV++ 
Sbjct  219   RFSYNTVIALYCKKGMRYEAMCVRDRMD--KEGIRADTVTWNSLIHGLCK---YGRVKEA  273

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
             A+L   M     +  P+  TY  L++ + +   + EA++    L+       +L     Y
Sbjct  274   AQLFTEMAA--AQATPDNVTYTTLIDGYCRAGNIEEAVK----LRGEMEATGMLPGVATY  327

Query  1191  GDPLSLYLRALCREGRIVELLEALEAM  1271
                 +  LR LC +G++ E+ + L  M
Sbjct  328   ----NAILRKLCEDGKMKEVNQLLNEM  350



>ref|NP_001105869.1| pentatricopeptide repeat protein [Zea mays]
 gb|ABF57644.1| pentatricopeptide repeat protein [Zea mays]
Length=886

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 95/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F    K GL+    IY+LL+E  CK G+   A+ I   M+      +
Sbjct  471   FIHLHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMQKERMQPS  530

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + AF T + M    +   P   TYN +I    R    ++   V
Sbjct  531   NRTFRPIIEGFAVAGDMKRAFDTLDLMR--RSGCAPTVMTYNALIHGLVRKHQVEKAVSV  588

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  589   LDKMSI-----AGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  634

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  635   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  681



>ref|XP_008235960.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 
[Prunus mume]
Length=873

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 9/153 (6%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++  L+ A K F +     L     IYD+ I   CK G  S+A  +  +ME  G   +
Sbjct  538   LCKAGRLDEAKKKFMEMMGKNLHPDSVIYDMFINSFCKQGRISSAFQVLKDMEKKGCNKS  597

Query  831   TFHFNCLLSVQATCGIPEVAFATFENM-EYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N L+      G  +  F  +  M E  E  + PD  TYN+++      E   RV+D
Sbjct  598   IQTYNSLI---LGLGSKKQIFEIYGLMDEMRERGVTPDVCTYNYMMNCLCEGE---RVKD  651

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYC  1106
                LL  M++  K + PN+ T+ +L++ F K C
Sbjct  652   ATSLLDEMLQ--KGISPNISTFRILIKAFCKAC  682



>ref|XP_006653488.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Oryza brachyantha]
Length=598

 Score = 54.3 bits (129),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/196 (23%), Positives = 81/196 (41%), Gaps = 32/196 (16%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   LE A  VF K  K G+R    ++ +LI+  CK G+    L +  EM   G    
Sbjct  310   LCRVGRLEGARTVFEKMCKTGMRPNAVVFTILIDAHCKEGNVETILELHREMGERGVRPD  369

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L  V   C   ++  A    ++   A ++PD  TY  +I  Y + E  D   ++
Sbjct  370   VVAYNAL--VNGLCRARDLKSARGILVDMRSAGLRPDKVTYTTLIDGYCKEEELDMAMEI  427

Query  1011  AELL---GMMVE------------------DHKR---------LQPNMRTYVLLVECFSK  1100
              + +   G+ ++                  D KR         L+P+  TY ++++ F +
Sbjct  428   KQNMVAEGVALDEVTYTALISGLSKAGRSVDAKRVLDEMMEAGLEPDNTTYTMVIDAFCR  487

Query  1101  YCVVREAIRHFRALKN  1148
                V+  +R  + +++
Sbjct  488   KGDVKTGLRLLKEMQS  503


 Score = 27.3 bits (59),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 36/77 (47%), Gaps = 3/77 (4%)
 Frame = +2

Query  350  VFMEELMERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRE  529
            V M +L+   R  D++    V  +M + G+ P   SF+ +I       D++GA    R  
Sbjct  235  VLMRDLL---RSGDLASAQNVFDEMHSRGVRPTAVSFNTIISGMCRLGDLDGADRLYRGM  291

Query  530  LSEGLRPLHETFVALIR  580
               G+ P   T+ ALI+
Sbjct  292  AEAGVLPDVYTYGALIQ  308



>ref|XP_004145582.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic-like [Cucumis sativus]
Length=1113

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 75/165 (45%), Gaps = 7/165 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  LENA ++F K    G +    IY  L+++    GD         +MEA G M  
Sbjct  307   LCNAGQLENAKELFVKMKANGHKPDQVIYITLLDKFNDFGDLDTFKEFWSQMEADGYMPD  366

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  L+ V       + AFATF+ M   +  + P+  TYN +I    RA    R++D 
Sbjct  367   VVTFTILVDVLCKARDFDEAFATFDVMR--KQGILPNLHTYNTLICGLLRA---GRIEDA  421

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
              +LLG M  +   +QP   TY + ++ F K     +A+  F  +K
Sbjct  422   LKLLGTM--ESVGVQPTAYTYNIFIDYFGKSGETGKAVETFEKMK  464



>ref|XP_011042278.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Populus euphratica]
Length=871

 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +A  +  EM+  G       +N LLS+ A  G  E A      ME
Sbjct  373   YSTMIDGYAKAGRLDDARNLFNEMKFLGISLDRVSYNTLLSIYAKLGRFEEAMDVCREME  432

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V++V E +       + + PN+ TY  L++ +
Sbjct  433   --NSGIRKDVVTYNALLGGYGKQYKYDVVRNVFEEM-----KARHVSPNLLTYSTLIDVY  485

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + REA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  486   SKGGLYREAMDVFREFK----------KAGLKADVVLYSALIDALCKNGLVESAVSLLDE  535

Query  1269  MLKD  1280
             M K+
Sbjct  536   MTKE  539



>ref|XP_008381425.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Malus domestica]
Length=868

 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL++  EM+          +N LLS+    G  E A    + ME
Sbjct  365   YSTIIDGYAKAGRLEDALSLFNEMKFLAISLDRVLYNTLLSLYGKLGRFEDALNVCKEME  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +  D  +YN ++  Y +   YD V+    +   M+E+H  + PN+ TY  L++ +
Sbjct  425   --SVGIAKDVVSYNALLGGYGKQGKYDEVK---RMYNEMIEEH--VSPNILTYSTLIDLY  477

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA+R FR  K+   G++   +L++E          + ALC+ G +   L  L+
Sbjct  478   SKGGLYAEAMRVFREFKH--AGLKADVVLYSE---------LINALCKNGLVESALSLLD  526

Query  1266  AMLKD  1280
              M K+
Sbjct  527   EMTKE  531



>ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=593

 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 91/209 (44%), Gaps = 21/209 (10%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             LV+   ++N  KV+ K  + G+     +Y++L+   CK GD   A  +  EME       
Sbjct  175   LVKEKLIDNVWKVYKKMVRLGVVGNLHVYNVLVHACCKGGDVEKAEKVLSEMELKSVFPD  234

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F +N L+++    G+   A    + ME   A + PD  TYN +I  + R     R+++ 
Sbjct  235   RFTYNTLIALYCKKGMHYEALCVQDRME--RAGISPDIITYNSLIYGFCRE---GRMREA  289

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
               L     ++ K + PN  TY  L++    YC V +     R  +  E        +G Y
Sbjct  290   VRLF----KEIKGVSPNHVTYTTLID---GYCRVNDLGEALRVREMMEA-------KGIY  335

Query  1191  GDPLSL--YLRALCREGRIVELLEALEAM  1271
                ++    +R LC EG+I E    L  M
Sbjct  336   PGVVTYNSIIRKLCEEGKIREANRVLNEM  364



>ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=874

 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 89/209 (43%), Gaps = 18/209 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++  L++A K F +    GL+    IYD  I   C+ G  S+A  +  +ME  G   T
Sbjct  534   LCKAGRLDDAKKKFIEMMSKGLQPDSAIYDTFIHSFCREGKISSAFQVLKDMEKRGCNKT  593

Query  831   TFHFNCL-LSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N L L + +   I E+     E  E G   + PD  TYN ++          R+ D
Sbjct  594   LQTYNSLILGLGSKNQIFELYGLIDEMREKG---VSPDVCTYNHMLNCLCEG---GRIND  647

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                +L  M++  K + PN+ ++ +L++ F K C  + +   F    N  G     H E  
Sbjct  648   APSVLDEMLQ--KGISPNISSFRILIKAFCKACDFKASHEVFEIALNVCG-----HKEAL  700

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAML  1274
             Y    +L    L   G++ E  E  E  L
Sbjct  701   Y----TLMFNELLVGGKVAEAKELFETAL  725



>ref|XP_010440983.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Camelina sativa]
Length=596

 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 91/201 (45%), Gaps = 20/201 (10%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             LV+    +   KVF K  K G+ A   +Y++L+    K+GD   A  +  EME  G    
Sbjct  178   LVKERLTDTVWKVFKKMVKLGVVANIHVYNVLVHACSKSGDPEKAEKLLSEMEEKGVFPD  237

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F +N L+SV    G+   A +  + ME   + + PD  TYN +I  ++R     R+++ 
Sbjct  238   LFTYNTLISVYCKKGMHYEALSVQDRME--RSGVAPDIVTYNSLIHGFSRE---GRMREA  292

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL--KNFEGGMRLLHNEG  1184
               L     E    +  N  TY  L++ + +   + EA+R    +  + F  G+ + +N  
Sbjct  293   TRLFR---EIKGVVTANHVTYTTLIDGYCRMNDIDEALRLREVMESRGFTPGV-VTYNS-  347

Query  1185  KYGDPLSLYLRALCREGRIVE  1247
                      LR LC +GRI E
Sbjct  348   --------ILRKLCEDGRIRE  360



>ref|XP_004960011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Setaria italica]
 ref|XP_004960012.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Setaria italica]
Length=893

 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 95/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F    K GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  478   FIHLHDFANAFSIFEDMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRIFEKMQKERMQPS  537

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M    +   P   TYN +I    R    +R   V
Sbjct  538   NRTFRPIIEGFAVSGDMKRALDTLDLMR--RSGCAPTVMTYNALIHGLIRKHQVERAVSV  595

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  596   LDKMAI-----AGIAPNEHTYTIIMRGYAAGGDIGKAFEYFTKIK--ESGLKL-------  641

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  642   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  688


 Score = 50.4 bits (119),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 96/213 (45%), Gaps = 13/213 (6%)
 Frame = +3

Query  678   ANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLS  857
             A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF +N L+ 
Sbjct  627   AFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFIYNILID  686

Query  858   VQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVE  1037
               A  G    A    + M+  E  + P+  TY   I A  +A    R ++V + +  +  
Sbjct  687   GWARRGDVWEAADLMKQMK--EDGVPPNIHTYTSYINACCKAGDMRRAENVIQEMADV--  742

Query  1038  DHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL-SLYL  1214
                 L+PN++TY  L++ +++  +   A++ F  +K    G++   +E  Y   + SL  
Sbjct  743   ---GLKPNVKTYTTLIKGWARVSLPDRALKCFEEMKM--AGLK--PDEAAYHCLVTSLLS  795

Query  1215  RALCREGRI-VELLEALEAMLKDNQTIPPRAMI  1310
             RA   EG     +L     M +++ T+  R  +
Sbjct  796   RATVMEGSTYTGILGVCREMFENDLTVDLRTAV  828


 Score = 22.7 bits (47),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I    ++ D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  534  MQPSNRTFRPIIEGFAVSGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLIRKHQVERAV  593

Query  617  EILAAM  634
             +L  M
Sbjct  594  SVLDKM  599



>emb|CBI36966.3| unnamed protein product [Vitis vinifera]
Length=730

 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 95/217 (44%), Gaps = 21/217 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM+ A        +N LLS+ A  G  E A    + ME
Sbjct  250   YSTVIDGYAKAGRLDEALNLFNEMKFASIGLDRVSYNTLLSIYAKLGRFEEALNVCKEME  309

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + +K D  TYN ++  Y +   Y+ V+ V E +       +R+ PN+ TY  L++ +
Sbjct  310   --SSGIKKDAVTYNALLGGYGKQGKYEEVKRVFEEM-----KAERIFPNLLTYSTLIDVY  362

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  363   SKGGLYQEAMEVFREFK----------KAGLKADVVLYSALIDALCKNGLVESAVSFLDE  412

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELG  1379
             M K+   I P  +  +        S I     E+E+G
Sbjct  413   MTKEG--IRPNVVTYNSIIDAFGRSGIVEDATESEVG  447



>ref|XP_006826435.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
 gb|ERM93672.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
Length=735

 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 86/211 (41%), Gaps = 34/211 (16%)
 Frame = +3

Query  711   GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVA  890
             G   T   Y +LI+  CK G    A  + Y+M++ G +     +N LL      G  E A
Sbjct  523   GFELTSFTYSILIDGLCKNGKIETAKKLLYDMQSHGLVPNQRDYNTLLDALCKVGDLEHA  582

Query  891   FATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRT  1070
              + F  M  G    +PD  T+N +I    RA     + D  E+L  M++  +   P++ T
Sbjct  583   MSLFLVMNEGGC--EPDVITFNILIDGMCRA---GNLNDAKEMLNEMIQ--RGFIPDIVT  635

Query  1071  YVLLVECFSKY----------------------CVVREAIRHFRALKNFEGGMRLLHNEG  1184
             Y +++   SK                       C+    ++ F A  + E  MRLLH   
Sbjct  636   YSIIINGLSKVGDMDDAKGLLEKMIAKGLSPDACIYDSLLKGFWAKGDVEEFMRLLHGMA  695

Query  1185  KYG----DPL-SLYLRALCREGRIVELLEAL  1262
               G    D L S  L  L  +GRI   +E+L
Sbjct  696   AQGVRLDDKLESTILDCLSGDGRISTFMESL  726



>ref|XP_010063125.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g42310, mitochondrial [Eucalyptus grandis]
Length=729

 Score = 48.1 bits (113),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 74/170 (44%), Gaps = 13/170 (8%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             K  V++  L +A  +  +  + G+   +  Y LLI+    AG   +A  +  EMEA+   
Sbjct  367   KGYVKTGSLRDAEWIVSEMERNGVLPDEHTYSLLIDAYVNAGRWESARIVLKEMEASNLQ  426

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
               +F F  +L+     G  +  F     M+     ++PD   YN +I  + +    D   
Sbjct  427   PNSFVFGRILAAYRDKGEWQRTFQVLREMK--SCGVRPDRHFYNVMIDTFGKYNCLDHAM  484

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFE  1154
             D  +   M+ E    ++P   T+  L++C SK      A  H RA++ FE
Sbjct  485   DTFD--RMLSEG---IEPCNVTWNTLIDCHSK------AGHHDRAVELFE  523


 Score = 33.1 bits (74),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 30/63 (48%), Gaps = 3/63 (5%)
 Frame = +2

Query  458  FHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEILAAME  637
            FH +IV    + D + A+H L      GL P   T VA+I   G+ G   R LE  A  E
Sbjct  292  FHDVIVGFAKSGDPDRALHFLGVAQGCGLSPKTATLVAVISALGNSG---RTLEAEAVFE  348

Query  638  NLK  646
             LK
Sbjct  349  ELK  351



>ref|XP_007200313.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica]
 gb|EMJ01512.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica]
Length=872

 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 9/153 (6%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++  L+ A K F +     L     IYD+ I   CK G  S+A  +  +ME  G   +
Sbjct  537   LCKAGRLDEAKKKFMEMMGKNLHPDSVIYDMFINSFCKQGRISSAFRVLKDMEKKGCNKS  596

Query  831   TFHFNCLLSVQATCGIPEVAFATFENM-EYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N   S+    G  +  F  +  M E  E  + PD  TYN+++      E   RV+D
Sbjct  597   IQTYN---SLVLGLGSKKQIFEIYGLMDEMRERGVTPDVCTYNYMMNCLCEGE---RVKD  650

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYC  1106
                LL  M++  K + PN+ T+ +L++ F K C
Sbjct  651   ATSLLDEMLQ--KGISPNISTFRILIKAFCKAC  681



>ref|XP_004149490.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150-like [Cucumis sativus]
Length=786

 Score = 61.6 bits (148),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 109/262 (42%), Gaps = 42/262 (16%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +S + +   K F      G+  +   Y+++I+  CK GD  N+  +  +M   G    
Sbjct  264   LSKSGNGQLVRKFFNDMIGAGIAPSVFTYNVMIDYLCKEGDLENSRRLFVQMREMGLSPD  323

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD-  1007
                +N L+      G  E   + F  M+  +    PD  TYN +I  Y + E   R  + 
Sbjct  324   VVTYNSLIDGYGKVGSLEEVASLFNEMK--DVGCVPDIITYNGLINCYCKFEKMPRAFEY  381

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK--------------  1145
              +E+       +  L+PN+ TY  L++ F K  +++ AI+ F  ++              
Sbjct  382   FSEM------KNNGLKPNVVTYSTLIDAFCKEGMMQGAIKLFVDMRRTGLLPNEFTYTSL  435

Query  1146  --------NFEGGMRLLHNEGKYGDPLSLY-----LRALCREGRIVELLEALEAMLKDNQ  1286
                     N     +LL++  + G  L++      L  LC+ GR++E  E   +MLKD  
Sbjct  436   IDANCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALLDGLCKAGRMIEAEEVFRSMLKDG-  494

Query  1287  TIPPRAMILSRKYRTLVSSWIE  1352
              I P   +    Y  LV  +I+
Sbjct  495   -ISPNQQV----YTALVHGYIK  511



>ref|XP_010680035.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680036.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680037.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Beta vulgaris subsp. vulgaris]
Length=899

 Score = 61.6 bits (148),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 96/211 (45%), Gaps = 15/211 (7%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             + L  S   E + K+F      G+  +   Y+++I + CK  D   A+ +  +M+  G +
Sbjct  231   RRLCESGRGEMSRKIFSDMVGVGMSPSVFSYNIIIYDRCKERDLVGAMALFNQMKGCGLI  290

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
                  +N L+      G+       +  M   EA   PD  TYN +I  + +   Y+++ 
Sbjct  291   PDIVTYNTLIDGHGKLGLLNETINIYVEMR--EAGCSPDIITYNTLINCFCK---YEKLP  345

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
                E L  M  D   L+PN+ TY  L++ F K  ++REA++ F  ++     + L  NE 
Sbjct  346   QAFEFLRQMKSDD--LKPNVVTYSTLIDSFCKEGMMREAMKFFVDMRR----LALSPNEY  399

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLK  1277
              Y    +  + A C+ G + E  + ++ M++
Sbjct  400   TY----TSLIDANCKSGNLGEASKMVKEMVE  426



>ref|XP_006410274.1| hypothetical protein EUTSA_v10016252mg [Eutrema salsugineum]
 gb|ESQ51727.1| hypothetical protein EUTSA_v10016252mg [Eutrema salsugineum]
Length=825

 Score = 61.6 bits (148),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 84/184 (46%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL++  EM   G       +N L+S+    G  E A   F  M 
Sbjct  320   YSTVIDGFAKAGRFDEALSLFDEMRYLGIALDRVSYNTLVSIYTKVGRSEEALDVFREM-  378

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   Y  V++V      M ++H  + PN+ TY  L++ +
Sbjct  379   -ASVGIKKDVVTYNALLGGYGKQGKYVEVKNV---FAEMKKEH--VLPNLLTYSTLIDVY  432

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  433   SKGGLYKEAMEIFREFKSV--GLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  482

Query  1269  MLKD  1280
             M K+
Sbjct  483   MTKE  486



>emb|CDY58113.1| BnaA02g35150D [Brassica napus]
Length=505

 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 94/209 (45%), Gaps = 16/209 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG-RM  824
             LV S  +  A K+   G K  GL+    I+++L++  CK+GD  +A  +  EM+ +G   
Sbjct  169   LVDSKEVGLAKKLLLYGKKNLGLQPNTCIFNILVKHHCKSGDVDSAFGVVEEMKRSGLSY  228

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
                  ++ L+         + A   FE+M   +  + PD  T+N +I  + RA   +R +
Sbjct  229   PNLITYSTLMECLFAQSRSKEAMELFEDM-ISKERISPDPVTFNVMINGFCRAGEVERGK  287

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
              + E +           PN+  Y  L+  F K    +EA   F  +K  E G++L  +  
Sbjct  288   MIIEFM-----KKNGCNPNVYNYSALMNGFCKEGRAQEAKEVFDEVK--ETGLKL--DTV  338

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAM  1271
              Y    +  +  LCR G++ E +E L  M
Sbjct  339   GY----TTLMNCLCRSGQVDEAMELLGEM  363



>ref|XP_003580632.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, 
mitochondrial [Brachypodium distachyon]
Length=644

 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 71/160 (44%), Gaps = 11/160 (7%)
 Frame = +3

Query  804   MEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRA  983
             M  AG   +   +NCLL   A  G+ + A   F+ M   E  ++PD  +YN +I+ Y RA
Sbjct  199   MRLAGVEPSRVTYNCLLDGLANAGLLDTAINVFDAMST-EDRVRPDVVSYNILIKGYCRA  257

Query  984   ESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGM  1163
                 R QD    L  M E    L P+  TY+ L++         + IR F+ ++    G 
Sbjct  258   ---GRAQDAMARLAHMRE-QAELSPDKVTYLTLMQLHYSEGTFSQCIRLFQEMEEMGMGK  313

Query  1164  RLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDN  1283
              +  +         L + ALC+EG+  E L   E MLK  
Sbjct  314   DIPQHA------YVLVIGALCKEGKPFEGLAVFERMLKSG  347



>ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Vitis vinifera]
Length=867

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 84/184 (46%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM+ A        +N LLS+ A  G  E A    + ME
Sbjct  364   YSTVIDGYAKAGRLDEALNLFNEMKFASIGLDRVSYNTLLSIYAKLGRFEEALNVCKEME  423

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + +K D  TYN ++  Y +   Y+ V+ V E +       +R+ PN+ TY  L++ +
Sbjct  424   --SSGIKKDAVTYNALLGGYGKQGKYEEVKRVFEEM-----KAERIFPNLLTYSTLIDVY  476

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K            G   D +  S  + ALC+ G +   +  L+ 
Sbjct  477   SKGGLYQEAMEVFREFK----------KAGLKADVVLYSALIDALCKNGLVESAVSFLDE  526

Query  1269  MLKD  1280
             M K+
Sbjct  527   MTKE  530



>ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Glycine max]
 ref|XP_006587579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X2 [Glycine max]
 ref|XP_006587580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X3 [Glycine max]
Length=892

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 80/181 (44%), Gaps = 19/181 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y +LI+  CK G    AL +  EM   G   +   FN L+      G+ E A      ME
Sbjct  328   YTVLIDYLCKEGRMDEALKMLNEMVEKGVAPSVVPFNALIGSYCKRGMMEDAVGVLGLME  387

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
               +    P+  TYN +I  + R +S DR      LL  MVE   +L P++ TY  L+   
Sbjct  388   SKKVC--PNVRTYNELICGFCRGKSMDRAM---ALLNKMVES--KLSPDVVTYNTLIHGL  440

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGD--PLSLYLRALCREGRIVELLEALEA  1268
              +  VV  A R F          RL+  +G   D    + ++  LCR GR+ E  + LE+
Sbjct  441   CEVGVVDSASRLF----------RLMIRDGFSPDQWTFNAFMVCLCRMGRVGEAHQILES  490

Query  1269  M  1271
             +
Sbjct  491   L  491



>ref|XP_010026088.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g31400, chloroplastic [Eucalyptus grandis]
Length=910

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/273 (22%), Positives = 112/273 (41%), Gaps = 50/273 (18%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R  + E A   F++    G+      Y+  ++  CK G   +A+ I  +M A   +    
Sbjct  353   RGGYWEAAKNWFYEMVDKGIDQDIVTYNTFLDALCKGGQLDSAIEIMSQMPAKNILPNVV  412

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              ++ ++   A  G  + A + F NM +    ++ D  +YN ++  Y++   +  V D+ +
Sbjct  413   TYSTMVDGYAKAGRSDEALSIFNNMRF--LGIELDRVSYNTLLTIYSKLGDFQEVVDICK  470

Query  1017  ----------------LLGM---------MVEDHKRLQ-----PNMRTYVLLVECFSKYC  1106
                             LLG          M   +K ++     PN+ TY  L++ +SK  
Sbjct  471   EMDDCRVVKDVVTYNALLGGYGKQGKYDDMTRVYKEMKAAQVCPNLLTYSTLIDMYSKAG  530

Query  1107  VVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEAMLKD  1280
             + REA+  F+ LK           EG   D +  S  + ALC+ G +   +  L  M ++
Sbjct  531   LYREAMDAFKGLK----------QEGLQPDVVLYSALIDALCKNGLVESAVSLLHEMTRE  580

Query  1281  NQTIPPRAMILSRKYRTLVSSWIEPLQEEAELG  1379
                I P  +     Y +++ ++   +  EA+ G
Sbjct  581   G--ISPNVVT----YNSIIDAFGRYMSAEADFG  607



>ref|XP_002518803.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF43728.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=775

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 55/242 (23%), Positives = 104/242 (43%), Gaps = 38/242 (16%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++   + +NK F      G+  +   Y+++I   CK GD   A ++ ++M+  G    
Sbjct  227   LAKTGKGDLSNKFFRDMVGAGIAQSVFTYNIMIGYMCKEGDMVTAKSLFHQMKQMGLTPD  286

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L+      G+ + +F  FE M+  +   +PD  TYN +I  + +   Y+++   
Sbjct  287   IVTYNSLIDGYGKLGLLDESFCLFEEMK--DVGCEPDVITYNALINCFCK---YEQMPKA  341

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK---------------  1145
                L  M   +  L+PN+ TY  L++   K  ++++AI+    ++               
Sbjct  342   FHFLHEM--KNSGLKPNVVTYSTLIDALCKEHMLQQAIKFLLDMRRVGLSPNEFTYTSLI  399

Query  1146  --NFEGGMRLLHNEGKYGDPL------------SLYLRALCREGRIVELLEALEAMLKDN  1283
               N + G   L +  K  D +            +  L  LC+EGR++E  +   AM+K  
Sbjct  400   DANCKAGY--LSDALKLADEMLQVQVGFNVVTYTTLLDGLCKEGRMMEAEDLFRAMIKAG  457

Query  1284  QT  1289
              T
Sbjct  458   VT  459



>ref|XP_010029448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Eucalyptus grandis]
 ref|XP_010029449.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Eucalyptus grandis]
 gb|KCW56372.1| hypothetical protein EUGRSUZ_I02100 [Eucalyptus grandis]
Length=593

 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 88/205 (43%), Gaps = 19/205 (9%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             K++ K  + G+     IY++LI   CK+ D   A  I  EME+       F FN L+++ 
Sbjct  186   KLYKKMVRLGVVPNIHIYNVLIHACCKSADAEKAENILIEMESKCVHPDLFTFNTLIALY  245

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G+   A    + ME G   + PD  TYN +I    R     R+++   L      + 
Sbjct  246   CKKGMHYEALCVQDRMERGG--VSPDIVTYNSLIYGLCRE---GRMREAVRLF----REI  296

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRAL  1223
             K + PN  TY  L++ + +   + EA+R    L+       L H    Y       LR L
Sbjct  297   KGVTPNHVTYTTLIDGYCRINDLEEALR----LREVMVAKGLYHGVATYNS----ILRKL  348

Query  1224  CREGRIVELLEALEAMLKDNQTIPP  1298
             C EGR+ +  + L  M    Q + P
Sbjct  349   CEEGRMRDANKLLNEM--SEQKVEP  371



>ref|XP_009333596.1| PREDICTED: uncharacterized protein LOC103926525 [Pyrus x bretschneideri]
Length=926

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 93/212 (44%), Gaps = 21/212 (10%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   +E+A  V       GL      YD L+   CK G    A+    +M + G +  
Sbjct  666   LCRDRKVEDAVNVLKIMKDKGLTPDVYSYDPLVSAFCKEGRLDLAIEFLDDMISDGCLPD  725

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
               ++N +L+     G  + A   FEN+  GE    P+  +YN +  A       DRV+ V
Sbjct  726   IVNYNTILAALCKSGNADQALEIFENL--GEVGCPPNVSSYNKMFSALWNCG--DRVR-V  780

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              +++  MV  +K + P+  TY   + C  +  +V EAI           G+ +    G +
Sbjct  781   LQMVSEMV--NKGIDPDEITYNSFISCLCRDRMVNEAI-----------GLLVDMESGGF  827

Query  1191  GDPL---SLYLRALCREGRIVELLEALEAMLK  1277
                +   S+ L  LC+  RIV  +EAL AM++
Sbjct  828   QPTVISYSIVLLGLCKTPRIVNAIEALAAMVE  859



>ref|XP_006293642.1| hypothetical protein CARUB_v10022597mg [Capsella rubella]
 gb|EOA26540.1| hypothetical protein CARUB_v10022597mg [Capsella rubella]
Length=932

 Score = 61.2 bits (147),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 81/184 (44%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  421   YSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREM-  479

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V+ V      M  +H  + PN+ TY  L++ +
Sbjct  480   -ASVGIKKDVVTYNALLGGYGKQGKYDEVKKV---FAEMKREH--VVPNLLTYSTLIDGY  533

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  534   SKGGLYKEAMEIFREFKS--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  583

Query  1269  MLKD  1280
             M K+
Sbjct  584   MTKE  587



>ref|XP_010424167.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like 
[Camelina sativa]
Length=478

 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 90/194 (46%), Gaps = 27/194 (14%)
 Frame = +3

Query  711   GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG-----RMATTFHFNCLLSVQATCG  875
             GL     I+++L++  CK GD  +A  +  EM+ +G      +  +   NCL +   +  
Sbjct  163   GLLPNTCIFNILVKHHCKNGDIDSAFRVVEEMKRSGISYPDSITYSTLMNCLFAHSRS--  220

Query  876   IPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQ  1055
               + A   FE+M   E +  PD  T+N +I  + R+   +R + + + +           
Sbjct  221   --KEAMELFEDMISKEGF-SPDPVTFNVIINGFCRSGEVERAKMILDFM-----KKNGCN  272

Query  1056  PNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCR  1229
             PN+  Y  L+  +S+   V+EA R F+ +K  + G++L        D +  +  +  LCR
Sbjct  273   PNVYNYSTLMNGYSREGKVQEAKRIFKEVK--QNGLKL--------DTVGYTTLMNCLCR  322

Query  1230  EGRIVELLEALEAM  1271
              G+I E L+ L  M
Sbjct  323   NGQIDEALKLLGEM  336



>ref|XP_008365652.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Malus domestica]
Length=613

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 85/210 (40%), Gaps = 17/210 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   +E A          G+      Y +LI   CK      ALT+   M   G    
Sbjct  184   LCQLGRMEKAKSYLICMLNSGISPDVYTYSILISSLCKEERIQEALTLLENMTTKGIKPD  243

Query  831   TFHFNCLLSVQATCGIPEVAFATFENM-EYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                F  L+S     G  E   + F+ M  YG   + PD  TYN +I    + E   R+Q+
Sbjct  244   VVTFTSLISASCKSGNWEEGVSLFKTMIGYG---ISPDVYTYNILISTLCKEE---RIQE  297

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                LL  M    K ++PN+ T+  L+    K     E +R F+ +     G  +L +   
Sbjct  298   ALTLLENMTT--KGIKPNVVTFTSLISASCKSGNWEEGVRLFKTMI----GYGVLPDIVT  351

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAMLK  1277
             Y    S  L ALC+EG+  E L  +E M+ 
Sbjct  352   Y----SAVLDALCKEGKTTEALNLVEEMIS  377



>ref|XP_010450873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Camelina sativa]
Length=596

 Score = 60.5 bits (145),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 90/201 (45%), Gaps = 20/201 (10%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             LV+    +   KVF K  K G+ A   +Y++L+    K+GD   A     EME  G    
Sbjct  178   LVKERLTDTVWKVFKKMVKLGVVANIHVYNVLVHACSKSGDPEKAEKFLSEMEEKGVFPD  237

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F +N L+SV    G+   A +  + ME   + + PD  TYN +I  ++R     R+++ 
Sbjct  238   LFTYNTLISVYCKKGMHYEALSVQDRME--RSGVAPDIVTYNSLIHGFSRE---GRMREA  292

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL--KNFEGGMRLLHNEG  1184
               L     E    +  N  TY  L++ + +   + EA+R    +  + F  G+ + +N  
Sbjct  293   TRLFR---EIKGVVTANHVTYTTLIDGYCRMNDIDEALRLREVMESRGFTPGV-VTYNS-  347

Query  1185  KYGDPLSLYLRALCREGRIVE  1247
                      LR LC +GRI E
Sbjct  348   --------ILRKLCEDGRIRE  360



>ref|XP_010469705.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Camelina sativa]
Length=934

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 93/219 (42%), Gaps = 25/219 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  422   YSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREM-  480

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V+ V      M  +H  + PN+ TY  L++ +
Sbjct  481   -ASVGIKKDVVTYNALLGGYGKQGKYDEVKKV---FTEMKREH--VLPNLLTYSTLIDGY  534

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  535   SKGGLYKEAMEIFREFKS--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  584

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYE  1385
             M K+   I P  +     Y +++ ++   +  E    Y 
Sbjct  585   MTKEG--ISPNVVT----YNSIIDAFGRSVTTERSADYS  617



>ref|XP_009349918.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like isoform X2 [Pyrus x bretschneideri]
Length=732

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL++  EM+          +N LLS+    G  E A    + ME
Sbjct  365   YSTIIDGYAKAGRLEDALSLFNEMKFLAISLDRVLYNTLLSLYGKLGRFEDALNVCKEME  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +  D  +YN ++  Y +   YD V+    +   M+E+H  + PN+ TY  L++ +
Sbjct  425   --SVGIAKDVVSYNALLGGYGKQGKYDEVK---RMYNEMIEEH--VSPNILTYSTLIDLY  477

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA++ FR  K+   G++   +L++E          + ALC+ G +   L  L+
Sbjct  478   SKGGLYAEAMKVFREFKH--AGLKADVVLYSE---------LINALCKNGLVESALSLLD  526

Query  1266  AMLKD  1280
              M K+
Sbjct  527   EMTKE  531



>gb|EYU42756.1| hypothetical protein MIMGU_mgv1a024236mg [Erythranthe guttata]
Length=556

 Score = 60.5 bits (145),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 103/249 (41%), Gaps = 22/249 (9%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             +   L  A K+  K A+ GL      Y  LI+  CK G    AL I +EME    +   +
Sbjct  201   KEGRLSEAEKLCSKMAECGLLPNVITYSTLIDGLCKNGGIDLALKIFHEMERRNCLPNLY  260

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              ++ L+  Q   G  + A    E M   + Y  PD  TY  +I       S  R+     
Sbjct  261   TYSSLIYGQCQVGRVDDAEIMLEEMVIKKLY--PDEVTYTSLIDGLA---SLGRLDSAFS  315

Query  1017  LLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKN----FEGGMRLLHNEG  1184
             LL  M+  H   +PN RTY +L+    K   V+    H   +      FE    LL    
Sbjct  316   LLRRMI--HAGCKPNYRTYCVLLIGMQKKMAVQHETVHSHTIDAKCVIFETFCNLLVKMS  373

Query  1185  KYG-----DPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSWI  1349
             + G     D   + +  LCR+GR  E  + +E M  + + + P   I    Y +L+ ++ 
Sbjct  374   EMGCEPCTDTYYILIAGLCRDGRSYEADKLVEFM--EEKGLSPNEAI----YCSLLGAYC  427

Query  1350  EPLQEEAEL  1376
             + L+ +A L
Sbjct  428   KNLRVDAAL  436



>ref|XP_009345921.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like 
[Pyrus x bretschneideri]
Length=874

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 80/182 (44%), Gaps = 14/182 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++  L+ A K F +     L     IYD+ I   C+ G  S+A  +  +ME  G   +
Sbjct  539   LCKAGRLDEAKKKFMEMLGKNLPPDSVIYDMFIRSFCEQGKISSAFRVLKDMEKKGCNKS  598

Query  831   TFHFNCLLSVQATCGIPEVAFATFENM-EYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N L+      G  +  F  +  M E  E  + PD  TYN ++++    E   RV+D
Sbjct  599   IQTYNSLI---LGLGSKKQIFEIYGLMDEMRERGVPPDVRTYNNMMKSLCEGE---RVRD  652

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                LL  M++  K + PN+ T+ +L+E F K C    A   F    +  G     H E  
Sbjct  653   ATSLLDEMLQ--KGISPNISTFRILIEAFCKGCDFGAAHEVFDIALSVCG-----HKEAL  705

Query  1188  YG  1193
             YG
Sbjct  706   YG  707



>ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa]
 gb|ERP51296.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa]
Length=593

 Score = 60.5 bits (145),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 88/188 (47%), Gaps = 21/188 (11%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             K++ K  K G+ A   +Y++L+   CK+GD   A  +  EME        F +N L+S+ 
Sbjct  192   KIYKKMVKLGVVANIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTYNTLISLY  251

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G+   A +  + ME   A + PD  TYN +I  + R     R+++  +L      D 
Sbjct  252   CKKGMHYEALSVQDRMEM--AGISPDIFTYNSLIYGFCRE---GRMREAVQLF----RDI  302

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSL--YLR  1217
             K + PN  TY  L++ + +   + EA+R    LK       ++  +G Y   ++    LR
Sbjct  303   KDVTPNHVTYTSLIDGYCRVNDLDEALR----LK------EVMSEKGLYPTVITYNSILR  352

Query  1218  ALCREGRI  1241
              LC  GR+
Sbjct  353   KLCEGGRL  360



>gb|KHN38886.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=734

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 80/181 (44%), Gaps = 19/181 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y +LI+  CK G    AL +  EM   G   +   FN L+      G+ E A      ME
Sbjct  170   YTVLIDYLCKEGRMDEALKMLNEMVEKGVAPSVVPFNALIGSYCKRGMMEDAVGVLGLME  229

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
               +    P+  TYN +I  + R +S DR      LL  MVE   +L P++ TY  L+   
Sbjct  230   SKKVC--PNVRTYNELICGFCRGKSMDRAM---ALLNKMVE--SKLSPDVVTYNTLIHGL  282

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGD--PLSLYLRALCREGRIVELLEALEA  1268
              +  VV  A R F          RL+  +G   D    + ++  LCR GR+ E  + LE+
Sbjct  283   CEVGVVDSASRLF----------RLMIRDGFSPDQWTFNAFMVCLCRMGRVGEAHQILES  332

Query  1269  M  1271
             +
Sbjct  333   L  333



>ref|XP_006338085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like 
[Solanum tuberosum]
Length=511

 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 97/210 (46%), Gaps = 18/210 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
             L+ +  +E A +      K   L+    I+++L++  C+ GD   A  +  EM  + R++
Sbjct  174   LIEAKQIELAKEFLLNVQKHLDLKPNTCIFNILVKYHCRKGDVEAAFVVVEEMRKS-RVS  232

Query  828   --TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRV  1001
                   ++ L+     CG  + A   FE M   +  + PD  TYN +I A+ RA   DR 
Sbjct  233   HPNLITYSTLMDGLCRCGRLQDALDLFEKM-LAKDQIPPDALTYNILINAFCRAGKVDRA  291

Query  1002  QDVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNE  1181
             +++   +G M ++    QPN+  Y  L+  F K   V +A   F  +K    G+ L  + 
Sbjct  292   RNI---IGFMRKNG--CQPNIVNYTALMNGFCKEGRVGDAKEVFHEMK----GVGLKPDV  342

Query  1182  GKYGDPLSLYLRALCREGRIVELLEALEAM  1271
               Y    +  + + CR G++ + +E LE M
Sbjct  343   VGY----TTLINSFCRAGKVDKGIELLEEM  368



>gb|KDP31244.1| hypothetical protein JCGZ_11620 [Jatropha curcas]
Length=763

 Score = 48.1 bits (113),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 9/139 (6%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENM-  911
             ++L+I   CK G  S+A  +     A G +   F FN L+         E A     +M 
Sbjct  429   FNLVINGLCKMGCMSDANNLMNGAIAKGYIPDIFTFNTLIDGYCKQRKMENAIEILNSMW  488

Query  912   EYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVEC  1091
              +G   + PD  TYN V+    +A    + +DV E   +M+E  KR  PN+ TY +L+E 
Sbjct  489   SHG---VTPDIITYNSVLNGLCKAA---KPEDVMETFKLMME--KRCVPNLITYNILIES  540

Query  1092  FSKYCVVREAIRHFRALKN  1148
               K   V +A+     ++N
Sbjct  541   LCKARKVNDALDLVEEIRN  559


 Score = 32.3 bits (72),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 38/89 (43%), Gaps = 5/89 (6%)
 Frame = +2

Query  368  MERARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLR  547
            M   +DAD      ++ D I  G  P   ++  LI     + D+E A+      L +GL+
Sbjct  334  MGMVQDAD-----KILNDAIFKGFVPDEFTYCALINGLCQHGDIERALALFDEALGKGLK  388

Query  548  PLHETFVALIRLFGSKGLATRGLEILAAM  634
            P    +  LI+     GL    L+++  M
Sbjct  389  PSIVLYNTLIKGLSQHGLVLEALQLMNNM  417



>ref|XP_009363136.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Pyrus x bretschneideri]
Length=868

 Score = 60.8 bits (146),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL++  EM+          +N LLS+    G  E A    + ME
Sbjct  365   YSTIIDGYAKAGRLEDALSLFNEMKFLAISLDRVLYNTLLSLYGKLGRFEDALNVCKEME  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +  D  +YN ++  Y +   YD V+    +   M+E+H  + PN+ TY  L++ +
Sbjct  425   --SVGIAKDVVSYNALLGGYGKQGKYDEVK---RMYNEMIEEH--VSPNILTYSTLIDLY  477

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA++ FR  K+   G++   +L++E          + ALC+ G +   L  L+
Sbjct  478   SKGGLYAEAMKVFREFKH--AGLKADVVLYSE---------LINALCKNGLVESALSLLD  526

Query  1266  AMLKD  1280
              M K+
Sbjct  527   EMTKE  531



>ref|XP_009349917.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like isoform X1 [Pyrus x bretschneideri]
Length=868

 Score = 60.8 bits (146),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL++  EM+          +N LLS+    G  E A    + ME
Sbjct  365   YSTIIDGYAKAGRLEDALSLFNEMKFLAISLDRVLYNTLLSLYGKLGRFEDALNVCKEME  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +  D  +YN ++  Y +   YD V+    +   M+E+H  + PN+ TY  L++ +
Sbjct  425   --SVGIAKDVVSYNALLGGYGKQGKYDEVK---RMYNEMIEEH--VSPNILTYSTLIDLY  477

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA++ FR  K+   G++   +L++E          + ALC+ G +   L  L+
Sbjct  478   SKGGLYAEAMKVFREFKH--AGLKADVVLYSE---------LINALCKNGLVESALSLLD  526

Query  1266  AMLKD  1280
              M K+
Sbjct  527   EMTKE  531



>gb|KCW58308.1| hypothetical protein EUGRSUZ_H00998 [Eucalyptus grandis]
Length=761

 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 59/273 (22%), Positives = 112/273 (41%), Gaps = 50/273 (18%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R  + E A   F++    G+      Y+  ++  CK G   +A+ I  +M A   +    
Sbjct  204   RGGYWEAAKNWFYEMVDKGIDQDIVTYNTFLDALCKGGQLDSAIEIMSQMPAKNILPNVV  263

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              ++ ++   A  G  + A + F NM +    ++ D  +YN ++  Y++   +  V D+ +
Sbjct  264   TYSTMVDGYAKAGRSDEALSIFNNMRF--LGIELDRVSYNTLLTIYSKLGDFQEVVDICK  321

Query  1017  ----------------LLGM---------MVEDHKRLQ-----PNMRTYVLLVECFSKYC  1106
                             LLG          M   +K ++     PN+ TY  L++ +SK  
Sbjct  322   EMDDCRVVKDVVTYNALLGGYGKQGKYDDMTRVYKEMKAAQVCPNLLTYSTLIDMYSKAG  381

Query  1107  VVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEAMLKD  1280
             + REA+  F+ LK           EG   D +  S  + ALC+ G +   +  L  M ++
Sbjct  382   LYREAMDAFKGLK----------QEGLQPDVVLYSALIDALCKNGLVESAVSLLHEMTRE  431

Query  1281  NQTIPPRAMILSRKYRTLVSSWIEPLQEEAELG  1379
                I P  +     Y +++ ++   +  EA+ G
Sbjct  432   G--ISPNVV----TYNSIIDAFGRYMSAEADFG  458



>ref|XP_002447352.1| hypothetical protein SORBIDRAFT_06g033480 [Sorghum bicolor]
 gb|EES11680.1| hypothetical protein SORBIDRAFT_06g033480 [Sorghum bicolor]
Length=888

 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F    K GL+    IY+LL+E  CK G+   A+ I   M+      +
Sbjct  473   FIHLHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMKKERMQPS  532

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A  T + M    +   P   TYN +I    R    +R   V
Sbjct  533   NRTFRPIIEGFAVAGDMKRALDTLDLMR--RSGCAPTVMTYNALIHGLIRKHQVERAVSV  590

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              + + +       + PN  TY +++  ++    + +A  +F  +K  E G++L       
Sbjct  591   LDKMSI-----AGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIK--ESGLKL-------  636

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q IP    I    Y  L+  W
Sbjct  637   --DVYIYETLLRACCKSGRMQSALAVTREM--SFQKIPRNTFI----YNILIDGW  683


 Score = 53.1 bits (126),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 99/219 (45%), Gaps = 13/219 (6%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S  +  A + F K  + GL+    IY+ L+   CK+G   +AL +  EM        TF 
Sbjct  616   SGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFI  675

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  T+   I A  +A    R ++V + 
Sbjct  676   YNILIDGWARRGDVWEAADLMKQMK--EDGIPPNIHTFTSYINACCKAGDMQRAENVIQE  733

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDP  1199
             +  +      L+PN++T+  L++ ++K  +   A++ F  +K+   G++   +E  Y   
Sbjct  734   MADV-----GLKPNVKTFTTLIKGWAKVSLPDRALKCFEEMKS--AGLK--PDEAAYHCL  784

Query  1200  L-SLYLRALCREGRI-VELLEALEAMLKDNQTIPPRAMI  1310
             + SL  RA   EG     +L     M +++ T+  R  +
Sbjct  785   VTSLLSRATVMEGSTYTGILSVCREMFENDLTVDLRTAV  823


 Score = 21.9 bits (45),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 27/66 (41%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I    +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  529  MQPSNRTFRPIIEGFAVAGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLIRKHQVERAV  588

Query  617  EILAAM  634
             +L  M
Sbjct  589  SVLDKM  594



>ref|XP_008794926.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial-like [Phoenix dactylifera]
Length=896

 Score = 60.5 bits (145),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 77/159 (48%), Gaps = 7/159 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R+N++E A++ F +  + GL   +  Y+ LI   C+AG+ + AL +   M   G +  
Sbjct  591   LCRANYMEEAHEAFHEMCRRGLVPNNFTYNSLISGFCRAGNVAEALKLERAMRQNGLVPD  650

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
              F  N +++     G  ++A   F  ME     + PD  TYN  I AY RA  +D V + 
Sbjct  651   IFTTNIIINGFCRQGRLKMANNIF--MEMYANGLSPDIVTYNTFISAYCRA--FDMV-NA  705

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIR  1127
             A L+  M  +    +P++ TY + +      C+   AI+
Sbjct  706   ANLVNKMSSEG--CEPDIFTYNIWIHSLCSSCMTNRAIK  742



>ref|XP_006450624.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
 ref|XP_006450625.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
 ref|XP_006450626.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
 gb|ESR63864.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
 gb|ESR63865.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
 gb|ESR63866.1| hypothetical protein CICLE_v10007728mg [Citrus clementina]
Length=637

 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 79/166 (48%), Gaps = 10/166 (6%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             S ++E A   F+K  + GL AT   Y+ LI+    AG    ++ +   M   G +     
Sbjct  155   SGNMEEAMDTFWKMKESGLTATTSTYNTLIKGYGIAGKPEESVKLLDLMSREGNVKPNLR  214

Query  840   -FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              +N L  V+A C    +  A     +   + MKPD  TYN +  AY +    D+ ++V  
Sbjct  215   TYNVL--VRAWCNEKNITEAWNVMHKMAASGMKPDVVTYNTIATAYAQNGEADQAEEV--  270

Query  1017  LLGMMVE-DHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNF  1151
                 +VE +H  +QPN RT  +++  + K   ++EA+R  R +K +
Sbjct  271   ----IVEMEHNGVQPNGRTCGIIISGYCKEGKIKEALRFARTMKEY  312



>ref|XP_006287082.1| hypothetical protein CARUB_v10000242mg [Capsella rubella]
 gb|EOA19980.1| hypothetical protein CARUB_v10000242mg [Capsella rubella]
Length=818

 Score = 60.5 bits (145),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 91/211 (43%), Gaps = 19/211 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   +E A ++  +    GL   + IY+ +I+  C+ GD   A      ME  G    
Sbjct  366   LCKEGKIEKAEEILGREVGKGLVPNEVIYNTMIDGYCRTGDVVGARMKIEVMEKQGMKPD  425

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +NCL  V+  C + E+A A  E  +     + P  ETYN +I  Y R   +D+  D+
Sbjct  426   HLAYNCL--VRRFCEVGEMANAEQEVKKMKLKGLPPSIETYNILIGGYGRKGEFDKCFDI  483

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREA--IRHFRALKNFEGGMRLLHNEG  1184
              + +    ED+  + PN+ +Y  L+ C  K   + EA  ++     +     +R+ +   
Sbjct  484   LKEM----EDNSTM-PNVVSYGTLINCLCKGSKLLEAEIVKRDMEDRGVSPNVRIYN---  535

Query  1185  KYGDPLSLYLRALCREGRIVELLEALEAMLK  1277
                    + +   C +G+I E     E MLK
Sbjct  536   -------MLINGCCSKGKIEEAFRLSEEMLK  559



>ref|XP_006845376.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda]
 gb|ERN07051.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda]
Length=1123

 Score = 47.0 bits (110),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 7/167 (4%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
              L     L +A ++F++   G  R     Y  LI      GD      +  EMEA G   
Sbjct  317   SLCSCGRLADAKELFYQMKSGNHRPDRVTYITLINRFGDLGDLGFVWELWREMEAYGYGT  376

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                 F  L++     G    A    + ME  +  +  +  TYN +I    + +     Q+
Sbjct  377   DVVSFTLLINALCKVGRVGEALKMLDVME--KKGISANPHTYNTLILGLLKVDRLGEAQE  434

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKN  1148
             + E +G+        QP + TY++ ++ F K    ++A+  F  +KN
Sbjct  435   LFEFMGL-----HGPQPTVYTYIIFIDYFGKSGYPQKALEIFGRMKN  476


 Score = 33.1 bits (74),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 29/56 (52%), Gaps = 0/56 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFG  589
            M++  + P  +++  L+V+     D+   M+ L    + GLRP   T+   IR+FG
Sbjct  229  MVSENIKPSLKTYSALMVAFGKRKDINTVMYLLHEMEALGLRPNVYTYTICIRIFG  284



>ref|XP_004157129.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g31850, chloroplastic-like [Cucumis sativus]
Length=1113

 Score = 60.5 bits (145),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 74/165 (45%), Gaps = 7/165 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  LENA ++F K    G +    IY  L+++    GD         +MEA G M  
Sbjct  307   LCNAGQLENAKELFVKMKANGHKPDQVIYITLLDKFNDFGDLDTFKEFWSQMEADGYMPD  366

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  L+ V       + AFATF+ M   +  + P+  TYN +I    RA    R++D 
Sbjct  367   VVTFTILVDVLCKARDFDEAFATFDVMR--KQGILPNLHTYNTLICGLLRA---GRIEDA  421

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
              +LL  M  +   +QP   TY+  ++ F K     +A+  F  +K
Sbjct  422   LKLLDTM--ESVGVQPTAYTYITFIDYFGKSGETGKAVETFEKMK  464



>gb|KCW58309.1| hypothetical protein EUGRSUZ_H00998 [Eucalyptus grandis]
Length=674

 Score = 60.1 bits (144),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/273 (22%), Positives = 112/273 (41%), Gaps = 50/273 (18%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R  + E A   F++    G+      Y+  ++  CK G   +A+ I  +M A   +    
Sbjct  204   RGGYWEAAKNWFYEMVDKGIDQDIVTYNTFLDALCKGGQLDSAIEIMSQMPAKNILPNVV  263

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              ++ ++   A  G  + A + F NM +    ++ D  +YN ++  Y++   +  V D+ +
Sbjct  264   TYSTMVDGYAKAGRSDEALSIFNNMRF--LGIELDRVSYNTLLTIYSKLGDFQEVVDICK  321

Query  1017  ----------------LLGM---------MVEDHKRLQ-----PNMRTYVLLVECFSKYC  1106
                             LLG          M   +K ++     PN+ TY  L++ +SK  
Sbjct  322   EMDDCRVVKDVVTYNALLGGYGKQGKYDDMTRVYKEMKAAQVCPNLLTYSTLIDMYSKAG  381

Query  1107  VVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEAMLKD  1280
             + REA+  F+ LK           EG   D +  S  + ALC+ G +   +  L  M ++
Sbjct  382   LYREAMDAFKGLK----------QEGLQPDVVLYSALIDALCKNGLVESAVSLLHEMTRE  431

Query  1281  NQTIPPRAMILSRKYRTLVSSWIEPLQEEAELG  1379
                I P  +     Y +++ ++   +  EA+ G
Sbjct  432   G--ISPNVV----TYNSIIDAFGRYMSAEADFG  458



>ref|XP_004253145.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial [Solanum lycopersicum]
Length=790

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 103/228 (45%), Gaps = 33/228 (14%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L RS+ + ++  ++ +  K G++  +    +L+   CK G    A  I  +M   G   T
Sbjct  317   LSRSDDVNSSLALYEEVVKTGVKLNEYTSSVLLNGLCKKGKTDKAAEILKKMLGNGLTPT  376

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                FN +LS     G  E A+ T + ME   + +KP   T+N +I  +            
Sbjct  377   DVLFNTILSGYCKEGNMEKAYLTIDEMEI--SGVKPSCVTFNTLITKFCE----------  424

Query  1011  AELLGMMVEDHKRLQ--------PNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMR  1166
                LGMM E +K L+        PN++TY +L++ + +    +E +R F  L+  E    
Sbjct  425   ---LGMMEEANKWLRKMLEKSVSPNVQTYNILIDGYGRK---QEFVRCFEILEEMENN-G  477

Query  1167  LLHNEGKYGDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMI  1310
             L  N   YG      + +LC++GR++E    L  M+  ++ + P A +
Sbjct  478   LNPNVITYGS----LINSLCKDGRLLEADVVLSDMI--SRGVKPNAQV  519



>ref|XP_010418730.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like, partial [Camelina sativa]
Length=856

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 90/206 (44%), Gaps = 25/206 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  344   YSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREM-  402

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V+ V      M  +H  + PN+ TY  L++ +
Sbjct  403   -ASVGIKKDVVTYNALLGGYGKQGKYDEVKKV---FTEMKREH--VLPNLLTYSTLIDGY  456

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  457   SKGGLYKEAMEIFREFKS--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  506

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSW  1346
             M K+   I P  +     Y +++ ++
Sbjct  507   MTKEG--ISPNVVT----YNSIIDAF  526



>ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica]
 gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica]
Length=589

 Score = 60.1 bits (144),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 87/188 (46%), Gaps = 21/188 (11%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             KV+    + G+     IY++LI   CK+GD   A ++  EME        F +N L+S+ 
Sbjct  185   KVYKNMIQAGVVPNVHIYNVLIHACCKSGDTEKADSLVGEMELKCIFPDLFTYNTLISLY  244

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
             +  G+   A +  + ME   A + PD  TYN +I A+ R     R+++  +L      + 
Sbjct  245   SKRGMHYEALSVQDRME--RAGVSPDMVTYNSLIYAFCRE---GRMREAVKLF----REI  295

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSL--YLR  1217
             K   PN  TY  L++ + +   + EA+R    +K           +G Y   ++    LR
Sbjct  296   KGATPNHVTYTTLIDGYCRVHDLEEALRLCEVMK----------AKGLYPGVVTYNSILR  345

Query  1218  ALCREGRI  1241
              LC +GR+
Sbjct  346   KLCEDGRM  353



>ref|XP_004156125.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At2g02150-like [Cucumis sativus]
Length=822

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 106/261 (41%), Gaps = 40/261 (15%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +S + +   K F      G+  +   Y+++I+  CK GD  N+  +  +M   G    
Sbjct  205   LSKSGNGQLVRKFFNDMIGAGIAPSVFTYNVMIDYLCKEGDLENSRRLFVQMREMGLSPD  264

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L+      G  E   + F  M+  +    PD  TYN +I  Y + E   R  + 
Sbjct  265   VVTYNSLIDGYGKVGSLEEVASLFNEMK--DVGCVPDIITYNGLINCYCKFEKMPRAFEY  322

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK---------------  1145
                +      +  L+PN+ TY  L++ F K  +++ AI+    ++               
Sbjct  323   FSEM-----KNNGLKPNVVTYSTLIDAFCKEGMMQGAIKLLXDMRRTGLLPNEFTYTSLI  377

Query  1146  -------NFEGGMRLLHNEGKYGDPLSLY-----LRALCREGRIVELLEALEAMLKDNQT  1289
                    N     +LL++  + G  L++      L  LC+ GR++E  E   +MLKD   
Sbjct  378   DANCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALLDGLCKAGRMIEAEEVFRSMLKDG--  435

Query  1290  IPPRAMILSRKYRTLVSSWIE  1352
             I P   +    Y  LV  +I+
Sbjct  436   ISPNQQV----YTALVHGYIK  452



>ref|XP_010692200.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris]
Length=802

 Score = 43.1 bits (100),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  711   GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLS--------VQA  866
             G+    QIY+++I   C AG    A  + +EM     + T   +N L+S         +A
Sbjct  519   GVLPNAQIYNMIIAGQCNAGKFQAAFGLYHEMLRNNVVPTLVTYNSLISGLCKKGKLQEA  578

Query  867   TCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHK  1046
              C +P +   T  N       + PD  TYN +I  Y+ A  + +   + E +  M     
Sbjct  579   ECLLPHI---TGRN-------LAPDAITYNCLILGYSGAGKFSKSLSLYESMKKM-----  623

Query  1047  RLQPNMRTYVLLVECFSK  1100
              ++P + TY  L+   +K
Sbjct  624   GIKPTLSTYHTLISGCTK  641


 Score = 36.6 bits (83),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  410  VIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFG  589
            ++  M + GL P   +F+ LI       ++E A   + +   +G+ P  ET+  LI  +G
Sbjct  406  ILEKMDSVGLRPSFVTFNSLIKKFCELGNMEEAEKWMVKMKDKGVAPTSETYNILIDGYG  465

Query  590  SKGLATRGLEILAAMEN  640
               +  R  E+L +MEN
Sbjct  466  RNHMIDRSFEVLESMEN  482



>ref|NP_180698.1| pentatricopeptide-repeat protein GUN1 [Arabidopsis thaliana]
 sp|Q9SIC9.1|PP178_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD26479.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08542.1| genomes uncoupled 1 protein [Arabidopsis thaliana]
Length=918

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 92/222 (41%), Gaps = 29/222 (13%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  412   YSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREM-  470

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V+ V      M  +H  + PN+ TY  L++ +
Sbjct  471   -ASVGIKKDVVTYNALLGGYGKQGKYDEVKKV---FTEMKREH--VLPNLLTYSTLIDGY  524

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  525   SKGGLYKEAMEIFREFKS--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  574

Query  1269  MLKDNQTIPPRAMILSRKYRTLVSSWIEPLQEEAELGYEIDY  1394
             M K+   I P  +          +S I+     A +    DY
Sbjct  575   MTKEG--ISPNVVTY--------NSIIDAFGRSATMDRSADY  606



>ref|XP_010510200.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Camelina sativa]
Length=934

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 81/184 (44%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  422   YSTVIDGFAKAGRFEEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREM-  480

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                  +K D  TYN ++  Y +   YD V+ V      M  +H  + PN+ TY  L++ +
Sbjct  481   -ASVGIKKDVVTYNALLGGYGKQGKYDEVKKV---FTEMKREH--VLPNLLTYSTLIDGY  534

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  FR  K+   G+R         D +  S  + ALC+ G +   +  ++ 
Sbjct  535   SKGGLYKEAMEIFREFKS--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLIDE  584

Query  1269  MLKD  1280
             M K+
Sbjct  585   MTKE  588



>ref|XP_010240633.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Brachypodium distachyon]
Length=595

 Score = 56.6 bits (135),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 93/209 (44%), Gaps = 13/209 (6%)
 Frame = +3

Query  690   FFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQAT  869
             F K  +GGL+    IY+ L+   CK+G   +AL +  EM        TF +N L+   A 
Sbjct  333   FTKIKEGGLKLDVYIYETLLRACCKSGRMQSALAVTREMSTQKIARNTFVYNILIDGWAR  392

Query  870   CGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKR  1049
              G    A    + M+  E  + P+  TY   I A  +A    R Q V E +  +      
Sbjct  393   RGDVWEAADLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAQKVIEEMADV-----G  445

Query  1050  LQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL-SLYLRALC  1226
             L+PN++TY  L++ ++K  +   A++ F  +K   G   L  +E  Y   + SL  RA  
Sbjct  446   LKPNLKTYTTLIKGWAKASLPDRALKSFEEMK-LAG---LKPDEAAYHCLVTSLLSRATV  501

Query  1227  REGRI-VELLEALEAMLKDNQTIPPRAMI  1310
              EG     +L     M +++ T+  R  +
Sbjct  502   MEGSTYTGILSICREMFENDLTVDMRTAV  530


 Score = 23.1 bits (48),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 17/64 (27%), Positives = 27/64 (42%), Gaps = 0/64 (0%)
 Frame = +2

Query  443  PGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGLEI  622
            P  R+F  +I    +  D++ A++ L      G  P   T+ ALI     K    R + +
Sbjct  238  PSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYNALIHGLIKKNQVERAVSV  297

Query  623  LAAM  634
            L  M
Sbjct  298  LNKM  301


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 94/235 (40%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA  +F +  K GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  180   FIHLHDFANAFSIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPS  239

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A    + M    +   P   TYN +I    +    +R   V
Sbjct  240   NRAFRPIIEGFAVAGDMKRALNILDLMR--RSGCAPTVMTYNALIHGLIKKNQVERAVSV  297

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
                + +       + PN  TY +++  ++    + +A  +F  +K  EGG++L       
Sbjct  298   LNKMSI-----AGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIK--EGGLKL-------  343

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M    Q I     +    Y  L+  W
Sbjct  344   --DVYIYETLLRACCKSGRMQSALAVTREM--STQKIARNTFV----YNILIDGW  390



>ref|XP_009126254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 
[Brassica rapa]
Length=506

 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 92/211 (44%), Gaps = 20/211 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAG-RM  824
             LV S  +  A K+   G K  GL+    I+++L++  CK+GD  +A  +  EM+ +G   
Sbjct  169   LVDSKEVGLAKKLLLYGKKNLGLQPNTCIFNILVKHHCKSGDVDSAFGVVEEMKRSGLSY  228

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
                  ++ L+         + A   FE+M   E  + PD  T+N +I  + RA   +R +
Sbjct  229   PNLITYSTLMECLFVQSRSKEAMELFEDMISKEG-ISPDPVTFNVMINGFCRAGEVERGK  287

Query  1005  DVAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEG  1184
              + E +           PN+  Y  L+  F K    +EA   F  +K  E G++L     
Sbjct  288   MIIEFM-----KKNGCNPNVYNYSALMNGFCKEGRAQEAKEVFDEVK--ETGLKL-----  335

Query  1185  KYGDPL--SLYLRALCREGRIVELLEALEAM  1271
                D +  +  +   CR G + E +E L  M
Sbjct  336   ---DTVGYTTLMNCFCRNGEVDEAMELLGEM  363



>dbj|BAJ97477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=913

 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 56/235 (24%), Positives = 96/235 (41%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA ++F +  K GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  497   FIHLHDFTNAFRIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPS  556

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A    + M    +   P   TYN +I    R    +R   V
Sbjct  557   NRAFRPIIEGFAVAGDMKRALDILDLMR--RSGCAPTVMTYNALIHGLIRKNQVERAVSV  614

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
                + +       + PN  TY +++  ++    + +A  +F  +K  EGG++L       
Sbjct  615   LNKMSI-----AGITPNEHTYTIIMRGYAATGDIAKAFEYFTKIK--EGGLKL-------  660

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M   +Q I     +    Y  L+  W
Sbjct  661   --DVYIYETLLRACCKSGRMQSALAVTREM--SSQKIARNTFV----YNILIDGW  707


 Score = 56.6 bits (135),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 98/219 (45%), Gaps = 13/219 (6%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             +  +  A + F K  +GGL+    IY+ L+   CK+G   +AL +  EM +      TF 
Sbjct  640   TGDIAKAFEYFTKIKEGGLKLDVYIYETLLRACCKSGRMQSALAVTREMSSQKIARNTFV  699

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R Q V + 
Sbjct  700   YNILIDGWARRGDVWEAADLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAQTVIDE  757

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDP  1199
             +  +      L+PN++TY  L++ +++  +   A++ F  +K   G   L  +E  Y   
Sbjct  758   MSDV-----GLKPNLKTYTTLIKGWARASLPDRALKCFEEMK-LAG---LKPDEAAYHCL  808

Query  1200  L-SLYLRALCREGRI-VELLEALEAMLKDNQTIPPRAMI  1310
             + SL  RA   EG     +L     M +++ T+  R  +
Sbjct  809   VTSLLSRATVMEGSTYTGILSVCREMFENDLTVDMRTAV  847


 Score = 21.9 bits (45),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 27/66 (41%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I    +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  553  MQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYNALIHGLIRKNQVERAV  612

Query  617  EILAAM  634
             +L  M
Sbjct  613  SVLNKM  618



>ref|XP_011099085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Sesamum indicum]
 ref|XP_011099086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Sesamum indicum]
Length=588

 Score = 60.1 bits (144),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 17/208 (8%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
              LV+    +   K++ K  K G+     +Y++LI   CK+GD   A  +  EME      
Sbjct  171   SLVKERLTDTVWKIYKKMIKVGVLPNLHVYNVLIHACCKSGDVKKAEELLSEMELKNIFP  230

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
               F +N L+S+    G+   A +  + ME G   + PD  T+N +I +Y R     R+++
Sbjct  231   DLFTYNTLISLYCKKGMHYEALSVLDKMERGG--VCPDIITHNSLIYSYCRE---GRMRE  285

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                L     ++ +   PN  TY  L++ + +   + EA++    L++      L      
Sbjct  286   ALRLF----KEIRGASPNHVTYTTLIDGYCRVGDIDEALQ----LRDIMVAKELYPGVVT  337

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAM  1271
             Y    ++ LR LC EGRI +  + L  M
Sbjct  338   Y----NVILRKLCEEGRIQDANKLLNEM  361



>ref|XP_010692201.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris]
Length=813

 Score = 43.1 bits (100),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  711   GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLS--------VQA  866
             G+    QIY+++I   C AG    A  + +EM     + T   +N L+S         +A
Sbjct  519   GVLPNAQIYNMIIAGQCNAGKFQAAFGLYHEMLRNNVVPTLVTYNSLISGLCKKGKLQEA  578

Query  867   TCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHK  1046
              C +P +   T  N       + PD  TYN +I  Y+ A  + +   + E +  M     
Sbjct  579   ECLLPHI---TGRN-------LAPDAITYNCLILGYSGAGKFSKSLSLYESMKKM-----  623

Query  1047  RLQPNMRTYVLLVECFSK  1100
              ++P + TY  L+   +K
Sbjct  624   GIKPTLSTYHTLISGCTK  641


 Score = 36.6 bits (83),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  410  VIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFG  589
            ++  M + GL P   +F+ LI       ++E A   + +   +G+ P  ET+  LI  +G
Sbjct  406  ILEKMDSVGLRPSFVTFNSLIKKFCELGNMEEAEKWMVKMKDKGVAPTSETYNILIDGYG  465

Query  590  SKGLATRGLEILAAMEN  640
               +  R  E+L +MEN
Sbjct  466  RNHMIDRSFEVLESMEN  482



>ref|XP_010048296.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Eucalyptus grandis]
Length=1113

 Score = 44.7 bits (104),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 71/165 (43%), Gaps = 7/165 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  L +A ++FFK      +     Y  L+++    GD  +      EME  G    
Sbjct  309   LCNAGKLNDAKELFFKMRNSSQKPDRVAYITLLDKFSDRGDVESVRQFWNEMENDGYDPD  368

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +  L++     G  + AFAT + M+  +  + P+  TYN +I       S +R+ D 
Sbjct  369   VVIYTILVNAFCKAGNMDEAFATLDVMK--KQRILPNLHTYNTLICGLL---SVNRLNDA  423

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
               + G M  +   ++P   TY+L ++ + K    + A+  F  +K
Sbjct  424   LGIFGSM--ESLGVKPTAYTYILFIDYYGKKGDCKSALETFNNMK  466


 Score = 35.0 bits (79),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGL  601
            M++ GL P  +++  ++V+     + E  M  L+   + GL+P   TF   IR+ G  G 
Sbjct  220  MVSEGLKPSMKTYSAIMVALGKRRNTEMVMSLLKEMENLGLKPNIYTFTICIRVLGRAGK  279

Query  602  ATRGLEILAAME  637
                 EIL  M+
Sbjct  280  IDEAHEILKRMD  291



>ref|XP_010525903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010525904.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=1115

 Score = 48.9 bits (115),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 13/168 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  L+ A  VF +   G  +     Y  ++++   +GD  +      EME  G    
Sbjct  306   LCTAGRLDCAKDVFLEMKTGRHKPDRVTYITMLDKFSDSGDLESVRRFWVEMEMDGYAPD  365

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  L+      G    AF T ++M   E  + P+  TYN +I    RA   +R++D 
Sbjct  366   VVTFTILVDALCKVGNFGEAFNTLDSMR--EQGVSPNLHTYNTLICGLLRA---NRLEDA  420

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFE  1154
              E+   M  D   ++P   TY+L ++ + K      A    RAL+ FE
Sbjct  421   MEIFDNM--DSLGVEPTAYTYILFIDYYGK------AGDSVRALETFE  460


 Score = 30.8 bits (68),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (47%), Gaps = 0/73 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGL  601
            M++ G  P  +++  L+ +     D+E  M  L+   + GL+P   TF   IR+ G  G 
Sbjct  217  MVSEGHRPSLQTYSALMGALGKRRDIEAVMGLLKEMENLGLKPNVYTFTICIRVLGRAGK  276

Query  602  ATRGLEILAAMEN  640
                  IL  M++
Sbjct  277  IDEAYGILKRMDD  289


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 101/222 (45%), Gaps = 17/222 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L+R+N LE+A ++F      G+  T   Y L I+   KAGD   AL    +M+A G +  
Sbjct  411   LLRANRLEDAMEIFDNMDSLGVEPTAYTYILFIDYYGKAGDSVRALETFEKMKARGIVPN  470

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                 N  L   A  G    A   F  ++     + PD+ TYN +++ Y++A   D   + 
Sbjct  471   IVACNASLYSLADAGRLREAKQIFFGLK--NIGLTPDSVTYNMMMKCYSKAGEID---EA  525

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
             ++LL  M+E+    +P++     L+    K   V EA + F+ +K     M+L      Y
Sbjct  526   SKLLSEMLENG--CEPDVIVINSLINTLYKADRVDEAWQMFKKMKE----MQLNPTVVTY  579

Query  1191  GDPLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMILS  1316
                 +  L  L ++G++ E +E  E M ++    PP  +  +
Sbjct  580   ----NTLLTGLGKDGKVHEAIELFEGMTRNG--CPPNTITFN  615



>ref|XP_008437970.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950 
[Cucumis melo]
Length=606

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 102/233 (44%), Gaps = 25/233 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L + + LE+A K++F+    G R  +  Y+ LI   CK G+   A+ +  EM  +G   T
Sbjct  342   LCKMSRLEDARKLWFEMIDKGFRPNEYSYNTLIYGFCKIGNLDEAMKLYKEMLDSGYKET  401

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
             T   N L+      G  + A+  F  M      +  D  TYN +IQ + R     +V   
Sbjct  402   TLSCNTLILGLCLHGRTDEAYDFFREMPCKS--IVCDVITYNTLIQGFCRE---GKVLQS  456

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
              +LL  +    K +QP+  +Y  L++   +   V+EA   +  +          HN G  
Sbjct  457   IDLLKEL--QAKGVQPSTSSYTHLIQKLCQLGNVQEAKEMWNDM----------HNRGL-  503

Query  1191  GDPLSL----YLRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLV  1337
               P+       +  LC +G +VE +E L  MLK N  + P+     +  ++L+
Sbjct  504   -QPMVCTRDHIISGLCEKGCVVEGMEWLITMLKSN--LKPQKKTFCKLIQSLI  553



>ref|XP_006405706.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum]
 gb|ESQ47159.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum]
Length=619

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 90/202 (45%), Gaps = 20/202 (10%)
 Frame = +3

Query  648   ELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMA  827
              LV+    +   K+F K  K G+ A   +Y++L+    K+GDH  A  +  EME  G   
Sbjct  200   SLVKERLTDTVWKIFKKMVKLGVVANIHLYNVLVHACSKSGDHERAEKLLSEMEEKGVFP  259

Query  828   TTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
               F +N L+S     G+   A +  + M+   + + PD  TYN +I  + R     R+++
Sbjct  260   DLFTYNTLISAYCRKGMHYEALSVQDRMQ--RSGVGPDIVTYNSLIHGFCRE---GRMKE  314

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL--KNFEGGMRLLHNE  1181
                L     E    +  N  TY  L++ + +   + EA+R    +  + F  G+ + +N 
Sbjct  315   ATRLFR---EIKGVVTANHVTYTTLIDGYCRMNDIDEALRLREVMEARGFSPGV-VTYNS  370

Query  1182  GKYGDPLSLYLRALCREGRIVE  1247
                       LR LC +GRI E
Sbjct  371   ---------ILRKLCEDGRIRE  383



>ref|XP_011021152.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Populus euphratica]
Length=593

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 83/186 (45%), Gaps = 17/186 (9%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             K++ K  K G+ +   +Y++L+   CK+GD   A  +  EME        F +N L+S+ 
Sbjct  192   KIYKKMVKLGVVSNIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTYNTLISLY  251

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G+   A    + ME   A + PD  TYN +I  + R     R+++  +L      D 
Sbjct  252   CKKGMHYEALCAQDRMEM--AGISPDIVTYNALIYGFCRE---GRMREAVQLF----RDI  302

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRAL  1223
             K + PN  TY  L++ + +   + EA+R    LK       L  N   Y       LR L
Sbjct  303   KDVTPNHVTYTSLIDGYCRVNDLDEALR----LKEVMSEKGLYPNIITYNS----ILRKL  354

Query  1224  CREGRI  1241
             C  GR+
Sbjct  355   CEGGRL  360



>ref|XP_010267950.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Nelumbo nucifera]
Length=868

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 88/184 (48%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM+  G       +N LLS+ A  G  E A +  + ME
Sbjct  364   YSTMIDGYAKAGRLDEALNLFNEMKFVGIGLDRVSYNTLLSIYAKLGRFEEALSVCKEME  423

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + +K D  TYN ++  Y +   YD V+++ E   M  E+   + PN+ TY  +++ +
Sbjct  424   --SSGIKKDAVTYNALLGGYGKQGKYDEVKELFE--EMKAEN---VTPNVLTYSTMIDAY  476

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA+  F   K  + G++         D +  S  + ALC+ G +   +  L+ 
Sbjct  477   SKGGMYKEAMDAFGEFK--QAGLK--------ADVVLYSALIDALCKNGLVESAVSLLDE  526

Query  1269  MLKD  1280
             M ++
Sbjct  527   MTRE  530



>gb|KCW80548.1| hypothetical protein EUGRSUZ_C01897 [Eucalyptus grandis]
Length=947

 Score = 44.7 bits (104),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 71/165 (43%), Gaps = 7/165 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  L +A ++FFK      +     Y  L+++    GD  +      EME  G    
Sbjct  167   LCNAGKLNDAKELFFKMRNSSQKPDRVAYITLLDKFSDRGDVESVRQFWNEMENDGYDPD  226

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +  L++     G  + AFAT + M+  +  + P+  TYN +I       S +R+ D 
Sbjct  227   VVIYTILVNAFCKAGNMDEAFATLDVMK--KQRILPNLHTYNTLICGLL---SVNRLNDA  281

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
               + G M  +   ++P   TY+L ++ + K    + A+  F  +K
Sbjct  282   LGIFGSM--ESLGVKPTAYTYILFIDYYGKKGDCKSALETFNNMK  324


 Score = 34.7 bits (78),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = +2

Query  422  MIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGL  601
            M++ GL P  +++  ++V+     + E  M  L+   + GL+P   TF   IR+ G  G 
Sbjct  78   MVSEGLKPSMKTYSAIMVALGKRRNTEMVMSLLKEMENLGLKPNIYTFTICIRVLGRAGK  137

Query  602  ATRGLEILAAME  637
                 EIL  M+
Sbjct  138  IDEAHEILKRMD  149



>ref|XP_011013222.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Populus euphratica]
Length=593

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 88/188 (47%), Gaps = 21/188 (11%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             K++ K  K G+ +   +Y++L+   CK+GD   A  +  EME        F +N L+S+ 
Sbjct  192   KIYKKMVKLGVVSNIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTYNTLISLY  251

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G+   A    + ME   A + PD  TYN +I  + R     R+++  +L      D 
Sbjct  252   CKKGMHYEALCAQDRMEM--AGISPDIVTYNALIYGFCRE---GRMREAVQLF----RDI  302

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSL--YLR  1217
             K + PN  TY  L++ + +   + EA+R    LK       ++  +G Y + ++    LR
Sbjct  303   KDVTPNHVTYTSLIDGYCRVNDLDEALR----LK------EVMSEKGLYPNIITYNSILR  352

Query  1218  ALCREGRI  1241
              LC  GR+
Sbjct  353   KLCEGGRL  360



>ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citrus clementina]
 gb|ESR57773.1| hypothetical protein CICLE_v10018807mg [Citrus clementina]
Length=877

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (48%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL +  EM+  G       +N +LS+ A  G  E A    + ME
Sbjct  372   YSTMIDGYAKAGRLDDALNMFSEMKFLGIGLDRVSYNTVLSIYAKLGRFEEALLVCKEME  431

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V+ + E    M  D   + PN+ TY  L++ +
Sbjct  432   --SSGIRKDAVTYNALLGGYGKQGKYDEVRRMFE---QMKAD--CVSPNLLTYSTLIDVY  484

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA++ FR  K  + G++         D +  S  + ALC+ G +   +  L+ 
Sbjct  485   SKGGLYKEAMQIFREFK--QAGLK--------ADVVLYSALIDALCKNGLVESAVSLLDE  534

Query  1269  MLKD  1280
             M K+
Sbjct  535   MTKE  538



>ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Citrus sinensis]
 gb|KDO86952.1| hypothetical protein CISIN_1g002814mg [Citrus sinensis]
Length=877

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (48%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL +  EM+  G       +N +LS+ A  G  E A    + ME
Sbjct  372   YSTMIDGYAKAGRLDDALNMFSEMKFLGIGLDRVSYNTVLSIYAKLGRFEEALLVCKEME  431

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V+ + E    M  D   + PN+ TY  L++ +
Sbjct  432   --SSGIRKDAVTYNALLGGYGKQGKYDEVRRMFE---QMKADC--VSPNLLTYSTLIDVY  484

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA++ FR  K  + G++         D +  S  + ALC+ G +   +  L+ 
Sbjct  485   SKGGLYKEAMQIFREFK--QAGLK--------ADVVLYSALIDALCKNGLVESAVSLLDE  534

Query  1269  MLKD  1280
             M K+
Sbjct  535   MTKE  538



>emb|CDY10802.1| BnaA05g11340D [Brassica napus]
Length=849

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 83/186 (45%), Gaps = 23/186 (12%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL +  EM   G       +N LLS+    G  E A      M 
Sbjct  359   YSTVIDGFAKAGRFDDALCLFDEMRYLGIALDRVSYNTLLSIYTKVGRDEEALDVLREM-  417

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKR--LQPNMRTYVLLVE  1088
                  +K D  TYN ++  Y +   Y  V+ V        ++ KR  + PN+ TY  L++
Sbjct  418   -ASVGIKKDVVTYNALLGGYGKRGKYVEVESV-------FDEMKREGVLPNLLTYSTLID  469

Query  1089  CFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEAL  1262
              +SK  + REA+  FR  K+   G+R        GD +  S  + ALC+ G +   +  +
Sbjct  470   VYSKGGLYREAMEVFREFKSV--GLR--------GDVVLYSALIDALCKSGLVGSAVSLI  519

Query  1263  EAMLKD  1280
             + M K+
Sbjct  520   DEMSKE  525



>ref|XP_008452843.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Cucumis melo]
Length=1113

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 74/165 (45%), Gaps = 7/165 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L  +  LENA ++F K    G +    IY  L+++    GD         +MEA G M  
Sbjct  307   LCNAGQLENAKELFVKMKANGHKPDQVIYITLLDKFNDFGDLDTFKEFWNQMEADGYMPD  366

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  L+      G    AFATF+ M   +  + P+  TYN +I    RA    R++D 
Sbjct  367   VVTFTILVDALCKAGDFVEAFATFDVMR--KQGILPNLHTYNSLICGLLRA---GRIEDA  421

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
              +LL  M  +   ++P   TY++ ++ F K     +A+  F  +K
Sbjct  422   LKLLDTM--ESVGVRPTAYTYIIFIDYFGKSGDTGKAVETFEKMK  464


 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (43%), Gaps = 8/154 (5%)
 Frame = +3

Query  684   KVFFKGAK-GGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSV  860
             K  F G +  GL      Y+++++   K G    A+ +  EM   G        N L+  
Sbjct  492   KTMFNGLRENGLAPDSVTYNMMMKCYSKVGQVDEAVNLLSEMIRNGCEPDVIVVNSLIDS  551

Query  861   QATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVED  1040
                 G  + A+  F+ M+  +  + P   TYN ++    +     RVQ   EL   M+E 
Sbjct  552   LYKAGRVDEAWQMFDRMK--DMKLSPTVVTYNTLLSGLGKE---GRVQKAIELFESMIE-  605

Query  1041  HKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL  1142
              +R  PN  ++  L++CF K   V  A++ F  +
Sbjct  606   -QRCSPNTISFNTLLDCFCKNDEVELALKMFSKM  638


 Score = 32.7 bits (73),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (46%), Gaps = 0/68 (0%)
 Frame = +2

Query  434  GLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRG  613
            G+ P   +++ LI   +    +E A+  L    S G+RP   T++  I  FG  G   + 
Sbjct  397  GILPNLHTYNSLICGLLRAGRIEDALKLLDTMESVGVRPTAYTYIIFIDYFGKSGDTGKA  456

Query  614  LEILAAME  637
            +E    M+
Sbjct  457  VETFEKMK  464



>gb|KCW89260.1| hypothetical protein EUGRSUZ_A01557 [Eucalyptus grandis]
Length=820

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/148 (26%), Positives = 70/148 (47%), Gaps = 7/148 (5%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +   +E A ++  K    GL     +Y+ L+   C+  D   A+++  +ME AG    
Sbjct  368   LCKEGKVEKAVEILDKLIANGLDPDVAVYNTLVSGYCQRNDLDGAVSMIEQMEVAGVKPN  427

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
             +  FNCL+S    C + ++  A +   +  E  +  + ET+N +I  Y R   +DR   +
Sbjct  428   SVSFNCLIS--KVCEMKKMESAEYWVKKMLEKGVSANVETFNILIDGYGRMCHFDRCFQI  485

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECF  1094
              E +     ++  L+PN+ +Y  L+ C 
Sbjct  486   LEQM-----ENNGLKPNVVSYGSLIHCL  508



>gb|KFK25485.1| hypothetical protein AALP_AA8G120600 [Arabis alpina]
Length=820

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 73/166 (44%), Gaps = 13/166 (8%)
 Frame = +3

Query  711   GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVA  890
             G+    +IY++LI+  C  G   +A   + EM   G       +N L++  +  G  ++A
Sbjct  530   GVLPNARIYNMLIDGCCSKGKIKDAFRFSEEMVKEGIDLNLVTYNTLINGLSLTG--KLA  587

Query  891   FATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKR--LQPNM  1064
              A    +E      +PD  TYN ++  Y    +  R   VA     + ED KR  ++PN+
Sbjct  588   EAEDLLLEISRKGFEPDIYTYNSLLSGYEHGGNVQRC--VA-----LYEDMKRSGVKPNL  640

Query  1065  RTYVLLVECFSKYCV--VREAIRHFRALKNFEGGMRLLHNEGKYGD  1196
             +TY LL+   SK  +    +         +F    R+LH    +GD
Sbjct  641   KTYHLLINACSKEGIELTEKIFGEMLVEPDFSVYSRVLHCYALHGD  686


 Score = 33.5 bits (75),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 0/88 (0%)
 Frame = +2

Query  377  ARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLH  556
             R  D+ G    I  M   GL P   +++ +I S     ++E A   + +   +G+ P  
Sbjct  406  CRKGDLVGARMKIEAMEKQGLKPDHLAYNCVIRSFCELGEMENAEREVNQMKLKGVSPSV  465

Query  557  ETFVALIRLFGSKGLATRGLEILAAMEN  640
            ET+  LI  +G KG   +  + L  MEN
Sbjct  466  ETYNILIGGYGRKGEFDKCFDTLKEMEN  493



>ref|XP_004298631.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150-like [Fragaria vesca subsp. vesca]
Length=760

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 92/196 (47%), Gaps = 16/196 (8%)
 Frame = +3

Query  690   FFKGAKG-GLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQA  866
             FFK   G G+  +   ++++I   CK GD   A  +  +M+  G       +N L+    
Sbjct  261   FFKDMLGAGVSPSVFTFNIMIGYTCKGGDMETARCLFAQMKQLGLTPDIVTYNSLIDGYG  320

Query  867   TCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHK  1046
               G+ + +   FE M+  +A  +PD  TYN +I  + +   ++++      L  M+ +  
Sbjct  321   KVGLLDDSVCIFEEMK--DAGCEPDLITYNALINCFCK---FEKMPQAFNFLREMMRNG-  374

Query  1047  RLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALC  1226
              L+PN+ TY  L++ F K  ++ EAI+ F  +K     + L  NE  Y    +  + A C
Sbjct  375   -LKPNVITYSTLIDAFCKEGMMLEAIKIFIDMKR----VGLSANEFTY----TSLIDASC  425

Query  1227  REGRIVELLEALEAML  1274
             + G + + L+    ML
Sbjct  426   KAGNLSQALKFRNEML  441



>gb|EMT10625.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=824

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 98/235 (42%), Gaps = 27/235 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
              +  +   NA ++F +  K GL+    IY+LLIE  CK G+   A+ I  +M+      +
Sbjct  408   FIHLHDFTNAFRIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPS  467

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                F  ++   A  G  + A    + M    +   P   TYN +I    R    +R   V
Sbjct  468   NRAFRPIIEGFAVAGDMKRALDILDLMR--RSGCAPTVMTYNALIHGLIRKNQVERA--V  523

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
             + L  M +     + PN  TY +++  ++    + +A  +F  +K  EGG++L       
Sbjct  524   SVLNKMYIAG---ITPNEHTYTIIMRGYAATGDIAKAFEYFTKIK--EGGLKL-------  571

Query  1191  GDPLSLY---LRALCREGRIVELLEALEAMLKDNQTIPPRAMILSRKYRTLVSSW  1346
                + +Y   LRA C+ GR+   L     M   +Q I     +    Y  L+  W
Sbjct  572   --DVYIYETLLRACCKSGRMQSALAVTREM--SSQKISRNTFV----YNILIDGW  618


 Score = 56.6 bits (135),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 98/219 (45%), Gaps = 13/219 (6%)
 Frame = +3

Query  660   SNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFH  839
             +  +  A + F K  +GGL+    IY+ L+   CK+G   +AL +  EM +      TF 
Sbjct  551   TGDIAKAFEYFTKIKEGGLKLDVYIYETLLRACCKSGRMQSALAVTREMSSQKISRNTFV  610

Query  840   FNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAEL  1019
             +N L+   A  G    A    + M+  E  + P+  TY   I A  +A    R Q V + 
Sbjct  611   YNILIDGWARRGDVWEAADLMKQMK--EDGVPPNIHTYTSYINACCKAGDMQRAQTVIDE  668

Query  1020  LGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDP  1199
             +  +      L+PN++TY  L++ +++  +   A++ F  +K   G   L  +E  Y   
Sbjct  669   MADV-----GLKPNLKTYTTLIKGWARASLPDRALKCFEEMK-LAG---LKPDEAAYHCL  719

Query  1200  L-SLYLRALCREGRI-VELLEALEAMLKDNQTIPPRAMI  1310
             + SL  RA   EG     +L     M +++ T+  R  +
Sbjct  720   VTSLLSRATVMEGSTYTGILSVCREMFENDLTVDMRTAV  758


 Score = 21.9 bits (45),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 27/66 (41%), Gaps = 0/66 (0%)
 Frame = +2

Query  437  LYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFGSKGLATRGL  616
            + P  R+F  +I    +  D++ A+  L      G  P   T+ ALI     K    R +
Sbjct  464  MQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYNALIHGLIRKNQVERAV  523

Query  617  EILAAM  634
             +L  M
Sbjct  524  SVLNKM  529



>ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=625

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 86/188 (46%), Gaps = 21/188 (11%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             KV+ K A+ G+ A   +Y++LI   CK+GD   A  +  EME+       F +N L+S+ 
Sbjct  186   KVYKKMARIGVEANIHVYNVLIHACCKSGDVEKADNLLSEMESKCVFPDLFTYNTLISLY  245

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                G+   A +  + ME     +KPD  TYN +I  + +     R+++   L     ++ 
Sbjct  246   CKKGMHYEALSVQDRME--REGIKPDIVTYNSLIHGFCKE---GRMREAMRLF----KEI  296

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSL--YLR  1217
             +   PN  TY  L++    YC + +  +  R  +  E        +G Y   ++    LR
Sbjct  297   RDATPNHVTYTTLID---GYCRLNDLDQALRLREEMEA-------QGLYPTVVTYNSILR  346

Query  1218  ALCREGRI  1241
              LC  GRI
Sbjct  347   KLCEIGRI  354



>gb|KDP42034.1| hypothetical protein JCGZ_03097 [Jatropha curcas]
Length=736

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/275 (23%), Positives = 121/275 (44%), Gaps = 33/275 (12%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L ++  L++A K F +     L+    IYD  I+  C+ G  S+A  +  +ME  G   T
Sbjct  397   LCKAGRLDDAKKKFIEMMGKNLQPDSAIYDTFIQSFCREGKISSAFRVLKDMEKKGCNKT  456

Query  831   TFHFNCLL-SVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N L+  + +   I EV +   + M+  E  + P+  TYN V+          R++D
Sbjct  457   LQTYNSLIQGLGSKNQIFEV-YGMIDEMK--EKGVSPNVSTYNMVLNCLCEG---GRIKD  510

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
                +L  M+++   + PN+ ++ +L++ F K    + A   F    N  G     HNE  
Sbjct  511   APSVLDEMLQNG--ISPNISSFRMLIKAFCKASDFKTAHEVFDIALNMCG-----HNEAL  563

Query  1188  YGDPLS------------LYLRALCREGRIVELL--EALEAMLKDNQTIPPRAM---ILS  1316
             YG   +            L++ AL R+  +   L  + +E + KD        +   ++ 
Sbjct  564   YGSMFNELLVGDVAEANKLFITALDRDFDLENFLYKDLIERLCKDGMMEAASGVLNKLID  623

Query  1317  RKYRTLVSSWIEPLQEEAELG--YEIDYIARYVAE  1415
             + Y+   +S++  +   +++G  +E D +A  + E
Sbjct  624   KGYQFDPASFMPLIDSFSKMGNKHEADKLAGRMME  658



>ref|XP_011088706.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g17140-like [Sesamum indicum]
Length=869

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 88/209 (42%), Gaps = 18/209 (9%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   LE A K F +     L     +YD+ +   CK G  S+A  +  +ME  G   T
Sbjct  530   LCRDGRLEEAKKKFIEMLGRNLYPDSTVYDIFLYNLCKRGKISSAFQVLKDMEXKGCNKT  589

Query  831   TFHFNCLLSVQATCGIPEVAFATFENM-EYGEAYMKPDTETYNWVIQAYTRAESYDRVQD  1007
                +N L+      GI    F     M E  E  + P+ +TYN V+ +    E   R ++
Sbjct  590   LQTYNWLI---LGLGITNQIFEMLGLMDEMKERGISPNVDTYNIVLDSVCEGE---RTEE  643

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
              A LL  M++  + + PN+ ++ LL++ F +    R A   F    +  G     H E  
Sbjct  644   AATLLDEMLQ--RGITPNIYSFKLLIKTFCRTGEFRPAQEVFEIAVSIGG-----HKEAL  696

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAML  1274
             Y    +L    L   G I+E  +  EA L
Sbjct  697   Y----TLMFNELLAGGEILEAKQLFEAAL  721



>ref|XP_011076945.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Sesamum indicum]
Length=582

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 87/210 (41%), Gaps = 17/210 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L R   L+ A  +       GL      YD LI   CK G    A+     M ++G    
Sbjct  322   LCRDGQLDEAINLLKLMMDEGLTPDTYTYDPLISALCKEGRLDLAIAFLDYMISSGCFPD  381

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDR-VQD  1007
               ++N +LS     G  + A   F  +   E+   PD  TYN ++ A   +    R ++ 
Sbjct  382   IVNYNTILSALCKNGNADEALEVFGKL--AESGCPPDVSTYNTMVSALWNSGDRSRALRL  439

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
             V+E++      HK + P+  TY  L+ C  +  +V  AI     +KN E     L     
Sbjct  440   VSEMI------HKGIDPDEITYNSLISCLCRDGMVDRAIELLGDMKNSE----FLPTVVT  489

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAMLK  1277
             Y    ++ L  LC+  RI E +  LE M+K
Sbjct  490   Y----NIVLLGLCKAHRIGEAISILEEMVK  515



>ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Prunus mume]
Length=589

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 86/188 (46%), Gaps = 21/188 (11%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             KV+    + G+     IY++LI   CK+GD   A ++  EME        F +N L+S+ 
Sbjct  185   KVYKNMIQAGVVPNVHIYNVLIHACCKSGDTDKADSLVGEMELKCIFPDLFTYNTLISLY  244

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
             +  G+   A +  + ME   A + PD  TYN +I A+ R     R+ +  +L      + 
Sbjct  245   SKRGMHYEALSVQDRME--RAGVSPDMVTYNSLIYAFCRE---GRMGEAVKLF----REI  295

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSL--YLR  1217
             K   PN  TY  L++ + +   + EA+R    +K           +G Y   ++    LR
Sbjct  296   KGATPNHVTYTTLIDGYCRVHDLEEALRLCEVMK----------AKGLYPGVVTYNSILR  345

Query  1218  ALCREGRI  1241
              LC +GR+
Sbjct  346   KLCEDGRM  353



>ref|XP_002464340.1| hypothetical protein SORBIDRAFT_01g016560 [Sorghum bicolor]
 gb|EER91338.1| hypothetical protein SORBIDRAFT_01g016560 [Sorghum bicolor]
Length=758

 Score = 47.8 bits (112),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 84/196 (43%), Gaps = 15/196 (8%)
 Frame = +3

Query  684   KVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQ  863
             ++F +    G    +  Y++LI+  C  G   NAL +  EME+ G   +T  +N ++   
Sbjct  428   RLFEEMKSSGCTPDEVTYNILIDHLCSMGKLGNALDLLNEMESNGCPRSTVTYNTIIDAL  487

Query  864   ATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDH  1043
                   E A   F+ M+     +     T+N +I    +A+   R+ D  EL+  MV++ 
Sbjct  488   CKKMRIEEAEEVFDQMD--AQGISRSAVTFNTLIDGLCKAK---RIDDATELIEQMVKEG  542

Query  1044  KRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRAL  1223
               LQPN  TY  ++  + K   +++A      +     G  +  +   YG      +  L
Sbjct  543   --LQPNNITYNSILTHYCKQGNIKKAADILETMT--ANGFEI--DVVTYGT----LINGL  592

Query  1224  CREGRIVELLEALEAM  1271
             C+ GR    L+ L  M
Sbjct  593   CKAGRTQVALKLLRGM  608


 Score = 31.2 bits (69),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/88 (24%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +2

Query  377  ARDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLH  556
            +++ ++    G++  M+  G  P   +F+ LIV+      +E A+   R    +GL P  
Sbjct  348  SKNGELDEAKGIVNQMVDRGCLPDTTTFNTLIVALSSQNRLEEALDLARELTVKGLSPDV  407

Query  557  ETFVALIRLFGSKGLATRGLEILAAMEN  640
             TF  LI      G    G+ +   M++
Sbjct  408  YTFNILINALCKVGDPHLGIRLFEEMKS  435



>emb|CDY19091.1| BnaA04g18310D [Brassica napus]
Length=729

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 99/223 (44%), Gaps = 32/223 (14%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG    AL +  EM+  G       +N LLS+    G  + A      M 
Sbjct  246   YSAVIDGFAKAGRFDEALGLFDEMKYLGIALDRVSYNTLLSIYTKLGRSKEALDVLREM-  304

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDV-AELLGMMVEDHKRLQPNMRTYVLLVEC  1091
                  +K D  TYN ++  Y +  +Y  V++V AE+        +R+ PN+ TY  L++ 
Sbjct  305   -ASVGIKKDVVTYNALLGGYGKQRNYLEVKNVFAEM------KRERVTPNLLTYSTLIDV  357

Query  1092  FSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALE  1265
             +SK  + +EA+  F+  K    G+R         D +  S  + ALC+ G +   +  ++
Sbjct  358   YSKGGLYKEAMEIFKEFKG--AGLR--------ADVVLYSALIDALCKNGLVGSAVSLID  407

Query  1266  AMLKDNQTIPPRAMILSRKYRTLV-----SSWIEPLQEEAELG  1379
              M K+   I P  +     Y +++     S+ +E L E  + G
Sbjct  408   EMTKEG--ISPNVV----TYNSIIDAFGRSATVECLAESGDGG  444



>ref|XP_011032465.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=584

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 90/208 (43%), Gaps = 17/208 (8%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L RSNH++ A  V  K  K G++     +  L+   C  G    A+ +  EM   G    
Sbjct  114   LCRSNHVDFAVSVLGKMFKLGIQPDVITFTTLLNGLCNEGKIKEAVVLFNEMVRQGHEPN  173

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDR-VQD  1007
                +  +++     G   +A   F+ ME  +   KPD  TY+ +I +  +    DR V D
Sbjct  174   VISYTTVINGLCKTGNTSMAVHVFKKME--QHGCKPDVVTYSIIIDSLCK----DRLVND  227

Query  1008  VAELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGK  1187
               E L  M++  + + PN+ TY  +V  F     + EA R F+ +     G  ++ +   
Sbjct  228   AMEFLSEMLD--RGIPPNVVTYSSIVHGFCNLGQLNEATRLFKEMV----GRDVMPDTVT  281

Query  1188  YGDPLSLYLRALCREGRIVELLEALEAM  1271
                 L++ +  LC+EG + E     E M
Sbjct  282   ----LTILVDGLCKEGMVSEAQRVFETM  305



>gb|EMS45043.1| hypothetical protein TRIUR3_16364 [Triticum urartu]
Length=483

 Score = 53.1 bits (126),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/250 (23%), Positives = 101/250 (40%), Gaps = 46/250 (18%)
 Frame = +3

Query  645   KELVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRM  824
             K L  S  +E+A K+F +  + G++    ++  LI+  CKAGD    + +  +M A G M
Sbjct  192   KGLSSSGRIEDATKMFDEMRERGVKPNAIVFTTLIDAHCKAGDVKAGMELYQDMRARGVM  251

Query  825   ATTFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQ  1004
                  +N LL+        E A    E M      +KPD  TY  +I    +    D   
Sbjct  252   PDLVAYNALLNGLCRARNFEAAECIVEEMR--GTGLKPDKVTYTTLIDGCCKDGKLDTAM  309

Query  1005  DVAELLG-----------------------------MMVEDHKR-LQPNMRTYVLLVECF  1094
             D+ + +                              ++VE  +  L+P+  TY ++++ F
Sbjct  310   DIKQKMADEEVALDEVTYTALISGLSKAQRPVDAERILVEMMEAGLEPDNTTYTMVIDAF  369

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLS--LYLRALCREGRIVELLEALEA  1268
              +   V+     F+ LK        + N+G+    ++  + +  LC+ G++      L A
Sbjct  370   CRKGDVKTG---FKLLKE-------MQNKGRKPGVVTYNVIMSGLCKLGQLKNADMLLNA  419

Query  1269  MLKDNQTIPP  1298
             ML  N  +PP
Sbjct  420   ML--NIGVPP  427


 Score = 25.8 bits (55),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 0/73 (0%)
 Frame = +2

Query  380  RDADVSGVSGVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHE  559
            R  D++    V  +M    + P   SF+ LI       D++GA    +     G+ P   
Sbjct  126  RFGDLASARKVFDEMRTRSVQPTVVSFNTLISGMCRARDLDGADELYKGMAQMGITPDVY  185

Query  560  TFVALIRLFGSKG  598
            T+ ALI+   S G
Sbjct  186  TYSALIKGLSSSG  198



>ref|XP_010247065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20300, 
mitochondrial [Nelumbo nucifera]
Length=537

 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 76/163 (47%), Gaps = 7/163 (4%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R+ ++  A +VF +  + G++     Y ++I+  C+ G  + A  +  EM   G    + 
Sbjct  267   RAGNISEAERVFREMKEAGIQPNVYTYSIVIDALCRCGQITRAHDVFAEMLDKGCEPNSI  326

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              FN L+ +    G  E     +  M+       PDT TYN++I+++ R E+   +++  +
Sbjct  327   TFNNLMRIHVKAGRTEKVLQVYNQMK--RLSCPPDTITYNFLIESHCRDEN---LEEAVK  381

Query  1017  LLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALK  1145
             +L  MV+  K   PN  T+  +  C  K   V  A R +  +K
Sbjct  382   VLNQMVK--KGCSPNASTFNPIFRCIFKLKDVNAAHRMYARMK  422



>ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Cucumis sativus]
Length=868

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  + +   KAG   +AL +  EM+  G       +N LLS+ A  G  E A    + M 
Sbjct  366   YSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCKEM-  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
              G + +K D  TYN ++  Y +   ++   +V  +   M +D  R+ PN+ TY  L++ +
Sbjct  425   -GSSGVKKDVVTYNALLDGYGKQGKFN---EVTRVFKEMKKD--RVFPNLLTYSTLIDVY  478

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA+  FR  K  + G++   +L++E          + ALC+ G +   +  L+
Sbjct  479   SKGSLYEEAMEVFREFK--QAGLKADVVLYSE---------LINALCKNGLVDSAVLLLD  527

Query  1266  AMLKD  1280
              M K+
Sbjct  528   EMTKE  532



>ref|XP_010278103.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X3 [Nelumbo nucifera]
Length=691

 Score = 47.4 bits (111),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 17/180 (9%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENM-  911
             Y+ LI   C +G    A+ +  EM   G +     FN L+   +  G+   A+   E M 
Sbjct  394   YNSLIHGLCNSGQRKEAVRLLNEMVLQGTLPDVVTFNTLVDDLSKEGMAREAYELLELMI  453

Query  912   EYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVEC  1091
             + GE   KP+T TYN ++  Y      +  ++V   + M    ++  QP++ TY +L+  
Sbjct  454   QRGE---KPNTTTYNALMDGYCLQGQMEEAREV--FVSMC---NRGCQPDVVTYNILING  505

Query  1092  FSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLEALEAM  1271
               K   + E ++ FR +    G   ++ N   Y   ++     LC  GRIV   E    M
Sbjct  506   HCKNRKIDEGMKIFREM-TLRG---VMPNTTTYNSLIA----GLCHAGRIVSAQELFSEM  557


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 47/101 (47%), Gaps = 17/101 (17%)
 Frame = +2

Query  383  DADVSGVSGVIY-DMIAAGLYPGPRSFHGLIVSHVLNLDVE--GAMHAL---RRELSEGL  544
            + D+   +G I+ DM+  G+ P  R+F+ LI +H    D++  GA+  +   R +  E  
Sbjct  282  NLDLWEEAGKIFKDMMDRGISPNTRTFNILIKAHCKKGDIKEAGALMKVMIQRGQWKEAT  341

Query  545  RPLHE-----------TFVALIRLFGSKGLATRGLEILAAM  634
            R L+E           TF  LI     +G+  +  E+L  M
Sbjct  342  RILNEMVGQGVSPNVVTFNVLIDGLCKEGMTRKACELLDIM  382



>ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Cucumis sativus]
 gb|KGN45026.1| Pentatricopeptide repeat-containing protein [Cucumis sativus]
Length=868

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  + +   KAG   +AL +  EM+  G       +N LLS+ A  G  E A    + M 
Sbjct  366   YSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCKEM-  424

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
              G + +K D  TYN ++  Y +   ++   +V  +   M +D  R+ PN+ TY  L++ +
Sbjct  425   -GSSGVKKDVVTYNALLDGYGKQGKFN---EVTRVFKEMKKD--RVFPNLLTYSTLIDVY  478

Query  1095  SKYCVVREAIRHFRALKNFEGGMR---LLHNEGKYGDPLSLYLRALCREGRIVELLEALE  1265
             SK  +  EA+  FR  K  + G++   +L++E          + ALC+ G +   +  L+
Sbjct  479   SKGSLYEEAMEVFREFK--QAGLKADVVLYSE---------LINALCKNGLVDSAVLLLD  527

Query  1266  AMLKD  1280
              M K+
Sbjct  528   EMTKE  532



>ref|XP_009404774.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 
[Musa acuminata subsp. malaccensis]
Length=562

 Score = 43.5 bits (101),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 96/215 (45%), Gaps = 29/215 (13%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             ++ LI+     G  +  +TI  E+ + G       +N LL+V    G+       F+ M+
Sbjct  165   FNALIKMHGNRGRFTEMMTIFEEIRSIGFKPDIVTWNSLLAVFGQNGMDSEVSGVFKEMK  224

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRL-----QPNMRTYVL  1079
               +A   P+ +TYN +I AY+R  S+D+  +V          +KR+      P++ TY  
Sbjct  225   --KAGFVPERDTYNTLISAYSRCGSFDQAMEV----------YKRMLAAGIGPDLSTYNA  272

Query  1080  LVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPLSLYLRALCREGRIVELLEA  1259
             ++   ++  + + A +    +K+     R   NE  Y   L  Y       G+ ++ L A
Sbjct  273   VLAALARGGLWQPAEKILAEMKD----GRCKPNELTYCSLLHAYA-----NGKELDRLHA  323

Query  1260  LEAMLKDNQTIPPRAMILSRKYRTLVSSWIEPLQE  1364
             L   +  ++TI P  M+L  K   LV+S  + L E
Sbjct  324   LSEDIY-SRTIVPHNMLL--KTLVLVNSKSDLLAE  355


 Score = 35.4 bits (80),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 0/78 (0%)
 Frame = +2

Query  407  GVIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLF  586
            GV++DM AAG  P   +++ LI S+  +  ++ AM    +   +G++P   T+  LI  F
Sbjct  78   GVLHDMEAAGFSPSIVTYNSLISSYAKDGILDEAMDLKEQMEVKGIKPDVFTYTTLISGF  137

Query  587  GSKGLATRGLEILAAMEN  640
               G     + I   ME+
Sbjct  138  EKAGRDELAVRIYEEMES  155


 Score = 53.5 bits (127),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 77/165 (47%), Gaps = 13/165 (8%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R +  E A ++F +    G    +  Y+ L++   K+  H+ AL + ++MEAAG   +  
Sbjct  34    RGSLYEEATEIFREMKAMGFAPDNVTYNTLLDVYGKSRRHAEALGVLHDMEAAGFSPSIV  93

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              +N L+S  A  GI + A    E ME     +KPD  TY  +I  + +A   +    + E
Sbjct  94    TYNSLISSYAKDGILDEAMDLKEQMEVKG--IKPDVFTYTTLISGFEKAGRDELAVRIYE  151

Query  1017  LLGMMVEDHKRLQPNMRTYVLLVEC------FSKYCVVREAIRHF  1133
              +     + KR +PN+ T+  L++       F++   + E IR  
Sbjct  152   EM-----ESKRCKPNLCTFNALIKMHGNRGRFTEMMTIFEEIRSI  191



>ref|XP_010544975.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, 
mitochondrial [Tarenaya hassleriana]
Length=607

 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 93/220 (42%), Gaps = 25/220 (11%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L RS    +A K+F      G     + Y ++I + CK      A+    EM  +G    
Sbjct  360   LFRSRKRSDAIKLFHVMKSKGPSPNVRSYTIMIRDFCKQSKMETAVEYFDEMSGSGLQPD  419

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
             T  + CL++   TC   +  +   E M+  E    PD++TYN +I+  T   S    +  
Sbjct  420   TDVYTCLITGYGTCKKLDTVYELLEEMQ--EKGCLPDSKTYNALIKILT---SQKMPEHA  474

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKY  1190
               +   M+E+   ++P +RT+ ++++             HFR  +N+E G  +       
Sbjct  475   TRIYNKMIENG--IEPTIRTFNMMMKS------------HFRK-RNYEMGRGVWEEMIGK  519

Query  1191  G-----DPLSLYLRALCREGRIVELLEALEAMLKDNQTIP  1295
             G     +  S+ +  L REG+  E  E LE ML     +P
Sbjct  520   GICPDENSYSVLVTGLVREGKPREACEYLEEMLDKGMKVP  559



>ref|XP_006444532.1| hypothetical protein CICLE_v10018807mg [Citrus clementina]
 gb|ESR57772.1| hypothetical protein CICLE_v10018807mg [Citrus clementina]
Length=820

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (48%), Gaps = 19/184 (10%)
 Frame = +3

Query  735   YDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTFHFNCLLSVQATCGIPEVAFATFENME  914
             Y  +I+   KAG   +AL +  EM+  G       +N +LS+ A  G  E A    + ME
Sbjct  372   YSTMIDGYAKAGRLDDALNMFSEMKFLGIGLDRVSYNTVLSIYAKLGRFEEALLVCKEME  431

Query  915   YGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRLQPNMRTYVLLVECF  1094
                + ++ D  TYN ++  Y +   YD V+ + E    M  D   + PN+ TY  L++ +
Sbjct  432   --SSGIRKDAVTYNALLGGYGKQGKYDEVRRMFE---QMKAD--CVSPNLLTYSTLIDVY  484

Query  1095  SKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGDPL--SLYLRALCREGRIVELLEALEA  1268
             SK  + +EA++ FR  K  + G++         D +  S  + ALC+ G +   +  L+ 
Sbjct  485   SKGGLYKEAMQIFREFK--QAGLK--------ADVVLYSALIDALCKNGLVESAVSLLDE  534

Query  1269  MLKD  1280
             M K+
Sbjct  535   MTKE  538



>ref|XP_009606615.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial [Nicotiana tomentosiformis]
Length=811

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/218 (26%), Positives = 102/218 (47%), Gaps = 17/218 (8%)
 Frame = +3

Query  657   RSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMATTF  836
             R + + ++  ++ +  K G++  +    +L+   CK G    A  I  ++   G   T  
Sbjct  321   RRDDVSSSLALYEEAVKKGVQMNEYTTSVLLNGLCKKGKTDKAAEILKKLMENGLTPTEV  380

Query  837   HFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDVAE  1016
              FN +LS     G  E A++T + ME   + +KP   T+N +I  +        +++  E
Sbjct  381   LFNTILSGYCKEGCMEKAYSTIDEMEI--SGVKPSCVTFNTLITKFC---DLGMMEEAKE  435

Query  1017  LLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRALKNFEGGMRLLHNEGKYGD  1196
              L  M+E  K + PN++TY +L++ F +    RE  R F  L+  E    L  N   YG 
Sbjct  436   WLRKMLE--KPVPPNVQTYNILIDGFGRK---REFTRCFEILEEMEDN-GLKPNVITYGS  489

Query  1197  PLSLYLRALCREGRIVELLEALEAMLKDNQTIPPRAMI  1310
                  + +LC++GR++E    L  M+  ++ + P A +
Sbjct  490   ----LINSLCKDGRLLEADVVLNDMI--SRGVKPNAHV  521



>gb|KDP23717.1| hypothetical protein JCGZ_23550 [Jatropha curcas]
Length=584

 Score = 52.4 bits (124),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 7/164 (4%)
 Frame = +3

Query  651   LVRSNHLENANKVFFKGAKGGLRATDQIYDLLIEEDCKAGDHSNALTIAYEMEAAGRMAT  830
             L +  + ++A +VF K  + G   T   Y+ +       GD   AL +  EM   G    
Sbjct  394   LCKKGNADHALEVFQKLNEVGCPPTVSSYNTMFSALWSCGDKYRALGMILEMLNQGIDPD  453

Query  831   TFHFNCLLSVQATCGIPEVAFATFENMEYGEAYMKPDTETYNWVIQAYTRAESYDRVQDV  1010
                +N L+S     G+   A     +ME  ++  +P+  +YN ++    +A   +RV D 
Sbjct  454   EITYNSLISCLCRDGMVNEAIGLLVDME--KSRFQPNIVSYNIILLGLCKA---NRVNDA  508

Query  1011  AELLGMMVEDHKRLQPNMRTYVLLVECFSKYCVVREAIRHFRAL  1142
              E+L  ++E  K  QPN  TY LL+E      +  EA+R   AL
Sbjct  509   IEVLAAIIE--KGCQPNETTYTLLIEGVGFTGLRAEAMRLANAL  550


 Score = 26.2 bits (56),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 0/75 (0%)
 Frame = +2

Query  410  VIYDMIAAGLYPGPRSFHGLIVSHVLNLDVEGAMHALRRELSEGLRPLHETFVALIRLFG  589
            ++ +MIA G  P   +   LI +   +  VE A+  L+    +GL+P    +  LI  F 
Sbjct  301  LLNEMIARGCKPNAVTHSILIGALCHDGKVEEAVSLLKSMKEKGLKPNAYCYDPLIAAFC  360

Query  590  SKGLATRGLEILAAM  634
             +G     +E L  M
Sbjct  361  REGNLHLAIEFLDYM  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9692360524496