BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15158_g1_i1 len=504 path=[47:0-344 23:345-389 23:390-434
435:435-503]

Length=504
                                                                      Score     E

ref|XP_009628238.1|  PREDICTED: ethylene-responsive transcription...  54.3    3e-08   
dbj|BAN58165.1|  ethylene response factor 115                         53.9    3e-08   
ref|XP_009787891.1|  PREDICTED: ethylene-responsive transcription...  49.3    6e-07   
ref|XP_009593489.1|  PREDICTED: ethylene-responsive transcription...  48.9    8e-07   
ref|XP_010325364.1|  PREDICTED: ethylene-responsive transcription...  46.2    6e-06   
ref|XP_009609535.1|  PREDICTED: ethylene-responsive transcription...  46.2    1e-05   
ref|XP_009794568.1|  PREDICTED: ethylene-responsive transcription...  45.8    1e-05   
ref|XP_009625878.1|  PREDICTED: ethylene-responsive transcription...  45.8    1e-05   
ref|XP_009781921.1|  PREDICTED: ethylene-responsive transcription...  43.9    4e-05   
ref|XP_006345610.1|  PREDICTED: ethylene-responsive transcription...  44.7    5e-05   
ref|XP_009609536.1|  PREDICTED: ethylene-responsive transcription...  43.1    7e-05   
dbj|BAN58167.1|  ethylene response factor 168                         43.1    8e-05   
ref|XP_009798817.1|  PREDICTED: ethylene-responsive transcription...  42.0    2e-04   
ref|XP_009607861.1|  PREDICTED: ethylene-responsive transcription...  45.8    2e-04   
ref|XP_009593488.1|  PREDICTED: ethylene-responsive transcription...  42.0    3e-04   
dbj|BAN58169.1|  ethylene response factor 91                          41.6    3e-04   
gb|KCW62805.1|  hypothetical protein EUGRSUZ_G00396                   38.9    5e-04   
ref|XP_004231147.1|  PREDICTED: ethylene-responsive transcription...  40.8    6e-04   
ref|XP_010089316.1|  Ethylene-responsive transcription factor 13      42.0    6e-04   
gb|ADH04266.1|  ERF1                                                  40.0    6e-04   
ref|XP_010068081.1|  PREDICTED: ethylene-responsive transcription...  39.3    6e-04   
ref|XP_009625877.1|  PREDICTED: ethylene-responsive transcription...  40.8    8e-04   
ref|XP_002511592.1|  Ethylene-responsive transcription factor, pu...  39.7    8e-04   Ricinus communis



>ref|XP_009628238.1| PREDICTED: ethylene-responsive transcription factor 1-like, partial 
[Nicotiana tomentosiformis]
Length=218

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMP+PARV  RR   RS   S+ +  S     ++ RKI +IN++AKA  I  
Sbjct  151  NFPHLIGSNMPKPARVTARRSRTRSPEPSSSSCTSSSEKGTRKRKIDLINSIAKAKFIRH  210

Query  220  SSILRML  240
            S  L+ML
Sbjct  211  SWNLQML  217


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  131  DAALAYDQAAFKIRSSRAR  149



>dbj|BAN58165.1| ethylene response factor 115 [Nicotiana tabacum]
Length=229

 Score = 53.9 bits (128),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMP+PARV  RR   RS   S+ +  S     ++ RKI +IN++AKA  I  
Sbjct  162  NFPHLIGSNMPKPARVTARRSRTRSPEPSSSSCTSSSEKGTRKRKIDLINSIAKAKFIRH  221

Query  220  SSILRML  240
            S  L+ML
Sbjct  222  SWNLQML  228


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  142  DAALAYDQAAFKIRSSRAR  160



>ref|XP_009787891.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=187

 Score = 49.3 bits (116),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 3/39 (8%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSK  165
            NFPHLVG+ MPEPARVNPRRRS S  +    S+  TP K
Sbjct  149  NFPHLVGSGMPEPARVNPRRRSHSPESS---SENGTPRK  184


 Score = 30.4 bits (67),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  129  DAALAYDQAAFKIRGSKAR  147



>ref|XP_009593489.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN58168.1| ethylene response factor 163 [Nicotiana tabacum]
Length=186

 Score = 48.9 bits (115),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 3/39 (8%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSK  165
            NFPHLVG+ MPEPARVNPRRRS S  +    S+  TP K
Sbjct  148  NFPHLVGSGMPEPARVNPRRRSHSPESS---SENGTPRK  183


 Score = 30.0 bits (66),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  128  DAALAYDQAAFKIRGSKAR  146



>ref|XP_010325364.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=180

 Score = 46.2 bits (108),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 7/41 (17%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPES--QETTPSK  165
            NFPHL+G+ +PEPARVNPRRRS S     PES  +  TP K
Sbjct  141  NFPHLIGSGVPEPARVNPRRRSHS-----PESSCENGTPRK  176


 Score = 30.0 bits (66),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  121  DAALAYDQAAFKIRGSKAR  139



>ref|XP_009609535.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=217

 Score = 46.2 bits (108),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTP---SKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMPEPARV   R +  +   +  S        ++ R I +IN++AKA  +  
Sbjct  150  NFPHLIGSNMPEPARVKGSRHNSCSLEPSSSSSTPLSENGTRKRNIDVINSIAKAKSVGH  209

Query  220  SSILRML  240
               L ML
Sbjct  210  IRNLHML  216


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  130  DAALAYDQAAFKIRGSRAR  148



>ref|XP_009794568.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=239

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMP+PARV  RR   RS   S+ +  S      + R I +IN++AKA  +  
Sbjct  172  NFPHLIGSNMPKPARVTARRSRTRSPEPSSSSSTSSSENVPRKRNIDVINSIAKAKFLCH  231

Query  220  SSILRML  240
            S  L+ L
Sbjct  232  SLNLQRL  238


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  152  DAALAYDQAAFKIRGSRAR  170



>ref|XP_009625878.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN57618.1| ethylene response factor 189 [Nicotiana tabacum]
Length=232

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMP+PARV  RR   RS   S+ +  S      + R I +IN++AKA  +  
Sbjct  165  NFPHLIGSNMPKPARVTARRSRTRSPEPSSSSSTSSSENVPRKRNIDVINSIAKAKFLCH  224

Query  220  SSILRML  240
            S  L+ L
Sbjct  225  SLNLQRL  231


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  145  DAALAYDQAAFKIRGSRAR  163



>ref|XP_009781921.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=223

 Score = 43.9 bits (102),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAK  201
            NFPHL+G+NMP+PARV  RR   RS    + +  S      + RKI +IN++AK
Sbjct  159  NFPHLIGSNMPKPARVTARRSRTRSPEPLSSSSTSSSVNVPRKRKIDVINSIAK  212


 Score = 29.3 bits (64),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  139  DAALAYDQAAFKIRGSRAR  157



>ref|XP_006345610.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=189

 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 4/56 (7%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPS-KNRKISIINTLAKANVI  213
            NFPHL+G N+ E  RV P+RRS ST       +E  PS K R   +IN++AK N I
Sbjct  119  NFPHLIGTNVAELNRVRPKRRSRSTEII---KEEEIPSPKRRNPQLINSIAKVNSI  171


 Score = 28.5 bits (62),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCS  49
            DAA+AYDR AFKLR +
Sbjct  99   DAALAYDRTAFKLRGT  114



>ref|XP_009609536.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana tomentosiformis]
Length=215

 Score = 43.1 bits (100),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = +1

Query  49   NFPHLVGAN-MPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLAKANVID  216
            NFPHL+G+N MPEP RV   R   RSL  S+ +  +     ++ R I +IN++AKA ++ 
Sbjct  147  NFPHLIGSNNMPEPTRVTGIRHNSRSLEPSSTSSTTSSENGTRKRNIEVINSIAKAKLVG  206

Query  217  RSSILRML  240
                L +L
Sbjct  207  HIRDLEIL  214


 Score = 29.6 bits (65),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  127  DAALAYDQAAFKIRGSRAR  145



>dbj|BAN58167.1| ethylene response factor 168 [Nicotiana tabacum]
Length=217

 Score = 43.1 bits (100),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVN---PRRRSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDR  219
            NFPHL+G+NMPEPARV        SL  S+ +        ++ R I +IN++AKA  +  
Sbjct  150  NFPHLIGSNMPEPARVKGSCHNSCSLEPSSSSSTPLSENGTRKRNIDVINSIAKAKSVGH  209

Query  220  SSILRML  240
               L ML
Sbjct  210  IRNLHML  216


 Score = 29.3 bits (64),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  130  DAALAYDQAAFKIRGSRAR  148



>ref|XP_009798817.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798818.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X2 [Nicotiana sylvestris]
Length=210

 Score = 42.0 bits (97),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 4/48 (8%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLS----TSAGNPESQETTPSKNRKIS  180
            NFPHL+G+N+ EP RV PRRR LS    +S+ +    E  P K RK+ 
Sbjct  159  NFPHLIGSNISEPVRVAPRRRCLSPEISSSSFSLSFVENVPLKKRKLE  206


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AA+K+R S +R
Sbjct  139  DAALAYDQAAYKIRGSKAR  157



>ref|XP_009607861.1| PREDICTED: ethylene-responsive transcription factor 1-like [Nicotiana 
tomentosiformis]
Length=204

 Score = 45.8 bits (107),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPE---SQETTPS-KNRKISIINTLAKANVID  216
            NFPHL+G+N+ E  RV P++R  S     P    ++ TTP+ K R +++IN+L KAN   
Sbjct  123  NFPHLIGSNVVELNRVKPKKRLRSLELSFPSQTTTECTTPNLKKRNVALINSLTKANFNT  182

Query  217  RSSILRML  240
             S + R L
Sbjct  183  HSILERGL  190


 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLR  43
            D A+AYDR+ +KLR
Sbjct  103  DVALAYDRSTYKLR  116



>ref|XP_009593488.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=204

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQ----ETTPSKNRKIS  180
            NFPHL+G+N+ EP RV PRRR LS    +        E  P K RK++
Sbjct  155  NFPHLIGSNISEPVRVAPRRRCLSPEISSSIFSSSFVENIPLKKRKLA  202


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AA+K+R S +R
Sbjct  135  DAALAYDQAAYKIRGSKAR  153



>dbj|BAN58169.1| ethylene response factor 91 [Nicotiana tabacum]
Length=144

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQ----ETTPSKNRKIS  180
            NFPHL+G+N+ EP RV PRRR LS    +        E  P K RK++
Sbjct  95   NFPHLIGSNISEPVRVAPRRRCLSPEISSSIFSSSFVENIPLKKRKLA  142


 Score = 28.9 bits (63),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2   DAAVAYDRAAFKLRCSTSR  58
           DAA+AYD+AA+K+R S +R
Sbjct  75  DAALAYDQAAYKIRGSKAR  93



>gb|KCW62805.1| hypothetical protein EUGRSUZ_G00396, partial [Eucalyptus grandis]
Length=181

 Score = 38.9 bits (89),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQE-TTPSKNRKISI  183
            NFPHL+G+   EP RV+P+RRS   S  +P S E +T +K RK  +
Sbjct  116  NFPHLIGSVEYEPVRVSPKRRSAEPS--SPSSDEGSTGTKRRKREV  159


 Score = 30.8 bits (68),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYDRAAFK+R S ++
Sbjct  96   DAALAYDRAAFKMRGSKAK  114



>ref|XP_004231147.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=202

 Score = 40.8 bits (94),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 3/43 (7%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSKNRKI  177
            NFPHL+G+++ EP RV PR+R  S+ +      E T SK RK+
Sbjct  163  NFPHLIGSDISEPVRVAPRKRCHSSQSS---LVEYTSSKKRKL  202


 Score = 28.5 bits (62),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AA+K+R S +R
Sbjct  143  DAALAYDQAAYKIRGSKAR  161



>ref|XP_010089316.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37641.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=260

 Score = 42.0 bits (97),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRS--LSTSAGNPESQETTPSKNRKISI  183
            NFPHL+G+   EP R+ P+RRS   STS+   E    +P+K R+I +
Sbjct  189  NFPHLIGSEAREPVRIKPKRRSPEPSTSSSMWEFSSLSPAKRRQIGV  235


 Score = 27.3 bits (59),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLR  43
            DAA+AYDRAAF++R
Sbjct  169  DAALAYDRAAFEMR  182



>gb|ADH04266.1| ERF1 [Nicotiana benthamiana]
Length=223

 Score = 40.0 bits (92),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRR---RSLSTSAGNPESQETTPSKNRKISIINTLA  198
            NFPHL+G+NM +PARV  RR   RS   S+ +  S      + RKI +IN++A
Sbjct  159  NFPHLIGSNMRKPARVTERRSRTRSPEPSSSSSTSSSVNVPRKRKIDVINSIA  211


 Score = 29.3 bits (64),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAFK+R S +R
Sbjct  139  DAALAYDQAAFKIRGSRAR  157



>ref|XP_010068081.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score = 39.3 bits (90),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 2/54 (4%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSKNRKISIINTLAKANV  210
            NFPHL+G+   EP RV+P+RRS   S+  P S E +    R+   +++ A+   
Sbjct  177  NFPHLIGSVEYEPVRVSPKRRSAEPSS--PSSDEGSTGTKRRKREVDSDAEVEF  228


 Score = 30.0 bits (66),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYDRAAFK+R S ++
Sbjct  157  DAALAYDRAAFKMRGSKAK  175



>ref|XP_009625877.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=206

 Score = 40.8 bits (94),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSKNRKISIINTLAKANVIDRSSI  228
            NFPHL+G+ + +PARV  R R + +   +  +     ++  KI +IN++AKA  I  S I
Sbjct  142  NFPHLIGSTITKPARVTTRCR-MRSPEPSSSASSENRTRKSKIDVINSIAKAKFIRHSLI  200

Query  229  -LRML  240
             L+ML
Sbjct  201  NLQML  205


 Score = 28.1 bits (61),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYD+AAF++R S +R
Sbjct  122  DAALAYDQAAFEIRGSKAR  140



>ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=223

 Score = 39.7 bits (91),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 7/41 (17%)
 Frame = +1

Query  49   NFPHLVGANMPEPARVNPRRRSLSTSAGNPESQETTPSKNR  171
            NFPHL+G++  EP RV+ RRRS       PES E++P + +
Sbjct  155  NFPHLIGSDDLEPVRVSNRRRS-------PESDESSPKRRK  188


 Score = 29.3 bits (64),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    DAAVAYDRAAFKLRCSTSR  58
            DAA+AYDRAAFK+R + ++
Sbjct  135  DAALAYDRAAFKMRGTKAK  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326