BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15123_g1_i2 len=849 path=[827:0-281 2335:282-282 1110:283-848]

Length=849
                                                                      Score     E

ref|XP_009631630.1|  PREDICTED: glutathione S-transferase F11           362   1e-122   
ref|XP_006348185.1|  PREDICTED: glutathione S-transferase F11-like      355   8e-120   
emb|CAA68993.1|  glutathione S-transferase                              347   8e-117   Petunia x hybrida [garden petunia]
ref|XP_004232669.1|  PREDICTED: glutathione S-transferase F11           346   2e-116   
ref|XP_009777301.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    344   3e-115   
gb|ADM26566.1|  glutathione S-transferase                               342   6e-115   
dbj|BAM14584.1|  glutathione S-transferase for anthocyanin accumu...    320   3e-106   
ref|XP_004288578.1|  PREDICTED: glutathione S-transferase F11-like      320   3e-106   
ref|XP_010270745.1|  PREDICTED: glutathione S-transferase F11-like      311   5e-103   
ref|XP_010270817.1|  PREDICTED: glutathione S-transferase F12-like      311   8e-103   
ref|XP_006372485.1|  putative glutathione S-transferase family pr...    311   9e-103   
ref|XP_009370587.1|  PREDICTED: glutathione S-transferase F12           311   1e-102   
ref|XP_006430394.1|  hypothetical protein CICLE_v10012739mg             310   1e-102   
ref|XP_011038319.1|  PREDICTED: glutathione S-transferase F12-like      309   3e-102   
ref|XP_008368725.1|  PREDICTED: glutathione S-transferase F12-like      309   5e-102   
gb|ADB11336.1|  phi class glutathione transferase GSTF8                 308   7e-102   Populus trichocarpa [western balsam poplar]
ref|NP_001275781.1|  uncharacterized protein LOC102625825               308   1e-101   
ref|NP_001241411.1|  uncharacterized protein LOC100812502               308   1e-101   
gb|KDO57306.1|  hypothetical protein CISIN_1g041226mg                   305   2e-100   
ref|XP_007215953.1|  hypothetical protein PRUPE_ppa011307mg             305   2e-100   
emb|CDP21282.1|  unnamed protein product                                305   2e-100   
ref|XP_008227889.1|  PREDICTED: glutathione S-transferase F11-like      304   3e-100   
gb|KHN08780.1|  Glutathione S-transferase F11                           302   2e-99    
ref|XP_003538377.1|  PREDICTED: glutathione S-transferase F11-like      302   2e-99    
ref|XP_007032197.1|  Glutathione S-transferase F11                      301   5e-99    
ref|NP_001267869.1|  glutathione S-transferase                          300   1e-98    
gb|ACN38271.1|  glutathione S-transferase                               300   1e-98    Vitis amurensis
dbj|BAM72333.1|  glutathione S-transferase                              300   2e-98    
ref|XP_010062332.1|  PREDICTED: glutathione S-transferase F12           299   3e-98    
gb|ADB97493.1|  glutathione S-transferase 4                             299   4e-98    Vitis hybrid cultivar
ref|XP_007146992.1|  hypothetical protein PHAVU_006G087500g             298   6e-98    
ref|XP_004503099.1|  PREDICTED: glutathione S-transferase F11-like      296   3e-97    
dbj|BAM21533.1|  glutathione S-transferase like protein                 296   6e-97    
ref|XP_011097023.1|  PREDICTED: glutathione S-transferase F12           293   5e-96    
gb|KHG09927.1|  Glutathione S-transferase F12 -like protein             291   3e-95    
gb|EYU33954.1|  hypothetical protein MIMGU_mgv1a013692mg                289   4e-94    
ref|XP_002272053.1|  PREDICTED: glutathione S-transferase F11           284   3e-92    Vitis vinifera
ref|XP_003600650.1|  Glutathione S-transferase                          284   4e-92    
gb|ABR15777.1|  glutathione S-transferase                               281   2e-91    Litchi chinensis [litchi]
ref|XP_010272271.1|  PREDICTED: glutathione S-transferase F10-like      277   1e-89    
dbj|BAG14300.1|  glutathione S-transferase                              276   3e-89    Perilla frutescens var. crispa
gb|KEH33687.1|  glutathione S-transferase, amino-terminal domain ...    270   9e-87    
ref|XP_007146234.1|  hypothetical protein PHAVU_006G023500g             268   8e-86    
ref|XP_007146198.1|  hypothetical protein PHAVU_006G020800g             268   1e-85    
ref|XP_008229579.1|  PREDICTED: glutathione S-transferase F9-like...    266   2e-85    
gb|KFK37761.1|  hypothetical protein AALP_AA3G026400                    266   2e-85    
gb|EPS73710.1|  hypothetical protein M569_01048                         266   3e-85    
ref|XP_009377060.1|  PREDICTED: glutathione S-transferase F9-like       266   4e-85    
gb|ABX65441.1|  glutathione S-transferase                               265   6e-85    Chimonanthus praecox [wintersweet]
ref|XP_008229575.1|  PREDICTED: glutathione S-transferase F9-like       265   1e-84    
ref|XP_007146224.1|  hypothetical protein PHAVU_006G022600g             264   1e-84    
ref|XP_006853524.1|  hypothetical protein AMTR_s00032p00224770          265   2e-84    
gb|KHN13181.1|  Glutathione S-transferase F9                            264   2e-84    
ref|XP_003532087.1|  PREDICTED: glutathione S-transferase F9-like       264   3e-84    
gb|KHN13182.1|  Glutathione S-transferase F9                            263   3e-84    
ref|XP_009396141.1|  PREDICTED: glutathione S-transferase F12-like      263   5e-84    
gb|KDP22743.1|  hypothetical protein JCGZ_02402                         262   7e-84    
ref|NP_001237836.1|  uncharacterized protein LOC100499911               263   7e-84    
gb|KFK37762.1|  hypothetical protein AALP_AA3G026500                    262   1e-83    
gb|KEH33682.1|  glutathione S-transferase                               262   1e-83    
ref|XP_010549801.1|  PREDICTED: glutathione S-transferase F12-like      261   2e-83    
ref|XP_004499970.1|  PREDICTED: glutathione S-transferase F9-like       261   2e-83    
ref|NP_001239642.1|  glutathione S-transferase GST 22                   261   3e-83    
ref|XP_009377051.1|  PREDICTED: glutathione S-transferase F9-like       261   4e-83    
ref|XP_010940257.1|  PREDICTED: glutathione S-transferase F12-like      261   5e-83    
ref|XP_007215956.1|  hypothetical protein PRUPE_ppa011337mg             260   6e-83    
ref|XP_007215944.1|  hypothetical protein PRUPE_ppa011246mg             260   6e-83    
ref|XP_004303893.1|  PREDICTED: glutathione S-transferase F9-like...    260   7e-83    
gb|ACJ86198.1|  unknown                                                 260   8e-83    Medicago truncatula
gb|AFK48920.1|  unknown                                                 259   1e-82    
ref|XP_002882279.1|  glutathione S-transferase F11                      259   2e-82    
ref|XP_010485656.1|  PREDICTED: glutathione S-transferase F11 iso...    259   2e-82    
ref|XP_010453905.1|  PREDICTED: glutathione S-transferase F12-like      259   2e-82    
ref|XP_008342336.1|  PREDICTED: glutathione S-transferase F9-like       259   3e-82    
emb|CDY43144.1|  BnaA05g32420D                                          258   4e-82    
gb|KDP20539.1|  hypothetical protein JCGZ_04912                         258   5e-82    
gb|KHG21992.1|  Glutathione S-transferase F9 -like protein              258   6e-82    
ref|XP_002283209.1|  PREDICTED: glutathione S-transferase F9            258   6e-82    Vitis vinifera
ref|XP_006289224.1|  hypothetical protein CARUB_v10002680mg             257   1e-81    
ref|XP_006484982.1|  PREDICTED: glutathione S-transferase F9-like       257   1e-81    
ref|XP_010492664.1|  PREDICTED: glutathione S-transferase F12-like      257   1e-81    
ref|XP_009130342.1|  PREDICTED: glutathione S-transferase F11           256   2e-81    
gb|ABI79308.1|  glutathione S-transferase                               256   2e-81    Pyrus communis
ref|XP_010420427.1|  PREDICTED: glutathione S-transferase F12           256   2e-81    
ref|XP_006298522.1|  hypothetical protein CARUB_v10014608mg             256   2e-81    
ref|XP_010463766.1|  PREDICTED: glutathione S-transferase F11-like      260   3e-81    
gb|AFK48087.1|  unknown                                                 256   4e-81    
ref|XP_009377092.1|  PREDICTED: glutathione S-transferase F9-like       255   4e-81    
gb|KFK37760.1|  hypothetical protein AALP_AA3G026300                    255   6e-81    
ref|XP_006400252.1|  hypothetical protein EUTSA_v10014654mg             255   8e-81    
ref|XP_007215954.1|  hypothetical protein PRUPE_ppa011337mg             254   8e-81    
gb|ABW34390.1|  glutathione S-transferase 5                             254   8e-81    Vitis vinifera
ref|XP_002530205.1|  glutathione-s-transferase theta, gst, putative     254   1e-80    Ricinus communis
ref|XP_008229577.1|  PREDICTED: glutathione S-transferase F9-like       254   1e-80    
emb|CAN75964.1|  hypothetical protein VITISV_036241                     254   1e-80    Vitis vinifera
ref|XP_007048950.1|  Glutathione S-transferase PHI 9                    254   1e-80    
ref|XP_006484981.1|  PREDICTED: glutathione S-transferase F9-like       254   2e-80    
gb|AAG34812.1|AF243377_1  glutathione S-transferase GST 22              253   4e-80    Glycine max [soybeans]
emb|CDY28744.1|  BnaCnng06300D                                          252   6e-80    
ref|XP_010485655.1|  PREDICTED: glutathione S-transferase F11 iso...    256   8e-80    
ref|XP_010035935.1|  PREDICTED: glutathione S-transferase F9-like       252   8e-80    
ref|XP_007215955.1|  hypothetical protein PRUPE_ppa011337mg             252   1e-79    
ref|XP_010549805.1|  PREDICTED: glutathione S-transferase F11-like      251   1e-79    
ref|XP_007048951.1|  Glutathione S-transferase PHI 9 isoform 1          251   2e-79    
ref|XP_006408331.1|  hypothetical protein EUTSA_v10021507mg             251   2e-79    
ref|NP_186969.1|  glutathione S-transferase F11                         251   3e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KFK25936.1|  hypothetical protein AALP_AA8G182300                    250   5e-79    
ref|XP_008380180.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    249   7e-79    
ref|XP_008380181.1|  PREDICTED: glutathione S-transferase F9-like       249   1e-78    
ref|XP_010035936.1|  PREDICTED: glutathione S-transferase F9-like       249   1e-78    
ref|XP_009356599.1|  PREDICTED: glutathione S-transferase F9-like       249   1e-78    
ref|XP_009121408.1|  PREDICTED: glutathione S-transferase F12-like      249   1e-78    
ref|XP_006437116.1|  hypothetical protein CICLE_v10032743mg             249   2e-78    
ref|XP_002871755.1|  glutathione S-transferase 26                       248   2e-78    
ref|XP_006437117.1|  hypothetical protein CICLE_v10032737mg             248   3e-78    
ref|NP_197224.1|  glutathione S-transferase phi 12                      248   3e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDY16947.1|  BnaC09g40740D                                          247   8e-78    
gb|AFK37527.1|  unknown                                                 246   1e-77    
ref|XP_010035937.1|  PREDICTED: glutathione S-transferase F9-like       246   1e-77    
dbj|BAD89984.1|  mutant protein of GST-like protein                     246   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229578.1|  PREDICTED: glutathione S-transferase F9-like...    246   2e-77    
emb|CDX85469.1|  BnaA02g03440D                                          246   2e-77    
ref|XP_009126170.1|  PREDICTED: glutathione S-transferase F12           245   5e-77    
ref|XP_007141437.1|  hypothetical protein PHAVU_008G195500g             244   1e-76    
ref|XP_007141438.1|  hypothetical protein PHAVU_008G195600g             243   2e-76    
ref|XP_008342338.1|  PREDICTED: glutathione S-transferase F9-like       243   5e-76    
ref|XP_010035940.1|  PREDICTED: glutathione S-transferase F9-like       242   8e-76    
ref|XP_008348377.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    241   1e-75    
ref|XP_007137174.1|  hypothetical protein PHAVU_009G105900g             241   2e-75    
ref|XP_003617377.1|  Glutathione S-transferase                          241   2e-75    
ref|XP_010035941.1|  PREDICTED: glutathione S-transferase F9-like       241   2e-75    
ref|NP_001267983.1|  glutathione S-transferase 3                        240   3e-75    
ref|XP_009395362.1|  PREDICTED: glutathione S-transferase F10-like      240   6e-75    
gb|AEX37999.1|  glutathione transferase                                 239   6e-75    
ref|XP_004499971.1|  PREDICTED: glutathione S-transferase F9-like       239   9e-75    
ref|XP_010507366.1|  PREDICTED: glutathione S-transferase F11 iso...    239   1e-74    
gb|AFK35789.1|  unknown                                                 238   3e-74    
gb|AFK45563.1|  unknown                                                 238   3e-74    
ref|XP_010038728.1|  PREDICTED: glutathione S-transferase F9-like       237   7e-74    
ref|XP_007141436.1|  hypothetical protein PHAVU_008G195400g             237   8e-74    
ref|XP_004491311.1|  PREDICTED: glutathione S-transferase F9-like       236   1e-73    
ref|XP_008348130.1|  PREDICTED: glutathione S-transferase F9-like       235   4e-73    
ref|XP_010035942.1|  PREDICTED: glutathione S-transferase F9-like       234   6e-73    
gb|KCW47449.1|  hypothetical protein EUGRSUZ_K01234                     234   9e-73    
ref|XP_010542711.1|  PREDICTED: glutathione S-transferase F9            234   1e-72    
emb|CDY02726.1|  BnaC02g07090D                                          233   2e-72    
gb|ADB85090.1|  glutathione S-transferase                               232   4e-72    
ref|XP_010035939.1|  PREDICTED: glutathione S-transferase F9-like...    234   5e-72    
ref|XP_006575642.1|  PREDICTED: glutathione S-transferase F9-like       232   8e-72    
ref|XP_003617376.1|  Glutathione S-transferase GST                      231   9e-72    
ref|XP_010035938.1|  PREDICTED: glutathione S-transferase F9-like...    234   1e-71    
ref|XP_009377080.1|  PREDICTED: glutathione S-transferase F9-like       231   2e-71    
ref|XP_010557150.1|  PREDICTED: glutathione S-transferase F9-like       230   3e-71    
gb|EYU33332.1|  hypothetical protein MIMGU_mgv1a013599mg                230   4e-71    
ref|XP_010469787.1|  PREDICTED: glutathione S-transferase F10           229   6e-71    
gb|ABY84869.1|  glutathione S transferase 1                             229   6e-71    Pteris vittata
ref|XP_011098399.1|  PREDICTED: glutathione S-transferase F9-like       229   6e-71    
ref|XP_006410183.1|  hypothetical protein EUTSA_v10017228mg             229   9e-71    
ref|XP_010414208.1|  PREDICTED: glutathione S-transferase F10-like      229   1e-70    
gb|AAM34480.1|  putative glutathione S-transferase                      228   2e-70    Phaseolus acutifolius
ref|XP_011098390.1|  PREDICTED: glutathione S-transferase F9-like       228   3e-70    
ref|XP_007146233.1|  hypothetical protein PHAVU_006G023400g             228   4e-70    
emb|CDY02724.1|  BnaC02g07110D                                          231   4e-70    
ref|XP_010510278.1|  PREDICTED: glutathione S-transferase F10-like      227   5e-70    
gb|AHA46521.1|  phi class glutathione S-transferase                     227   8e-70    
ref|XP_009132756.1|  PREDICTED: glutathione S-transferase F9            226   8e-70    
ref|NP_180643.1|  glutathione S-transferase PHI 9                       226   9e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDX97788.1|  BnaC04g41510D                                          226   1e-69    
ref|XP_004491312.1|  PREDICTED: glutathione S-transferase F9-like       226   1e-69    
emb|CDY29636.1|  BnaA04g17910D                                          226   1e-69    
gb|KFK31252.1|  hypothetical protein AALP_AA6G088400                    226   2e-69    
gb|AGC13155.1|  phi class glutathione S-transferase                     225   2e-69    
gb|ABY84871.1|  glutathione S transferase 2                             225   3e-69    Pteris vittata
ref|XP_006295885.1|  hypothetical protein CARUB_v10025015mg             223   1e-68    
ref|XP_002532973.1|  glutathione-s-transferase theta, gst, putative     221   4e-68    Ricinus communis
gb|ACB10397.1|  glutathione S-transferase                               221   5e-68    Brassica juncea [brown mustard]
ref|XP_009141109.1|  PREDICTED: glutathione S-transferase F9            222   5e-68    
emb|CAA72973.1|  glutathione transferase                                222   7e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294907.1|  hypothetical protein CARUB_v10023958mg             222   7e-68    
ref|XP_010414209.1|  PREDICTED: glutathione S-transferase F9            220   3e-67    
ref|XP_010510279.1|  PREDICTED: glutathione S-transferase F9-like...    220   3e-67    
gb|AHA46525.1|  phi class glutathione S-transferase                     219   6e-67    
gb|KFK31251.1|  hypothetical protein AALP_AA6G088300                    219   7e-67    
gb|ABK23015.1|  unknown                                                 219   1e-66    Picea sitchensis
gb|AHA46522.1|  phi class glutathione S-transferase                     218   1e-66    
gb|AGC13151.1|  phi class glutathione S-transferase                     218   2e-66    
ref|XP_006410185.1|  hypothetical protein EUTSA_v10017227mg             218   2e-66    
gb|AGC13154.1|  phi class glutathione S-transferase                     218   3e-66    
gb|AGC13153.1|  phi class glutathione S-transferase                     216   6e-66    
ref|XP_002879283.1|  early dehydration-induced 13                       216   7e-66    
gb|AHA46526.1|  phi class glutathione S-transferase                     216   1e-65    
gb|ACL37469.1|  phi class glutathione transferase                       216   1e-65    Cathaya argyrophylla
gb|KDO40902.1|  hypothetical protein CISIN_1g027956mg                   214   1e-65    
ref|NP_001236500.1|  glutathione S-transferase GST 24                   216   1e-65    
gb|ADM74484.1|  glutathione S-transferase-like protein                  214   3e-65    
ref|XP_001764210.1|  predicted protein                                  215   4e-65    
ref|NP_180644.1|  glutathione S-transferase PHI 10                      214   4e-65    Arabidopsis thaliana [mouse-ear cress]
gb|ABK21297.1|  unknown                                                 214   5e-65    Picea sitchensis
ref|XP_010259661.1|  PREDICTED: glutathione S-transferase F13           214   5e-65    
gb|ADM74477.1|  glutathione S-transferase-like protein                  213   1e-64    
ref|XP_009351388.1|  PREDICTED: glutathione S-transferase F9-like       211   1e-64    
gb|ACU13420.1|  unknown                                                 213   2e-64    Glycine max [soybeans]
emb|CDY23979.1|  BnaC03g17120D                                          213   2e-64    
gb|ADM74495.1|  glutathione S-transferase-like protein                  213   2e-64    
gb|ADM74486.1|  glutathione S-transferase-like protein                  212   3e-64    
gb|ACN40286.1|  unknown                                                 212   3e-64    Picea sitchensis
gb|ADM74498.1|  glutathione S-transferase-like protein                  212   3e-64    
gb|AHA46523.1|  phi class glutathione S-transferase                     212   4e-64    
emb|CDX84815.1|  BnaA03g14150D                                          212   4e-64    
ref|XP_009132757.1|  PREDICTED: glutathione S-transferase F10           212   4e-64    
gb|ADM74493.1|  glutathione S-transferase-like protein                  212   4e-64    
gb|ADM74481.1|  glutathione S-transferase-like protein                  211   5e-64    
gb|AHA46527.1|  phi class glutathione S-transferase                     211   7e-64    
gb|ADM74485.1|  glutathione S-transferase-like protein                  211   1e-63    
gb|AAY86780.1|  putative glutathione S-transferase                      211   1e-63    Noccaea caerulescens
gb|ADM74482.1|  glutathione S-transferase-like protein                  210   2e-63    
gb|ADE76351.1|  unknown                                                 210   3e-63    
gb|ACB59223.1|  glutathione S-transferase                               218   4e-63    Brassica oleracea
gb|ADM74487.1|  glutathione S-transferase-like protein                  209   4e-63    
ref|XP_010269471.1|  PREDICTED: glutathione S-transferase F13-like      209   5e-63    
gb|ADM74517.1|  glutathione S-transferase-like protein                  209   5e-63    
gb|ADE76600.1|  unknown                                                 209   7e-63    
gb|AGC13149.1|  phi class glutathione S-transferase                     207   3e-62    
ref|XP_008362360.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    207   4e-62    
ref|XP_010904820.1|  PREDICTED: probable glutathione S-transferas...    205   2e-61    
ref|XP_006484926.1|  PREDICTED: glutathione S-transferase F9-like       204   2e-61    
ref|XP_009384404.1|  PREDICTED: glutathione S-transferase 3-like        204   3e-61    
gb|AGC13152.1|  phi class glutathione S-transferase                     204   6e-61    
ref|XP_008795905.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    203   8e-61    
gb|KDO51859.1|  hypothetical protein CISIN_1g031084mg                   202   9e-61    
emb|CAN69111.1|  hypothetical protein VITISV_031837                     204   9e-61    Vitis vinifera
ref|XP_010938431.1|  PREDICTED: glutathione S-transferase 3             203   9e-61    
ref|XP_008805761.1|  PREDICTED: probable glutathione S-transferas...    203   1e-60    
gb|KDP36862.1|  hypothetical protein JCGZ_08153                         202   2e-60    
ref|XP_010090796.1|  Glutathione S-transferase F13                      202   4e-60    
gb|KDO87318.1|  hypothetical protein CISIN_1g036627mg                   202   4e-60    
gb|ACT82511.1|  glutathione S-transferase                               202   4e-60    Arachis hypogaea [goober]
ref|XP_002531867.1|  glutathione-s-transferase theta, gst, putative     202   4e-60    Ricinus communis
ref|XP_004291321.1|  PREDICTED: glutathione S-transferase F8, chl...    201   6e-60    
ref|XP_006480109.1|  PREDICTED: glutathione S-transferase F13-like      201   6e-60    
gb|ADB11335.1|  phi class glutathione transferase GSTF7                 201   7e-60    Populus trichocarpa [western balsam poplar]
ref|XP_006386755.1|  glutathione S-transferase family protein           201   7e-60    
gb|KDP28123.1|  hypothetical protein JCGZ_13894                         201   7e-60    
ref|XP_007223949.1|  hypothetical protein PRUPE_ppa011153mg             201   8e-60    
ref|XP_010090797.1|  Glutathione S-transferase                          201   8e-60    
ref|XP_002263386.1|  PREDICTED: glutathione S-transferase F13           201   1e-59    Vitis vinifera
ref|XP_008445310.1|  PREDICTED: glutathione S-transferase F11-like      201   1e-59    
ref|XP_011010721.1|  PREDICTED: glutathione S-transferase F13-like      200   2e-59    
ref|XP_002263424.1|  PREDICTED: glutathione S-transferase F13           200   2e-59    Vitis vinifera
gb|KHG13410.1|  Glutathione S-transferase F13 -like protein             200   2e-59    
ref|XP_009365718.1|  PREDICTED: glutathione S-transferase F13           200   2e-59    
ref|XP_011033572.1|  PREDICTED: glutathione S-transferase F13-like      199   3e-59    
ref|XP_006444271.1|  hypothetical protein CICLE_v10022160mg             199   3e-59    
gb|ADM76243.1|  glutathione S-transferase-like protein                  198   3e-59    
ref|XP_002510614.1|  glutathione-s-transferase theta, gst, putative     199   3e-59    Ricinus communis
gb|ADM76249.1|  glutathione S-transferase-like protein                  197   5e-59    
ref|XP_008373435.1|  PREDICTED: glutathione S-transferase F13-like      199   5e-59    
ref|XP_002321020.2|  glutathione S-transferase family protein           198   7e-59    Populus trichocarpa [western balsam poplar]
gb|ADM76259.1|  glutathione S-transferase-like protein                  197   8e-59    
gb|KCW47445.1|  hypothetical protein EUGRSUZ_K01230                     198   1e-58    
ref|XP_010259659.1|  PREDICTED: glutathione S-transferase-like          201   1e-58    
gb|AGC13150.1|  phi class glutathione S-transferase                     197   2e-58    
ref|XP_010935200.1|  PREDICTED: glutathione S-transferase F8, chl...    197   2e-58    
ref|XP_010904819.1|  PREDICTED: probable glutathione S-transferas...    197   3e-58    
ref|XP_006473732.1|  PREDICTED: glutathione S-transferase-like          196   5e-58    
gb|ADM76261.1|  glutathione S-transferase-like protein                  194   6e-58    
ref|XP_002301942.1|  hypothetical protein POPTR_0002s01660g             196   6e-58    Populus trichocarpa [western balsam poplar]
ref|XP_004985806.1|  PREDICTED: glutathione S-transferase F11-like      196   8e-58    
ref|XP_006435273.1|  hypothetical protein CICLE_v10002119mg             197   9e-58    
ref|XP_007035561.1|  Phi class glutathione transferase GSTF7            196   9e-58    
gb|ABK81651.1|  glutathione S-transferase                               196   9e-58    Vitis vinifera
ref|XP_004161070.1|  PREDICTED: glutathione S-transferase F8, chl...    195   1e-57    
ref|XP_006410184.1|  hypothetical protein EUTSA_v10017228mg             194   1e-57    
gb|AIC33066.1|  glutathione s-transferase                               195   2e-57    
ref|XP_009381929.1|  PREDICTED: probable glutathione S-transferas...    194   2e-57    
gb|KDO84982.1|  hypothetical protein CISIN_1g027634mg                   194   3e-57    
dbj|BAM14585.1|  putative glutathione S-transferase                     194   3e-57    
ref|XP_011079702.1|  PREDICTED: glutathione S-transferase-like          194   3e-57    
ref|XP_006342558.1|  PREDICTED: glutathione S-transferase-like          194   3e-57    
gb|KHG23493.1|  Glutathione S-transferase F8, chloroplastic -like...    194   5e-57    
gb|KGN62277.1|  hypothetical protein Csa_2G348150                       194   5e-57    
ref|XP_002465909.1|  hypothetical protein SORBIDRAFT_01g047970          194   6e-57    
ref|XP_008805760.1|  PREDICTED: probable glutathione S-transferas...    193   6e-57    
dbj|BAJ85232.1|  predicted protein                                      194   7e-57    
ref|XP_009624108.1|  PREDICTED: glutathione S-transferase-like          193   8e-57    
ref|XP_002964271.1|  hypothetical protein SELMODRAFT_142654             193   1e-56    
ref|XP_007050848.1|  Phi class glutathione transferase GSTF3            195   1e-56    
ref|XP_010269470.1|  PREDICTED: glutathione S-transferase F13-like      193   1e-56    
gb|ADM74397.1|  glutathione S-transferase-like protein                  192   1e-56    
ref|XP_011034942.1|  PREDICTED: glutathione S-transferase F11-like      192   2e-56    
ref|XP_007209587.1|  hypothetical protein PRUPE_ppa011249mg             192   2e-56    
dbj|BAF56180.1|  glutathione S-transferase                              192   2e-56    
gb|ADP95078.1|  glutathione S-transferase-like protein                  192   2e-56    
gb|EMT08743.1|  hypothetical protein F775_32323                         192   2e-56    
gb|ADP95082.1|  glutathione S-transferase-like protein                  192   2e-56    
gb|ADP95094.1|  glutathione S-transferase-like protein                  192   2e-56    
gb|AAL61612.1|AF401623_1  glutathione S-transferase                     192   2e-56    
ref|XP_002989538.1|  hypothetical protein SELMODRAFT_184606             192   2e-56    
gb|ADP95071.1|  glutathione S-transferase-like protein                  192   2e-56    
gb|ADP95089.1|  glutathione S-transferase-like protein                  192   2e-56    
gb|ADP95068.1|  glutathione S-transferase-like protein                  192   2e-56    
emb|CDX93963.1|  BnaC04g21220D                                          192   2e-56    
ref|XP_004495977.1|  PREDICTED: glutathione S-transferase PARB-like     192   2e-56    
ref|XP_009401217.1|  PREDICTED: glutathione S-transferase PARB-like     192   3e-56    
ref|XP_011079699.1|  PREDICTED: glutathione S-transferase-like          192   3e-56    
gb|AGH14254.1|  glutathione S-transferase                               192   3e-56    
gb|ADP95072.1|  glutathione S-transferase-like protein                  191   3e-56    
ref|XP_004253135.1|  PREDICTED: glutathione S-transferase               192   4e-56    
gb|ADM74357.1|  glutathione S-transferase-like protein                  190   4e-56    
gb|ADM74359.1|  glutathione S-transferase-like protein                  190   4e-56    
ref|XP_004290763.1|  PREDICTED: glutathione S-transferase-like          191   5e-56    
ref|XP_006828869.1|  hypothetical protein AMTR_s00001p00173570          191   6e-56    
ref|XP_007017931.1|  Ubiquitin-like superfamily protein isoform 3       192   6e-56    
ref|XP_010921802.1|  PREDICTED: glutathione S-transferase 3-like        191   6e-56    
gb|ADP95085.1|  glutathione S-transferase-like protein                  190   7e-56    
ref|XP_010101286.1|  Glutathione S-transferase F8                       191   7e-56    
gb|ADP95100.1|  glutathione S-transferase-like protein                  190   8e-56    
gb|KCW70494.1|  hypothetical protein EUGRSUZ_F03703                     191   8e-56    
ref|XP_004495978.1|  PREDICTED: glutathione S-transferase F13-like      191   9e-56    
ref|XP_008648145.1|  PREDICTED: glutathione transferase10 isoform X1    191   1e-55    
ref|XP_002262842.1|  PREDICTED: glutathione S-transferase               190   1e-55    
ref|XP_010545022.1|  PREDICTED: glutathione S-transferase F13           190   1e-55    
gb|ADM74365.1|  glutathione S-transferase-like protein                  189   1e-55    
ref|XP_011079698.1|  PREDICTED: glutathione S-transferase-like          190   1e-55    
gb|ADM74367.1|  glutathione S-transferase-like protein                  189   1e-55    
ref|XP_011082484.1|  PREDICTED: glutathione S-transferase-like          191   2e-55    
gb|KHG13026.1|  Glutathione S-transferase F6 -like protein              190   2e-55    
ref|XP_009803671.1|  PREDICTED: glutathione S-transferase-like          190   2e-55    
ref|XP_009336611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   2e-55    
ref|XP_007144545.1|  hypothetical protein PHAVU_007G164900g             189   2e-55    
ref|XP_008353665.1|  PREDICTED: glutathione S-transferase F9-like       187   3e-55    
ref|XP_007200490.1|  hypothetical protein PRUPE_ppa011383mg             189   3e-55    
ref|XP_002262604.1|  PREDICTED: glutathione S-transferase               189   3e-55    
gb|ADM74381.1|  glutathione S-transferase-like protein                  187   4e-55    
ref|XP_009389188.1|  PREDICTED: glutathione S-transferase-like          190   4e-55    
ref|XP_004240536.1|  PREDICTED: glutathione S-transferase               188   6e-55    
ref|XP_004499313.1|  PREDICTED: glutathione S-transferase F8, chl...    188   7e-55    
gb|ADE76841.1|  unknown                                                 188   8e-55    
ref|XP_007143851.1|  hypothetical protein PHAVU_007G107200g             188   8e-55    
ref|XP_006355799.1|  PREDICTED: glutathione S-transferase-like          188   9e-55    
gb|KHG05656.1|  Glutathione S-transferase F6 -like protein              188   9e-55    
gb|AHA46524.1|  phi class glutathione S-transferase                     188   9e-55    
ref|XP_008366579.1|  PREDICTED: glutathione S-transferase F13-like      187   9e-55    
ref|XP_007160612.1|  hypothetical protein PHAVU_001G002000g             188   1e-54    
ref|XP_008235033.1|  PREDICTED: glutathione S-transferase-like          189   1e-54    
gb|KEH43230.1|  glutathione S-transferase, amino-terminal domain ...    187   1e-54    
ref|XP_010943498.1|  PREDICTED: glutathione S-transferase F10-like      187   1e-54    
gb|AFK35043.1|  unknown                                                 187   1e-54    
emb|CDP07334.1|  unnamed protein product                                188   1e-54    
gb|EPS74341.1|  hypothetical protein M569_00413                         187   1e-54    
ref|XP_006355800.1|  PREDICTED: glutathione S-transferase-like          187   2e-54    
gb|ABQ96853.1|  glutathione S-transferase                               187   2e-54    
emb|CDX89147.1|  BnaA04g00390D                                          187   2e-54    
ref|XP_002878475.1|  hypothetical protein ARALYDRAFT_486776             187   2e-54    
ref|XP_009138718.1|  PREDICTED: glutathione S-transferase F13           187   2e-54    
ref|XP_008451607.1|  PREDICTED: glutathione S-transferase-like          187   2e-54    
gb|EYU34184.1|  hypothetical protein MIMGU_mgv1a013345mg                187   2e-54    
ref|XP_008368966.1|  PREDICTED: glutathione S-transferase F13-like      187   2e-54    
gb|EPS69720.1|  hypothetical protein M569_05047                         187   3e-54    
ref|XP_009789274.1|  PREDICTED: glutathione S-transferase               186   3e-54    
ref|XP_008386643.1|  PREDICTED: glutathione S-transferase F13-like      187   3e-54    
sp|P46423.1|GSTF_HYOMU  RecName: Full=Glutathione S-transferase; ...    186   3e-54    
ref|XP_006402344.1|  hypothetical protein EUTSA_v10006426mg             187   3e-54    
ref|XP_008368964.1|  PREDICTED: glutathione S-transferase-like          186   5e-54    
ref|XP_003558871.1|  PREDICTED: glutathione S-transferase F11-like      186   6e-54    
gb|EAY88429.1|  hypothetical protein OsI_09893                          186   7e-54    
gb|AAB65163.1|  glutathione S-transferase, class-phi                    185   7e-54    
gb|EPS58503.1|  hypothetical protein M569_16312                         185   8e-54    
gb|ABQ96852.1|  glutathione S-transferase                               185   8e-54    
ref|XP_008451606.1|  PREDICTED: glutathione S-transferase-like          185   8e-54    
ref|XP_008363706.1|  PREDICTED: glutathione S-transferase-like          185   9e-54    
dbj|BAB70616.1|  glutathione S-transferase                              185   9e-54    
ref|XP_006649352.1|  PREDICTED: glutathione S-transferase F11-like      185   1e-53    
ref|XP_010259660.1|  PREDICTED: glutathione S-transferase-like          185   1e-53    
gb|AAG32477.1|AF309384_1  putative glutathione S-transferase OsGSTF3    185   1e-53    
ref|NP_001048886.1|  Os03g0135300                                       185   2e-53    
ref|XP_008789932.1|  PREDICTED: glutathione S-transferase 3             184   2e-53    
ref|XP_009586784.1|  PREDICTED: glutathione S-transferase               184   2e-53    
gb|ACJ84570.1|  unknown                                                 184   2e-53    
emb|CAI51314.2|  glutathione S-transferase GST1                         184   2e-53    
gb|KEH43231.1|  glutathione S-transferase                               184   2e-53    
pdb|4RI6|A  Chain A, Crystal Structure Of Poplar Glutathione Tran...    184   3e-53    
gb|EYU46696.1|  hypothetical protein MIMGU_mgv1a013633mg                184   4e-53    
ref|XP_010522774.1|  PREDICTED: glutathione S-transferase F7-like       185   4e-53    
gb|KEH43226.1|  glutathione S-transferase, amino-terminal domain ...    183   4e-53    
gb|KHN46581.1|  Glutathione S-transferase F13                           184   4e-53    
ref|XP_006603237.1|  PREDICTED: glutathione S-transferase F10-like      185   5e-53    
ref|XP_003589566.1|  Glutathione S-transferase                          183   6e-53    
pdb|4RI7|A  Chain A, Crystal Structure Of Poplar Glutathione Tran...    183   6e-53    
ref|XP_008235026.1|  PREDICTED: glutathione S-transferase-like          183   6e-53    
ref|XP_004300542.1|  PREDICTED: glutathione S-transferase F13-like      183   7e-53    
ref|XP_008368965.1|  PREDICTED: glutathione S-transferase-like          183   8e-53    
ref|NP_001291446.1|  glutathione S-transferase GST 21                   183   8e-53    
ref|XP_011034940.1|  PREDICTED: glutathione S-transferase F11-like      182   9e-53    
ref|XP_008451608.1|  PREDICTED: glutathione S-transferase PARB-like     182   9e-53    
ref|XP_008363707.1|  PREDICTED: glutathione S-transferase-like          182   9e-53    
ref|NP_001242039.1|  uncharacterized protein LOC100815147               182   1e-52    
ref|XP_004136043.1|  PREDICTED: glutathione S-transferase PARB-like     182   1e-52    
ref|XP_002301941.1|  hypothetical protein POPTR_0002s01650g             182   1e-52    
pir||JC7899  glutathione transferase (EC 2.5.1.18) F1, Pugf - pum...    182   1e-52 
ref|XP_009785538.1|  PREDICTED: glutathione S-transferase-like          183   1e-52    
ref|XP_008235025.1|  PREDICTED: glutathione S-transferase F13-like      182   1e-52    
gb|ABK96715.1|  unknown                                                 182   2e-52    
gb|AEB77871.1|  phi class glutathione S-transferase protein             182   2e-52    
gb|AFK40227.1|  unknown                                                 182   2e-52    
ref|XP_011010221.1|  PREDICTED: glutathione S-transferase-like          181   3e-52    
ref|XP_004240537.1|  PREDICTED: glutathione S-transferase-like          181   3e-52    
ref|XP_006386753.1|  Glutathione S-transferase 1 family protein         181   3e-52    
ref|XP_008238004.1|  PREDICTED: glutathione S-transferase F13-like      181   3e-52    
ref|XP_006855528.1|  hypothetical protein AMTR_s00057p00211000          181   3e-52    
gb|KDO40903.1|  hypothetical protein CISIN_1g042826mg                   179   4e-52    
ref|NP_191835.1|  glutathione S-transferase F13                         181   4e-52    
ref|XP_008451662.1|  PREDICTED: glutathione S-transferase F13           182   4e-52    
ref|XP_004160543.1|  PREDICTED: glutathione S-transferase PARB-like     181   5e-52    
ref|XP_010069960.1|  PREDICTED: glutathione S-transferase-like          181   5e-52    
ref|XP_006437115.1|  hypothetical protein CICLE_v10033001mg             178   6e-52    
ref|XP_009628525.1|  PREDICTED: glutathione S-transferase-like          181   6e-52    
ref|XP_007201125.1|  hypothetical protein PRUPE_ppa017385mg             181   6e-52    
ref|XP_010069958.1|  PREDICTED: glutathione S-transferase-like          181   6e-52    
gb|EMT19643.1|  hypothetical protein F775_06186                         181   6e-52    
ref|XP_006646651.1|  PREDICTED: glutathione S-transferase 3-like        181   7e-52    
ref|XP_010069962.1|  PREDICTED: glutathione S-transferase-like          180   8e-52    
ref|XP_010918164.1|  PREDICTED: glutathione S-transferase F11-like      181   8e-52    
ref|XP_004160544.1|  PREDICTED: glutathione S-transferase-like          180   1e-51    
ref|XP_004290762.1|  PREDICTED: glutathione S-transferase F13-lik...    180   1e-51    
ref|XP_004136042.1|  PREDICTED: glutathione S-transferase-like          180   1e-51    
gb|ABK32074.1|  glutathione-S-transferase                               180   1e-51    
gb|KHN46580.1|  Glutathione S-transferase                               180   1e-51    
gb|AEB77873.1|  phi class glutathione S-transferase protein             180   1e-51    
emb|CAD29476.1|  glutathione transferase F3                             180   2e-51    
ref|XP_010474884.1|  PREDICTED: glutathione S-transferase F6-like       179   2e-51    
ref|XP_007050852.1|  Glutathione S-transferase 7 isoform 1              181   3e-51    
ref|XP_006644176.1|  PREDICTED: probable glutathione S-transferas...    179   3e-51    
ref|XP_006304809.1|  hypothetical protein CARUB_v10012427mg             178   3e-51    
ref|XP_004136044.1|  PREDICTED: glutathione S-transferase PARB-like     179   3e-51    
gb|ACF85374.1|  unknown                                                 179   4e-51    
ref|XP_010038186.1|  PREDICTED: glutathione S-transferase F13           178   5e-51    
gb|KFK35448.1|  hypothetical protein AALP_AA5G285500                    178   5e-51    
gb|AAF65767.1|AF242309_1  glutathione S-transferase                     178   5e-51    
ref|XP_011010723.1|  PREDICTED: glutathione S-transferase F6-like       178   5e-51    
gb|EMT15568.1|  hypothetical protein F775_09230                         178   6e-51    
gb|AFF18815.2|  glutathione S-transferase                               178   7e-51    
ref|NP_171792.1|  glutathione S-transferase F6                          177   7e-51    
ref|XP_006306479.1|  hypothetical protein CARUB_v10012455mg             177   8e-51    
dbj|BAJ98413.1|  predicted protein                                      178   9e-51    
gb|AAP58395.1|  glutathione S-transferase 5                             177   9e-51    
ref|XP_010041099.1|  PREDICTED: glutathione S-transferase-like          177   1e-50    
gb|EYU46695.1|  hypothetical protein MIMGU_mgv1a013389mg                177   1e-50    
ref|XP_008813666.1|  PREDICTED: glutathione S-transferase F10-like      176   1e-50    
emb|CDY18131.1|  BnaC05g01540D                                          177   1e-50    
ref|XP_010069956.1|  PREDICTED: glutathione S-transferase-like          177   1e-50    
dbj|BAM21532.1|  glutathione S-transferase-like protein                 177   1e-50    
ref|NP_001043059.1|  Os01g0371200                                       177   1e-50    
gb|ABR25713.1|  glutathione s-transferase gstf2                         177   1e-50    
ref|XP_009111176.1|  PREDICTED: glutathione S-transferase F6-like       177   1e-50    
ref|XP_008777856.1|  PREDICTED: glutathione S-transferase F10-like      177   1e-50    
ref|XP_010481374.1|  PREDICTED: glutathione S-transferase F6            177   1e-50    
ref|NP_001105111.1|  Glutathione transferase III(b)                     177   2e-50    
ref|XP_008791961.1|  PREDICTED: glutathione S-transferase F11-like      177   2e-50    
gb|AAG34811.1|AF243376_1  glutathione S-transferase GST 21              176   2e-50    
gb|KDO87317.1|  hypothetical protein CISIN_1g038052mg                   177   2e-50    
gb|EMT23806.1|  hypothetical protein F775_27835                         177   2e-50    
gb|KCW58500.1|  hypothetical protein EUGRSUZ_H01176                     176   2e-50    
gb|AFK43695.1|  unknown                                                 176   2e-50    
gb|EMS54823.1|  putative glutathione S-transferase GSTF1                176   2e-50    
ref|XP_010684078.1|  PREDICTED: glutathione S-transferase-like          176   3e-50    
ref|XP_009600539.1|  PREDICTED: glutathione S-transferase APIC          176   3e-50    
ref|XP_004971178.1|  PREDICTED: glutathione S-transferase 3-like        176   3e-50    
ref|XP_010474883.1|  PREDICTED: glutathione S-transferase F6-like       176   3e-50    
ref|XP_010457292.1|  PREDICTED: glutathione S-transferase F6-like       176   3e-50    
dbj|BAA04553.1|  glutathione S-transferase                              176   3e-50    
ref|XP_009134427.1|  PREDICTED: glutathione S-transferase F2-like       176   3e-50    
ref|XP_008342339.1|  PREDICTED: glutathione S-transferase F9-like       174   3e-50    
ref|XP_010069959.1|  PREDICTED: glutathione S-transferase-like          176   3e-50    
ref|XP_006387912.1|  hypothetical protein POPTR_0483s00220g             176   3e-50    
ref|XP_006386754.1|  glutathione S-transferase family protein           176   5e-50    
ref|NP_001043061.1|  Os01g0371500                                       176   5e-50    
ref|NP_001045306.1|  Os01g0933900                                       176   6e-50    
ref|XP_007050849.1|  Glutathione S-transferase phi 8                    175   6e-50    
pdb|1AW9|A  Chain A, Structure Of Glutathione S-Transferase Iii I...    175   7e-50    
ref|XP_009397596.1|  PREDICTED: glutathione S-transferase F10-like      175   8e-50    
ref|XP_001765390.1|  predicted protein                                  176   8e-50    
emb|CAB38118.1|  Glutathione transferase III(a)                         175   8e-50    
ref|XP_004968765.1|  PREDICTED: probable glutathione S-transferas...    175   8e-50    
gb|ACF82527.1|  unknown                                                 175   9e-50    
ref|XP_006359403.1|  PREDICTED: glutathione S-transferase APIC-like     175   9e-50    
ref|XP_001765336.1|  predicted protein                                  175   9e-50    
ref|XP_010069964.1|  PREDICTED: glutathione S-transferase-like          175   9e-50    
ref|XP_010522776.1|  PREDICTED: glutathione S-transferase F6-like       175   9e-50    
ref|XP_009758138.1|  PREDICTED: glutathione S-transferase PARB          175   1e-49    
ref|XP_010689209.1|  PREDICTED: glutathione S-transferase-like          175   1e-49    
gb|ABM53759.1|  glutathione S-transferase                               174   1e-49    
ref|XP_009119597.1|  PREDICTED: glutathione S-transferase F6-like       174   1e-49    
ref|XP_006444272.1|  hypothetical protein CICLE_v10024356mg             174   1e-49    
emb|CAA96431.1|  glutathione S-transferase                              174   1e-49    
gb|EMT03779.1|  hypothetical protein F775_27568                         174   1e-49    
dbj|BAM14582.1|  putative glutathione S-transferase                     174   2e-49    
gb|AFP86475.1|  glutathione-S-transferase                               174   2e-49    
ref|XP_006855529.1|  hypothetical protein AMTR_s00057p00211420          174   2e-49    
emb|CDX90934.1|  BnaA03g26140D                                          174   2e-49    



>ref|XP_009631630.1| PREDICTED: glutathione S-transferase F11 [Nicotiana tomentosiformis]
Length=229

 Score =   362 bits (929),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GSA AACPQRVM CL ELGV+FELIH+DL S E K PEFL  QPFGQVP IEDG
Sbjct  1    MVVKVYGSAMAACPQRVMVCLIELGVNFELIHVDLDSLEQKKPEFLTLQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KY +KG  L GKT+EE+ VVDQWLEVESNN+NDLVYNMVLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYEDKGTKLTGKTLEEKAVVDQWLEVESNNFNDLVYNMVLQLVV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MGQ SD+++V KCA+KL KV D+YE+RLSKSKYLAGDFFSLADLSHLPSLRFL NEG
Sbjct  121  FPKMGQNSDLTLVHKCADKLEKVFDIYEQRLSKSKYLAGDFFSLADLSHLPSLRFLMNEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQKN  738
            GF HLV+ERKCLN WY DIS+RPAWNKVL+L+  +K+
Sbjct  181  GFAHLVTERKCLNDWYLDISSRPAWNKVLELMIMKKS  217



>ref|XP_006348185.1| PREDICTED: glutathione S-transferase F11-like [Solanum tuberosum]
Length=230

 Score =   355 bits (910),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GSA AACPQRVM CL ELGVD+ELIHIDL S + K P+FL  QPFGQVP IEDG
Sbjct  1    MVVKVYGSAMAACPQRVMVCLIELGVDYELIHIDLDSLQQKKPDFLILQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KY +KGK L G T+EE+ +VDQWLEVESNNYNDLVYNMVLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYEDKGKKLTGTTLEEKALVDQWLEVESNNYNDLVYNMVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MG  SD+ VV+KCA  L KV D+YE+RLSKSKYLAGDFFSLADLSHLPSLRFL NEG
Sbjct  121  FPKMGHNSDLIVVQKCANNLEKVFDIYEQRLSKSKYLAGDFFSLADLSHLPSLRFLMNEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQKN  738
            GF HLV++RKCL+ WY DIS+RP+WNKVLD +N +K+
Sbjct  181  GFAHLVTQRKCLHDWYLDISSRPSWNKVLDFMNMKKS  217



>emb|CAA68993.1| glutathione S-transferase [Petunia x hybrida]
Length=232

 Score =   347 bits (890),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV GSA AACPQRVM CL ELGVDFELIH+DL S E K PEFL  QPFGQVP IEDG
Sbjct  1    MVVKVHGSAMAACPQRVMVCLIELGVDFELIHVDLDSLEQKKPEFLVLQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KY  KG  L G T+EE+ +VDQWLEVESNNYNDLVYNMVLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYEVKGSKLTGTTLEEKALVDQWLEVESNNYNDLVYNMVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MGQ SD+++V KCA KL  V D+YE+RLSKSKYLAG+FFSLADLSHLPSLRFL NEG
Sbjct  121  FPKMGQTSDLTLVTKCANKLENVFDIYEQRLSKSKYLAGEFFSLADLSHLPSLRFLMNEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLI  723
            GF HLV++RKCL+ WY DIS+R +W KVLDL+
Sbjct  181  GFSHLVTKRKCLHEWYLDISSRDSWKKVLDLM  212



>ref|XP_004232669.1| PREDICTED: glutathione S-transferase F11 [Solanum lycopersicum]
Length=230

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GSA AACPQRVM CL ELGVD+ELIH+DL S + K P+FL  QPFGQVP IE+G
Sbjct  1    MVVKVYGSAMAACPQRVMVCLIELGVDYELIHVDLDSLQQKKPDFLLLQPFGQVPVIEEG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KY +KGK L G T+EE+ +VDQWLEVESNNYNDLVYNMVLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYEDKGKKLTGTTLEEKALVDQWLEVESNNYNDLVYNMVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MG  SD+ VV+KCA  L KV D+YE+RLSKSKYLAGDFFSLADLSHLPSLRFL NEG
Sbjct  121  FPKMGHKSDLIVVQKCANNLEKVFDIYEQRLSKSKYLAGDFFSLADLSHLPSLRFLMNEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQK  735
            GF HLV++RK L+ WY DIS+RP+W+KVLD +N +K
Sbjct  181  GFAHLVTQRKYLHDWYLDISSRPSWSKVLDFMNLKK  216



>ref|XP_009777301.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F11-like 
[Nicotiana sylvestris]
Length=258

 Score =   344 bits (883),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 184/217 (85%), Gaps = 3/217 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GSA AACPQRVM CL ELGVDFELIH+DL S E K PEFL  QPFGQVP IEDG
Sbjct  1    MVVKVYGSAMAACPQRVMVCLIELGVDFELIHVDLDSLEQKKPEFLTLQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KY +KG  L G T+EE+ VVDQWLEVESNN+NDLVYNMVLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYEDKGTKLTGTTLEEKAVVDQWLEVESNNFNDLVYNMVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MGQ SD+++V KCA+KL KV D+YE+RLSK+KYLAGDFFSLADLSHLPSLRFL NEG
Sbjct  121  FPKMGQNSDLTLVHKCADKLEKVFDIYEQRLSKTKYLAGDFFSLADLSHLPSLRFLMNEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQKN  738
            GF +LV +RKCLN W    S+RPAWNKVL+L+  +K+
Sbjct  181  GFANLVRKRKCLNDW---XSSRPAWNKVLELMMMKKS  214



>gb|ADM26566.1| glutathione S-transferase, partial [Capsicum annuum]
Length=223

 Score =   342 bits (877),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = +1

Query  106  GSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFE  285
            GSA AACPQRVM CL ELGVDFELIH+DL S E K PEFL  QPFG VP IE+GDF+LFE
Sbjct  2    GSAMAACPQRVMVCLIELGVDFELIHVDLDSLEQKKPEFLLLQPFGHVPVIEEGDFRLFE  61

Query  286  SRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQ  465
            SRAIIRYYA KY +KG  L G T+EE+ +VDQWLEVESNN+NDLVYNMVLQ+ VFP MG 
Sbjct  62   SRAIIRYYAAKYVDKGTKLTGTTLEEKALVDQWLEVESNNFNDLVYNMVLQLLVFPKMGH  121

Query  466  PSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLV  645
             SDM++V+KCA+KL KV D+YE+RLSKSKYLAGDFFSLADLSHLPSLRF+ N+GGF HLV
Sbjct  122  KSDMTLVQKCADKLEKVFDIYEQRLSKSKYLAGDFFSLADLSHLPSLRFVMNDGGFAHLV  181

Query  646  SERKCLNAWYSDISARPAWNKVLDLINNQKN  738
            ++RKCL  WY DIS+RP+WNKVLDL+  +K+
Sbjct  182  TKRKCLQDWYLDISSRPSWNKVLDLMIMKKS  212



>dbj|BAM14584.1| glutathione S-transferase for anthocyanin accumulation [Cyclamen 
persicum x Cyclamen purpurascens]
Length=213

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G ATA CPQRV+ACLFEL VDFE+IH+DL+S EHK P+FL RQPFGQVPAIEDG
Sbjct  1    MVVKVYGPATAGCPQRVIACLFELDVDFEIIHVDLESGEHKKPDFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYA KY+EK  +L G T+EE+ +VDQWLEVES+N+NDLVY +VL + V
Sbjct  61   DFRLFESRAIMRYYAAKYSEKNPDLQGSTLEEKALVDQWLEVESHNFNDLVYTLVLHLMV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP MG+ SDM +V++C  KL KV D+YEERLSKS YLAG  F+LADLSHLPS+ FL  EG
Sbjct  121  FPQMGKRSDMQLVQECESKLEKVFDIYEERLSKSNYLAGKLFTLADLSHLPSITFLMGEG  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G GH+V  RK +N+W+ DIS+RP+W KV  L++
Sbjct  181  GLGHMVRNRKNVNSWWMDISSRPSWKKVRKLMD  213



>ref|XP_004288578.1| PREDICTED: glutathione S-transferase F11-like [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   AACPQRVM CL ELGV+FE++ +DLQ+ E K P  L RQPFGQVPAIEDG
Sbjct  1    MVLKVYGPVRAACPQRVMVCLLELGVEFEIVPVDLQAGEQKQPHILARQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI+RYYA KYAE+G NL+G T+EE+ +VDQWLEVES+N+NDLV+ +VLQ+ +
Sbjct  61   DFKLFESRAIVRYYAAKYAERGPNLLGTTLEEKALVDQWLEVESHNFNDLVFTVVLQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             PSMGQP D+++V+ C EKL KV DVYEERLSKS YLAG++FSLADLSHLP++RFL +E 
Sbjct  121  LPSMGQPGDLALVRSCEEKLKKVFDVYEERLSKSTYLAGNYFSLADLSHLPAIRFLVDEF  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              GHL++ERK +NAW+ DIS RPAW K++ L
Sbjct  181  KMGHLITERKNVNAWWKDISNRPAWKKLMKL  211



>ref|XP_010270745.1| PREDICTED: glutathione S-transferase F11-like [Nelumbo nucifera]
Length=213

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  TA CPQRV+ACL E  V+FE+IH+DL S E K PEFL +QPFGQVP IEDG
Sbjct  1    MVVKVYGPVTAVCPQRVIACLIEKDVEFEVIHVDLDSMEQKKPEFLTKQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D +LFESRAIIRY A KYA++G NL+G T+EE+ +VDQWLEVE++NYNDLV+++V ++ +
Sbjct  61   DLRLFESRAIIRYIAAKYADRGPNLLGNTLEEKAMVDQWLEVEAHNYNDLVFSIVFELLI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D + V  C +KL KVLD+YEERLSKSKYLAGD F+LADLSHLP+ R+LTNE 
Sbjct  121  LPRMGKVGDKAFVYTCEQKLAKVLDIYEERLSKSKYLAGDSFTLADLSHLPATRYLTNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G GHLV +RK +NAWY DI+ R AW KV++L+N
Sbjct  181  GMGHLVRDRKHVNAWYEDITKRAAWKKVVNLMN  213



>ref|XP_010270817.1| PREDICTED: glutathione S-transferase F12-like [Nelumbo nucifera]
Length=213

 Score =   311 bits (796),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G  TA CPQRV+ACL E GV FE+IH+DL   E K PEFL +QPFGQVP IEDG
Sbjct  1    MAVKVYGPVTAVCPQRVIACLIEKGVKFEVIHVDLDCMEQKKPEFLTKQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRY A KYA+ G NL+G T+EE+ +VDQWLE+E++NYNDLV+ +V ++ +
Sbjct  61   DFRLFESRAIIRYIAAKYADSGPNLLGNTLEEKAMVDQWLEIENHNYNDLVFGIVFELLI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D ++V  C +KL KVLD+YE+RLSKSKYLAGD F+LADLSHLP+ R+LTNE 
Sbjct  121  LPRMGKVGDKALVYACEQKLAKVLDIYEDRLSKSKYLAGDSFTLADLSHLPATRYLTNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G GHLV +RK +NAW+ DIS RPAW KVL+L+N
Sbjct  181  GMGHLVRDRKHVNAWWEDISKRPAWEKVLNLMN  213



>ref|XP_006372485.1| putative glutathione S-transferase family protein [Populus trichocarpa]
 gb|ERP50282.1| putative glutathione S-transferase family protein [Populus trichocarpa]
Length=214

 Score =   311 bits (796),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A CPQRVMACL E GV+F+L+H+DL S E K PEFL +QPFGQVP +EDG
Sbjct  1    MVVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KY ++G NL+G T+EE+ +VDQWLE+E++N+NDLV+N+V Q+ +
Sbjct  61   DFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +GQ  D  +V+   EKL KVLDVYE+RLSKSKYLAGD F+LADLSHLP+ R+L NE 
Sbjct  121  LPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G GHLV +RK LNAW+ DIS+RPAW K+++L
Sbjct  181  GLGHLVKDRKKLNAWWEDISSRPAWKKLINL  211



>ref|XP_009370587.1| PREDICTED: glutathione S-transferase F12 [Pyrus x bretschneideri]
 gb|AHB33320.1| glutathione S-transferase 1 [Pyrus pyrifolia]
Length=215

 Score =   311 bits (796),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRVM CL E GV+FE++ +DL++ EHK PEFL RQPFGQVP +EDG
Sbjct  1    MVVKVYGPVMAACPQRVMVCLLEKGVNFEIVDVDLEAGEHKRPEFLTRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D +LFESRAIIRYYA KYA +G NL+G T+EE+ VVDQWLEVE +N+NDLVY +VLQ+ V
Sbjct  61   DLRLFESRAIIRYYAAKYAGRGPNLLGTTLEEKAVVDQWLEVEGHNFNDLVYTLVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MGQ  D++++  C EKL KV DVYEERLSKSKYLAG+ F+LADLSHLP +R+L +E 
Sbjct  121  LPRMGQRGDVALINACEEKLEKVFDVYEERLSKSKYLAGETFTLADLSHLPGIRYLIDEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              GHLV+ERK +NAW+ DIS RP+W K++ L ++
Sbjct  181  KLGHLVTERKKVNAWWEDISNRPSWKKLMQLASD  214



>ref|XP_006430394.1| hypothetical protein CICLE_v10012739mg [Citrus clementina]
 gb|ESR43634.1| hypothetical protein CICLE_v10012739mg [Citrus clementina]
Length=213

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  AACPQRV+ACL E GVDFE++ +DL   EHK PEFL RQPFGQVP IEDG
Sbjct  1    MVVKVYGSVKAACPQRVLACLLEKGVDFEIVQVDLDEGEHKRPEFLLRQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KYA +G NL+G T+EE+ +VDQWLEVE++N+NDL +N+VLQ+ +
Sbjct  61   DFKLFESRAIIRYYAAKYANQGPNLLGNTLEEKALVDQWLEVEAHNFNDLAFNLVLQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MGQ SD ++V    +KL  VL++YE+RLSKS YLAGD F+LADLSHLP+LR+L NE 
Sbjct  121  LPRMGQRSDTALVHNLKQKLSAVLNIYEQRLSKSNYLAGDSFTLADLSHLPALRYLMNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV++RK +NAW+  IS+RPAW K+  L
Sbjct  181  GMAHLVTQRKHVNAWWDKISSRPAWKKLASL  211



>ref|XP_011038319.1| PREDICTED: glutathione S-transferase F12-like [Populus euphratica]
Length=214

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A CPQRVMACL E GV+F+L+H+DL S E K PEFL +QPFGQVP +EDG
Sbjct  1    MVVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KY ++G NL+G T+EE+ +VDQWLE+E++N+NDLV+N+V Q+ +
Sbjct  61   DFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +GQ  D  ++K   EKL KVLDVYE+RLSKSKYLAGD F+LADLSHLP+ R+L NE 
Sbjct  121  LPRIGQQGDSELLKTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G GHLV +RK LNAW+ DIS+RPAW ++++L
Sbjct  181  GLGHLVKDRKKLNAWWEDISSRPAWKRLVNL  211



>ref|XP_008368725.1| PREDICTED: glutathione S-transferase F12-like [Malus domestica]
 gb|AEN84869.1| GST-like protein [Malus domestica]
 gb|AEN84870.1| GST-like protein [Malus domestica]
Length=215

 Score =   309 bits (791),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 172/214 (80%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRVM CL E GV+FE++ +DL++ EHK PEFL RQPFGQVP +EDG
Sbjct  1    MVVKVYGPVMAACPQRVMVCLLEKGVNFEIVDVDLEAGEHKRPEFLTRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KYA +G NL+G T+EE+ VVDQWLEVE +N+NDLVY +VLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYAGRGPNLLGTTLEEKAVVDQWLEVEGHNFNDLVYTLVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MGQ  D +++  C EKL KV DVYEERLSKSKYLAG+ F+LADLSHLP +R+L +E 
Sbjct  121  LPRMGQRGDAALINACEEKLEKVFDVYEERLSKSKYLAGETFTLADLSHLPGIRYLIDEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              GHLV+ RK +NAW+ DIS RP+W K++ L ++
Sbjct  181  KLGHLVTGRKKVNAWWEDISNRPSWKKLMQLASD  214



>gb|ADB11336.1| phi class glutathione transferase GSTF8 [Populus trichocarpa]
Length=214

 Score =   308 bits (790),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A CPQRVMACL E GV+F+L+H+DL S E K PEFL  QPFGQVP +EDG
Sbjct  1    MVVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLFQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KY ++G NL+G T+EE+ +VDQWLE+E++N+NDLV+N+V Q+ +
Sbjct  61   DFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +GQ  D  +V+   EKL KVLDVYE+RLSKSKYLAGD F+LADLSHLP+ R+L NE 
Sbjct  121  LPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G GHLV +RK LNAW+ DIS+RPAW K+++L
Sbjct  181  GLGHLVKDRKKLNAWWEDISSRPAWKKLINL  211



>ref|NP_001275781.1| uncharacterized protein LOC102625825 [Citrus sinensis]
 gb|ABA42223.1| glutathione S-transferase [Citrus sinensis]
 gb|ABA42224.1| glutathione S-transferase [Citrus sinensis]
Length=213

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  AACPQRV+ACL E GV+FE++ +DL   EHK PEFL RQPFGQVP IEDG
Sbjct  1    MVVKVYGSVKAACPQRVLACLLEKGVEFEIVQVDLDEGEHKRPEFLLRQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KYA +G NL+G T+EE+ +VDQWLEVE++N+NDL +N+VLQ+ +
Sbjct  61   DFKLFESRAIIRYYAAKYANQGPNLLGNTLEEKALVDQWLEVEAHNFNDLAFNLVLQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MGQ SD ++V    +KL  VL++YE+RLSKS YLAGD F+LADLSHLP+LR+L NE 
Sbjct  121  LPRMGQRSDTALVHNLEQKLEAVLNIYEQRLSKSNYLAGDSFTLADLSHLPALRYLMNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV++RK +NAW+  IS+RPAW K+  L
Sbjct  181  GMAHLVTQRKHVNAWWDKISSRPAWKKLASL  211



>ref|NP_001241411.1| uncharacterized protein LOC100812502 [Glycine max]
 gb|ACU23510.1| unknown [Glycine max]
 gb|AJE59623.1| phi class glutathione S-transferase [Glycine max]
Length=213

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A+AACPQRV+ CL E GV+FEL+H+DL   EHKTPEFL RQPFGQVPA+EDG
Sbjct  1    MVVKVYGPASAACPQRVLVCLLEKGVEFELVHVDLDQGEHKTPEFLLRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRY+A+KYA++G +L+GKT+EER +V+QWLEVE++N+N+L +N++ Q+ +
Sbjct  61   DFRLFESRAIIRYFASKYADRGPDLLGKTLEERALVEQWLEVEASNFNNLCFNIMFQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+P D+++  KC + + KVLDVYE RLS+S YLAGD F+LADLSHLP L  L  E 
Sbjct  121  LPKMGKPGDLALAHKCEQDIEKVLDVYETRLSQSTYLAGDNFTLADLSHLPGLEHLIEEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
              GHLV+ERK +NAW+  IS+RPAW K+ DLI+
Sbjct  181  KLGHLVTERKNVNAWWEKISSRPAWKKLKDLIH  213



>gb|KDO57306.1| hypothetical protein CISIN_1g041226mg [Citrus sinensis]
Length=213

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  AACPQRV+ACL E GV+FE++ +DL   EHK PEFL RQPFGQVP IEDG
Sbjct  1    MVVKVYGSVKAACPQRVLACLLEKGVEFEIVQVDLDEGEHKRPEFLLRQPFGQVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KY  +G NL+G T+EE+ +VDQWLEVE++N NDL +N+VLQ+ +
Sbjct  61   DFKLFESRAIIRYYAAKYVNQGPNLLGNTLEEKALVDQWLEVEAHNLNDLAFNLVLQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MGQ SD ++V    +KL  VL++YE+RLSKS YLAGD F+LADLSHLP+LR+L NE 
Sbjct  121  LPRMGQRSDTALVHNLEQKLEAVLNIYEQRLSKSNYLAGDSFTLADLSHLPALRYLMNEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV++RK +NAW+  IS+RPAW K+  L
Sbjct  181  GMAHLVTQRKHVNAWWDKISSRPAWKKLASL  211



>ref|XP_007215953.1| hypothetical protein PRUPE_ppa011307mg [Prunus persica]
 gb|EMJ17152.1| hypothetical protein PRUPE_ppa011307mg [Prunus persica]
Length=215

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRVM CL E GV+FE++ ++L+  E K P+FL RQPFGQVPA+EDG
Sbjct  1    MVVKVYGPVKAACPQRVMVCLLEKGVNFEIVDVNLEVGEQKQPQFLSRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KYA++G NL+G T+EE+ +VDQWLEVE++N+NDLVY +VLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYADRGPNLLGTTLEEKALVDQWLEVEAHNFNDLVYTLVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++V  C EKL KV DVYEERLSKS YLAG+ F+LADLSHLP + +L +E 
Sbjct  121  LPRMGERGDVALVHACEEKLEKVFDVYEERLSKSSYLAGEAFTLADLSHLPGISYLIDEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              GHLVSERK +NAW+ DIS RPAW K++ L ++
Sbjct  181  KLGHLVSERKNVNAWWKDISNRPAWKKLMSLASD  214



>emb|CDP21282.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G  TA CPQRV+ CL E+GVDFE++H+DL++ +HK PEFL  QPFGQVP +EDG
Sbjct  1    MAVKVYGPVTAGCPQRVLVCLVEMGVDFEVVHVDLETGDHKKPEFLPLQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYA+K AE G NL+G T+EE+ +VDQWLEVES+N+ND++Y +VLQ+ V
Sbjct  61   DFRLFESRAIVRYYASKNAEHGPNLLGTTLEEKALVDQWLEVESHNFNDMIYGLVLQLEV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+ +D  +V+K  + L KVLDVYEERLSKSKYLAGD++++AD+ HLP + FL    
Sbjct  121  LPRMGKSTDFKLVQKFVDNLDKVLDVYEERLSKSKYLAGDYYTIADMCHLPGITFLLTGN  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLI  723
            GFGHL+ ERK +N+W++DIS RPAW KVL+L+
Sbjct  181  GFGHLIRERKSVNSWWNDISGRPAWKKVLELM  212



>ref|XP_008227889.1| PREDICTED: glutathione S-transferase F11-like [Prunus mume]
Length=214

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRVM CL E GV+FE++ ++L+  E K P+FL RQPFGQVP +EDG
Sbjct  1    MVVKVYGPVKAACPQRVMVCLLEKGVNFEIVDVNLEVGEQKRPQFLSRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA KYA++G NL+G T+EE+ +VDQWLEVE++N+NDLVY +VLQ+ V
Sbjct  61   DFRLFESRAIIRYYAAKYADRGPNLLGTTLEEKALVDQWLEVEAHNFNDLVYTLVLQLLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++V  C EKL KV DVYEERLSKS YLAG+ F+LADLSHLP +R+L +E 
Sbjct  121  LPRMGERGDVALVHACEEKLEKVFDVYEERLSKSSYLAGEAFTLADLSHLPGIRYLIDEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              GHLV+ERK +NAW+ DIS RPAW K++ L ++
Sbjct  181  KLGHLVTERKNVNAWWKDISNRPAWKKLMSLASD  214



>gb|KHN08780.1| Glutathione S-transferase F11 [Glycine soja]
Length=213

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A+AACPQRV+ CL E GV+FEL+H+DL   EHK PEFL RQPFGQVPA+EDG
Sbjct  1    MVVKVYGPASAACPQRVLVCLLEKGVEFELVHVDLDQGEHKKPEFLLRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D +LFESRAIIRY+A+KYA++G +L+GKT+EER +V+QWLEVE++N+N+L +N++ Q+ +
Sbjct  61   DCRLFESRAIIRYFASKYADRGPDLLGKTLEERALVEQWLEVEASNFNNLCFNIMFQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+P D+++  KC + + KVLDVYE RLS+S YLAGD F+LADLSHLP L  L  E 
Sbjct  121  LPKMGKPGDLALAHKCEQDIEKVLDVYETRLSQSTYLAGDNFTLADLSHLPGLEHLIEEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
              GHLV+ERK +NAW+  IS+RPAW K+ DLI+
Sbjct  181  KLGHLVTERKNVNAWWEKISSRPAWKKLKDLIH  213



>ref|XP_003538377.1| PREDICTED: glutathione S-transferase F11-like [Glycine max]
 gb|KHN24165.1| Glutathione S-transferase F11 [Glycine soja]
 gb|AJE59621.1| phi class glutathione S-transferase [Glycine max]
Length=213

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A+AACPQRV+ CL E GV+FEL+H+DL   EHK PEFL RQPFGQVPA+EDG
Sbjct  1    MVVKVYGPASAACPQRVLVCLLEKGVEFELVHVDLDLGEHKKPEFLLRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYA+K+A++G +L+GKT+EER +V+QWLEVE++N+N+L +N++ Q+ +
Sbjct  61   DFRLFESRAIIRYYASKFADRGPDLLGKTLEERALVEQWLEVEAHNFNNLCFNIMFQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+P D+++  KC + L KVLDVYE RLS+S YLAGD F+LADLSHLP L  L  E 
Sbjct  121  LPKMGKPGDLALAHKCEQDLKKVLDVYESRLSQSTYLAGDNFTLADLSHLPGLGHLIEEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
              GHLV+ERK ++AW+  IS+RPAW K+ DL++
Sbjct  181  KLGHLVTERKNVSAWWEKISSRPAWKKLKDLVH  213



>ref|XP_007032197.1| Glutathione S-transferase F11 [Theobroma cacao]
 gb|EOY03123.1| Glutathione S-transferase F11 [Theobroma cacao]
Length=214

 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV GS  AACPQRV+ACL E  V+FE+ H+DL + EHK PEFL RQPFGQ+PA+EDG
Sbjct  1    MVVKVHGSVRAACPQRVLACLLEKDVEFEIFHVDLDAGEHKRPEFLLRQPFGQIPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAIIRYYA KY ++G NL+G ++EER VVDQWLEVE++N+NDLV  +V Q+ +
Sbjct  61   DLKLFESRAIIRYYAAKYVDRGPNLLGNSLEERAVVDQWLEVEAHNFNDLVKTLVFQIVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++  KC ++L KV D+YE+ LSKS YLAGD F+LADLSHLP++R+L N+ 
Sbjct  121  LPRMGEHGDLALAHKCEQQLEKVFDIYEQHLSKSSYLAGDSFTLADLSHLPAIRYLVNDA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G GHLV+ERK +NAW+ DIS R AW K+++L
Sbjct  181  GMGHLVAERKHVNAWWEDISNRSAWKKLMEL  211



>ref|NP_001267869.1| glutathione S-transferase [Vitis vinifera]
 gb|AAX81329.1| glutathione S-transferase [Vitis vinifera]
 emb|CBI27362.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   AACPQRV+ACL E GV+FE++H+DL S E K P+FL RQPFGQVP +EDG
Sbjct  1    MVMKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RY A KYAE+G +L+GK++EE+ VVDQWLEVE++N+N+LVY +V+Q+ +
Sbjct  61   DFRLFESRAIVRYIAAKYAEQGPDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++   C +KL KV DVYE+RLSKS+YLAGD F+LADLSHLP++R+L  E 
Sbjct  121  LPRMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGDSFTLADLSHLPAIRYLVKEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV+ERK ++AW+ DIS R AW KV++L
Sbjct  181  GMAHLVTERKSVSAWWEDISNRAAWKKVMEL  211



>gb|ACN38271.1| glutathione S-transferase [Vitis amurensis]
Length=213

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   AACPQRV+ACL E GV+FE++H+DL S E K P+FL RQPFGQVP +EDG
Sbjct  1    MVMKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RY A KYAE+G +L+GK++EE+ VVDQWLEVE++N+N+LVY +V+Q+ +
Sbjct  61   DFRLFESRAIVRYIAAKYAEQGPDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++   C +KL KV DVYE+RLSKS+YLAGD F+LADLSHLP++R+L  E 
Sbjct  121  LPRMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGDSFTLADLSHLPAIRYLVKEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G  HLV+ERK ++AW+ DIS R AW KV++L +
Sbjct  181  GMAHLVTERKSVSAWWEDISNRAAWKKVMELAS  213



>dbj|BAM72333.1| glutathione S-transferase [Dahlia pinnata]
Length=216

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRV+ACLFE GVDFEL+ ++L S EHK P+FL++QPFGQVP +EDG
Sbjct  1    MVVKVYGPIRAACPQRVLACLFEFGVDFELVRVNLDSGEHKQPDFLQKQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYATKY +K +NL G T+EE+ +VDQWLEVE++++ND+VY +VLQ  V
Sbjct  61   DFRLFESRAIIRYYATKYNDKNQNLYGTTLEEKALVDQWLEVEAHHFNDMVYTIVLQKLV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG  +D+ +V+ C +KL  VLD+YE+RLSKS YLAGD F+LADLSHLP  R+L NE 
Sbjct  121  IPKMGGKNDLDLVQNCVKKLELVLDIYEQRLSKSGYLAGDRFTLADLSHLPGTRYLINEC  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G  HLV +RK +N W+ DIS RPAW KV+ L +
Sbjct  181  GLDHLVRDRKKVNMWWDDISNRPAWKKVMQLFH  213



>ref|XP_010062332.1| PREDICTED: glutathione S-transferase F12 [Eucalyptus grandis]
 gb|KCW69459.1| hypothetical protein EUGRSUZ_F02915 [Eucalyptus grandis]
Length=212

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV GS  AACPQRV+ CL E  VDFE+ H+DL + E K PEFL+RQPFGQVPA+EDG
Sbjct  1    MAVKVHGSIRAACPQRVIVCLLEKEVDFEIEHVDLDAGEQKKPEFLQRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYATKYA +G +L+G T+EE+ VVDQWLEVE++N+N+  +N+V  + +
Sbjct  61   DFRLFESRAIIRYYATKYANRGTDLLGATLEEQAVVDQWLEVEAHNFNEPAFNLVFHLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G  SDM++V    +KL KV+DVYE+RLSKS+YLAGDFFSLADLSHLP+LR L  + 
Sbjct  121  SPRLGLRSDMALVHSSEQKLEKVMDVYEQRLSKSRYLAGDFFSLADLSHLPALRCLIEDA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLI  723
            G GHLV ERK +NAW+ DIS+RP+W K+L L+
Sbjct  181  GLGHLVKERKYVNAWWEDISSRPSWKKLLTLL  212



>gb|ADB97493.1| glutathione S-transferase 4 [Vitis hybrid cultivar]
Length=213

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   AACPQRV+ACL E GV+FE++H+DL S E K P+FL RQPFGQVP +EDG
Sbjct  1    MVMKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RY A KYAE+G +L+GK++EE+ VVDQWLEVE++N+N+LVY +V+Q+ +
Sbjct  61   DFRLFESRAIVRYIAAKYAEQGPDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++   C +KL KV DVYE+RLSKS+YLAGD F+LADLSHLP++R+L  E 
Sbjct  121  LPRMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGDSFTLADLSHLPAIRYLVKEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV+ERK  +AW+ DIS R AW KV++L
Sbjct  181  GMAHLVTERKSESAWWEDISNRAAWKKVMEL  211



>ref|XP_007146992.1| hypothetical protein PHAVU_006G087500g [Phaseolus vulgaris]
 gb|ESW18986.1| hypothetical protein PHAVU_006G087500g [Phaseolus vulgaris]
Length=214

 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A AACPQRVM CL E GV+F+L+HIDLQ  + KTP+FL  QPFGQVP +EDG
Sbjct  2    MVVKVYGEARAACPQRVMVCLLEKGVEFQLVHIDLQQGQQKTPQFLLLQPFGQVPVVEDG  61

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAIIRYYATKYA++G  L+GKT+EER +V+QWLEVE++N+N+L ++++LQ+ +
Sbjct  62   DFRLFESRAIIRYYATKYADRGTELLGKTLEERALVEQWLEVEAHNFNNLCFSIMLQLVI  121

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++ KK  E +GKVLDVYE RLS+S YLAGD FSLADLSHLP L  L  E 
Sbjct  122  LPKMGKVGDLALAKKGEEDIGKVLDVYESRLSESTYLAGDHFSLADLSHLPGLGHLIEEA  181

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
              GHLV++RK +NAW+  IS+RPAW K+ ++++
Sbjct  182  KLGHLVTQRKNVNAWWEKISSRPAWKKLKNMVH  214



>ref|XP_004503099.1| PREDICTED: glutathione S-transferase F11-like [Cicer arietinum]
Length=213

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  AACPQRV+ACL E G++FEL+H+DL   E K PEFL  QPFGQVP +EDG
Sbjct  1    MVVKVYGSIRAACPQRVLACLLEKGIEFELVHVDLDKGEQKHPEFLLLQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYATKYA +G +L+G T+EE+ +VDQWLEVE++N+NDL +N++  + +
Sbjct  61   DFRLFESRAIVRYYATKYANQGTDLVGTTLEEKALVDQWLEVEAHNFNDLCFNIMFHLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+P D+++   C +KL KV D+YE+RLSKS YLAGD FSLADLSHLP +  L  E 
Sbjct  121  LPRMGKPGDIALAHSCEQKLEKVFDIYEQRLSKSTYLAGDKFSLADLSHLPGIEHLIEEA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
              GHL++ERK +NAW+  IS+RPAW K+  L+N
Sbjct  181  KLGHLITERKNVNAWWEKISSRPAWKKLKTLVN  213



>dbj|BAM21533.1| glutathione S-transferase like protein [Dianthus caryophyllus]
Length=217

 Score =   296 bits (758),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            V+KV+G+  AACPQRV+ACL ELG+D+++I +DL+S  HK P+FL  QPFGQVP IEDGD
Sbjct  3    VIKVYGAKKAACPQRVIACLIELGIDYDVIFVDLESGHHKQPDFLALQPFGQVPVIEDGD  62

Query  271  FKLFESRAIIRYYATKYAEKG---KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQM  441
            F+L+ESRAIIRY ATKY+ K     NL+G  VEE+  VDQWLEVE++++N  VYN+VL++
Sbjct  63   FRLYESRAIIRYLATKYSPKNSLNNNLLGTNVEEKAFVDQWLEVEAHHFNQQVYNIVLEL  122

Query  442  FVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
             VFP MG+ +D+S V    +KL  VLDVYEERLSKSKYLAGDFF+LADLSHLP LR+LT 
Sbjct  123  IVFPKMGKQTDISYVHSLEKKLANVLDVYEERLSKSKYLAGDFFTLADLSHLPGLRYLTT  182

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            E    HLV + KC+NAW++DIS+RPAW KVL L N
Sbjct  183  EAKMPHLVEDLKCVNAWWTDISSRPAWKKVLSLDN  217



>ref|XP_011097023.1| PREDICTED: glutathione S-transferase F12 [Sesamum indicum]
Length=214

 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A AACPQRV+ CL ELG ++ELI IDL S E K P FL RQPFGQVPAIEDG
Sbjct  1    MVVKVYGPAYAACPQRVLTCLLELGFEYELIPIDLHSGEQKKPPFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYA-EKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DF+LFESRAIIRYYA K A + G NL+G T+EER +VDQWLEVE NNYN L+Y +VLQ+ 
Sbjct  61   DFRLFESRAIIRYYAAKCASDGGTNLLGDTLEERAIVDQWLEVEVNNYNSLIYTLVLQLL  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P MG   DM +V+ C  KL KVLDVYEERL+ SKYLAG+ F++ADLSHLP+ RFL +E
Sbjct  121  VLPRMGLGGDMELVRDCKGKLEKVLDVYEERLASSKYLAGERFTIADLSHLPNTRFLMDE  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            GG  HL+  RK +  W+ DIS+RP+W KV++L N
Sbjct  181  GGMEHLMKGRKSVYRWWMDISSRPSWKKVMELRN  214



>gb|KHG09927.1| Glutathione S-transferase F12 -like protein [Gossypium arboreum]
Length=214

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRV+ACL E  V+F+++ +DL++ +HK P+FL RQPFGQVPAIEDG
Sbjct  1    MVVKVYGPIKAACPQRVLACLLEKEVEFQIVDVDLEAGDHKKPDFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAIIRYYA KY ++G NL+G ++EER +VDQWLEVE++N+NDL Y +V Q+ +
Sbjct  61   DFKLFESRAIIRYYAAKYEKQGTNLLGNSLEERAMVDQWLEVEAHNFNDLAYTLVFQLLI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D ++V  C +KL KVLD+YE+RLS + YLAGD F+LADLSHLP+LR+L ++ 
Sbjct  121  LPRMGKQGDTALVLSCQQKLEKVLDIYEQRLSTTAYLAGDSFTLADLSHLPALRYLVDDV  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G  H+VS+RK +NAW+  IS R AW K++ L N
Sbjct  181  GMWHMVSQRKHVNAWWETISNRAAWKKLMKLAN  213



>gb|EYU33954.1| hypothetical protein MIMGU_mgv1a013692mg [Erythranthe guttata]
Length=213

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKVFG A  ACPQRV+ CL ELG++FELI ID+ S +HK P+FL RQPFGQVPAIEDG
Sbjct  1    MVVKVFGPAYGACPQRVLTCLVELGLEFELIPIDILSGQHKKPDFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYA-EKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DF+LFESRAIIRYYA K A + G NL GKT+EER +VDQWLEVE NNYN L+Y MVLQ+ 
Sbjct  61   DFRLFESRAIIRYYAAKCARDGGVNLYGKTLEERALVDQWLEVEVNNYNSLIYTMVLQLL  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P MGQ +D+ +V+ C  KL KVLDVYEERLSKSKYLAG+ F++AD+SHLP+ RFL  E
Sbjct  121  VLPRMGQGTDLELVRDCKGKLEKVLDVYEERLSKSKYLAGEEFTIADVSHLPNTRFLMEE  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLI  723
             G   L+  RK + AW+ DIS+RP+W KV++ +
Sbjct  181  -GMEDLIKGRKNVYAWWIDISSRPSWKKVMEFL  212



>ref|XP_002272053.1| PREDICTED: glutathione S-transferase F11 [Vitis vinifera]
 emb|CBI27364.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+   ACPQRV+ACL E G++FE++H+DL   E K PEFL RQPFGQV  +EDG
Sbjct  1    MVVKVYGAVMTACPQRVLACLVEKGLEFEVVHVDLDFGEQKRPEFLIRQPFGQVRVMEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LF+SRAIIRY   KY ++G NL+G+ +EER +VDQWLEVE NN N L++ +VLQ+ +
Sbjct  61   DFRLFDSRAIIRYIVAKYVDEGPNLVGRNLEERSLVDQWLEVEENNLNPLIFTVVLQLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+  D+++V+ C +KL KV D YE+RLSKS YL GD F+LADLSHLP +R+L NE 
Sbjct  121  LPRMGEKGDLTLVRNCEQKLDKVFDAYEQRLSKSSYLGGDSFTLADLSHLPGIRYLVNEV  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G GHL++ERK ++AW+ +IS  PAW KV++L
Sbjct  181  GIGHLITERKNVSAWWENISNMPAWKKVMNL  211



>ref|XP_003600650.1| Glutathione S-transferase [Medicago truncatula]
 gb|AES70901.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=213

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  AACPQRVMACL E  V+FE++HIDL   E K PEFL  QPFGQVP +EDG
Sbjct  1    MVVKVYGSINAACPQRVMACLLEKEVEFEIVHIDLDKGEQKKPEFLLLQPFGQVPVVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYA KYA++G +L+G T+E++ VVDQWLEVE++N++DL +N++  + +
Sbjct  61   DFRLFESRAIVRYYAAKYADRGPDLLGTTLEKKAVVDQWLEVEAHNFDDLCFNIMFNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG+P D+++     +KL +VLDVYE RLSKS YLAGD F+LADLSHLP +  L    
Sbjct  121  LPKMGKPGDITIAHSSEQKLEEVLDVYERRLSKSTYLAGDKFTLADLSHLPGIGHLIEAA  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              GHL+SERK +NAW+  IS+RPAW K+ +L
Sbjct  181  KLGHLISERKNVNAWWEKISSRPAWKKLKEL  211



>gb|ABR15777.1| glutathione S-transferase [Litchi chinensis]
Length=214

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  TA CPQRVMACL E  V+FE+IH+++ + EHK PEFL RQPFGQVP IED 
Sbjct  1    MVVKVYGPVTAGCPQRVMACLLEKDVEFEIIHVNIDNGEHKRPEFLLRQPFGQVPVIEDD  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYA KYA++G NL+G T+EER  VDQWLEVE++N+NDL+Y MVLQ+ V
Sbjct  61   DFRLFESRAILRYYAAKYADRGPNLLGTTLEERATVDQWLEVEAHNFNDLIYTMVLQLIV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             PSMGQP D+++V  C +KL  V DVYE++L KSKYLAGD+F LADLS +P+LRFLT + 
Sbjct  121  LPSMGQPGDLTLVHTCEQKLETVFDVYEKQLLKSKYLAGDWFFLADLSPMPALRFLTEDV  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                L  ERK +N    +IS  P+W K++ L
Sbjct  181  KLVPLGKERKHVNGGGEEISGPPSWKKLMKL  211



>ref|XP_010272271.1| PREDICTED: glutathione S-transferase F10-like [Nelumbo nucifera]
Length=211

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV G A A+C +RV+ACL E  ++F+++ +DL   E K+PEFL  QPFG VP I+DG
Sbjct  1    MVVKVHGPAYASCSRRVLACLVEKEIEFDIVPVDLLKGEQKSPEFLELQPFGVVPVIQDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIR+YA KY  +G +L+GKTVEERGVV+QWLEVE  NY+  +Y +V+Q+  
Sbjct  61   DYTLYESRAIIRFYAEKYRTQGTDLLGKTVEERGVVEQWLEVEGQNYHPPIYTLVVQLLF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G P D  +V++C EKLGKVLDVYEERLSKSKYLAGDFFSLADL+HLP   +L N+ 
Sbjct  121  HPKLGLPVDQKIVQECEEKLGKVLDVYEERLSKSKYLAGDFFSLADLTHLPFTHYLVNDI  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HLV +RK ++AW+ DIS+RP+W KVL L
Sbjct  181  GKEHLVRDRKHVSAWWDDISSRPSWKKVLQL  211



>dbj|BAG14300.1| glutathione S-transferase [Perilla frutescens var. crispa]
Length=214

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 168/212 (79%), Gaps = 1/212 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+  AAC QRV++CL ELG +FELI +DLQS EHK P+FL RQPFGQVPAIEDG
Sbjct  1    MVVKVYGATYAACSQRVLSCLIELGFEFELIPVDLQSGEHKKPQFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKY-AEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DFKLFESRAIIRYYA K  +E G NL+G T+EERGVV+QW+EVE NNYN L+Y MVLQ+ 
Sbjct  61   DFKLFESRAIIRYYAAKSGSEGGVNLLGDTLEERGVVEQWVEVEVNNYNPLIYTMVLQLL  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P MGQ  DM +V+ C  KL KVLDVYEERLSKSKYL G+ F++ADL+HLP+ RFL  E
Sbjct  121  VLPQMGQVGDMELVRDCKGKLEKVLDVYEERLSKSKYLGGERFTIADLTHLPNTRFLMEE  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            GG   L+  RK +  W+  IS+RP+W KV+DL
Sbjct  181  GGMEDLIKRRKNVYNWWIHISSRPSWRKVMDL  212



>gb|KEH33687.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=215

 Score =   270 bits (690),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    ACP+RV+ CL E  ++FE +H+D    EHK  E+L+ QPFG +P I+DG
Sbjct  1    MVVKVYG-PDYACPKRVIVCLIEKDIEFETVHVDGFKGEHKEAEYLKLQPFGLLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N+N  +YN+V+ + V
Sbjct  60   DYTLYESRAILRYYAEKYKNQGTDLLGKTIEERGLVEQWLEVEAHNFNPPIYNLVMNLLV  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            +P +G PSD  VV++  EKLGKVLD+YEERLSK+KYLAGDFFSLADLSHLP   +L N  
Sbjct  120  YPLVGLPSDQKVVQESEEKLGKVLDIYEERLSKTKYLAGDFFSLADLSHLPFGHYLMNSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  ++V ERK +NAW+ DIS RP+W KVL L
Sbjct  180  GKENMVKERKHVNAWWDDISNRPSWKKVLQL  210



>ref|XP_007146234.1| hypothetical protein PHAVU_006G023500g [Phaseolus vulgaris]
 gb|ESW18228.1| hypothetical protein PHAVU_006G023500g [Phaseolus vulgaris]
Length=215

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKVFG  T  CP+RV+ CL E  ++FE + +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVFG-PTYGCPKRVVVCLIEKEIEFETVDVDLFKGEHKEPEFLKLQPFGSVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY+A KY E+G  L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYFAEKYKEQGTELLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++  +KL KVLDVYEERLS SKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLKGVPSDQKVIEESDKKLEKVLDVYEERLSNSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK +NAW+ DIS RP+W KVL L
Sbjct  180  GRGNLVRERKHVNAWWDDISNRPSWKKVLQL  210



>ref|XP_007146198.1| hypothetical protein PHAVU_006G020800g [Phaseolus vulgaris]
 gb|ESW18192.1| hypothetical protein PHAVU_006G020800g [Phaseolus vulgaris]
Length=240

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +1

Query  37   FTN*HSIVTILILCCVNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTP  216
             T+ H+  T        MVVKV+G  T A P+RV+ CL E  ++FE + +DL   EHK P
Sbjct  9    MTDIHNQTTDKNYLDTKMVVKVYG-PTYASPKRVLVCLIEKEIEFETVDVDLFKGEHKEP  67

Query  217  EFLRRQPFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVE  396
            EFL+ QPFG VP I+DGD+ L+ESRAIIRY A KY E+G  L+GKT+EE+G+V+QWLEVE
Sbjct  68   EFLKLQPFGSVPVIQDGDYTLYESRAIIRYLAEKYKEQGTELLGKTIEEKGLVEQWLEVE  127

Query  397  SNNYNDLVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFS  576
            ++N++  +YN+V+ +   P MG PSD  V+++  +KL KVLDVYEERLS SKYLAGDFFS
Sbjct  128  AHNFHPPLYNLVINILFAPLMGAPSDQKVIEESDKKLEKVLDVYEERLSNSKYLAGDFFS  187

Query  577  LADLSHLPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVL  714
            LADLSHLP   +L N+ G G+LV ERK +NAW+ DIS RP+W KVL
Sbjct  188  LADLSHLPFGHYLVNQTGRGNLVRERKHVNAWWDDISNRPSWKKVL  233



>ref|XP_008229579.1| PREDICTED: glutathione S-transferase F9-like isoform X2 [Prunus 
mume]
Length=215

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 162/209 (78%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  +YN+V+Q+  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLYNLVIQILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G PSD  ++++  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  APELGLPSDPKIIQESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTYYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK + AW+ DIS RP+W KVL
Sbjct  180  GKEYMIKDRKHVAAWWDDISNRPSWKKVL  208



>gb|KFK37761.1| hypothetical protein AALP_AA3G026400 [Arabis alpina]
Length=214

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 163/211 (77%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRV+ C  E  ++FELIH+DL + EHK PE L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGFLQAACPQRVLLCFLEKDIEFELIHVDLNTLEHKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KL+ESRAI+RYY+TKYA++G +L+GKT+E+R +VDQW+E E+N +N +   +V+ + V
Sbjct  61   DLKLYESRAILRYYSTKYADQGTDLLGKTLEQRAIVDQWMETETNYFNAVGLPIVINLVV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+P D ++V++   K+ K+ DVYE RL+ ++YLAGD F+LADL+H+P LR+  NE 
Sbjct  121  KPRLGEPCDFALVEEQKAKMEKIFDVYENRLATNRYLAGDEFTLADLTHMPGLRYTMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G   +V+ R  LN W+++ISARP+W K++++
Sbjct  181  GSSSMVTSRPNLNRWWNEISARPSWKKLMEM  211



>gb|EPS73710.1| hypothetical protein M569_01048, partial [Genlisea aurea]
Length=208

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G A +AC QRV+ACL ELG++++++ +DL   E K PEFL +QPFGQVPA+EDG
Sbjct  1    MAVKVYGPAYSACTQRVIACLVELGIEYDIVPVDLMKGEQKKPEFLVKQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DFKLFESRAIIRYYA K A  G KNL+G T+EE+ +VDQWLEVE NNYN LV+ +VLQ+ 
Sbjct  61   DFKLFESRAIIRYYAAKTAAGGGKNLLGNTLEEKALVDQWLEVEVNNYNPLVFTLVLQIM  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D  V+++   KL +VLDVYEERLSK++YLAGD F++ADLSHLP+  FL  +
Sbjct  121  VLPRAGLGGDAKVIEETKGKLERVLDVYEERLSKTEYLAGDEFTIADLSHLPNTTFLIGQ  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNK  708
            GG    +  R+ LN+W++ IS RP+W K
Sbjct  181  GGMAESIRRRESLNSWWNRISNRPSWKK  208



>ref|XP_009377060.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA P+RV+ CL E  ++FE   IDL   EHK+PEFL+ QPFGQ+P I+DG
Sbjct  1    MVVKVYGPFYAA-PKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLYNLVMHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              +MG PSD  ++++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  ASAMGFPSDPKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++ +RK ++AW+ DIS+RP+W KVL+ 
Sbjct  180  GKEYMIRDRKHVSAWWDDISSRPSWKKVLEF  210



>gb|ABX65441.1| glutathione S-transferase [Chimonanthus praecox]
Length=211

 Score =   265 bits (677),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G A A+  +RV+AC  E G++FE++ +DL   E K P+FL+ QPFG VP IEDG
Sbjct  1    MTVKVYGPAYASATRRVLACFVEKGIEFEIVPLDLLKGEQKNPDFLKLQPFGLVPVIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF L+ESRAIIRYYA KYA +G +L+GKT+E+R +V+QWLEVE  NY+  +Y +VLQ+  
Sbjct  61   DFTLYESRAIIRYYAEKYATQGTDLLGKTLEDRAIVEQWLEVEGQNYHPPLYTLVLQLMY  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            +P MG   D  V+++C EKLGKVLD+YEERLSKSKYLAGDFFSLADL+HLP   +L  E 
Sbjct  121  YPKMGLALDHKVLEECEEKLGKVLDIYEERLSKSKYLAGDFFSLADLTHLPFTYYLLTET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              G+++ +RK +N W+ DIS R +W KVL L
Sbjct  181  DKGYMIRDRKHVNGWWDDISNRESWKKVLQL  211



>ref|XP_008229575.1| PREDICTED: glutathione S-transferase F9-like [Prunus mume]
Length=214

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+A A+ P+RV+ CL E  VDFE I IDL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGAAYAS-PKRVLVCLVEKEVDFETIPIDLLKGEHKHPEFLKLQPFGTVPLIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++  +YN+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTALLGKTIEERGLVEQWLEVEAHNFHPPLYNLVLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  V+++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L    
Sbjct  120  ASALGFPSDPKVIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLVTIL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW++DIS RP+W KVL+ 
Sbjct  180  GKEYLIKDRKHVSAWWNDISNRPSWKKVLEF  210



>ref|XP_007146224.1| hypothetical protein PHAVU_006G022600g [Phaseolus vulgaris]
 gb|ESW18218.1| hypothetical protein PHAVU_006G022600g [Phaseolus vulgaris]
Length=215

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  T A P+RV+ CL E  ++FE + +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYG-PTYASPKRVLVCLIEKEIEFETVDVDLFKGEHKEPEFLKLQPFGSVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY+A KY E+G  L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYFAEKYKEQGTELLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++  +KL KVLDVYEERLS SKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLKGVPSDQKVIEESDKKLEKVLDVYEERLSNSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G G+LV ERK +NAW+ DIS RP+W KVL
Sbjct  180  GRGNLVRERKHVNAWWDDISNRPSWKKVL  208



>ref|XP_006853524.1| hypothetical protein AMTR_s00032p00224770 [Amborella trichopoda]
 gb|ERN14991.1| hypothetical protein AMTR_s00032p00224770 [Amborella trichopoda]
Length=233

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 168/221 (76%), Gaps = 0/221 (0%)
 Frame = +1

Query  58   VTILILCCVNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQP  237
            V+ ++ C V MVVK+ G+A AACP+RV ACL+E  V+FEL+++DL + +HK PEFL+  P
Sbjct  13   VSSVVGCIVRMVVKLHGAAFAACPRRVAACLYEKNVEFELVNVDLFAGDHKKPEFLQLHP  72

Query  238  FGQVPAIEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDL  417
            FG VP I+D D   FESRAIIRYYA KYA +G +L+GK++E+R  ++QWLEVE++ +N+ 
Sbjct  73   FGLVPVIQDCDLTFFESRAIIRYYAEKYAGQGTDLLGKSLEDRATIEQWLEVEAHYFNEP  132

Query  418  VYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHL  597
             +++  Q+     +GQ  D++V+K   EKL KVLDVYEERLSKSKYL G+FFSLADLSHL
Sbjct  133  AFSLAFQVLYAEKLGQEPDLNVIKSSEEKLTKVLDVYEERLSKSKYLGGEFFSLADLSHL  192

Query  598  PSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            P   +L N+ G G+L  +RK ++AW+ DIS+RP+W KVL+L
Sbjct  193  PFAHYLINDSGKGYLFHDRKHVSAWWEDISSRPSWKKVLEL  233



>gb|KHN13181.1| Glutathione S-transferase F9 [Glycine soja]
Length=215

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  T ACP+RV+ CL E  ++FE +H+DL   E K PEFL+ QPFG +P I+DG
Sbjct  1    MVVKVYG-PTYACPKRVLVCLIEKEIEFETVHVDLFKGEAKEPEFLKLQPFGLLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L ESRAIIRYYA KY ++G +L+GKT+EERG+V+QWLEVE++N++  ++++V+ +  
Sbjct  60   DYTLSESRAIIRYYAEKYKDQGTDLLGKTIEERGLVEQWLEVEAHNFHPPLFDLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG PSD  V+++  +K+ KVLDVYEERLSKSKYLAGDFF LADLSHLP+  +L N+ 
Sbjct  120  APLMGAPSDPKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFCLADLSHLPAGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS RP+W+KVL L
Sbjct  180  GRGNLVRERKHVSAWWDDISNRPSWHKVLQL  210



>ref|XP_003532087.1| PREDICTED: glutathione S-transferase F9-like [Glycine max]
 gb|KHM99649.1| Glutathione S-transferase F9 [Glycine soja]
 gb|AJE59619.1| phi class glutathione S-transferase [Glycine max]
Length=216

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    A P+RV+ CL E  ++FE IH+D    EHK PE+L+ QPFG +P I+DG
Sbjct  1    MVVKVYG-PDYANPKRVIVCLIEKEIEFETIHVDSFKEEHKQPEYLKLQPFGLMPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYY+ KY  +G +L+GKT+EERG+V+QWLEVE++NY   +YN+V+ + V
Sbjct  60   DYTLYESRAILRYYSEKYKNQGTDLLGKTIEERGLVEQWLEVEAHNYYPPIYNLVMHVLV  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D  V+++  EKLGKVLD+YEERLSK+KYLAGDFFSLADLSHLP   +L N  
Sbjct  120  HPYKGEPFDPKVIQESEEKLGKVLDIYEERLSKTKYLAGDFFSLADLSHLPFTHYLMNHM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              G++V ERK ++AW+ DIS RP+W KVL L  +
Sbjct  180  KKGYMVRERKHVSAWWDDISNRPSWKKVLQLYKD  213



>gb|KHN13182.1| Glutathione S-transferase F9 [Glycine soja]
 gb|AJE59624.1| phi class glutathione S-transferase [Glycine max]
Length=215

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M+VKV+G  T   P+RV+ CL E  ++FE +HIDL   E+K PEFL+ QPFG +P I+DG
Sbjct  1    MLVKVYG-PTYGAPKRVLVCLIEKEIEFETVHIDLFKGENKEPEFLKLQPFGSLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY+A KY ++G +L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYFAEKYKDQGTDLLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++  +K+ KVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLTGAPSDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS RPAW KVL L
Sbjct  180  GRGNLVRERKHVSAWWDDISNRPAWQKVLQL  210



>ref|XP_009396141.1| PREDICTED: glutathione S-transferase F12-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 157/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A CPQRVM CL E GV FEL+H+D+ + EHK PEFL++QPFGQVP I DG
Sbjct  1    MVVKVYGKAQAVCPQRVMHCLVEKGVPFELVHVDIDTMEHKRPEFLQKQPFGQVPYIVDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D +LFESRAI+RY A KY ++G NL+G+T+EER  VDQWL+VE+ NYN   + +V  +FV
Sbjct  61   DLELFESRAIVRYLAAKYEDRGPNLLGRTLEERAKVDQWLDVEAINYNPWAFPIVFNLFV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P++ +      +KL KVL+VYE++LSK+KYLAGD F+LADL+H+P+ R++    
Sbjct  121  LPIRGLPANKADAGAAVDKLNKVLEVYEKQLSKTKYLAGDEFTLADLTHIPATRYIVENC  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
            G  HL+ ++K +  W+ DI+ RPAW KV+  +  
Sbjct  181  GLSHLLDDKKHVKTWWEDITGRPAWKKVMSFVET  214



>gb|KDP22743.1| hypothetical protein JCGZ_02402 [Jatropha curcas]
Length=210

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+A A+ P+RV+ CL E G++FE + IDL   EHK+PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGTAYAS-PKRVLVCLIEKGIEFETVPIDLIKGEHKSPEYLQLQPFGAVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE+ NY+  +YN+ L +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTELLGKTIEERGLVEQWLEVEAQNYHPPIYNLTLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P++G P D  V+K+  EKL KVLD+YE+RLSKSKYLAG+FFSLADLSHLP  ++L    
Sbjct  120  APALGFPPDEKVIKESEEKLAKVLDIYEDRLSKSKYLAGEFFSLADLSHLPFTQYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+  RK ++AW+ +IS RP+W KVL L
Sbjct  180  NKEYLIKSRKHVSAWWDNISNRPSWKKVLQL  210



>ref|NP_001237836.1| uncharacterized protein LOC100499911 [Glycine max]
 gb|ACU14147.1| unknown [Glycine max]
Length=215

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M+VKV+G  T   P+RV+ CL E  ++FE +HIDL   E++ PEFL+ QPFG +P I+DG
Sbjct  1    MLVKVYG-PTYGAPKRVLVCLIEKEIEFETVHIDLFKGENREPEFLKLQPFGSLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY+A KY ++G +L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYFAEKYKDQGTDLLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++  +K+ KVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLTGAPSDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS RPAW KVL L
Sbjct  180  GRGNLVRERKHVSAWWDDISNRPAWQKVLQL  210



>gb|KFK37762.1| hypothetical protein AALP_AA3G026500 [Arabis alpina]
Length=214

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AACPQRV+ C  E  ++FELIH+DL + EHK PE L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGFLQAACPQRVLHCFLEKEIEFELIHVDLNTLEHKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KL+ESRAI+RYY+TKYA++G +L+GKT+E+R +VDQW+E E+N +N +   +++ + V
Sbjct  61   DMKLYESRAILRYYSTKYADQGTDLLGKTLEQRAIVDQWMETEANYFNAVGLPIIINLVV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D ++V++   KL K+ DVYE RL+ ++YLAGD F+LADL+H+P LR++ NE 
Sbjct  121  NPKLGEICDFALVEELKVKLEKIFDVYENRLATNRYLAGDEFTLADLTHMPGLRYMMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V+ R  LN W+++IS RPAW K++++
Sbjct  181  SLSSMVTSRPNLNRWWNEISTRPAWKKLMEM  211



>gb|KEH33682.1| glutathione S-transferase [Medicago truncatula]
Length=215

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A  + P+RV+ CLFE  V+FE + IDL   EHK P+FL+ QPFG+VP ++DG
Sbjct  1    MVVKVYGPAYGS-PKRVLVCLFEKEVEFEAVDIDLFKGEHKQPDFLKLQPFGEVPLVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKTVEERG+V+QWLEVE++N++  +Y++V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKNQGTDLLGKTVEERGLVEQWLEVEAHNFHPAIYSLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P D   +++  EKL KVLD+YEERLSK+KYLAGDFFSLADLSHL    +L N+ 
Sbjct  120  APLRGVPGDQKAIEESDEKLKKVLDIYEERLSKTKYLAGDFFSLADLSHLAFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS+RP+W KVL+L
Sbjct  180  GRGNLVRERKHVSAWWDDISSRPSWKKVLEL  210



>ref|XP_010549801.1| PREDICTED: glutathione S-transferase F12-like [Tarenaya hassleriana]
Length=214

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G  TAACPQRV+ C  E G++FE+ HI+L SFE K P+FL RQPFGQVPA+EDG
Sbjct  1    MAVKVYGQITAACPQRVLLCFLEKGIEFEVAHINLDSFEQKNPDFLLRQPFGQVPAVEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYA KY+++G  L+GK++E+R +VDQW EVE+  +N LV  +V+ + V
Sbjct  61   DFKLFESRAIARYYAAKYSDQGTALLGKSLEQRAIVDQWAEVEAQYFNPLVQPIVINLVV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P D  +V     KL KVLDVYE RL  ++YLAGD F++ADL+H+P +R+L +E 
Sbjct  121  KPKFGYPCDDVLVADLRSKLEKVLDVYETRLGPNRYLAGDEFTMADLTHMPPMRYLMDET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
            G   LV +R  +N W+ +ISARPAW K++++ +
Sbjct  181  GLSRLVKDRLNVNRWWEEISARPAWIKLMEMAD  213



>ref|XP_004499970.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum]
Length=215

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    + P+RV+ CLFE  ++FE + IDL   EHK P+FL+ QPFG+VP ++DG
Sbjct  1    MVVKVYGPIYGS-PKRVLVCLFEKEIEFETLDIDLFKGEHKQPDFLKLQPFGEVPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKNQGTDLLGKTIEERGLVEQWLEVEAHNFHPAIYNLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PS+  V+++  EKL KVLD+YEE+LSK+KYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLQGTPSNQKVIEESDEKLKKVLDIYEEKLSKTKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G G+LV ERK ++ W+ DIS RP+W KVL+
Sbjct  180  GRGNLVRERKHVSEWWDDISNRPSWKKVLE  209



>ref|NP_001239642.1| glutathione S-transferase GST 22 [Glycine max]
 gb|ACU13210.1| unknown [Glycine max]
 gb|KHM99650.1| Glutathione S-transferase F9 [Glycine soja]
 gb|AJE59618.1| phi class glutathione S-transferase [Glycine max]
Length=215

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  T   P+RV+ CL E  ++FE +H+DL   E+K PEFL+ QPFG +P I+DG
Sbjct  1    MVVKVYG-PTYGSPKRVLVCLIEKEIEFETVHVDLFKGENKEPEFLKLQPFGSLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY A KY ++G +L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +  
Sbjct  60   DYTLYESRAIIRYLAEKYKDQGTDLLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++  +K+ KVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLTGAPSDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV +RK ++AW+ DIS RPAW KVL L
Sbjct  180  GRGNLVRDRKHVSAWWDDISNRPAWQKVLQL  210



>ref|XP_009377051.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK+PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLDNLVMHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  ++++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  ASALGFPSDPKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++ +RK ++AW+ DIS+RP+W KVL+ 
Sbjct  180  GKEYMIRDRKHVSAWWDDISSRPSWKKVLEF  210



>ref|XP_010940257.1| PREDICTED: glutathione S-transferase F12-like [Elaeis guineensis]
Length=221

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 165/215 (77%), Gaps = 0/215 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVV+++G   A CPQRVM CL E GV+FE+IH++L+  E KTPE++ +QPFGQVP I DG
Sbjct  1    MVVQIYGMTPAVCPQRVMHCLIEKGVEFEIIHVNLEKGEQKTPEYMTKQPFGQVPYIVDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RYYA KYA +G NL+G+T+EE+  VD WL+VE+ N N LV+ +V  +FV
Sbjct  61   DFELFESRAIVRYYADKYAGRGPNLLGRTLEEKARVDMWLDVEAINLNPLVFPIVFNLFV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   + +  +  AEKL KVL+VYE +LSK+KYLAGD F+LADL+H+P+LR++    
Sbjct  121  LPGQGLTGNKAEAQAAAEKLDKVLEVYERQLSKAKYLAGDEFTLADLTHIPALRYVVENC  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQ  732
            G GHL+S +K + AW++DI++RPAW KV+ ++ ++
Sbjct  181  GMGHLISSKKHVKAWWADITSRPAWKKVMGIVESR  215



>ref|XP_007215956.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17155.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=215

 Score =   260 bits (665),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V+Q+  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLDNLVIQILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G PSD  ++++  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  APELGLPSDPKIIQESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTYYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
               +++ +RK ++AW+ DIS RP+W KVL
Sbjct  180  EKEYMIKDRKHVSAWWDDISNRPSWKKVL  208



>ref|XP_007215944.1| hypothetical protein PRUPE_ppa011246mg [Prunus persica]
 gb|EMJ17143.1| hypothetical protein PRUPE_ppa011246mg [Prunus persica]
Length=217

 Score =   260 bits (665),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  A+ PQRV+ACL E  +DFE+I IDL   EHK PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGSVDAS-PQRVLACLVEKEIDFEIIPIDLFKGEHKDPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA K+  +G  L+GKT+EERG+V+QWLEVE+  ++  VY +V+ + +
Sbjct  60   DYTLYESRAIMRYYAEKFKSQGTELLGKTIEERGLVEQWLEVEAQRFHPPVYKLVVHILL  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  ++++   KLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP  + L  + 
Sbjct  120  ASALGFPSDPKIIQESEAKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFNQHLVADL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  H++ +RK ++AW+ DI  RP+W KVL L
Sbjct  180  GKEHMIRDRKHVSAWWDDIGNRPSWKKVLQL  210



>ref|XP_004303893.1| PREDICTED: glutathione S-transferase F9-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004303894.1| PREDICTED: glutathione S-transferase F9-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=214

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G + A+ P+RV+ CL E  ++FE I IDL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPSYAS-PKRVLVCLVEKEIEFETIPIDLFKGEHKDPEFLKLQPFGAVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE+ NY+  + N+V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAQNYHPSIDNLVIHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  ++++  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP  ++L    
Sbjct  120  APVQGFPSDPKIIQESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGAV  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++  RK ++AW+ DIS RP+W KVL+ 
Sbjct  180  GKDYMIKSRKHVSAWWDDISNRPSWKKVLEF  210



>gb|ACJ86198.1| unknown [Medicago truncatula]
Length=215

 Score =   260 bits (664),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A  + P+RV+ CLFE  V+FE + IDL   EHK P+FL+ QPFG+VP ++DG
Sbjct  1    MVVKVYGPAYGS-PKRVLVCLFEKEVEFEAVDIDLFKGEHKQPDFLKLQPFGEVPLVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKTVEERG+V+QWLEVE++N++  +Y++V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKNQGTDLLGKTVEERGLVEQWLEVEAHNFHPAIYSLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P D   +++  EKL KVLD+YEERLSK+KYLAGDFFSLADL HL    +L N+ 
Sbjct  120  APLRGVPGDQKAIEESDEKLKKVLDIYEERLSKTKYLAGDFFSLADLGHLAFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS+RP+W KVL+L
Sbjct  180  GRGNLVRERKHVSAWWDDISSRPSWKKVLEL  210



>gb|AFK48920.1| unknown [Medicago truncatula]
Length=215

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A  + P+RV+ CLFE  V+FE + IDL   EHK P+FL+ QPFG+VP ++DG
Sbjct  1    MVVKVYGPAYGS-PKRVLVCLFEKEVEFEAVDIDLFKGEHKQPDFLKLQPFGEVPLVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKTVEERG+V+QWLEVE++N++  +Y++V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKNQGTDLLGKTVEERGLVEQWLEVEAHNFHPAIYSLVINVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P D   +++  EKL KVLD+YEERLSK+KYLAGDFFSLADLSHL    +L N+ 
Sbjct  120  APLRGVPGDQKAIEESDEKLKKVLDIYEERLSKTKYLAGDFFSLADLSHLAFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+LV ERK ++AW+ DIS+ P+W KVL+L
Sbjct  180  GRGNLVRERKHVSAWWDDISSTPSWKKVLEL  210



>ref|XP_002882279.1| glutathione S-transferase F11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58538.1| glutathione S-transferase F11 [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA PQRV+ C  E G++FE+IH+DL   E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDKLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E+R +VDQW+EVE+N +  +   +V+ +  
Sbjct  61   DLKLFESRAIARYYATKYADQGTDLLGKTLEKRAIVDQWVEVENNYFYAVALPLVINIVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D+++V++   K  KVLDVYE RL+ ++YL GD F+LADL+H+P +R++ NE 
Sbjct  121  KPMFGEPIDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLTHMPGMRYIMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                LV+ R+ LN W+++ISARPAW K+++L
Sbjct  181  SLSGLVTSRENLNRWWNEISARPAWKKLMEL  211



>ref|XP_010485656.1| PREDICTED: glutathione S-transferase F11 isoform X2 [Camelina 
sativa]
Length=215

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 161/212 (76%), Gaps = 1/212 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA PQRV+ C  E G++FE+IH+DL   E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDQLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI+RYYATKYA++G +L+GKT+E+R +VDQW+EVE+N    +   +V+ +  
Sbjct  61   DLKLFESRAIVRYYATKYADQGTDLLGKTLEKRAIVDQWVEVENNYLYAVALPLVINVVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D++++++   K  KVLDVYE RL+ ++YLAGD F+LADL+H+P +R++ NE 
Sbjct  121  KPKFGEPCDVTLIEELKVKFEKVLDVYENRLATNRYLAGDEFTLADLTHMPGMRYIMNET  180

Query  628  GFGH-LVSERKCLNAWYSDISARPAWNKVLDL  720
              G  LV+ R+ +N W+++ISARPAW K++DL
Sbjct  181  TLGDGLVTSRENVNRWWNEISARPAWKKLMDL  212



>ref|XP_010453905.1| PREDICTED: glutathione S-transferase F12-like [Camelina sativa]
Length=214

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E G++FE+IHIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA+KG NL+GK++E R +VDQW +VES+ +N L + +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYADKGTNLLGKSLEHRAIVDQWSDVESHYFNALAHPIVVNLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V++   KLG VLD+YE RL+ +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEECDLVLVEELKTKLGVVLDIYENRLASNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R+  N W+ +ISARPAW K++++
Sbjct  181  DIIQMVKARENFNRWWEEISARPAWKKLMEM  211



>ref|XP_008342336.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
Length=236

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 163/213 (77%), Gaps = 1/213 (0%)
 Frame = +1

Query  76   CCVNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPA  255
              + MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK+PEFL+ QPFGQ P 
Sbjct  19   LTIAMVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQXPV  77

Query  256  IEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVL  435
            I+DGD+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V+
Sbjct  78   IQDGDYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLDNLVM  137

Query  436  QMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFL  615
             +    ++G PSD  ++++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L
Sbjct  138  HILFASALGFPSDPKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYL  197

Query  616  TNEGGFGHLVSERKCLNAWYSDISARPAWNKVL  714
             N  G  +++ +RK ++AW+ DIS+RP+W KVL
Sbjct  198  ANSMGKEYMIRDRKHVSAWWDDISSRPSWKKVL  230



>emb|CDY43144.1| BnaA05g32420D [Brassica napus]
Length=210

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 163/211 (77%), Gaps = 4/211 (2%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK+FG   A  PQRV+ C  E G++FE+IH+DL +FE K PE+L RQPFGQVPAIEDG
Sbjct  1    MVVKLFGQIKAGNPQRVLLCFLEKGIEFEVIHVDLNTFEQKKPEYLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E+R +V+QW+EVE+N +N +V  +V+ +  
Sbjct  61   DLKLFESRAISRYYATKYADQGTDLLGKTLEQRAIVEQWMEVEANYFNVVVLPLVINIVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P      D+++V++   KL KVLDVYE +L+ ++YLAG  FSLADL+H+P +R++ NE 
Sbjct  121  TPKF----DVALVEELKVKLDKVLDVYENQLATNRYLAGAEFSLADLTHMPGMRYIMNEA  176

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G +++ R+ +N W+++ISARPAW K++++
Sbjct  177  GLGSMITSRENVNRWWNEISARPAWKKLMEM  207



>gb|KDP20539.1| hypothetical protein JCGZ_04912 [Jatropha curcas]
Length=210

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+A A+ P+RV+ CL E G++FE + IDL   EHK+PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGTAYAS-PKRVLVCLIEKGIEFETVPIDLIKGEHKSPEYLQLQPFGAVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE+ NY+  +YN+ L +  
Sbjct  60   DYALYESRAIIRYYAEKYKSQGTELLGKTIEERGLVEQWLEVEAQNYHPPIYNLTLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G P D  ++K+  EKL KVLD+YE+RLSKSKYLAG+FFSLADLSHLP  ++L    
Sbjct  120  ASALGFPPDEKIIKESEEKLAKVLDIYEDRLSKSKYLAGEFFSLADLSHLPFTQYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +++  RK ++AW+ +IS RP+W KVL L
Sbjct  180  NKEYMIKSRKHVSAWWDNISNRPSWKKVLQL  210



>gb|KHG21992.1| Glutathione S-transferase F9 -like protein [Gossypium arboreum]
Length=215

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ACL E  ++FE + +DL   EHK PEFL+ QPFG VP  +DG
Sbjct  1    MVVKVYGPAFAS-PKRVIACLIEKEIEFETVPVDLLKGEHKDPEFLKLQPFGTVPVTQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKTVEERG V+ WLEVE++N+N  +Y + L +  
Sbjct  60   DYVLYESRAIIRYYAEKYKSQGTDLLGKTVEERGQVENWLEVEAHNFNPPIYALTLHVMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P D +++K+  EKLGKVLD+YEERLSK+KYLAGDFFSLADLSHLP  ++L  + 
Sbjct  120  ASKMGFPPDENLIKESEEKLGKVLDIYEERLSKNKYLAGDFFSLADLSHLPFTQYLVGQM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  ++++ RK ++AW+ DIS+RP+W KVL L
Sbjct  180  GKEYMITSRKHVSAWWDDISSRPSWQKVLQL  210



>ref|XP_002283209.1| PREDICTED: glutathione S-transferase F9 [Vitis vinifera]
 emb|CBI22080.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A CP+RV+ CL E  ++FE + +D+   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPAFA-CPKRVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG V+QWLEVE+ NY+  +YN+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGTVEQWLEVEAQNYHPPIYNLVLHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P+D  V+++  + LGKVLD+YEERLSKSKYLAGDFFSLADLSH+P   +L   G
Sbjct  120  SDKMGFPADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFSLADLSHIPFTNYLGAMG  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ER+ ++AW+ DIS+RP+W KVL+L
Sbjct  180  KM-YLIKEREHVSAWWDDISSRPSWKKVLEL  209



>ref|XP_006289224.1| hypothetical protein CARUB_v10002680mg [Capsella rubella]
 gb|EOA22122.1| hypothetical protein CARUB_v10002680mg [Capsella rubella]
Length=215

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TA CPQRV+ C  E G++FE+ HIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAVCPQRVLLCFLEKGIEFEIFHIDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA++G NL+GK++E R +VDQW +VE+ ++N L + +VL + +
Sbjct  61   DFKLFESRAIARYYATKYADQGTNLLGKSLEHRAIVDQWADVENQSFNALAHPIVLNLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D  +V++   KLG VLD+YE RL+ +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPKLGEKCDTVLVEELKVKLGVVLDIYENRLASNRFLAGEEFTMADLTHMPAMAYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R+ +N W+ +I+ARPAW K+++L
Sbjct  181  DINQMVKARESINRWWEEITARPAWKKLMEL  211



>ref|XP_006484982.1| PREDICTED: glutathione S-transferase F9-like [Citrus sinensis]
 gb|KDO40901.1| hypothetical protein CISIN_1g027956mg [Citrus sinensis]
Length=216

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  ++FE + +DL   E ++PE+L+ QPFG++P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVILCLVEKEIEFETVPVDLIKGEQRSPEYLKLQPFGELPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE++NYN  +Y + +Q+  
Sbjct  60   DFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYNPAIYELTIQLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G+P D  +VK+  EKLGK LDVYEERLSKSKYLAGDFFSLADLSH+P   +L    
Sbjct  120  SSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADLSHIPFTHYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  H++ +RK ++AW+ DIS RP+W KVL+L
Sbjct  180  GRQHMIRDRKHVSAWWDDISNRPSWKKVLEL  210



>ref|XP_010492664.1| PREDICTED: glutathione S-transferase F12-like [Camelina sativa]
Length=214

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E G++FE+IH+DL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHVDLDTLEQKKPENLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA++G NL+GK++E R +VDQW +VES+ +N L + +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYADQGTNLLGKSLEHRAIVDQWTDVESHYFNALAHPIVVNLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V++   KLG VLD+YE RL+ +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEECDLVLVEELKTKLGVVLDIYENRLASNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R+  N W+ +ISARPAW K++++
Sbjct  181  DIIQMVKARENFNRWWEEISARPAWKKLMEM  211



>ref|XP_009130342.1| PREDICTED: glutathione S-transferase F11 [Brassica rapa]
Length=210

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 163/211 (77%), Gaps = 4/211 (2%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK+FG   A  PQRV+ C  E G++FE+IH+DL +FE K PE+L RQPFGQVPAIEDG
Sbjct  1    MVVKLFGQIKAGNPQRVLLCFLEKGIEFEVIHVDLNTFEQKKPEYLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E+R +V+QW+EVE+N +N +V  +V+ +  
Sbjct  61   DLKLFESRAISRYYATKYADQGTDLLGKTLEQRAIVEQWMEVEANYFNVVVLPLVINIVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P      D+++V++   KL KVLDVYE +L+ ++YLAG  FSLADL+H+P +R++ NE 
Sbjct  121  TPKF----DVALVEELKVKLDKVLDVYENQLAMNRYLAGAEFSLADLTHMPGMRYIMNEA  176

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G +++ R+ +N W++++SARPAW K++++
Sbjct  177  GLGSMITSRENVNRWWNEMSARPAWKKLMEM  207



>gb|ABI79308.1| glutathione S-transferase [Pyrus communis]
Length=204

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK+PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLDNLVMHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  ++++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  ASALGFPSDPKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAW  702
            G  +++ +RK ++AW+ DIS+RPAW
Sbjct  180  GKEYMIRDRKHVSAWWDDISSRPAW  204



>ref|XP_010420427.1| PREDICTED: glutathione S-transferase F12 [Camelina sativa]
Length=214

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E G++FE+IHIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA++G NL+GK++E + +VDQW +VES+ +N L + +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYADQGTNLLGKSLEHQAIVDQWADVESHYFNALAHPIVVNLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V++   KLG VLD+YE RL+ +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEECDLVLVEELKTKLGVVLDIYENRLASNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R+  N W+ +ISARPAW K++++
Sbjct  181  DIIQMVKARENFNRWWEEISARPAWKKLMEM  211



>ref|XP_006298522.1| hypothetical protein CARUB_v10014608mg [Capsella rubella]
 gb|EOA31420.1| hypothetical protein CARUB_v10014608mg [Capsella rubella]
Length=214

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 158/211 (75%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA PQRV+ C  E G++FE++H+DL   E K P+ L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGQIKAANPQRVLLCFLEKGIEFEVVHVDLDQLEQKKPQHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E R +VDQW+EVE+N    +   +V+ +  
Sbjct  61   DLKLFESRAIARYYATKYADQGTDLLGKTLERRAIVDQWMEVENNYLYAVALPLVMNVVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D+++V++   K  KVLDVYE RL+ ++YLAGD F+LADL+H+P +R++ NE 
Sbjct  121  KPKFGEPCDVTLVEELKVKFDKVLDVYENRLATNRYLAGDEFTLADLTHMPGMRYIMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                LV+ R+ +N W+++ISARPAW K+++L
Sbjct  181  SLCGLVTSRENVNRWWNEISARPAWKKLMEL  211



>ref|XP_010463766.1| PREDICTED: glutathione S-transferase F11-like [Camelina sativa]
Length=344

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA PQRV+ C  E G++FE+IH+DL   E K PE L RQPFGQVPAIEDG
Sbjct  131  MVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDQLEQKKPEHLLRQPFGQVPAIEDG  190

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI+RYYATKYA++G +L+GKT+EER +VDQW+EVE+N    +   +V+ +  
Sbjct  191  DLKLFESRAIVRYYATKYADQGTDLLGKTLEERAIVDQWVEVENNYLYAVALPLVINVVF  250

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D+++V++   K  KVLDVYE RL+ ++YLAGD F+LADL+H+P +R++ NE 
Sbjct  251  KPKFGEPCDVTLVEELKVKFEKVLDVYENRLATNRYLAGDEFTLADLTHMPGMRYIMNEV  310

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                LV+ R+ +N W+++ISARPAW K++DL
Sbjct  311  SLSGLVTSRENVNRWWNEISARPAWKKLMDL  341



>gb|AFK48087.1| unknown [Lotus japonicus]
Length=215

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  V FE + +DL   E+K PE+L+ QPFG++P I+DG
Sbjct  1    MVVKVYGPIFAS-PKRVLVCLIEKAVQFETVPLDLFKGENKEPEYLKLQPFGKLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKTVEERG+V+QWLEVE++N++  V ++VLQ+  
Sbjct  60   DYTLYESRAIIRYYAEKYRNQGTELLGKTVEERGLVEQWLEVEAHNFHPPVLDLVLQVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  ++++  EK+ KVLD+YE+RLSKSKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APLRGLPSDQKLIEESDEKVQKVLDIYEDRLSKSKYLAGDFFSLADLSHLPFGHYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G+ V ERK ++AW+ DIS+RP+W KVL L
Sbjct  180  GRGNFVRERKHVSAWWDDISSRPSWQKVLQL  210



>ref|XP_009377092.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 160/209 (77%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA P+RV+ CL E  VDFE I IDL   E+K P+FL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPLYAA-PKRVLVCLVEKEVDFETIPIDLLKGENKHPDFLKLQPFGTVPLIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N+   +YN+V+ +  
Sbjct  60   DYTLYESRAIMRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAHNFQPPIYNLVVHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G PSD  ++++  EKLGKVLD+YEE+LSKSKYLAGDFFSLADLSHLP   FL    
Sbjct  120  APVLGFPSDPKILQESEEKLGKVLDIYEEQLSKSKYLAGDFFSLADLSHLPFTHFLVANM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS RP+W +VL
Sbjct  180  GKEYMIRDRKHVSAWWDDISNRPSWKRVL  208



>gb|KFK37760.1| hypothetical protein AALP_AA3G026300 [Arabis alpina]
Length=213

 Score =   255 bits (651),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+CPQRV+ C  E  ++FELIH+DL + EHK P+ L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGYVHASCPQRVLLCFLEKEIEFELIHVDLDTLEHKKPDHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKL+ESRAI+RYY+ KY ++G +L+GKT+E+R +VDQW+E E+N +N L   +V+ + +
Sbjct  61   DFKLYESRAILRYYSNKYTDQGTDLLGKTLEQRAIVDQWMETETNYFNALALPIVVNLVL  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D + V++   KL K++DVYE +L++++YLAGD F+LADL+H+P +  + N  
Sbjct  121  KPKFGKPCDFTFVEEQKVKLEKIMDVYENQLARNRYLAGDEFTLADLTHMPMMNIM-NII  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
            G   +V+ R  LN W++DISARPAW K++++  N
Sbjct  180  GLSSMVTTRPNLNRWWNDISARPAWKKLIEMAAN  213



>ref|XP_006400252.1| hypothetical protein EUTSA_v10014654mg [Eutrema salsugineum]
 dbj|BAJ34302.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41705.1| hypothetical protein EUTSA_v10014654mg [Eutrema salsugineum]
Length=214

 Score =   255 bits (651),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  TAACPQRV+ C  E G++FE+IH+DL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGQITAACPQRVLLCFLEKGIEFEIIHVDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKY+++G NL+GK++E R +VDQW +VE + +N L + +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYSDQGTNLLGKSLEHRAIVDQWADVEVHYFNVLAHPIVMNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+++V++  +KL  VLDVY+ RLS +++L GD F++ADL+H+P++R+L +  
Sbjct  121  KPKLGEECDLNLVEELKKKLEVVLDVYDNRLSSNRFLGGDEFTMADLTHMPAMRYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R  +N W+ +I+ARP+W K++++
Sbjct  181  DINRIVKARVNMNRWWEEITARPSWKKLMEM  211



>ref|XP_007215954.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17153.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=214

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++  + N+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTALLGKTIEERGLVEQWLEVEAHNFHPPLNNLVLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  V+++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP  +++    
Sbjct  120  ASALGFPSDPKVIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYMVTLL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW++DIS RP+W KVL+ 
Sbjct  180  GKEYLIKDRKHVSAWWNDISNRPSWKKVLEF  210



>gb|ABW34390.1| glutathione S-transferase 5 [Vitis vinifera]
Length=216

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  ++FE + +D+   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPAFAS-PKRVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG V+QWLEVE+ NY+  +YN+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKAQGTDLLGKTIEERGTVEQWLEVEAQNYHPSIYNLVLHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P+D  V+++  + LGKVLD+YEERLSKSKYLAGDFFSLADLSH+P   +L   G
Sbjct  120  SDKMGFPADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFSLADLSHIPFTNYLGAMG  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ER+ ++AW+ DIS+RP+W KVL+L
Sbjct  180  KM-YLIKEREHVSAWWDDISSRPSWKKVLEL  209



>ref|XP_002530205.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF32179.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=214

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E G++FE + +DL   EH+ P+FL+ QPFG +P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVLVCLIEKGIEFETVPVDLIKGEHRNPDFLKLQPFGALPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE+ NY+  VYNM L +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAQNYHPHVYNMTLHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G   D  ++K+  EK+ KVLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L    
Sbjct  120  ASALGFTPDEKLIKESEEKIAKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
                ++ +RK ++AW+ DIS+RP+W KVL+L  +
Sbjct  180  KRECMIKDRKYVSAWWDDISSRPSWKKVLELYRS  213



>ref|XP_008229577.1| PREDICTED: glutathione S-transferase F9-like [Prunus mume]
Length=219

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+GS  A+ PQRV+ACL E  +DFE+I IDL   EHK PEFL+ +PFGQVP I+DG
Sbjct  1    MVVKVYGSIDAS-PQRVLACLVEKEIDFEIIRIDLFKGEHKDPEFLKLEPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA K+  +G  L+GKTVEERG+V+QWLEVE+  ++  VY +V+ + +
Sbjct  60   DYTLYESRAIMRYYAEKFKSQGTELLGKTVEERGLVEQWLEVEALRFHPPVYKLVVHILL  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  ++++   KLGKVLD+YEERLSKSKYLAGDFFSLAD SHLP  + L  + 
Sbjct  120  ASALGFPSDPKIIQESEAKLGKVLDIYEERLSKSKYLAGDFFSLADRSHLPFSQHLVADL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  H++ +RK ++AW+ DIS  P+W KVL L
Sbjct  180  GKEHMIRDRKHVSAWWDDISNGPSWKKVLQL  210



>emb|CAN75964.1| hypothetical protein VITISV_036241 [Vitis vinifera]
Length=216

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 160/211 (76%), Gaps = 2/211 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A  P+RV+ CL E  ++FE + +D+   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPAFAX-PKRVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G +L+GKT+EERG V+QWLEVE+ NY+  +YN+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKXQGTDLLGKTIEERGTVEQWLEVEAQNYHPXIYNLVLHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P+D  V+++  + LGKVLD+YEERLSKSKYLAGDFFSLADLSH+P   +L   G
Sbjct  120  SDKMGFPADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFSLADLSHIPFTNYLGAMG  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ER+ ++AW+ DIS+RP+W KVL+L
Sbjct  180  KM-YLIKEREHVSAWWDDISSRPSWKKVLEL  209



>ref|XP_007048950.1| Glutathione S-transferase PHI 9 [Theobroma cacao]
 gb|EOX93107.1| Glutathione S-transferase PHI 9 [Theobroma cacao]
Length=217

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  V+FE + +DL   EHK PE+L+ QPFG VP  +DG
Sbjct  1    MVVKVYGPAYAS-PKRVLVCLIEKEVEFETVPVDLLKGEHKDPEYLKLQPFGTVPVTQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKTVEERG+V+ WLEVE+ +YN  ++ + +Q+ +
Sbjct  60   DYTLYESRAIMRYYAEKYKSQGTDLLGKTVEERGLVENWLEVEAQSYNPPMFTLTVQIML  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G P D +++K+  EKLGKVLD+YEERLSKSKYLAG+FFSLADLSHLP  ++L +  
Sbjct  120  SSKLGLPRDENLIKESEEKLGKVLDIYEERLSKSKYLAGNFFSLADLSHLPFTQYLVDHM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++  RK ++AW+ DIS+RP+W KVL L
Sbjct  180  GKEYMIKSRKHVSAWWDDISSRPSWQKVLQL  210



>ref|XP_006484981.1| PREDICTED: glutathione S-transferase F9-like [Citrus sinensis]
Length=211

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  ++FE   +DL   EH+ PE+L+ QPFG +P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF L+ESRAIIRYYA KY  +G  L+GKT EERG+V+QWLEVE++NY+  +Y M +Q+  
Sbjct  60   DFTLYESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G   D  +VKK  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP  ++L    
Sbjct  120  ASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +++ +RK ++AW+ DIS RP+W KVL+L
Sbjct  180  EKEYMIRDRKHVSAWWDDISNRPSWKKVLEL  210



>gb|AAG34812.1|AF243377_1 glutathione S-transferase GST 22, partial [Glycine max]
Length=210

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +1

Query  115  TAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRA  294
            T   P+RV+ CL E  ++FE +H+DL   E+K PEFL+ QPFG +P I+DGD+ L+ESRA
Sbjct  4    TYGSPKRVLVCLIEKEIEFETVHVDLFKGENKEPEFLKLQPFGSLPVIQDGDYTLYESRA  63

Query  295  IIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSD  474
            IIRY A KY ++G +L+GKT+EE+G+V+QWLEVE++N++  +YN+V+ +   P  G PSD
Sbjct  64   IIRYLAEKYKDQGTDLLGKTIEEKGLVEQWLEVEAHNFHPPLYNLVINVLFAPLTGAPSD  123

Query  475  MSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSER  654
              V+++  +K+ KVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N+ G G+LV +R
Sbjct  124  QKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFSLADLSHLPFGHYLVNQTGRGNLVRDR  183

Query  655  KCLNAWYSDISARPAWNKVLDL  720
            K ++AW+ DIS RPAW KVL L
Sbjct  184  KHVSAWWDDISNRPAWQKVLQL  205



>emb|CDY28744.1| BnaCnng06300D [Brassica napus]
Length=210

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 162/211 (77%), Gaps = 4/211 (2%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK+FG   A  PQRV+ C  E G++FE+IH+DL +FE K PE+L RQPFGQVPAIED 
Sbjct  1    MVVKLFGQIKAGNPQRVLLCFLEKGIEFEVIHVDLNTFEQKKPEYLLRQPFGQVPAIEDE  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E+R +V++W+EVE+N +N +V  +V+ +  
Sbjct  61   DLKLFESRAISRYYATKYADQGTDLLGKTLEQRAIVEEWMEVEANYFNVVVLPLVINIVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P      D+++V++   KL KVLDVYE +L+ ++YLAG  FSLADL+H+P +R++ NE 
Sbjct  121  TPKF----DVALVEELKVKLDKVLDVYENQLATNRYLAGAEFSLADLTHMPGMRYIMNEA  176

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G G +V+ R+ +N W+++ISARPAW +++++
Sbjct  177  GLGSMVTSRENVNRWWNEISARPAWKQLMEM  207



>ref|XP_010485655.1| PREDICTED: glutathione S-transferase F11 isoform X1 [Camelina 
sativa]
Length=343

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +1

Query  82   VNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIE  261
            + MVVKV+G   AA PQRV+ C  E G++FE+IH+DL   E K PE L RQPFGQVPAIE
Sbjct  127  LKMVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDQLEQKKPEHLLRQPFGQVPAIE  186

Query  262  DGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQM  441
            DGD KLFESRAI+RYYATKYA++G +L+GKT+E+R +VDQW+EVE+N    +   +V+ +
Sbjct  187  DGDLKLFESRAIVRYYATKYADQGTDLLGKTLEKRAIVDQWVEVENNYLYAVALPLVINV  246

Query  442  FVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
               P  G+P D++++++   K  KVLDVYE RL+ ++YLAGD F+LADL+H+P +R++ N
Sbjct  247  VFKPKFGEPCDVTLIEELKVKFEKVLDVYENRLATNRYLAGDEFTLADLTHMPGMRYIMN  306

Query  622  EGGFGH-LVSERKCLNAWYSDISARPAWNKVLDL  720
            E   G  LV+ R+ +N W+++ISARPAW K++DL
Sbjct  307  ETTLGDGLVTSRENVNRWWNEISARPAWKKLMDL  340



>ref|XP_010035935.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47444.1| hypothetical protein EUGRSUZ_K01229 [Eucalyptus grandis]
Length=215

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+  AA P+RV+ CL E GV+FE + +DL   E K PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGT-DAAAPKRVLVCLIEKGVEFETVPVDLFKGEQKAPEFLKLQPFGSVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLE E+++Y   + ++V ++ +
Sbjct  60   DYTLFESRAIIRYYAEKYKHQGTDLLGKTIEERGLVEQWLEAEAHSYQPPLRDLVHKIVL  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G  SD  ++K+  +KL KVLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L  + 
Sbjct  120  APIRGLTSDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLMGKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW+ DIS+RP+W KV++L
Sbjct  180  GKEYLIRDRKSVSAWWDDISSRPSWKKVVEL  210



>ref|XP_007215955.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17154.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=214

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  ++FE   IDL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPFYAS-PKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGTVPLIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++  + N+VL +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTALLGKTIEERGLVEQWLEVEAHNFHPPLNNLVLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G PSD  V+++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP  +++    
Sbjct  120  ASALGFPSDPKVIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYMVTLL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW++DIS RP+W KVL+ 
Sbjct  180  GKEYLIKDRKHVSAWWNDISNRPSWKKVLEF  210



>ref|XP_010549805.1| PREDICTED: glutathione S-transferase F11-like [Tarenaya hassleriana]
Length=214

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 155/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV     AA PQRV+ C  E G++FE+IH+DL +FE K P+FL RQPFGQVPAIEDG
Sbjct  1    MAVKVHAQIKAASPQRVLLCFLEKGIEFEVIHVDLDTFEQKKPDFLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYA++G +L+GKT+E+R VVDQW EVE++ ++ LV  +V+ + V
Sbjct  61   DLKLFESRAIARYYATKYADQGTDLLGKTLEQRAVVDQWSEVEAHYFHPLVLPIVINIVV  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+  D  +V++   KL +VLD+Y+ RL  ++Y AGD FS ADL+H+P++R+L  E 
Sbjct  121  KPKFGEKCDDVLVEELKSKLEEVLDIYDARLGSNRYFAGDEFSTADLTHMPAMRYLMGET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  H++  R  +N W+  ++ARPAW K++++
Sbjct  181  GLSHMIKARVNVNRWWETVTARPAWKKLMEM  211



>ref|XP_007048951.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 ref|XP_007048952.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 gb|EOX93108.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 gb|EOX93109.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
Length=217

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A  A P+RV+ CL E  V+FE + +DL   EHK PE+L+ QPFG VP  +DG
Sbjct  1    MVVKVYGPA-YATPKRVLVCLIEKEVEFETVPVDLLKGEHKDPEYLKLQPFGTVPVTQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKTVEERG+V+ WLEVE+ +Y+  +Y + +Q+  
Sbjct  60   DYILYESRAILRYYAEKYKSQGTDLLGKTVEERGLVENWLEVEAQSYHPPIYTLTVQILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G P D +++K+  EKL KVLD+YEERLSKSKYL GDFFSLADLSHLP  ++L ++ 
Sbjct  120  SSKLGFPRDENLIKESEEKLAKVLDIYEERLSKSKYLGGDFFSLADLSHLPFTQYLVDQM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++  RK ++AW+ DIS+RP+W KVL L
Sbjct  180  GKEYMIRSRKHVSAWWDDISSRPSWQKVLQL  210



>ref|XP_006408331.1| hypothetical protein EUTSA_v10021507mg [Eutrema salsugineum]
 dbj|BAJ33811.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49784.1| hypothetical protein EUTSA_v10021507mg [Eutrema salsugineum]
Length=213

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G   A  PQRV+ C  E G++FE+IH+DL  FE K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQIKAGNPQRVLLCFLEKGIEFEVIHVDLDKFEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D KLFESRAI RYYATKYAE+G +L+GKT+E+R +VDQW+EVE+N +N +V  +V+ +  
Sbjct  61   DLKLFESRAISRYYATKYAEQGTDLLGKTLEQRAIVDQWMEVEANYFNVVVLPLVINIVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P   +  D+++V++   K  KVLDVYE RL+ ++YLAG  F+LADL+H+P +R++ NE 
Sbjct  121  KPKFVE-CDVALVEELKVKFEKVLDVYENRLATNRYLAGAEFTLADLTHMPGMRYIMNEA  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G   +++ R+ +N W+ +IS+RPAW K++++
Sbjct  180  GLSGMITSRENVNRWWDEISSRPAWKKLMEM  210



>ref|NP_186969.1| glutathione S-transferase F11 [Arabidopsis thaliana]
 sp|Q96324.1|GSTFB_ARATH RecName: Full=Glutathione S-transferase F11; Short=AtGSTF11; 
AltName: Full=AtGSTF6; AltName: Full=GST class-phi; AltName: 
Full=GST class-phi member 11 [Arabidopsis thaliana]
 gb|AAF26107.1|AC012328_10 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAB09584.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAM20627.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAM91277.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AEE73911.1| glutathione S-transferase F11 [Arabidopsis thaliana]
Length=214

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA PQRV+ C  E  ++FE+IH+DL   E K P+ L RQPFGQVPAIEDG
Sbjct  1    MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              KLFESRAI RYYATKYA++G +L+GKT+E R +VDQW+EVE+N +  +   +V+ +  
Sbjct  61   YLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D+++V++   K  KVLDVYE RL+ ++YL GD F+LADLSH+P +R++ NE 
Sbjct  121  KPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                LV+ R+ LN W+++ISARPAW K+++L
Sbjct  181  SLSGLVTSRENLNRWWNEISARPAWKKLMEL  211



>gb|KFK25936.1| hypothetical protein AALP_AA8G182300 [Arabis alpina]
Length=214

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACP+RV+ C  E  +DFE++HIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPRRVLLCFLEKEIDFEIVHIDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKY ++G NL+GK++E R +VDQW ++E++ +N LV+ +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYPDQGTNLLGKSLEHRAIVDQWADIETHYFNVLVHPIVINLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V++   KL  VLDVY  RL+ +++LAGD F++ADL+H+P++ +L    
Sbjct  121  KPRLGEECDVGLVEELKVKLAVVLDVYNNRLASNRFLAGDEFTMADLTHMPAMGYLMGIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                ++  R+ +N W+ +ISARPAW K+L L
Sbjct  181  DLNRMIKARENMNRWWEEISARPAWKKLLVL  211



>ref|XP_008380180.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like 
[Malus domestica]
Length=214

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 156/209 (75%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  VDFE + IDL   EHK P+FL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPLYAS-PKRVLVCLVEKEVDFETVPIDLLKGEHKHPDFLKLQPFGSVPLIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRY A KY  +G NL+G T+EERG+V+QWLEVE+ N++  + N+VL +  
Sbjct  60   DYTLYESRAIIRYCAEKYKSQGTNLLGNTIEERGLVEQWLEVEAQNFHPPINNLVLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G PSD  ++++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L    
Sbjct  120  ASVLGFPSDRKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLVANM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS RP+W +VL
Sbjct  180  GKEYMIRDRKHVSAWWDDISNRPSWKRVL  208



>ref|XP_008380181.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
 ref|XP_008380182.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
 ref|XP_008380183.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
 ref|XP_008380185.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
Length=225

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 158/209 (76%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    + P+RV+ CL E  ++FE + ID+   E + PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPVYPS-PKRVLVCLVEKEIEFETVPIDIFKGEQRNPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V  +  
Sbjct  60   DYTLFESRAIIRYYAEKYKSQGTDLLGKTMEERGLVEQWLEVEASNYHQPLDNIVTHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              +MG  SD  ++++  EK+GKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N  
Sbjct  120  ASAMGISSDPKIIQESEEKVGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++ W+ DIS+RP+W KVL
Sbjct  180  GKEYMIRDRKHVSVWWDDISSRPSWKKVL  208



>ref|XP_010035936.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47447.1| hypothetical protein EUGRSUZ_K01232 [Eucalyptus grandis]
Length=215

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+R + CL E GV+FE + +DL   EHK PE+L+ QPFG +P ++DG
Sbjct  1    MVVKVYGPDYAS-PKRALVCLLEKGVEFETVGVDLLKGEHKAPEYLKLQPFGSLPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY ++G  L+GKT+EERG+V+QWLEVE++N++  +Y++VL++  
Sbjct  60   DYTLFESRAIIRYYAEKYKDQGTELLGKTIEERGLVEQWLEVEAHNFHPPIYDLVLKIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G   D   +K+  +KL +VLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L  + 
Sbjct  120  GPFIGLTPDPKQLKESEDKLCQVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGKI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++ W+ DIS+RP+W KVL+L
Sbjct  180  GKEYLIRDRKHVSGWWDDISSRPSWKKVLEL  210



>ref|XP_009356599.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
 ref|XP_009356600.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=225

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 158/209 (76%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    + P+RV+ CL E  +DFE I +D+   E + PEFL+ QPFGQVP I+DG
Sbjct  1    MVVKVYGPVYPS-PKRVLVCLVEKEIDFETIPMDIFKGEQRNPEFLKLQPFGQVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++NY+  + N+V  +  
Sbjct  60   DYTLFESRAIIRYYAEKYKSQGTELLGKTMEERGLVEQWLEVEASNYHQPLDNIVTHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              +MG  SD  ++++  EK+GKVLD+YEERLSKSKYLAG FFSLADLSHLP  ++L N  
Sbjct  120  ASAMGISSDPKIIQESEEKVGKVLDIYEERLSKSKYLAGAFFSLADLSHLPFTQYLANSM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS+RP+W KVL
Sbjct  180  GKEYMIRDRKHVSAWWDDISSRPSWKKVL  208



>ref|XP_009121408.1| PREDICTED: glutathione S-transferase F12-like [Brassica rapa]
 emb|CDX69395.1| BnaA10g17440D [Brassica napus]
Length=213

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ CL E  ++FE+IHIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCLLEKEIEFEIIHIDLDTLEQKRPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA++G NL+GK++E R +VDQW +VE   +N LV+ +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYADQGTNLLGKSLEHRAIVDQWADVEVGYFNVLVHPLVMNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D  +V++   KLG VLD+YE +L+ +++LAGD F++ADL+H+P++ +L    
Sbjct  121  KPRLGEECDAVLVEELKVKLGVVLDIYENQLASNRFLAGDEFTMADLTHMPAMGYLMR-T  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V +R  +N W+ +++ARPAW K++ +
Sbjct  180  NINRIVKDRVNMNRWWEEVTARPAWKKLMKM  210



>ref|XP_006437116.1| hypothetical protein CICLE_v10032743mg [Citrus clementina]
 gb|ESR50356.1| hypothetical protein CICLE_v10032743mg [Citrus clementina]
Length=211

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  ++FE   +DL   E++ PE+L+ QPFG +P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVIVCLIEKQIEFETAPVDLIKGENRNPEYLKLQPFGALPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++NY+  +Y M +Q+  
Sbjct  60   DFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G   D  +VKK  EKLGKVLDVYE RLSKSKYLAGDFFSLADLSHLP  ++L    
Sbjct  120  ASKLGLSVDEKLVKKSEEKLGKVLDVYEGRLSKSKYLAGDFFSLADLSHLPFTQYLVGPM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +++ +RK ++AW+ DIS RP+W KVL+L
Sbjct  180  EKEYMIRDRKHVSAWWDDISNRPSWKKVLEL  210



>ref|XP_002871755.1| glutathione S-transferase 26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48014.1| glutathione S-transferase 26 [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E  ++FE+IHIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKEIEFEIIHIDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKYA++G NL+GK++E R +VDQW +VE++ +N L + +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYADQGTNLLGKSLEHRAIVDQWADVETHYFNALAHPIVINLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V++   KLG VLD+Y  RLS +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEKCDVVLVEELKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R   N W+ +IS RP+W K++ L
Sbjct  181  DINQMVKARGSFNRWWEEISDRPSWKKLMVL  211



>ref|XP_006437117.1| hypothetical protein CICLE_v10032737mg [Citrus clementina]
 gb|ESR50357.1| hypothetical protein CICLE_v10032737mg [Citrus clementina]
Length=212

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 161/212 (76%), Gaps = 2/212 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  ++FE + +DL   E+K PE+L+ QPFG +P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVIVCLIEKQIEFETVPVDLVKGENKNPEYLKLQPFGSLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DF L+ESRAIIRYYA KY  +G  +L+G+TVEERG+V+QWLEVE++N++  +Y M  Q+ 
Sbjct  60   DFTLYESRAIIRYYAEKYKSQGTTDLLGRTVEERGLVEQWLEVEAHNFHPPIYQMTTQIL  119

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
             F   G P+D +++K+  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP  ++L   
Sbjct  120  FFAKRGLPADENLIKESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGP  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +++ +RK ++AW+ DIS R +W KVL+L
Sbjct  180  MEKEYMIRDRKHVSAWWDDISNRLSWKKVLEL  211



>ref|NP_197224.1| glutathione S-transferase phi 12 [Arabidopsis thaliana]
 sp|Q9FE46.1|GSTFC_ARATH RecName: Full=Glutathione S-transferase F12; Short=AtGSTF12; 
AltName: Full=GST class-phi member 12; AltName: Full=Glutathione 
S-transferase 26; AltName: Full=Protein TRANSPARENT TESTA 
19 [Arabidopsis thaliana]
 gb|AAG30138.1|AF288189_1 glutathione S-transferase [Arabidopsis thaliana]
 dbj|BAB10509.1| glutathione S-transferase-like protein [Arabidopsis thaliana]
 gb|AED92398.1| glutathione S-transferase phi 12 [Arabidopsis thaliana]
Length=214

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 155/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E G++FE+IHIDL +FE K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATK+A++G NL+GK++E R +VDQW +VE+  +N L   +V+ + +
Sbjct  61   DFKLFESRAIARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V+    KLG VLD+Y  RLS +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R   N W+ +IS RP+W K++ L
Sbjct  181  DINQMVKARGSFNRWWEEISDRPSWKKLMVL  211



>emb|CDY16947.1| BnaC09g40740D [Brassica napus]
Length=213

 Score =   247 bits (630),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ CL E  ++FE++HIDL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCLLEKKIEFEIVHIDLDTLEQKRPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKY+++G NL+GK++E R +VDQW +VE   +N LV+ +V+ + +
Sbjct  61   DFKLFESRAIARYYATKYSDQGTNLLGKSLEHRAIVDQWADVEVGYFNVLVHPLVMNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D ++V++   KLG VLD+Y+ +L+ +++LAGD F++ADL+H+P++ +L    
Sbjct  121  KPRLGEECDAALVEELKVKLGVVLDIYDNQLASNRFLAGDEFTMADLTHMPAMGYLMRT-  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V +R  +N W+ +++ARPAW K++ +
Sbjct  180  DINRIVKDRANMNRWWEEVTARPAWKKLMKM  210



>gb|AFK37527.1| unknown [Lotus japonicus]
Length=215

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  T A P+ V+ CL E  ++FE + +DL   E+KTPEFL+ QPFG++P I+DG
Sbjct  1    MVVKVYG-PTYAAPKGVVMCLIEKEIEFESVPVDLSKGENKTPEFLKIQPFGKIPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI RY A KY  +G  L+GKT+EERG+V+QWLEVE+ N++  ++ +VL +  
Sbjct  60   DYTLYESRAINRYLAEKYKNQGTELLGKTIEERGLVEQWLEVEAQNFHPPLHKLVLHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G PSD  V+++   KL KVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N+ 
Sbjct  120  APIRGFPSDPKVIEESEVKLLKVLDIYEERLSKSKYLAGDFFSLADLSHLPFGYYLVNQT  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +LV ERK ++AW+ DIS RP+W KVL L
Sbjct  180  GRENLVRERKHVSAWWDDISTRPSWQKVLQL  210



>ref|XP_010035937.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47446.1| hypothetical protein EUGRSUZ_K01231 [Eucalyptus grandis]
Length=215

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E GV+FE + +DL   EHK PE+L  QPFG +P ++DG
Sbjct  1    MVVKVYGPDYAS-PKRVLVCLIEKGVEFETVGVDLFKGEHKAPEYLELQPFGSLPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY ++G  L+GKTVEERG+V+QWLEVE+ N++  ++++VL++ +
Sbjct  60   DYTLFESRAIIRYYAEKYKDQGTELLGKTVEERGLVEQWLEVEAQNFHPPIFDLVLKVVI  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D   +K+  +KL +VLD+YEERLSKSKYLAG+FFSLADLSHLP  ++L  + 
Sbjct  120  GPLRGLTPDPKQLKESEDKLCQVLDIYEERLSKSKYLAGNFFSLADLSHLPFTQYLVGKI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++ W+ DIS+RP+W KVL+L
Sbjct  180  GKEYLIRDRKHVSGWWDDISSRPSWKKVLEL  210



>dbj|BAD89984.1| mutant protein of GST-like protein [Arabidopsis thaliana]
Length=214

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 154/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E G++FE+IHIDL +FE K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRA  RYYATK+A++G NL+GK++E R +VDQW +VE+  +N L   +V+ + +
Sbjct  61   DFKLFESRAFARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLII  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D+ +V+    KLG VLD+Y  RLS +++LAG+ F++ADL+H+P++ +L +  
Sbjct  121  KPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R   N W+ +IS RP+W K++ L
Sbjct  181  DINQMVKARGSFNRWWEEISDRPSWKKLMVL  211



>ref|XP_008229578.1| PREDICTED: glutathione S-transferase F9-like isoform X1 [Prunus 
mume]
Length=219

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 151/196 (77%), Gaps = 2/196 (1%)
 Frame = +1

Query  127  PQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRAIIRY  306
            P+ V+   FE  ++FE   IDL   EHK PEFL+ QPFGQVP I+DGD+ L+ESRAIIRY
Sbjct  19   PKAVLRRHFE--IEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYESRAIIRY  76

Query  307  YATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSDMSVV  486
            YA KY  +G +L+GKT+EERG+V+QWLEVE++NY+  +YN+V+Q+   P +G PSD  ++
Sbjct  77   YAEKYKSQGTDLLGKTIEERGLVEQWLEVEASNYHPPLYNLVIQILFAPELGLPSDPKII  136

Query  487  KKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSERKCLN  666
            ++  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLP   +L N  G  +++ +RK + 
Sbjct  137  QESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTYYLANSMGKEYMIKDRKHVA  196

Query  667  AWYSDISARPAWNKVL  714
            AW+ DIS RP+W KVL
Sbjct  197  AWWDDISNRPSWKKVL  212



>emb|CDX85469.1| BnaA02g03440D [Brassica napus]
Length=215

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 156/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E  ++FE++H+DL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGQVTAACPQRVLLCFLEKEIEFEIVHVDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKY+ +G NL+GK++E R +VDQW +VE++ +N L + +VL + +
Sbjct  61   DFKLFESRAIARYYATKYSNQGTNLLGKSLEHRAIVDQWADVETHYFNVLAFPIVLNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D  +V++   KLG VLD+YE RL+ +++LAGD F++ADL+H+P++ +L    
Sbjct  121  KPRLGEECDAVLVEELKAKLGVVLDIYENRLASNRFLAGDEFTMADLTHMPAMGYLMR-T  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R  +N W+ +++ARPAW K++ +
Sbjct  180  DVNQMVKARVNMNRWWEELTARPAWKKLMKM  210



>ref|XP_009126170.1| PREDICTED: glutathione S-transferase F12 [Brassica rapa]
Length=215

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 156/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G  TAACPQRV+ C  E  ++FE++H+DL + E K PE L RQPFGQVPAIEDG
Sbjct  1    MVVKLYGLVTAACPQRVLLCFLEKEIEFEIVHVDLDTLEQKKPEHLLRQPFGQVPAIEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DFKLFESRAI RYYATKY+ +G NL+GK++E R +VDQW +VE++ +N L + +VL + +
Sbjct  61   DFKLFESRAIARYYATKYSNQGTNLLGKSLEHRAIVDQWADVETHYFNVLAFPIVLNLVI  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G+  D  +V++   KLG VLD+YE RL+ +++LAGD F++ADL+H+P++ +L    
Sbjct  121  KPRLGEECDAVLVEELKAKLGVVLDIYENRLASNRFLAGDEFTMADLTHMPAMGYLMR-T  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                +V  R  +N W+ +++ARPAW K++ +
Sbjct  180  DVNQMVKARVNMNRWWEELTARPAWKKLMKM  210



>ref|XP_007141437.1| hypothetical protein PHAVU_008G195500g [Phaseolus vulgaris]
 gb|ESW13431.1| hypothetical protein PHAVU_008G195500g [Phaseolus vulgaris]
Length=215

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  V+FE++ +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCAST-KRVLVCLLEKDVEFEVVPVDLTKGEHKDPEFLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+G+T EERGVV+QWLEVE++N++   Y++ + +  
Sbjct  60   DYTLYESRAIMRYYADKYRSQGVELLGRTPEERGVVEQWLEVEAHNFHPPAYDLAVHLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  V+++   KL KVLDVYEERLSKSKYL GDFFSLAD+SHLP   F+ N+ 
Sbjct  120  APLFGMTPDPKVIEESEAKLLKVLDVYEERLSKSKYLGGDFFSLADISHLPFTYFIVNQM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              G+L+ ERK ++ W+ DIS+RP+W KV+ L
Sbjct  180  NKGYLIKERKHVSGWWDDISSRPSWKKVIQL  210



>ref|XP_007141438.1| hypothetical protein PHAVU_008G195600g [Phaseolus vulgaris]
 gb|ESW13432.1| hypothetical protein PHAVU_008G195600g [Phaseolus vulgaris]
Length=215

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  V+FE++ +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCAST-KRVLVCLLEKEVEFEVVPVDLTKGEHKAPEFLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+R+YA KY  +G  L+G+T EERGVV+QWLEVE++N++   Y++ + +  
Sbjct  60   DYTLYESRAIMRFYADKYRSQGVELVGRTAEERGVVEQWLEVEAHNFHPPAYDLAVHLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  V+++   KL KVLDVYEERLSKSKYL GDFFSLAD+SHLP   F+ N+ 
Sbjct  120  APIFGMTPDPKVIEESEAKLLKVLDVYEERLSKSKYLGGDFFSLADISHLPFTYFIVNQM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              G+L+ ERK ++ W+ DIS+RP+W KV++L
Sbjct  180  NKGYLIKERKHVSGWWDDISSRPSWKKVIEL  210



>ref|XP_008342338.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
Length=214

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 157/209 (75%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA P+RV+ CL E  V FE + IDL   E+K P+FL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPLYAA-PKRVLVCLVEKEVXFETVPIDLLKGENKHPDFLKLQPFGTVPLIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+Q LE++++N+   +YN+V+ +  
Sbjct  60   DYTLYESRAIMRYYAEKYKSQGTDLLGKTIEERGLVEQXLEIKAHNFQPPIYNLVVHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G PSD  ++++  EKLGKVLD+YEE+LSK KYLAGDFFSLADLSHLP   FL    
Sbjct  120  SPVLGFPSDPKILQESEEKLGKVLDIYEEQLSKCKYLAGDFFSLADLSHLPFTHFLVANM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS RP+W +VL
Sbjct  180  GKEYMIRDRKHVSAWWDDISNRPSWKRVL  208



>ref|XP_010035940.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47448.1| hypothetical protein EUGRSUZ_K01233 [Eucalyptus grandis]
Length=215

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+RV+ CL E  V+FE + +DL   EHK PE+L+ QPFG VP ++DG
Sbjct  1    MVVKVYGPDYAS-PKRVLVCLIEKDVEFETVIVDLFKGEHKAPEYLKLQPFGSVPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LF+SRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++  +Y++V  +  
Sbjct  60   DYALFDSRAIIRYYAEKYKHQGTELLGKTIEERGLVEQWLEVEAHNFHPPIYDLVHNLVY  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G   D   +K+  +KL +VLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L  + 
Sbjct  120  GPLIGLTPDPKQLKESEDKLCRVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLMGKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQ  732
               +L+ +RK ++ W+ DIS+RP+W KVL+L   Q
Sbjct  180  RKEYLIRDRKHVSGWWDDISSRPSWKKVLELWPGQ  214



>ref|XP_008348377.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like, 
partial [Malus domestica]
Length=202

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = +1

Query  127  PQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRAIIRY  306
            P+RV+ CL E  VDFE + IDL   EHK P+FL+ QPFG VP I+DGD+ L+ESRAIIRY
Sbjct  1    PKRVLVCLVEKEVDFETVPIDLLKGEHKHPDFLKLQPFGSVPLIQDGDYTLYESRAIIRY  60

Query  307  YATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSDMSVV  486
             A KY  +G NL+G T+EERG+V+QWLEVE+ N++  + N+VL +     +G PSD  ++
Sbjct  61   CAEKYKSQGTNLLGNTIEERGLVEQWLEVEAQNFHPPINNLVLHILFASVLGFPSDRKII  120

Query  487  KKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSERKCLN  666
            ++  EKLGKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L    G  +++ +RK ++
Sbjct  121  QESEEKLGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLVANMGKEYMIRDRKHVS  180

Query  667  AWYSDISARPAWNKVL  714
            AW+ DIS RP+W +VL
Sbjct  181  AWWDDISNRPSWKRVL  196



>ref|XP_007137174.1| hypothetical protein PHAVU_009G105900g [Phaseolus vulgaris]
 gb|ESW09168.1| hypothetical protein PHAVU_009G105900g [Phaseolus vulgaris]
Length=216

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 157/212 (74%), Gaps = 2/212 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    A P++V+ CL E  V+FE +H+D  + EHK PE+L+ QPFG +P ++DG
Sbjct  1    MVVKVYG-PDYANPKKVIVCLIEKQVEFETVHVDGINGEHKQPEYLKLQPFGLLPVVKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYY+ KY  +G  L+G T+EERG+V+QWLEVE++NY   +YN+V+ + +
Sbjct  60   DYILYESRAILRYYSEKYKNQGSALLGNTIEERGLVEQWLEVEAHNYYPPIYNLVMNILI  119

Query  448  FPSM-GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
             P + G+ SD  V ++  EKL KVLD+YEERLSK+KYLAGDFFSLADLSHLP   +L   
Sbjct  120  LPIVKGEASDPKVSEENEEKLCKVLDIYEERLSKTKYLAGDFFSLADLSHLPFTHYLMTS  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                ++V ERK ++AW+ DIS RP+W KVL L
Sbjct  180  MKKEYMVRERKHVSAWWDDISNRPSWKKVLQL  211



>ref|XP_003617377.1| Glutathione S-transferase [Medicago truncatula]
 gb|AET00336.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=216

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 162/213 (76%), Gaps = 6/213 (3%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  ++FE++ I++   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCASA-KRVLVCLVEKEIEFEVVPINVLKGEHKDPEYLKLQPFGNVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EE+G+V+QWLEVE++N+N   YN+V+ +  
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEEKGLVEQWLEVEAHNFNPPAYNLVIHVL-  118

Query  448  FPSM---GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLT  618
            FPS+   G P D  V+++   KL KVL++YEERLSK+KYLAGDFFSLAD+SHLP   ++ 
Sbjct  119  FPSLLVDGTP-DPKVIEESEAKLVKVLNIYEERLSKNKYLAGDFFSLADISHLPFTDYIV  177

Query  619  NEGGFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            N  G  +L+ ERK ++AW+ DIS+RP+WNK+L+
Sbjct  178  NNMGKDYLIKERKNVSAWWDDISSRPSWNKILE  210



>ref|XP_010035941.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47450.1| hypothetical protein EUGRSUZ_K01236 [Eucalyptus grandis]
Length=215

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    + P+R + CL E GV+FE + +DL   EHK PE+L+ QPF  +P ++DG
Sbjct  1    MVVKVYGPDYPS-PKRALVCLIEKGVEFETVGVDLFKGEHKAPEYLKLQPFRSLPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAIIRYYA KY ++   L+GKT+EERG+V+QWLEVE++N++  +Y++VL++  
Sbjct  60   DYTLFESRAIIRYYAEKYKDQRTELLGKTIEERGLVEQWLEVEAHNFHPPIYDLVLKIVY  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +G   D   +K+  +KL +VLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L  + 
Sbjct  120  GPFIGLTPDPKQLKESEDKLCQVLDIYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++ W+ DIS+RP+W KVL+L
Sbjct  180  GKEYLIRDRKHVSGWWDDISSRPSWKKVLEL  210



>ref|NP_001267983.1| glutathione S-transferase 3 [Vitis vinifera]
 gb|ABO64930.1| glutathione S-transferase [Vitis vinifera]
 gb|ABW34389.1| glutathione S-transferase 3 [Vitis vinifera]
 emb|CBI22081.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  V+FE + ID+   ++K PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPDFASA-KRVLVCLIEKEVEFETLPIDIIKGQNKDPEFLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAI+RYYA KY  +G +L+GKT+EERGVV+QWLEVE+ +Y+  + N+V+++  
Sbjct  60   DYTLFESRAIMRYYAEKYKSQGTDLLGKTIEERGVVEQWLEVEAQSYHPAIDNLVIEILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G P D  V+++  +KL KVLD+YEERLSKSKYLAGDFFSLADLSHLP  ++L + G
Sbjct  120  GRKRGIPPDAKVIEESEKKLAKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTKYLADMG  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
               +L+ ERK + AW+ DIS RP+W KV 
Sbjct  180  KM-YLIEERKHVKAWWDDISNRPSWKKVF  207



>ref|XP_009395362.1| PREDICTED: glutathione S-transferase F10-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G   A CPQRVM CL E GV FE + +D+ + E K PE++ + PFGQVP I DG
Sbjct  1    MAVKVYGKPQAVCPQRVMHCLVEKGVPFEFVLVDIDAMEQKRPEYMEKHPFGQVPFIADG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            DF+LFESRAI+RY+A KYA++G NL+G+T EER  V+QWL+VE+ +Y+   + +V  +F+
Sbjct  61   DFELFESRAIVRYFAAKYADRGPNLLGRTAEERAKVEQWLDVEAISYSPCAFTIVFNLFL  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P +        EKL KVL+VYE++LS++KYLAGD F+LADL+H+P  R++    
Sbjct  121  LPIRGLPGNKGEAVAAMEKLDKVLEVYEKQLSRTKYLAGDEFTLADLTHIPVTRYIVEHC  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
            G  +L+ ++    AW+ D+S RPAW KV+  + +
Sbjct  181  GLAYLLDDKPHAKAWWEDVSRRPAWKKVMSFVAS  214



>gb|AEX37999.1| glutathione transferase [Phaseolus vulgaris]
Length=215

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  +A+  +RV+ CL E  V+FE++ +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHSASA-KRVLVCLLEKEVEFEVVPVDLLKGEHKGPEFLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+R+YA KY  +G  L+G+T EERGVV+QWLEVE++N++   Y++ + +  
Sbjct  60   DYTLYESRAIMRFYADKYRSQGVELVGRTAEERGVVEQWLEVEAHNFHPPAYDLAVHLLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  V+++   KL KVLDVYEERLSKSKYL GDFFSLAD+SHLP   F+ N+ 
Sbjct  120  APLFGMTPDPKVIEESEAKLLKVLDVYEERLSKSKYLGGDFFSLADISHLPLTYFIVNKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ERK ++ W+ DIS+RP+W KV++L
Sbjct  180  NKEYLIRERKHVSGWWDDISSRPSWKKVIEL  210



>ref|XP_004499971.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum]
Length=217

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 158/213 (74%), Gaps = 3/213 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFG--QVPAIE  261
            MVVKV+G    ACP+RV+ CL E  ++FE +H+D    EHK  E+L+ Q +G    P ++
Sbjct  1    MVVKVYG-PDYACPKRVIVCLIEKEIEFETVHVDGFKGEHKKAEYLKLQVYGSKNWPILQ  59

Query  262  DGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQM  441
            DGD+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N+N  ++N+V+ +
Sbjct  60   DGDYILYESRAILRYYAEKYKTQGTDLLGKTIEERGLVEQWLEVETHNFNPPIFNLVMNL  119

Query  442  FVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
             V+P +G P+D  V+++  EKL  VLD+YEERLSK+KYLAGDFFS ADL HLP   +L N
Sbjct  120  LVYPLVGLPNDPKVIQESEEKLENVLDIYEERLSKTKYLAGDFFSHADLRHLPFGHYLMN  179

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            +    ++V ERK ++AW+ DIS RP+W KVL L
Sbjct  180  QMKKENMVRERKHVSAWWDDISHRPSWKKVLQL  212



>ref|XP_010507366.1| PREDICTED: glutathione S-transferase F11 isoform X2 [Camelina 
sativa]
Length=214

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 152/211 (72%), Gaps = 0/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVK++G   AA PQRV+ C  E G++FE+IH+DL   E K  E L RQPFGQVPAI   
Sbjct  1    MVVKLYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDQLEQKKTEHLLRQPFGQVPAIAQA  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              +L ESRAI+RYYATKYA++G +L+GKT+E+R +VDQW+EVE+N    +   +V+ +  
Sbjct  61   FLQLQESRAIVRYYATKYADQGADLLGKTLEKRAIVDQWVEVENNYLYAVALPLVINVVF  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G+P D+++V++   K  KVLDVYE RL+ ++YLAGD F+LADL+H+P +R++ NE 
Sbjct  121  KPKFGEPCDVTLVEELKVKFKKVLDVYENRLATNRYLAGDEFTLADLTHMPGMRYIMNET  180

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                LV+ R+ +N W++ IS RPAW K++DL
Sbjct  181  SLSGLVTSRENVNRWWNVISIRPAWKKLMDL  211



>gb|AFK35789.1| unknown [Medicago truncatula]
Length=216

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 161/212 (76%), Gaps = 6/212 (3%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  ++FE++ I++   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCASA-KRVLVCLVEKEIEFEVVPINVLKGEHKDPEYLKLQPFGNVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EE+G+V+QWLEVE++++N   YN+V+ +  
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEEKGLVEQWLEVEAHSFNPPAYNLVIHVL-  118

Query  448  FPSM---GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLT  618
            FPS+   G P D  V+++   KL KVL++YEERLSK+KYLAGDFFSLAD+SHLP   ++ 
Sbjct  119  FPSLLVDGTP-DPKVIEESEAKLVKVLNIYEERLSKNKYLAGDFFSLADISHLPFTDYIV  177

Query  619  NEGGFGHLVSERKCLNAWYSDISARPAWNKVL  714
            N  G  +L+ ERK ++AW+ DIS+RP+WNK+L
Sbjct  178  NNMGKDYLIKERKNVSAWWDDISSRPSWNKIL  209



>gb|AFK45563.1| unknown [Lotus japonicus]
Length=215

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G + AA  +RV+  L E  ++FE++ +D+   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MAVKVYGPSCAAA-KRVLVVLIEKAIEFEVVPVDVFKGEHKDPEYLKLQPFGVVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N++   Y++ + + V
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGIDLLGKTIEERGLVEQWLEVEAHNFHPPAYDLTIHILV  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D  V+++   KL  VL++YEERLSKSKYLAGDFFSLAD+SHLP   ++ N  
Sbjct  120  PQLAGITPDQKVIEESEAKLVNVLNIYEERLSKSKYLAGDFFSLADISHLPFTDYIVNNM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  HL+ ERK ++AW+ DIS RP+W KVL+L
Sbjct  180  GKEHLIKERKHVSAWWDDISNRPSWKKVLEL  210



>ref|XP_010038728.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
Length=210

 Score =   237 bits (604),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 157/215 (73%), Gaps = 6/215 (3%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   AA P+RV+ CL E GV+F  + ID    EHK PE+L+ QPFG VPA++DG
Sbjct  1    MVVKVYGP-DAAAPKRVLECLIEKGVEFRTVTIDHFKGEHKAPEYLKLQPFGSVPAVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAII YYA KY  +G +L+GKT+EERG+V+QWLEVE+ N++  ++++VL++  
Sbjct  60   DYTLFESRAIISYYAEKYKRQGTDLLGKTIEERGLVEQWLEVEAQNFHPPIFDLVLKIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P +         ++  +KL KVLD+YEE LSKSKYLAGDF SLADLSHLP  ++L  + 
Sbjct  120  GPELP-----PAAQRERDKLCKVLDIYEEMLSKSKYLAGDFVSLADLSHLPFTQYLVGKM  174

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQ  732
            G  +L+ +RK ++AW+ DIS+RP+W KVL+L   Q
Sbjct  175  GKEYLIRDRKHVSAWWDDISSRPSWKKVLELWPGQ  209



>ref|XP_007141436.1| hypothetical protein PHAVU_008G195400g [Phaseolus vulgaris]
 gb|ESW13430.1| hypothetical protein PHAVU_008G195400g [Phaseolus vulgaris]
Length=215

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G  +A+  +RV+ CL E  V+FE++ +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHSASA-KRVLVCLLEKEVEFEVVPVDLLKGEHKGPEFLKLQPFGAVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+G+T EERGVV+QWLEVE++N+N    ++ + +  
Sbjct  60   DYTLYESRAIMRYYADKYRSQGIELVGRTPEERGVVEQWLEVEAHNFNPPANDLAVHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  ++++   KL KVLDVYEERLSKSKYL GDFFSLAD+SHLP   F+ N+ 
Sbjct  120  APFFGITPDPKLIEESEAKLLKVLDVYEERLSKSKYLGGDFFSLADISHLPLTYFIVNKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ERK ++ W+ DIS+RP+W KV++L
Sbjct  180  NKEYLIRERKHVSGWWDDISSRPSWKKVIEL  210



>ref|XP_004491311.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum]
Length=215

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  ++FE++ +D+   EHK P++L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCAST-KRVLVCLIEKEIEFEVVPVDVFKGEHKDPDYLKLQPFGAVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE+ NYN   YN+ L   +
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEERGLVEQWLEVEAQNYNPPAYNLALHG-L  118

Query  448  FPSM-GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            FPS+ G   D  V+++   KL KVL++YEERLSK+KYLAGDFFSL D+SHLP   ++ N 
Sbjct  119  FPSLIGNNPDPKVIEESEAKLVKVLNIYEERLSKNKYLAGDFFSLVDISHLPFTDYIVNH  178

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G  +L+ +RK + AW+ DIS+RP+W KVL+L
Sbjct  179  MGKDYLIKDRKHVCAWWDDISSRPSWTKVLEL  210



>ref|XP_008348130.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
Length=220

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +1

Query  139  MACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRAIIRYYATK  318
            + CL E  ++FE + ID+   E + PEFL+ QPFGQVP I+DGD+ LFESRAIIRYYA K
Sbjct  12   LVCLVEKEIEFETVPIDIFKGEQRNPEFLKLQPFGQVPVIQDGDYTLFESRAIIRYYAEK  71

Query  319  YAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSDMSVVKKCA  498
            Y  +G +L+GKT+EERG+V+QWLEVE++NY+  + N+V  +    +MG  SD  ++++  
Sbjct  72   YKSQGTDLLGKTMEERGLVEQWLEVEASNYHQPLDNIVTHILFASAMGISSDPKIIQESE  131

Query  499  EKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSERKCLNAWYS  678
            EK+GKVLD+YEERLSKSKYLAGDFFSLADLSHLP   +L N  G  +++ +RK ++ W+ 
Sbjct  132  EKVGKVLDIYEERLSKSKYLAGDFFSLADLSHLPFTHYLANSMGKEYMIRDRKHVSVWWD  191

Query  679  DISARPAWNKVL  714
            DIS+RP+W KVL
Sbjct  192  DISSRPSWKKVL  203



>ref|XP_010035942.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47451.1| hypothetical protein EUGRSUZ_K01237 [Eucalyptus grandis]
 gb|KCW47452.1| hypothetical protein EUGRSUZ_K01237 [Eucalyptus grandis]
Length=215

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A  P+RV+ CL E GV+FE + ID+   E+K PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYGPDYAN-PKRVLVCLIEKGVEFETVPIDIFKDENKAPEFLKLQPFGSVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAI RYYA KY  +G +L+GKT+EE G+V+QWLEVE+  Y+  + +++ ++  
Sbjct  60   DYTLFESRAIARYYAQKYKHQGTDLLGKTIEETGLVEQWLEVEAQCYSPPITDLIYKIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  ++K+  +KL KVLD+YEERLSKSKYLAGD FSLADLSHL   ++L  + 
Sbjct  120  DPIRGLTPDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDLFSLADLSHLSLTQYLMGKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW+ DIS+RP+W KV++L
Sbjct  180  GKEYLIRDRKHVSAWWDDISSRPSWKKVVEL  210



>gb|KCW47449.1| hypothetical protein EUGRSUZ_K01234 [Eucalyptus grandis]
Length=215

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 156/211 (74%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    A P+RV+ CL E GV+FE + ID+   E+++PEFL+ QPFG VP I+DG
Sbjct  1    MVVKVYG-PDYANPKRVLVCLIEKGVEFETVPIDIFKDENRSPEFLKLQPFGSVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ LFESRAI RYYA KY  +G +L+GKT+EE G+V+QWLEVE+  Y+  + +++ ++  
Sbjct  60   DYTLFESRAIARYYAQKYKHQGTDLLGKTIEETGLVEQWLEVEAQCYSPPITDLIYKIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G   D  ++K+  +KL KVLD+YEERLSKSKYLAGD FSLADLSHL   ++L  + 
Sbjct  120  DPIRGLTPDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDLFSLADLSHLSLTQYLMGKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ +RK ++AW+ DIS+RP+W KV++L
Sbjct  180  GKEYLIRDRKHVSAWWDDISSRPSWKKVVEL  210



>ref|XP_010542711.1| PREDICTED: glutathione S-transferase F9 [Tarenaya hassleriana]
Length=217

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 151/210 (72%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G    A P+RV+  L E GV FE + +DL + EHK P +L  QPFG VP + DG
Sbjct  1    MVLKVYGP-IFASPKRVLVTLVEKGVPFETVPVDLFTGEHKQPPYLELQPFGSVPVVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G  L+GKT+EERG V+QWL+VE+ NY+  + N+ + +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPELLGKTLEERGQVEQWLDVEAVNYHPPLLNLTMHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  ++K+  EKL +VLDVYEE LSK+KYLAGDF SLADL+HLP   +L    
Sbjct  120  APVMGFPADEKLIKESEEKLAQVLDVYEEHLSKNKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +L+ +RK ++AW+ DIS+RPAW +VL+
Sbjct  180  GKAYLIKDRKHVSAWWDDISSRPAWKEVLE  209



>emb|CDY02726.1| BnaC02g07090D [Brassica napus]
Length=214

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = +1

Query  115  TAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRA  294
            TAACPQRV+ C  E  ++FE++H+DL + E K  E L RQPFGQVPAIEDGDFKLFESRA
Sbjct  9    TAACPQRVVLCFLEKEIEFEIVHVDLDTLEQKKSEHLLRQPFGQVPAIEDGDFKLFESRA  68

Query  295  IIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSD  474
            I RYYATKY+ +G NL+GK++E R +VDQW +VE++ +N L + +VL + + P +G+  D
Sbjct  69   IARYYATKYSNQGTNLLGKSLEHRAIVDQWADVETHYFNVLAFPIVLNLVIKPRLGEECD  128

Query  475  MSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSER  654
            + +V++   KLG VLD+YE RL+ +++LAGD F++ADL+H+P++ +L        +V  R
Sbjct  129  VVLVEELKAKLGVVLDIYENRLASNRFLAGDEFTMADLTHMPAMGYLMR-TDVNQMVKAR  187

Query  655  KCLNAWYSDISARPAWNKVLDL  720
              +N W+ +I+ARPAW K++ +
Sbjct  188  VNMNRWWEEITARPAWKKLMKM  209



>gb|ADB85090.1| glutathione S-transferase [Jatropha curcas]
Length=203

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G+A A+ P+RV+ CL E G++FE + IDL   EHK+PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGTAYAS-PKRVLVCLIEKGIEFETVPIDLIKGEHKSPEYLQLQPFGAVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE+ NY+  +YN+ L +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTELLGKTIEERGLVEQWLEVEAQNYHPPIYNLTLHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              ++G P D  ++K+  EKL KVLD+YE+RLSKSKYLAG+FFSLADLSHLP  ++L    
Sbjct  120  ASALGFPPDEKIIKESEEKLAKVLDIYEDRLSKSKYLAGEFFSLADLSHLPFTQYLGWSH  179

Query  628  GFGHLVSERKCLNAWYSDISARPA  699
              G    E+K        IS RP+
Sbjct  180  EQGVYDKEQKACECLVGYISNRPS  203



>ref|XP_010035939.1| PREDICTED: glutathione S-transferase F9-like isoform X2 [Eucalyptus 
grandis]
Length=284

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 156/212 (74%), Gaps = 1/212 (0%)
 Frame = +1

Query  85   NMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIED  264
             MVVKV+G   A  P+RV+ CL E GV+FE + ID+   E+++PEFL+ QPFG VP I+D
Sbjct  69   KMVVKVYGPDYAN-PKRVLVCLIEKGVEFETVPIDIFKDENRSPEFLKLQPFGSVPVIQD  127

Query  265  GDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            GD+ LFESRAI RYYA KY  +G +L+GKT+EE G+V+QWLEVE+  Y+  + +++ ++ 
Sbjct  128  GDYTLFESRAIARYYAQKYKHQGTDLLGKTIEETGLVEQWLEVEAQCYSPPITDLIYKIV  187

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
              P  G   D  ++K+  +KL KVLD+YEERLSKSKYLAGD FSLADLSHL   ++L  +
Sbjct  188  FDPIRGLTPDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDLFSLADLSHLSLTQYLMGK  247

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G  +L+ +RK ++AW+ DIS+RP+W KV++L
Sbjct  248  MGKEYLIRDRKHVSAWWDDISSRPSWKKVVEL  279



>ref|XP_006575642.1| PREDICTED: glutathione S-transferase F9-like [Glycine max]
 gb|KHN38343.1| Glutathione S-transferase F9 [Glycine soja]
 gb|AJE59617.1| phi class glutathione S-transferase [Glycine max]
Length=215

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  V+F+++ +D+   E K PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCAST-KRVLVCLVEKEVEFDVVPVDVTKGEQKDPEYLKLQPFGVVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++   YN+ L    
Sbjct  60   DYTLYESRAIIRYYAEKYRSQGAELLGKTIEERGLVEQWLEVEAHNFHPPAYNLCLHGLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D  V+++   KL +VL++YEERLSK+KYLAGDFFS+AD+SHLP L ++ N  
Sbjct  120  GSLFGVTPDPKVIEESEAKLVQVLNIYEERLSKTKYLAGDFFSIADISHLPFLDYVVNNM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ ERK + AW+ DIS+RP+WNKVL L
Sbjct  180  EKKYLLKERKHVGAWWDDISSRPSWNKVLQL  210



>ref|XP_003617376.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AET00335.1| glutathione S-transferase [Medicago truncatula]
Length=216

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 160/213 (75%), Gaps = 4/213 (2%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+  +RV+ CL E  ++FE++ +++   EHK PE+L+ QPFG VP I+DG
Sbjct  1    MVVKVYGPHCASA-KRVLVCLVEKKIEFEVVPVNVLEGEHKDPEYLKLQPFGTVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EE+G+V+QWLEVE++N++   YN+   +  
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEEKGLVEQWLEVEAHNFHPSAYNLTCHVLC  119

Query  448  FPSM--GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
             P++  G   D  V+++   KL KV ++YEERLSK+KYLAGDFFSLAD+SHLP + ++ N
Sbjct  120  -PTLLGGSSPDPKVIEESEAKLVKVFNIYEERLSKNKYLAGDFFSLADISHLPFMDYVVN  178

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              G  +L+ ++K ++AW++DIS+RP+WNKVL+L
Sbjct  179  NMGKDYLIKDKKHVSAWWNDISSRPSWNKVLEL  211



>ref|XP_010035938.1| PREDICTED: glutathione S-transferase F9-like isoform X1 [Eucalyptus 
grandis]
Length=305

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 156/212 (74%), Gaps = 1/212 (0%)
 Frame = +1

Query  85   NMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIED  264
             MVVKV+G    A P+RV+ CL E GV+FE + ID+   E+++PEFL+ QPFG VP I+D
Sbjct  90   KMVVKVYG-PDYANPKRVLVCLIEKGVEFETVPIDIFKDENRSPEFLKLQPFGSVPVIQD  148

Query  265  GDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            GD+ LFESRAI RYYA KY  +G +L+GKT+EE G+V+QWLEVE+  Y+  + +++ ++ 
Sbjct  149  GDYTLFESRAIARYYAQKYKHQGTDLLGKTIEETGLVEQWLEVEAQCYSPPITDLIYKIV  208

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
              P  G   D  ++K+  +KL KVLD+YEERLSKSKYLAGD FSLADLSHL   ++L  +
Sbjct  209  FDPIRGLTPDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDLFSLADLSHLSLTQYLMGK  268

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G  +L+ +RK ++AW+ DIS+RP+W KV++L
Sbjct  269  MGKEYLIRDRKHVSAWWDDISSRPSWKKVVEL  300


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G   A+ P+R + CL E GV+FE + +DL   EHK PE+L+ QPFG +P ++DG
Sbjct  1    MVVKVYGPDYAS-PKRALVCLIEKGVEFETVGVDLFKGEHKAPEYLKLQPFGSLPVVQDG  59

Query  268  DFKLFESRA  294
            D+ LF++  
Sbjct  60   DYTLFDAEG  68



>ref|XP_009377080.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 148/209 (71%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    + P+ V+ CL E  VD E + IDL   EHK P+FL+  PFG V  I+D 
Sbjct  1    MVVKVYGPPYGS-PKHVLVCLVEKEVDLETVPIDLLKGEHKHPDFLKLHPFGSVLLIQDE  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G NL+GK  EERG+V+QWLEVE++N++   YNM L +  
Sbjct  60   DYTLYESRAIMRYYAEKYKSQGTNLLGKITEERGLVEQWLEVEAHNFHPPSYNMALHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G PSD  ++++  E LGKVLD+YEE+LSKSKYLAGDFFSLADLSH P  ++L    
Sbjct  120  ASVLGFPSDPKIIQESEETLGKVLDIYEEQLSKSKYLAGDFFSLADLSHFPLTQYLVANM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G   ++ +RK ++AW+ +IS RP+W +VL
Sbjct  180  GKEDMIRDRKHVSAWWDNISNRPSWKRVL  208



>ref|XP_010557150.1| PREDICTED: glutathione S-transferase F9-like [Tarenaya hassleriana]
Length=217

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+RV+  L E GV FE +H+DL + EHK P +L  QPFGQVP + DG
Sbjct  1    MVLKVYGPLFAS-PKRVLVTLVEKGVPFETVHVDLPTEEHKQPPYLELQPFGQVPVVFDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G  L+GKT+EERG V+QWL+VE+ NY+  + N+ + + +
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPELLGKTLEERGQVEQWLDVEAVNYHPPLLNLTMHVML  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG   D  ++K+  EKL +VLDVYE  LS++KYLAGDF SLADL+HLP   +L    
Sbjct  120  APVMGFTPDEKLIKESEEKLAQVLDVYEAHLSQNKYLAGDFISLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RP+W +V++
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPSWKEVIE  209



>gb|EYU33332.1| hypothetical protein MIMGU_mgv1a013599mg [Erythranthe guttata]
Length=215

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  130  QRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRAIIRYY  309
            +RV+ACL E  ++FE++ +DL   EHK+P+FL+ QPFG VP I+DGD+ L+ESRAIIRYY
Sbjct  14   ERVIACLLEKEIEFEVVDVDLFKGEHKSPQFLKLQPFGSVPVIQDGDYTLYESRAIIRYY  73

Query  310  ATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSDMSVVK  489
            A KY  KG  L+GKT+EERG+++QWL+VE++N+   +Y++V+Q+   P +G   D   + 
Sbjct  74   AEKYRSKGTELLGKTIEERGLIEQWLDVEAHNFQPPLYDLVIQVLFGPKLGMTPDQKRID  133

Query  490  KCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSERKCLNA  669
            +  +KL +VLDVYEERLSKSKYLAGD FSLADLSHLP  ++L    G  +++ +RK ++ 
Sbjct  134  ENEKKLAQVLDVYEERLSKSKYLAGDSFSLADLSHLPFGQYLVTSLGKEYMIKDRKNVSR  193

Query  670  WYSDISARPAWNKVL  714
            W+ DIS+RP W KV+
Sbjct  194  WWDDISSRPCWKKVV  208



>ref|XP_010469787.1| PREDICTED: glutathione S-transferase F10 [Camelina sativa]
Length=220

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 150/208 (72%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +H+DL   EH+ PE++  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYVAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L NE 
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVNEI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  HL+ +RK ++AW+  IS+RPAW +V
Sbjct  180  GKAHLIKDRKHVSAWWDKISSRPAWKEV  207



>gb|ABY84869.1| glutathione S transferase 1 [Pteris vittata]
 gb|ABY84870.1| glutathione S transferase 1 [Pteris vittata]
Length=217

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 144/217 (66%), Gaps = 1/217 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGV-DFELIHIDLQSFEHKTPEFLRRQPFGQVPAIED  264
            M + V G AT++C  RV+  LFE  V DF+L+H+DL +  HK P++L  QPFG +P ++D
Sbjct  1    MTITVHGQATSSCTSRVLTTLFEKDVSDFQLLHVDLSTGAHKQPDYLALQPFGVIPVVQD  60

Query  265  GDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            GD  +FESRAIIRY A KY ++G  L G+T+EER +V+QWLEVES N++     +V Q+ 
Sbjct  61   GDLTIFESRAIIRYLALKYEDQGSPLYGRTLEERALVEQWLEVESQNFHVAASALVYQLS  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
                 G P D  VVK   EKL   LD+YE+RLSKS +LAGDFFSLADLSHLP  + L   
Sbjct  121  SRAKKGLPPDADVVKANIEKLEATLDIYEKRLSKSSFLAGDFFSLADLSHLPRTKSLMKS  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQK  735
                HL++ R+ ++AW+  IS RP+W KV ++    K
Sbjct  181  ANLTHLITAREHVHAWWQRISTRPSWVKVTEMATPSK  217



>ref|XP_011098399.1| PREDICTED: glutathione S-transferase F9-like [Sesamum indicum]
Length=215

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A  + P+RV+AC  E  ++++++HIDL   E+ TP +L  QPFG +P I+DG
Sbjct  1    MVVKVYGGAYGS-PKRVIACFIEKEIEYDVVHIDLFKGENTTPHYLNLQPFGALPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+G+TVEERG+V+QWLEVE++N+   +Y++V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKSQGTELLGRTVEERGLVEQWLEVEAHNFQPPLYDLVIHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D   +K+  EKL +VLDVYE+RLS SKYLAGD FSLADLSHLP   +L    
Sbjct  120  DGKEGVIPDEKRIKEDEEKLARVLDVYEQRLSTSKYLAGDSFSLADLSHLPFGHYLVTSL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++ +RK ++ W+ DIS+RP+W KVL L
Sbjct  180  GREYMIRDRKHVSRWWDDISSRPSWKKVLQL  210



>ref|XP_006410183.1| hypothetical protein EUTSA_v10017228mg [Eutrema salsugineum]
 gb|ABY86893.1| glutathione S-transferase [Eutrema halophilum]
 dbj|BAJ33732.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51636.1| hypothetical protein EUTSA_v10017228mg [Eutrema salsugineum]
Length=215

 Score =   229 bits (584),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 148/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE I +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLVEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHVMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P+D  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPADQKLIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RPAW +VL+
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKEVLE  209



>ref|XP_010414208.1| PREDICTED: glutathione S-transferase F10-like [Camelina sativa]
Length=220

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +H+DL   EH+ PE++  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G  L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYVAEKYRSQGPELLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L NE 
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVNEI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  HL+ +RK ++AW+  IS+RPAW +V
Sbjct  180  GKAHLIKDRKHVSAWWDKISSRPAWKEV  207



>gb|AAM34480.1| putative glutathione S-transferase [Phaseolus acutifolius]
Length=215

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 150/208 (72%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G  T A  +RV+ CL E  V+FE+I +DL   EHK PEFL+ QPFG VP I+DG
Sbjct  1    MVLKVYG-PTCASTKRVLVCLLEKEVEFEVIPVDLTKGEHKDPEFLKLQPFGVVPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+R+YA K+  +G  L+G+T EERGVV+QWLEVE++N++   Y++ + +  
Sbjct  60   DYTLYESRAIMRFYADKFRSQGVELLGRTAEERGVVEQWLEVEAHNFHPPAYDLAVHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D  V+++   KL KVLDVYE+RLSK KYL GDF SLAD+SHLP + ++ N+ 
Sbjct  120  ASLFGITPDPKVIEESEAKLLKVLDVYEDRLSKGKYLGGDFLSLADISHLPFIDYIVNKM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
              G+L+ ERK ++ W+ DIS+RP+W KV
Sbjct  180  NKGYLIKERKHVSDWWDDISSRPSWKKV  207



>ref|XP_011098390.1| PREDICTED: glutathione S-transferase F9-like [Sesamum indicum]
Length=215

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G A A+ P+RV+ CL E  +++E++H++L   E+ TP++L+ QPFG +P I+DG
Sbjct  1    MVVKVYGPAYAS-PKRVITCLVEKEIEYEVVHVNLFKGENTTPQYLQLQPFGVLPVIQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAIIRYYA KY  +G  L+G+TVEERG+V+QWLEVE++N++  + ++V+ +  
Sbjct  60   DYTLYESRAIIRYYAEKYKTQGTELLGRTVEERGLVEQWLEVEAHNFHPPLDDLVIHVLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D   +K+  EKL +VLDVYE+RLS SKYLAGD FSLADLSHLP   +L    
Sbjct  120  DGKKGVTPDEKRIKEDEEKLARVLDVYEQRLSTSKYLAGDSFSLADLSHLPFGHYLVTSL  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +++ ERK ++ W+ DIS RP+W KVL L
Sbjct  180  GKEYMIRERKHVSRWWDDISNRPSWKKVLHL  210



>ref|XP_007146233.1| hypothetical protein PHAVU_006G023400g [Phaseolus vulgaris]
 gb|ESW18227.1| hypothetical protein PHAVU_006G023400g [Phaseolus vulgaris]
Length=225

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 153/214 (71%), Gaps = 1/214 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+G    +  + V+ CL E  V+FE +H+D    EHK PE+L+ QPFG  P ++DG
Sbjct  1    MVVKVYGPDYGST-KGVLLCLIEKEVEFETVHVDGFKGEHKQPEYLKMQPFGLFPVVQDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RY+A KY  +G +L+GKTVE+RG+V+QWL+VE++N+   +Y++V   F 
Sbjct  60   DYVLYESRAILRYFAEKYKNQGTDLLGKTVEDRGLVEQWLDVEAHNFTPPIYSLVKIYFA  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G P+D   +K+  EK+ K LD+YE+RLS++KYLAGDFFSLADL+HLP   +L NE 
Sbjct  120  SVLEGVPADPKAIKENEEKIEKYLDIYEKRLSQTKYLAGDFFSLADLNHLPFTSYLMNEM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
              G +V ERK ++AW+ DIS+RP+W KVL    N
Sbjct  180  EKGFMVRERKHVSAWWDDISSRPSWKKVLQDYKN  213



>emb|CDY02724.1| BnaC02g07110D [Brassica napus]
Length=342

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = +1

Query  115  TAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRA  294
            TAACPQRV+ C  E  ++FE++H+DL + E K  E L RQPFGQVPAIEDGDFKLFESRA
Sbjct  137  TAACPQRVVLCFLEKEIEFEIVHVDLDTLEQKKSEHLLRQPFGQVPAIEDGDFKLFESRA  196

Query  295  IIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSD  474
            I RYYATKY+ +G NL+GK++E R +VDQW +VE++ +N L + +VL + + P +G+  D
Sbjct  197  IARYYATKYSNQGTNLLGKSLEHRAIVDQWADVETHYFNVLAFPIVLNLVIKPRLGEECD  256

Query  475  MSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSER  654
            + +V++   KLG VLD+YE RL+ +++LAGD F++ADL+H+P++ +L        +V  R
Sbjct  257  VVLVEELKAKLGVVLDIYENRLASNRFLAGDEFTMADLTHMPAMGYLMRT-DVNQMVKAR  315

Query  655  KCLNAWYSDISARPAWNKVLDL  720
              +N W+ +I+ARPAW K++ +
Sbjct  316  VNMNRWWEEITARPAWKKLMKM  337



>ref|XP_010510278.1| PREDICTED: glutathione S-transferase F10-like [Camelina sativa]
Length=220

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +H+DL   EH+ PE++  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYVAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D +V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L NE 
Sbjct  120  APLMGFPADENVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVNEI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  +L+ +RK ++AW+  IS+RPAW +V
Sbjct  180  GKAYLIKDRKHVSAWWDKISSRPAWKEV  207



>gb|AHA46521.1| phi class glutathione S-transferase [Larix kaempferi]
Length=216

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 142/207 (69%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            V+KV G   +     V+ CL E  V++EL+ +DL +  HK P++L   PFG VP I+DGD
Sbjct  3    VIKVHGFHASTATVMVLCCLNEKQVEYELVLVDLPAGAHKQPQYLALNPFGVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAI+RY A K+  +G +L+G T+ E  +VDQW EVE  ++N  + ++V Q+ V 
Sbjct  63   LTLFESRAILRYLAKKFKGQGTDLLGSTLSEEALVDQWCEVEGQSFNPAISSIVSQILVV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D +VV+   EKLGKVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G
Sbjct  123  PMRGGSTDEAVVEMNIEKLGKVLDIYEERLSKSKYLAGDFFSLADLQHLPFTHYLVNACG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L++ RK +NAW+ DIS+RP W KV
Sbjct  183  KGDLITSRKHVNAWWEDISSRPTWKKV  209



>ref|XP_009132756.1| PREDICTED: glutathione S-transferase F9 [Brassica rapa]
 emb|CDY23980.1| BnaC03g17110D [Brassica napus]
 emb|CDX84816.1| BnaA03g14140D [Brassica napus]
Length=215

 Score =   226 bits (577),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVAFETVPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVEERG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEERGQVEQWLDVEATTYHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLSAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+  IS+RPAW + L+
Sbjct  180  GKAYMIKDRKHVSAWWDSISSRPAWKETLE  209



>ref|NP_180643.1| glutathione S-transferase PHI 9 [Arabidopsis thaliana]
 ref|XP_002879282.1| hypothetical protein ARALYDRAFT_482003 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O80852.1|GSTF9_ARATH RecName: Full=Glutathione S-transferase F9; Short=AtGSTF9; AltName: 
Full=AtGSTF7; AltName: Full=GST class-phi member 9 [Arabidopsis 
thaliana]
 gb|AAK49621.1|AF372905_1 At2g30860/F7F1.7 [Arabidopsis thaliana]
 gb|AAC20720.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAO11595.1| At2g30860/F7F1.7 [Arabidopsis thaliana]
 gb|EFH55541.1| hypothetical protein ARALYDRAFT_482003 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC08448.1| glutathione S-transferase PHI 9 [Arabidopsis thaliana]
Length=215

 Score =   226 bits (577),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 146/209 (70%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE I +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS+RPAW + +
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETV  208



>emb|CDX97788.1| BnaC04g41510D [Brassica napus]
Length=215

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVPFETVPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  ++  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTFHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RPAW + L+
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETLE  209



>ref|XP_004491312.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum]
Length=219

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKV+ S   A  +RVM CL E  V+FE I +D+   EHK P++L+ QPFG +P IEDG
Sbjct  1    MVVKVY-SPHCASTKRVMVCLIEKEVEFETIPLDVIKGEHKDPQYLKLQPFGGIPVIEDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE+ N+N    ++ + +  
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEERGLVEQWLEVEAQNFNPPASDLAIHILF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               +G   D  V+++   KL  VL++YEERLSK+KYLAGDFFSL D+SHLP + ++ N  
Sbjct  120  PFIIGNNPDPKVIEESEAKLVNVLNIYEERLSKNKYLAGDFFSLVDISHLPFIDYIVNHM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +L+ +RK ++AW+ DIS RP+W KVL+L
Sbjct  180  RKDYLIKDRKYVSAWWDDISNRPSWTKVLEL  210



>emb|CDY29636.1| BnaA04g17910D [Brassica napus]
Length=215

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVPFETVPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  ++  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTFHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLSAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RPAW + L+
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETLE  209



>gb|KFK31252.1| hypothetical protein AALP_AA6G088400 [Arabis alpina]
Length=215

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 148/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE I +DL   EHK P +L  QPFG +PA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGVLPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+ +Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYIAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATSYHPPLLNLTLHVMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG P+D +++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPADQNLIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +L+ +RK ++AW+ DIS RPAW + L+
Sbjct  180  GKAYLIKDRKHVSAWWDDISNRPAWKETLE  209



>gb|AGC13155.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=219

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   ++C  RV+ACL E  V++ELI ++ ++ +HK P++L   PFG  PA+EDG  
Sbjct  4    IKVHGLPFSSCTARVLACLNEKQVEYELIPVNARAGDHKKPQYLSLNPFGLFPALEDGCL  63

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAII+Y A KY  +G  NL+G TVEE  VV+QW EVES+++N   Y +V Q+ + 
Sbjct  64   TLFESRAIIKYLAKKYEGQGCPNLLGSTVEEEAVVEQWCEVESHHFNPPCYALVSQIIIN  123

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D +VV+  AEKL +VLDVYE+RLSKSKYLAGD+FSLADL H+P L +L N+ G
Sbjct  124  PLKGGTTDEAVVESNAEKLSRVLDVYEDRLSKSKYLAGDWFSLADLQHMPFLHYLVNDVG  183

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
               L+S RK +NAW+ DI +RPAW K+
Sbjct  184  KATLISSRKHVNAWWEDICSRPAWKKI  210



>gb|ABY84871.1| glutathione S transferase 2 [Pteris vittata]
Length=217

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 145/217 (67%), Gaps = 1/217 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGV-DFELIHIDLQSFEHKTPEFLRRQPFGQVPAIED  264
            M + V G AT++C QRV+  LFE  V DF+L+H+DL +  HK PE+L  QPFG +P ++D
Sbjct  1    MTITVHGQATSSCTQRVLTTLFEKDVSDFQLLHVDLSTGAHKQPEYLALQPFGVIPVVQD  60

Query  265  GDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            GD  +FESRAIIRY A KY ++G  L G+T+EER  V+QWLEVES N++     +V Q+ 
Sbjct  61   GDLTIFESRAIIRYLALKYEDQGSPLYGRTLEERANVEQWLEVESQNFHVAASAIVNQLS  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
                 G P +  VVK   EKL  +LDVYE+RLS+S +LAGDFFSLADLSHLP  + L   
Sbjct  121  SRAKKGLPPEEGVVKTNMEKLEAILDVYEKRLSESSFLAGDFFSLADLSHLPRTKSLVKS  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLINNQK  735
                HL++ RK ++ W+  IS RP+W KV+++    K
Sbjct  181  CKLPHLITSRKHVHEWWQRISTRPSWIKVIEMAAPSK  217



>ref|XP_006295885.1| hypothetical protein CARUB_v10025015mg [Capsella rubella]
 gb|EOA28783.1| hypothetical protein CARUB_v10025015mg [Capsella rubella]
Length=215

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE I +DL   E K P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVAFETIPVDLMKGEQKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y   + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYYPPLLNLTLHVMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  V+K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKVIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS RPAW + L
Sbjct  180  GKAYMIKDRKHVSAWWDDISNRPAWKETL  208



>ref|XP_002532973.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF29410.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=172

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  283  ESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMG  462
            ESRAI RYYATKYA++G NL+G T+EER +VDQWLEVE++N+N+LVYN+VLQ+ +FP MG
Sbjct  24   ESRAIARYYATKYADRGANLLGTTLEERAIVDQWLEVEAHNFNELVYNLVLQLVIFPRMG  83

Query  463  QPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHL  642
            QP D+ +V  C +KL KV D+YE+RLSK+KYLAGD+F+LADLSHLP++R+L N+ G GHL
Sbjct  84   QPGDLKLVHNCEQKLEKVFDIYEKRLSKTKYLAGDYFTLADLSHLPAIRYLVNDAGLGHL  143

Query  643  VSERKCLNAWYSDISARPAWNKVLDL  720
            V++R+ +NAW+ DIS+RPAW K++ L
Sbjct  144  VTDREKVNAWWEDISSRPAWKKLMKL  169



>gb|ACB10397.1| glutathione S-transferase [Brassica juncea]
Length=201

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = +1

Query  121  ACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDFKLFESRAII  300
            A P+R +  L E GV FE I +DL   EHK P +L  QPFG VPA+ DGD+K+FESRA++
Sbjct  4    ASPKRALVTLIEKGVPFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVM  63

Query  301  RYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFPSMGQPSDMS  480
            RY A KY  +G +L+GKTVE+RG V+QWL+VE+  ++  + N+ L +     MG PSD  
Sbjct  64   RYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTFHPPLLNLTLHIMFASVMGFPSDEK  123

Query  481  VVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGFGHLVSERKC  660
            ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    G  +++ +RK 
Sbjct  124  LIKESEEKLSAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDRKH  183

Query  661  LNAWYSDISARPAWNKVL  714
            ++AW+ DIS+RPAW + L
Sbjct  184  VSAWWDDISSRPAWKETL  201



>ref|XP_009141109.1| PREDICTED: glutathione S-transferase F9 [Brassica rapa]
Length=215

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVPFETVPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+G TVE+RG V+QWL+VE+  ++  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGITVEDRGQVEQWLDVEATTFHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  L+KSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLSAVLDVYEAHLAKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RPAW + L+
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETLE  209



>emb|CAA72973.1| glutathione transferase [Arabidopsis thaliana]
Length=215

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 146/209 (70%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE I +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVY+ + +KSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASVMGFPSDEKLIKESEEKLAGVLDVYKAQRAKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS+RPAW + +
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETV  208



>ref|XP_006294907.1| hypothetical protein CARUB_v10023958mg, partial [Capsella rubella]
 gb|EOA27805.1| hypothetical protein CARUB_v10023958mg, partial [Capsella rubella]
Length=239

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+K++    A+  +R +  L E GV FE +H+DL   E + PE+L  QPFG++P + DG
Sbjct  25   MVLKIYAPLFASS-KRAVVTLIEKGVSFETVHVDLMKGEQRNPEYLAIQPFGKIPVLVDG  83

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  84   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  143

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L N+ 
Sbjct  144  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVNQI  203

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  +++ +RK ++AW+  IS+R AW +V
Sbjct  204  GKAYMIKDRKHVSAWWDKISSRAAWKEV  231



>ref|XP_010414209.1| PREDICTED: glutathione S-transferase F9 [Camelina sativa]
 ref|XP_010469788.1| PREDICTED: glutathione S-transferase F9 [Camelina sativa]
Length=215

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ V+G   A+ P+R +  L E GV FE + +DL   E K P +L  QPFG VPA+ DG
Sbjct  1    MVLTVYGPHFAS-PKRALVTLIEKGVAFETVPVDLLKGEQKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYKSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHVVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              +MG PSD  V+K    +L  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASAMGFPSDEKVIKDSEAQLSAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS+RPAW + L
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETL  208



>ref|XP_010510279.1| PREDICTED: glutathione S-transferase F9-like isoform X1 [Camelina 
sativa]
Length=215

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ V+G   A+ P+R +  L E GV FE + +DL   E K P +L  QPFG VPA+ DG
Sbjct  1    MVLTVYGPHFAS-PKRALVTLIEKGVAFETVPVDLLKGEQKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  Y+  + N+ L +  
Sbjct  60   DYKIFESRAVMRYVAEKYKSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHVVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
              +MG PSD  V+K    +L  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  120  ASAMGFPSDEKVIKDSEAQLSAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVL  714
            G  +++ +RK ++AW+ DIS+RPAW + L
Sbjct  180  GKAYMIKDRKHVSAWWDDISSRPAWKETL  208



>gb|AHA46525.1| phi class glutathione S-transferase [Larix kaempferi]
Length=216

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 144/207 (70%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            V+KV G   +     V+ CL E  +++EL+ +D  +  HKTPE+L   P G +P I+DGD
Sbjct  3    VIKVHGHHGSTATVMVLCCLNEKNLEYELVFVDFFAGAHKTPEYLALNPLGLIPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAII+Y A +Y  +G +L+G+TV E+ +V+QW +VE+ ++N  V+ ++ Q+ + 
Sbjct  63   LTLFESRAIIKYLAKQYEGQGTDLLGRTVSEQALVEQWSQVEAQSFNSPVFFIIEQVLIA  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P +G  +D + V+   EK+GK+LD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G
Sbjct  123  PIVGGSTDEAAVEIRVEKVGKLLDIYEERLSKSKYLAGDFFSLADLQHLPYTNYLINGCG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L+S RK + AW+ DIS+RPAW KV
Sbjct  183  KGDLISSRKHVKAWWEDISSRPAWKKV  209



>gb|KFK31251.1| hypothetical protein AALP_AA6G088300 [Arabis alpina]
Length=215

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +H+DL   E + PE+L  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRGVVTLVEKGVPFETVHVDLMKGEQRQPEYLAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNVVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKL +VLDVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  HL+ +RK ++AW+  IS+RPAW +V
Sbjct  180  GKAHLIKDRKHVSAWWDKISSRPAWKEV  207



>gb|ABK23015.1| unknown [Picea sitchensis]
Length=216

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 137/206 (67%), Gaps = 0/206 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASTATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G +L+G T+ E  +V QW EVE  ++N    ++V Q+ V P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTDLLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQILVVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAWNKV  711
            G L+S RK +NAW+ DIS+RP W KV
Sbjct  184  GDLISSRKHVNAWWEDISSRPTWKKV  209



>gb|AHA46522.1| phi class glutathione S-transferase [Larix kaempferi]
Length=215

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 142/212 (67%), Gaps = 0/212 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            ++K+ G   +     V+ CL E  VD+EL+ IDL +   K P++L   PFG VP I+DGD
Sbjct  3    LIKLHGHYFSTATTVVLCCLNEKQVDYELVVIDLLTGAQKQPQYLALNPFGVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              L+ESRAI+RY A K+  +G +L+G T+ E+ VVDQW EVE +++N      V Q+ + 
Sbjct  63   LTLYESRAILRYLARKFKGQGTDLLGSTLSEQAVVDQWCEVEGHSFNTPASVTVYQLLIV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P +G  +D + V+   EKL KVLD+YEERLSK+KYLAGDFFSLADL HLP   +L N  G
Sbjct  123  PMIGGSTDQAAVEMNVEKLKKVLDIYEERLSKNKYLAGDFFSLADLQHLPRTHYLVNLCG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
             G L+S RK + AW+ DIS+RPAW KV + I+
Sbjct  183  KGDLISSRKHVKAWWDDISSRPAWKKVAEKIS  214



>gb|AGC13151.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=216

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 137/206 (67%), Gaps = 0/206 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V+++ + IDL +  HK P++L   PFG VP I+DGD 
Sbjct  4    IKVHGFHASTATNMVLCCLNEKQVEYDFVLIDLLTGAHKKPQYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             LFESRAI+RY A K+  +G +L+G T+ E  +V QW EVE  ++N  V  +V Q+ V P
Sbjct  64   TLFESRAILRYLAQKFKGQGTDLLGSTLSEEALVYQWCEVEGQSFNPPVSTIVSQILVVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKLGKVLD+YEERLSKSKYLAGDFFSLADL HLP   +L +  G 
Sbjct  124  RRGGSTDEAAVEMNIEKLGKVLDIYEERLSKSKYLAGDFFSLADLQHLPHTHYLVSACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAWNKV  711
            G L+S RK +NAW+ DIS+RP W KV
Sbjct  184  GDLISSRKHVNAWWEDISSRPTWQKV  209



>ref|XP_006410185.1| hypothetical protein EUTSA_v10017227mg [Eutrema salsugineum]
 dbj|BAJ34506.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51638.1| hypothetical protein EUTSA_v10017227mg [Eutrema salsugineum]
Length=215

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 147/208 (71%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ V+    A+  +R +  L E GVDFE +++DL   E + PE++  QPFG++P + DG
Sbjct  1    MVLTVYAPLYAST-KRALVTLVEKGVDFETVNVDLLKGEQRQPEYVAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYVAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIIF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+V DVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLGEVFDVYEAQLSKTEYLAGDFVSLADLAHLPFTSYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  +++ +RK ++AW+  IS+RPAW +V
Sbjct  180  GKAYMIKDRKHVSAWWDKISSRPAWKEV  207



>gb|AGC13154.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=214

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 135/207 (65%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             +KV G   +   + V+ CL E  VD+EL+ +DL +  HK P++L   PFG VP I+DGD
Sbjct  3    TIKVHGHHLSTATRLVLCCLEEKQVDYELVVVDLAAGAHKKPQYLALSPFGVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAI++Y A KY  +G  L G ++ E  +V+QW EVE  +YN     ++ Q+   
Sbjct  63   LTLFESRAIVKYLAKKYKGQGTELFGNSLSEEALVEQWCEVEGQSYNSPASAILFQILFV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D +VV+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP+  +L    G
Sbjct  123  PMRGGTTDEAVVEMNVEKLVKVLDIYEERLSKSKYLAGDFFSLADLQHLPTTHYLVTACG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L+S RK + AW+ DIS RPAW KV
Sbjct  183  KGDLISSRKHVKAWWEDISCRPAWKKV  209



>gb|AGC13153.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=214

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             +KV G   +   + V+ CL E  VD+EL+ +D  +  HK P++L   PFG VP I+DGD
Sbjct  3    TIKVLGYPLSTATRLVLCCLEEKQVDYELVVVDAAAGAHKQPQYLALNPFGLVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAI++Y A KY  +G  L G ++ E  +V+QW EVE  +YN     ++ Q+   
Sbjct  63   LTLFESRAIVKYLAKKYKGQGTELFGNSLSEEALVEQWCEVEGQSYNSPALTILSQILFV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D ++V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP+  +L  + G
Sbjct  123  PKKGGTTDEALVEMNVEKLVKVLDIYEERLSKSKYLAGDFFSLADLQHLPTTHYLVTDCG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L+S RK + AW+ DIS+RPAW KV
Sbjct  183  KGDLISSRKHVKAWWEDISSRPAWKKV  209



>ref|XP_002879283.1| early dehydration-induced 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55542.1| early dehydration-induced 13 [Arabidopsis lyrata subsp. lyrata]
Length=215

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +++DL   E + PE+L  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVSFETVNVDLMKGEQRKPEYLAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  HL+ +RK ++AW+  IS+R AW +V
Sbjct  180  GKAHLIKDRKHVSAWWDKISSRAAWKEV  207



>gb|AHA46526.1| phi class glutathione S-transferase [Larix kaempferi]
Length=220

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 143/211 (68%), Gaps = 1/211 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             VK++G   +    R +A L E  V+++L+ +DL++ EHK P+FL  QPFGQVP ++DG 
Sbjct  3    AVKLYGPLASTATSRALASLLEKQVEYQLVPVDLKNGEHKKPQFLAMQPFGQVPVLQDGA  62

Query  271  FKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              LFESRAI+RY A KYA +G   L+GK++ ER V++QW+EVES  YN     +V Q+  
Sbjct  63   LTLFESRAIVRYIADKYAAQGTIGLLGKSLAERAVIEQWMEVESQTYNPPSSVLVFQLAF  122

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P + + ++K AEKL K LDVYE+RLS+SKYLAGD FS+ADLSHLP+  +L    
Sbjct  123  APLWGIPQNQAEIEKNAEKLSKALDVYEKRLSESKYLAGDEFSIADLSHLPNTEYLVKAT  182

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G   L++ RK +NA + DIS R +W K+ ++
Sbjct  183  GKSELITSRKYVNARWEDISTRDSWKKIREM  213



>gb|ACL37469.1| phi class glutathione transferase [Cathaya argyrophylla]
 gb|ACL37470.1| phi class glutathione transferase [Cathaya argyrophylla]
Length=218

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 137/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             + ++G   ++  + V++CL E  +D+E++ +DL +   K P++L   PFG +P I+DGD
Sbjct  3    TITLYGHNLSSPTKMVLSCLEEKQLDYEIVIVDLSAGAQKEPQYLALNPFGLIPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRA+IRY A KY  +G  L+GKTV E+ VVDQW EVE  ++N     +V Q    
Sbjct  63   LTLFESRAMIRYLAKKYKGQGTELLGKTVLEQAVVDQWCEVEGQSFNSPASTIVAQTIFV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLPS   L N  G
Sbjct  123  PMRGGTTDEAAVEVNVEKLKKVLDIYEERLSKSKYLAGDFFSLADLQHLPSTDNLVNTCG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L+  RK + AW+ DIS+RPAW KV
Sbjct  183  KGDLILSRKHVKAWWEDISSRPAWKKV  209



>gb|KDO40902.1| hypothetical protein CISIN_1g027956mg [Citrus sinensis]
Length=170

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 126/163 (77%), Gaps = 0/163 (0%)
 Frame = +1

Query  232  QPFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYN  411
            QPFG++P I+DGDF L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE++NYN
Sbjct  2    QPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYN  61

Query  412  DLVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLS  591
              +Y + +Q+      G+P D  +VK+  EKLGK LDVYEERLSKSKYLAGDFFSLADLS
Sbjct  62   PAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADLS  121

Query  592  HLPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            H+P   +L    G  H++ +RK ++AW+ DIS RP+W KVL+L
Sbjct  122  HIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKVLEL  164



>ref|NP_001236500.1| glutathione S-transferase GST 24 [Glycine max]
 gb|AAG34814.1|AF243379_1 glutathione S-transferase GST 24 [Glycine max]
 gb|KHN11988.1| Glutathione S-transferase F9 [Glycine soja]
 gb|AJE59622.1| phi class glutathione S-transferase [Glycine max]
Length=215

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G   A+  +RV+ CL E  V+FE++ +D+   E K PE+L+ QPFG VP I+DG
Sbjct  1    MAVKVYGPHCAST-KRVLVCLVEKEVEFEVVPVDVTKGEQKDPEYLKLQPFGVVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++   YN+ L    
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEERGLVEQWLEVEAHNFHPQAYNLCLHGLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D  V+++   KL +VL++YEERLSK+KYLAGDFFS+AD+SHLP L ++ N  
Sbjct  120  GSLFGVTPDPKVIEESEAKLVQVLNIYEERLSKTKYLAGDFFSIADISHLPFLDYVVNNM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ ERK + AW+ DIS+RP+WNKVL L
Sbjct  180  GKKYLLEERKHVGAWWDDISSRPSWNKVLQL  210



>gb|ADM74484.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASTLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++  Q+ + P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSICTQILIVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>ref|XP_001764210.1| predicted protein [Physcomitrella patens]
 gb|EDQ71051.1| predicted protein [Physcomitrella patens]
 gb|AFZ39127.1| phi class glutathione S-transferase [Physcomitrella patens]
Length=219

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 144/213 (68%), Gaps = 3/213 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGV-DFELIHIDLQSFEHKTPEFLRRQPFGQVPAIED  264
            M + V G+  + C QR +  L EL V D++L  +D+    HK+PEFL++QPFGQ+P +ED
Sbjct  1    MAIIVHGAGFSTCTQRTLTTLAELNVNDYKLEFVDMMKGVHKSPEFLKKQPFGQIPVLED  60

Query  265  GDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            GD ++FESRAIIRY A K+  +G  L+GKTV+++ +V QWLEVES NYN     +V Q  
Sbjct  61   GDIQIFESRAIIRYLAEKFEGQGTPLLGKTVKDKALVSQWLEVESQNYNPPTAQIVYQR-  119

Query  445  VFPSM-GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
            VF SM G   +  VV +   KL KVLDVYE  LS +KYLAGDFFSLADLSHLP    L N
Sbjct  120  VFSSMFGSSCNEDVVTEQVAKLEKVLDVYEAHLSNNKYLAGDFFSLADLSHLPYTYLLVN  179

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
              G   L++ R  ++AW++DIS+RP + KVL +
Sbjct  180  AAGKSDLITSRPHVSAWWNDISSRPTFQKVLGM  212



>ref|NP_180644.1| glutathione S-transferase PHI 10 [Arabidopsis thaliana]
 sp|P42761.3|GSTFA_ARATH RecName: Full=Glutathione S-transferase F10; Short=AtGSTF10; 
AltName: Full=AtGSTF4; AltName: Full=GST class-phi member 10; 
AltName: Full=Protein EARLY RESPONSE TO DEHYDRATION 13 [Arabidopsis 
thaliana]
 dbj|BAA04554.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC20721.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAM91601.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAN15396.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AEC08450.1| glutathione S-transferase PHI 10 [Arabidopsis thaliana]
Length=215

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV FE +++DL   E + PE+L  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKL +VLDVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  HL+ +RK ++AW+  IS+R AW +V
Sbjct  180  GKAHLIKDRKHVSAWWDKISSRAAWKEV  207



>gb|ABK21297.1| unknown [Picea sitchensis]
 gb|ABK26176.1| unknown [Picea sitchensis]
Length=220

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 141/211 (67%), Gaps = 1/211 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             VK++G   +    R +ACL E  V+++LI +DL+  E K P+FL  QPFGQVP ++DG 
Sbjct  3    AVKLYGPLASTATSRALACLLEKQVEYQLIPVDLKKGEQKKPQFLAMQPFGQVPVLQDGA  62

Query  271  FKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              LFESRAI+RY A KYA +G   L+GK++ ER V++QW+EVES  YN     +V Q+  
Sbjct  63   LTLFESRAIVRYIAEKYAAQGTIGLLGKSLAERAVIEQWMEVESQTYNPPSSFLVFQLAF  122

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P  G P + + + K  +K  KVLDVYE+RLS+SKYL GD FS+ADLSHLP+  ++    
Sbjct  123  APLWGIPQNQAEIVKNEKKFSKVLDVYEKRLSESKYLGGDEFSIADLSHLPNTEYIVKAT  182

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G   L++ RK +NAW+ DIS+R +W K+ ++
Sbjct  183  GKSELITSRKYVNAWWEDISSRDSWKKIREM  213



>ref|XP_010259661.1| PREDICTED: glutathione S-transferase F13 [Nelumbo nucifera]
Length=214

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 142/209 (68%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VK++G A + C  RVM CL E GVDFE++ I+L + EHK P F+ + PFGQ+PA+EDG
Sbjct  1    MAVKLYGIAMSTCTTRVMTCLHEKGVDFEIVPINLSAGEHKQPSFISKNPFGQIPALEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMG-KTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI +Y ATK+ +KG +L+    ++E  +V+ WLEVE+  +N  +  +V Q  
Sbjct  61   DLTLFESRAITKYLATKHKDKGTDLLRLDNLKEAALVNVWLEVEAQQFNPPISALVYQRM  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
              P  G   D  V++  AEKLGKVLDVYEERLSKSKYLAGDF+SLADL HL S  +   +
Sbjct  121  FSPLFGGTPDEKVIEANAEKLGKVLDVYEERLSKSKYLAGDFYSLADLHHL-SYTYYLMK  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
                +L++ R  + AW+ DIS+RPA+ K 
Sbjct  180  NPEANLINSRPHVKAWWEDISSRPAFRKA  208



>gb|ADM74477.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 134/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++V Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSIVSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>ref|XP_009351388.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=168

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  232  QPFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYN  411
            QPFG VP I+DGD+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N+ 
Sbjct  2    QPFGTVPLIQDGDYTLYESRAIMRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAHNFQ  61

Query  412  DLVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLS  591
              +YN+V+ +   P +G PSD  ++++  EKLGKVLD+YEE+LSKSKYLAGDFFSLADLS
Sbjct  62   PPIYNLVVHILFAPVLGFPSDPKILQEREEKLGKVLDIYEEQLSKSKYLAGDFFSLADLS  121

Query  592  HLPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVL  714
            HLPS  FL    G  +++ +RK ++AW+ DIS RP+W +VL
Sbjct  122  HLPSTHFLVANMGKEYMIRDRKHVSAWWDDISNRPSWKRVL  162



>gb|ACU13420.1| unknown [Glycine max]
Length=215

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G   A+  +RV+ CL E  V+FE++ +D+   E K PE+L+ QPFG VP I+DG
Sbjct  1    MAVKVYGPHCAST-KRVLVCLVEKEVEFEVVPVDVTKGEQKDPEYLKLQPFGVVPVIKDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+ L+ESRAI+RYYA KY  +G  L+GKT+EERG+V+QWLEVE++N++   YN+ L    
Sbjct  60   DYTLYESRAIMRYYAEKYRSQGVELLGKTIEERGLVEQWLEVEAHNFHPQAYNLCLHGLF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G   D  V+++   KL +VL++YEERLSK+KYLAGDF S+AD+SHLP L ++ N  
Sbjct  120  GSLFGVTPDPKVIEESEAKLVQVLNIYEERLSKTKYLAGDFSSIADISHLPFLDYVVNNM  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G  +L+ ERK + AW+ DIS+RP+WNKVL L
Sbjct  180  GKKYLLEERKHVGAWWDDISSRPSWNKVLQL  210



>emb|CDY23979.1| BnaC03g17120D [Brassica napus]
Length=215

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 147/208 (71%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV+FE +++DL   E + PE++  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVY+ +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYDAQLSKNEYLAGDFVSLADLAHLPFTEYLVGAI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G G+++ +RK ++AW+  IS R AW +V
Sbjct  180  GKGYMIKDRKHVSAWWDKISNRAAWKEV  207



>gb|ADM74495.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74496.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASTLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++  Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSICTQILNVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|ADM74486.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASTLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++V Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|ACN40286.1| unknown [Picea sitchensis]
 gb|ADM74475.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74476.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74478.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74479.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74480.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74488.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74489.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74490.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74491.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74492.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74499.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74500.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74501.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74502.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74503.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74504.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74505.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74506.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74507.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74508.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74509.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74510.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74511.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74512.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74513.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74514.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74515.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74516.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74518.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74519.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74520.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++V Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|ADM74498.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 134/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++  Q+ + P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSICTQILIVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L +  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVSACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|AHA46523.1| phi class glutathione S-transferase [Larix kaempferi]
Length=214

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            ++KV G   +     V+ CL E  + +EL+ +DL S   K P++L   PFG VP I+DGD
Sbjct  3    MIKVHGHPFSTATALVLCCLEEKQLQYELVLVDLSSGAQKKPQYLALNPFGVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAII+Y A KY  +G +L+G T+ E+ +VDQW EVE+ ++    +N+++Q    
Sbjct  63   LTLFESRAIIKYLAKKYQAQGTDLLGNTLSEQALVDQWCEVEAQSFFPPAWNILVQTAKV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D ++VKK  EKL K+LD+YEERLSK KYLAGDFFSLADL HLP   +L   GG
Sbjct  123  PMQGGITDEAIVKKDMEKLEKLLDIYEERLSKCKYLAGDFFSLADLQHLPCAEYLVKSGG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L   RK +NAW+ DIS+RP W K 
Sbjct  183  KGDLFFSRKHVNAWWEDISSRPTWKKA  209



>emb|CDX84815.1| BnaA03g14150D [Brassica napus]
Length=215

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV+FE +++DL   E + PE++   PFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIHPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGAI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G G+++ +RK ++AW+  IS R AW +V
Sbjct  180  GKGYMIKDRKHVSAWWDKISNRAAWKEV  207



>ref|XP_009132757.1| PREDICTED: glutathione S-transferase F10 [Brassica rapa]
Length=215

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+ ++    A+  +R +  L E GV+FE +++DL   E + PE++  QPFG++P + DG
Sbjct  1    MVLTIYAPLFASS-KRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIQPFGKIPVLVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+FESRAI+RY A KY  +G +L+GKT+EERG V+QWL+VE+ +Y+  +  + L +  
Sbjct  60   DYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF  119

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  V+K+  EKLG+VLDVYE +LSK++YLAGDF SLADL+HLP   +L    
Sbjct  120  APLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGAI  179

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKV  711
            G  +++ +RK ++AW+  IS R AW +V
Sbjct  180  GKAYMIKDRKHVSAWWDKISNRAAWKEV  207



>gb|ADM74493.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74494.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++V Q+   P
Sbjct  64   TLYESRAIIRYLAKKFRGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|ADM74481.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++  Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSICTQILNVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|AHA46527.1| phi class glutathione S-transferase [Larix kaempferi]
Length=215

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
            V+KV G   +     V  CL E  V++E + +DL +  HK P++L   PFG VP I+DGD
Sbjct  3    VIKVHGHHFSTATAMVFCCLNEKQVEYEFVVVDLPTGAHKKPQYLALNPFGVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESRAI+RY A KYA +G +L+G T+ E+ +VDQW EV+S ++      ++ Q  + 
Sbjct  63   LILFESRAIVRYLAKKYAGQGTDLLGSTLAEQALVDQWCEVQSQSFFSPAAAILFQTVLL  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D + V    EKL KVLD+YEERLSKSKYLAGDFFSLADL+HLP  ++L     
Sbjct  123  PIRGGTTDEAAVAINIEKLNKVLDIYEERLSKSKYLAGDFFSLADLTHLPWTQYLVTACK  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
             G L+S RK + AW+ DIS+RPAW KV
Sbjct  183  KGDLISSRKHVKAWWDDISSRPAWKKV  209



>gb|ADM74485.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N   +++  Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPAFSICSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|AAY86780.1| putative glutathione S-transferase [Noccaea caerulescens]
Length=214

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 142/210 (68%), Gaps = 2/210 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VP + DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVPFETVPVDLLKGEHKQPAYLALQPFGTVPTVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K   SR    Y A KY  +G  L+GKTVEERG V+QWL+VE+ +++  ++N+ L +  
Sbjct  60   DYK-SSSRVRDEYVAEKYRSQGPELLGKTVEERGQVEQWLDVEATSFHPPLFNLTLHVMF  118

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P MG P+D  ++K+  EKL  VLDVYE  L+KSKYLAGDF SLADL+HLP   +L    
Sbjct  119  SPVMGFPADQKLIKESEEKLAAVLDVYEAHLAKSKYLAGDFVSLADLAHLPFTDYLVGPI  178

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +L+ +RK ++AW+ DIS+RPAW +VL+
Sbjct  179  GKPYLIKDRKHVSAWWDDISSRPAWKEVLE  208



>gb|ADM74482.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74483.1| glutathione S-transferase-like protein [Picea sitchensis]
 gb|ADM74497.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 132/203 (65%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASTLTVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++  Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIFSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>gb|ADE76351.1| unknown [Picea sitchensis]
Length=214

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV+G   +   + V+ CL E  V+++ + ++L +  HK P++L   PFG +P I+DGD 
Sbjct  4    IKVYGHPISTATRLVLCCLHEKKVEYDFVLVELSAGAHKQPQYLALNPFGVLPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             LFESRAI +Y A KY  +G  L+G ++ E+ +V+QW +VE  ++N     ++ Q+ + P
Sbjct  64   TLFESRAIAKYLAKKYEGQGTELLGNSLSEQALVEQWSQVEGQSFNSPASAILFQILIVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP L +L  + G 
Sbjct  124  MSGGSTDEAAVEMNVEKLKKVLDIYEERLSKSKYLAGDFFSLADLQHLPYLDYLVTDCGK  183

Query  634  GHLVSERKCLNAWYSDISARPAWNK  708
            G L+S RK + AW+ DIS+RPAW K
Sbjct  184  GDLISSRKHVKAWWEDISSRPAWKK  208



>gb|ACB59223.1| glutathione S-transferase [Brassica oleracea]
Length=523

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 2/210 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+KV+G   A+ P+R +  L E GV FE + +DL   EHK P +L  QPFG VPA+ DG
Sbjct  1    MVLKVYGPHFAS-PKRALVTLIEKGVPFETVPVDLMKGEHKQPAYLALQPFGTVPAVVDG  59

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D+K+F SRA++RY A KY  +G +L+GKTVE+RG V+QWL+VE+  ++  + N+ L +  
Sbjct  60   DYKIF-SRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTFHPPLLNLTLHIMF  118

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
               MG PSD  ++K+  EKL  VLDVYE  LSKSKYLAGDF SLADL+HLP   +L    
Sbjct  119  ASVMGFPSDEKLIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPI  178

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLD  717
            G  +++ +RK ++AW+ DIS+RPAW + L+
Sbjct  179  GKAYMIKDRKHVSAWWDDISSRPAWKETLE  208



>gb|ADM74487.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 132/203 (65%), Gaps = 0/203 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   P G VP I+DGD 
Sbjct  4    IKVHGYHASMATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPCGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++V Q+   P
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQIVFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G 
Sbjct  124  MRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACGK  183

Query  634  GHLVSERKCLNAWYSDISARPAW  702
            G L+S RK +NAW+ DIS+RP W
Sbjct  184  GDLISSRKHVNAWWEDISSRPTW  206



>ref|XP_010269471.1| PREDICTED: glutathione S-transferase F13-like [Nelumbo nucifera]
Length=218

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 138/207 (67%), Gaps = 2/207 (1%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VK+ G   + C  RV+ACL E G+DFEL+ ++L + EHK P FL + PFGQ+PA++DGD 
Sbjct  4    VKLLGLPMSTCTARVLACLHEKGIDFELVPVNLPAGEHKQPPFLSKNPFGQIPALDDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMG-KTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAI +Y ATK  + G +L+     +E   V+ WLEVE++ Y+  +  +V Q  V 
Sbjct  64   TLFESRAITKYLATKRNDVGPDLLRLGDAKEAAFVNVWLEVEAHQYSPPISALVYQRVVL  123

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G   D  V++  AEKLGK+LDVYEERLSKSKYLAGDF+SLADL HLP   +LT    
Sbjct  124  PVFGGTPDEKVIEANAEKLGKILDVYEERLSKSKYLAGDFYSLADLHHLPYTYYLTKTPE  183

Query  631  FGHLVSERKCLNAWYSDISARPAWNKV  711
               L+  R  + AW+ DIS+RPA+ KV
Sbjct  184  -AKLIYSRPHVKAWWEDISSRPAFKKV  209



>gb|ADM74517.1| glutathione S-transferase-like protein [Picea sitchensis]
Length=211

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV G   +     V+ CL E  V++EL+ +DL +  HK PE+L   PFG VP I+DGD 
Sbjct  4    IKVHGYHASMATVMVLCCLNEKEVEYELVLVDLPTGAHKKPEYLALNPFGVVPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             L+ESRAIIRY A K+  +G N +G T+ E  +V QW EVE  ++N    ++V Q+ VF 
Sbjct  64   TLYESRAIIRYLAKKFQGQGTNFLGSTLSEEALVYQWCEVEGQSFNPPALSIVSQI-VFV  122

Query  454  SM-GQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            SM G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP   +L N  G
Sbjct  123  SMRGGSTDEAAVEMNVEKLEKVLDIYEERLSKSKYLAGDFFSLADLQHLPCTHYLVNACG  182

Query  631  FGHLVSERKCLNAWYSDISARPAW  702
             G L+S RK +NAW+ DIS+RP W
Sbjct  183  KGDLISSRKHVNAWWEDISSRPTW  206



>gb|ADE76600.1| unknown [Picea sitchensis]
Length=214

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 136/206 (66%), Gaps = 0/206 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            +KV+G   +   + V+ CL E  V+++ + ++L +  HK P++L   PFG +P I+DGD 
Sbjct  4    IKVYGHPISTATRLVLCCLHEKKVEYDFVLVELSAGAHKQPQYLALNPFGVLPTIQDGDL  63

Query  274  KLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVFP  453
             LFESRAI +Y A KY  +G  L+G ++ E+ +V+QW +VE  ++N     ++ Q+   P
Sbjct  64   TLFESRAIAKYLAKKYEGQGTELLGNSLSEQALVEQWSQVEGQSFNSPASTILFQILFVP  123

Query  454  SMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGGF  633
              G  +D + V+   EKL KVLD+YEERLSKSKYLAGDFFSLADL HLP L +L  + G 
Sbjct  124  MSGGSTDEAAVEMNVEKLKKVLDIYEERLSKSKYLAGDFFSLADLQHLPYLDYLVTDCGK  183

Query  634  GHLVSERKCLNAWYSDISARPAWNKV  711
            G L+S RK + AW+ DIS+RPAW K 
Sbjct  184  GDLISSRKHVKAWWEDISSRPAWKKA  209



>gb|AGC13149.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=220

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 138/211 (65%), Gaps = 1/211 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             VK++G   +    R +ACL E  V+++LI +DL+  E K P FL  QPFGQVP ++DG 
Sbjct  3    AVKLYGPLASTATSRALACLLEKQVEYQLIPVDLKKREQKKPGFLAMQPFGQVPVLQDGA  62

Query  271  FKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              LFESRAI+RY A KYA +G   L+GK++ ER V++QW+EVES  YN     +V Q+  
Sbjct  63   LTLFESRAIVRYMAEKYAAQGTIGLLGKSLAERAVIEQWMEVESQTYNPPSSFLVFQLAF  122

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
                G P + + + K  +K    LDVYE+RLS+SKYLAGD FS+ADLSHLP+  ++    
Sbjct  123  AQLWGIPQNQTEIAKNEKKFSNALDVYEKRLSESKYLAGDEFSIADLSHLPNTEYIVKAT  182

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            G   L++ RK +NAW+ +IS+R +W K+ ++
Sbjct  183  GKAELITSRKYVNAWWENISSRDSWKKIREM  213



>ref|XP_008362360.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like 
[Malus domestica]
Length=244

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +1

Query  235  PFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYND  414
            PFG VP I+DGD+ L+ESRAI+RYYA KY  +G +L+GKT+EERG+V+QWLEVE++N+  
Sbjct  79   PFGTVPLIQDGDYTLYESRAIMRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAHNFQP  138

Query  415  LVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSH  594
             +YN+V+ +   P +G PSD  ++++  EKLGKVLD+YEE+LSKSKYLAGDFFSLAD+SH
Sbjct  139  PIYNLVVHILFAPVLGFPSDPKILQESEEKLGKVLDIYEEQLSKSKYLAGDFFSLADISH  198

Query  595  LPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVL  714
            LP   FL    G  +++ +RK ++AW+ DIS RP+W +VL
Sbjct  199  LPFTHFLVANMGKEYMIKDRKHVSAWWDDISNRPSWKRVL  238



>ref|XP_010904820.1| PREDICTED: probable glutathione S-transferase GSTF1 [Elaeis guineensis]
Length=216

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 133/209 (64%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G   + C  RV++ L E+G ++E++ ID ++ EHK P  L R PFGQVPA EDG
Sbjct  1    MGVKVYGPPMSTCTARVISTLEEMGAEYEVVPIDFEAGEHKQPPHLARNPFGQVPAFEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGK-TVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI RY A KY   G +L+ +  ++E  +VD WLEVES  YN  +  +V Q  
Sbjct  61   DLMLFESRAIARYVARKYKSSGPDLLREGNLQESAMVDLWLEVESQQYNPAIAPIVYQCL  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G  +D  ++    EKLGKVLDVYE+ LSK+KYLAGDFFSLADLSHLP   +    
Sbjct  121  VIPMRGGVADQKLIDANVEKLGKVLDVYEDHLSKTKYLAGDFFSLADLSHLPYTHYFMAT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
              +  L   R  + AW+ D+S+RPA  K 
Sbjct  181  -PYASLFESRPHVQAWWQDLSSRPAVRKT  208



>ref|XP_006484926.1| PREDICTED: glutathione S-transferase F9-like [Citrus sinensis]
Length=209

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = +1

Query  223  LRRQPFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVES  399
            L+ QPFG +P I+DGDF L+ESRAIIRYYA KY  +G  +L+G+TVEERG+V+QWLEVE+
Sbjct  42   LKLQPFGSLPVIQDGDFTLYESRAIIRYYAEKYKSQGTTDLLGRTVEERGLVEQWLEVEA  101

Query  400  NNYNDLVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSL  579
            +N++  +Y M  Q+  F   G P+D +++K+  EKLGKVLDVYEERLSKSKYLAGDFFSL
Sbjct  102  HNFHPPIYQMTTQILFFAKRGLPADENLIKESEEKLGKVLDVYEERLSKSKYLAGDFFSL  161

Query  580  ADLSHLPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            ADLSHLP  ++L       +++ +RK ++AW+ DIS R +W KVL+L
Sbjct  162  ADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRLSWKKVLEL  208



>ref|XP_009384404.1| PREDICTED: glutathione S-transferase 3-like [Musa acuminata subsp. 
malaccensis]
Length=215

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 138/209 (66%), Gaps = 3/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G   +    RV+A L E GV+FEL+ +DL++  HK P+FL   PFGQ+PA+EDG
Sbjct  1    MGVKVYGMPMSTNTVRVLAALNEKGVEFELVIVDLRTGAHKKPDFLALNPFGQIPALEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM--GKTVEERGVVDQWLEVESNNYNDLVYNMVLQM  441
            D  LFESRAI RY ATKYAE G +L+    T  ER VVD WLEVES  +   +  +V + 
Sbjct  61   DVVLFESRAINRYIATKYAEAGPDLLLSSGTPAERAVVDLWLEVESQQFGPPIAALVYEA  120

Query  442  FVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
             + P +G  +D++VV+  A KL KVLDVYE RL++SKYLAG  F+L DL+H+P   +L  
Sbjct  121  LIKPMLGGATDVTVVEAQATKLEKVLDVYEARLAQSKYLAGAEFTLVDLNHIPYTNYLMK  180

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNK  708
                  LV+ R  L AW+ D+S+RPAW K
Sbjct  181  TPK-ASLVTSRPHLLAWWQDVSSRPAWQK  208



>gb|AGC13152.1| phi class glutathione S-transferase [Pinus tabuliformis]
Length=214

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 133/209 (64%), Gaps = 0/209 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             +KV G + +   + V+ CL E  VD+EL+ +D  + +H  P +L   PF  VP I+DGD
Sbjct  3    TIKVLGYSGSITTRTVLCCLKEKRVDYELVVVDPAAGDHLQPRYLALNPFAVVPTIQDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
              LFESR I++Y A KY  +G  L G ++ E  +V+QW EVE  +YN     ++ Q+   
Sbjct  63   LTLFESRGILKYLAKKYKGQGTELYGNSLSEEALVEQWCEVEGQSYNSPALAILSQIVFV  122

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P  G  +D +VV+   EK+GK+LD+YEERLSKSKYLAGDFFSLADL HL +  +L    G
Sbjct  123  PKKGGTTDEAVVELNVEKVGKLLDIYEERLSKSKYLAGDFFSLADLQHLATTHYLVTVCG  182

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLD  717
             G L+S RK + AW+ DIS+RP W KV +
Sbjct  183  KGDLISSRKHVKAWWKDISSRPTWKKVTE  211



>ref|XP_008795905.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like 
[Phoenix dactylifera]
Length=204

 Score =   203 bits (516),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 139/211 (66%), Gaps = 18/211 (9%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MVVKVFG    A P+RV+ACL E  V+F+++ +DL   E K+PEFL+ QPFG VP ++DG
Sbjct  1    MVVKVFGLPNIARPRRVLACLKEKMVEFQIVPVDLSKGEQKSPEFLKLQPFGVVPTVKDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
            D  LFESRAI+RYYA KYA++G +L+  ++EE+ +V+ WLEVE  N++   Y +V+Q  +
Sbjct  61   DLTLFESRAIMRYYAQKYAKQGTDLLWNSLEEKALVELWLEVEGQNFHPPTYTLVIQAVL  120

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            FP +G P +     K  E+L             SK+ AGDFFSLADLSHLP  + L   G
Sbjct  121  FPKLGIPQE----HKAMERL-------------SKFFAGDFFSLADLSHLPFTQLLXQVG  163

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
               +++  RK +NAW+ DIS RPAW +VL +
Sbjct  164  K-ANMIKNRKQVNAWWEDISNRPAWKEVLQM  193



>gb|KDO51859.1| hypothetical protein CISIN_1g031084mg [Citrus sinensis]
Length=166

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +1

Query  235  PFGQVPAIEDGDFKLFESRAIIRYYATKYAEKGK-NLMGKTVEERGVVDQWLEVESNNYN  411
            PFG +P I+DGDF L+ESRAIIRYYA KY  +G  +L+G+TVEERG+V+QWLEVE++N++
Sbjct  3    PFGSLPVIQDGDFTLYESRAIIRYYAEKYKSQGTTDLLGRTVEERGLVEQWLEVEAHNFH  62

Query  412  DLVYNMVLQMFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLS  591
              +Y M  Q+  F   G P+D +++K+  EKLGKVLDVYEERLSKSKYLAGDFFSLADLS
Sbjct  63   PPIYQMTTQILFFAKRGLPADENLIKESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLS  122

Query  592  HLPSLRFLTNEGGFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
            HLP  ++L       +++ +RK ++AW+ DIS R +W KVL+L
Sbjct  123  HLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRLSWKKVLEL  165



>emb|CAN69111.1| hypothetical protein VITISV_031837 [Vitis vinifera]
 emb|CBI18904.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 139/210 (66%), Gaps = 1/210 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VKV+G   +    RV+ACL E  V+F+LI +D+   EHK P++L+ QPFGQVP+ +D   
Sbjct  5    VKVYGPPMSTAVSRVLACLLEKDVNFQLIPVDMSKGEHKKPDYLKIQPFGQVPSFQDESI  64

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAI RY + KYA +G K L G    E+  ++QWLE E  ++N     +V Q+   
Sbjct  65   SLFESRAICRYVSEKYANQGNKRLYGTNPLEKASIEQWLEAEGQSFNPPSSALVFQLAFA  124

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P M    D+ V+K+  EKL KVLDVYE+RL +S++LAGD F+LADLSHLP+ ++L +   
Sbjct  125  PRMKLKQDLGVIKQSEEKLAKVLDVYEQRLGESRFLAGDEFTLADLSHLPNTQYLVSVTE  184

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G + ++RK +  W+S+IS R +W KV+DL
Sbjct  185  KGEMFTKRKNVGRWWSEISGRDSWKKVVDL  214



>ref|XP_010938431.1| PREDICTED: glutathione S-transferase 3 [Elaeis guineensis]
Length=215

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 140/210 (67%), Gaps = 3/210 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +KV+G A +    RV+A L E G+D+EL+ +DL++  HK P FL   PFGQ+P +EDG
Sbjct  1    MGLKVYGLAMSTNTVRVVAALNEKGLDYELVPVDLRTGAHKQPSFLALNPFGQIPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM--GKTVEERGVVDQWLEVESNNYNDLVYNMVLQM  441
            D  LFESRAI RY A++Y E G +L+  G    E   ++ WLEVES  +   + ++V ++
Sbjct  61   DLVLFESRAISRYIASRYKETGPDLLRSGGGPAETAALEVWLEVESQQFGPPIADLVFEL  120

Query  442  FVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTN  621
             + P +G  +D +VV+K AEKLGKVLDVYE+RLSK+KYLAG  F+LADL+H+P   +L  
Sbjct  121  LIKPLLGGTTDPAVVEKQAEKLGKVLDVYEDRLSKNKYLAGGHFTLADLNHMPYTHYLLQ  180

Query  622  EGGFGHLVSERKCLNAWYSDISARPAWNKV  711
                  LV+ R  + AW+ DISARPAW K 
Sbjct  181  TPK-ADLVTARPRVLAWWQDISARPAWKKT  209



>ref|XP_008805761.1| PREDICTED: probable glutathione S-transferase GSTF1 [Phoenix 
dactylifera]
Length=216

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 135/209 (65%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M VKV+G+  + C  RV+ CL E+G ++EL+ ID  + EHK P  L R PFGQVPA EDG
Sbjct  1    MGVKVYGATMSTCTARVLLCLEEMGAEYELVPIDFSTGEHKQPAHLARNPFGQVPAFEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGK-TVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
               L+ESRAI RY   KY   G +L+ + +++E  +VD WLEVES  +N  +  +  Q+F
Sbjct  61   ALILYESRAIARYILRKYKSSGGDLLKEGSLQESAMVDLWLEVESQQFNPAIGPIFYQIF  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            +FP  G   D +V+    EKL KVLDVYE RLSK+KYLAGDFFSLADLSH+P L +    
Sbjct  121  IFPRFGNVPDQAVIDTNLEKLCKVLDVYEARLSKTKYLAGDFFSLADLSHVPLLHYFMAT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
                 +V+ R  + AW+  +S+RPA  KV
Sbjct  181  -PHASVVNSRPHVKAWWEGVSSRPACKKV  208



>gb|KDP36862.1| hypothetical protein JCGZ_08153 [Jatropha curcas]
Length=217

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 138/213 (65%), Gaps = 1/213 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VKV+G   +    RV+ACL E  V+F+LI I++   EHK PEFL+ QPFGQVPA +D   
Sbjct  5    VKVYGPTLSPAVCRVLACLIEKDVNFQLIPINMSKGEHKKPEFLKIQPFGQVPAFQDESI  64

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAI RY   KY +KG K L G     +  +DQW+E E  +YN     ++ Q+ + 
Sbjct  65   SLFESRAICRYICEKYPDKGYKGLYGTNPLAKASIDQWVEAEGQSYNAPSGALLFQLALA  124

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P M  P D  ++K+  EKLGKVLDVYE+RL +S++LAGD FSLADLSHLP+ ++L     
Sbjct  125  PRMNIPQDQGIIKQNEEKLGKVLDVYEKRLGESRFLAGDEFSLADLSHLPNTQYLVAATD  184

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
               L++ ++ +  W+S+IS R +W KV+++  N
Sbjct  185  RAELITSKQNVGRWWSEISNRQSWKKVVEMQKN  217



>ref|XP_010090796.1| Glutathione S-transferase F13 [Morus notabilis]
 gb|EXB40829.1| Glutathione S-transferase F13 [Morus notabilis]
Length=217

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 141/209 (67%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+K+ G   +    RVM CL E G+DFEL+ +DL + E+K P FL + PFGQVP +EDG
Sbjct  1    MVLKLHGLPMSTSTTRVMICLHEKGLDFELVPVDLFARENKQPLFLAKNPFGQVPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A KY +   +L+  +++ E  +V  W EVES+ Y+ +V  +V Q F
Sbjct  61   DLTLFESRAITAYLAEKYKDSRNDLIRHESLNESAMVKVWSEVESHEYDPVVSQIVHQHF  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P +G+ SD +V+ +  EKLGKVLDVYE RLS +KYLAGDFFSLADL HLP   F   +
Sbjct  121  VAPMIGKTSDQTVIDENLEKLGKVLDVYETRLSNTKYLAGDFFSLADLHHLP-YTFYFMK  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
              +  ++++R  + AW+ DIS+RPA+ KV
Sbjct  180  TPWASILNDRPHVKAWWEDISSRPAFEKV  208



>gb|KDO87318.1| hypothetical protein CISIN_1g036627mg [Citrus sinensis]
Length=219

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  82   VNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIE  261
            +  ++K++G+  + C  RVM CL E  VDF L+ +DL S EHK P FL + PFGQ+P +E
Sbjct  1    MTTLIKLYGAPVSTCTARVMTCLHEKAVDFALVPVDLFSCEHKQPPFLAKNPFGQIPVLE  60

Query  262  DGDFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQ  438
            DGD  LFESRA+  Y A K+ E G +L+    ++E  +V  W+EVES  ++  +  +V +
Sbjct  61   DGDLTLFESRAMTAYVAEKFKEAGTDLIRHHDLKEAALVKVWIEVESQQFHPAIAPIVYE  120

Query  439  MFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLT  618
             FV P  G+  D  V+    EKL KVLDVYE +LS +KYLAGDF+SLADL HLP   +  
Sbjct  121  YFVAPIQGKSPDQGVIDANLEKLSKVLDVYEAKLSSAKYLAGDFYSLADLHHLPYTYYFM  180

Query  619  NEGGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                   ++SER  + AW+ DIS+RPA+NKV + +N
Sbjct  181  KTPC-ASIISERAHVKAWWEDISSRPAFNKVSEGMN  215



>gb|ACT82511.1| glutathione S-transferase [Arachis hypogaea]
Length=218

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 134/211 (64%), Gaps = 1/211 (0%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             VKV+G   +    RV+ACL E  V FE+I +D+   EHK PEFL  QPFGQVP  +DG+
Sbjct  3    AVKVYGPTLSTAVSRVLACLIEKDVQFEVIPVDMSKGEHKRPEFLSLQPFGQVPVFQDGN  62

Query  271  FKLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFV  447
              LFESRAI RY   KYAE+G K L G     +  +DQW+E E  ++N     +V Q+  
Sbjct  63   ISLFESRAICRYVCEKYAERGNKGLYGTDPLAKASIDQWVEAEGQSFNPPSSALVFQLAF  122

Query  448  FPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
             P M    D  V+++  EKL KVLDVYE+RLS++++LAGD FSLADLSHLP+  +L    
Sbjct  123  APRMKLKQDQGVIRQNEEKLAKVLDVYEKRLSQTRFLAGDDFSLADLSHLPNAHYLVTGT  182

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDL  720
                L ++R  ++ W++DIS R +WN+VL L
Sbjct  183  DRAPLFTQRDNVSRWWNDISTRQSWNEVLHL  213



>ref|XP_002531867.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF30504.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=217

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 134/208 (64%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +K+ G A + C   V+ CL E GVDFEL+ IDL + EHK P F+ + PFGQVP +EDG
Sbjct  1    MALKLHGVAMSTCTSLVITCLHEKGVDFELVPIDLFAGEHKQPPFIAKNPFGQVPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A K+ E G +L+  + ++E   V  W EVES  Y+  +  +V Q++
Sbjct  61   DLTLFESRAIAAYIAEKFKESGYDLIRHQNLKEAATVRVWTEVESQQYHPAIAPIVYQLY  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D  +++   EKLGKVLD+YE RLS SKYLAGDF+SLADL HLP   +L   
Sbjct  121  VNPLKGVSPDQEIIETNLEKLGKVLDIYEARLSTSKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNK  708
                 +++ER  + AW+ DIS+RPA+ K
Sbjct  181  HA-ASVINERPHVKAWWEDISSRPAFKK  207



>ref|XP_004291321.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=217

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 137/210 (65%), Gaps = 1/210 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VKV+G   + C  RV+ACL E  V ++LI +++   EHK P +L+ QPFGQVP  ED  F
Sbjct  5    VKVYGPPISTCVSRVLACLLEKEVPYQLIPVNMAKGEHKKPAYLKIQPFGQVPGFEDDGF  64

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             +FESR+I RY   KYA++G K L G     +  +DQWLE E  +++     +V Q+   
Sbjct  65   TVFESRSICRYICDKYAKQGNKGLYGDNPLAKASIDQWLEAEGQSFSPPSSVLVFQLAFA  124

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P M    D   +++  EKL KVLDVYEERLS+S++LAGD F+LADLSHLP+  +L N   
Sbjct  125  PRMKLKQDQVAIRQNEEKLKKVLDVYEERLSESRFLAGDEFTLADLSHLPNTHYLVNATD  184

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G L +ER+C+  W+++IS+R +W KV+++
Sbjct  185  IGELFTERECVGRWWAEISSRESWKKVVEM  214



>ref|XP_006480109.1| PREDICTED: glutathione S-transferase F13-like [Citrus sinensis]
Length=229

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  82   VNMVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIE  261
            +  ++K++G+  + C  RVM CL E  VDF L+ +DL S EHK P FL + PFGQ+P +E
Sbjct  11   MTTLIKLYGAPVSTCTARVMTCLHEKAVDFALVPVDLFSCEHKQPPFLAKNPFGQIPVLE  70

Query  262  DGDFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQ  438
            DGD  LFESRA+  Y A K+ E G +L+    ++E  +V  W+EVES  ++  +  +V +
Sbjct  71   DGDLTLFESRAMTAYVAEKFKEAGTDLIRHHDLKEAALVKVWIEVESQQFHPAIAPIVYE  130

Query  439  MFVFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLT  618
             FV P  G+  D  V+    EKL KVLDVYE +LS +KYLAGDF+SLADL HLP   +  
Sbjct  131  YFVAPIQGKSPDQGVIDANLEKLSKVLDVYEAKLSSAKYLAGDFYSLADLHHLPYTYYFM  190

Query  619  NEGGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                   ++SER  + AW+ DIS+RPA+NKV + +N
Sbjct  191  KTPC-ASIISERAHVKAWWEDISSRPAFNKVSEGMN  225



>gb|ADB11335.1| phi class glutathione transferase GSTF7 [Populus trichocarpa]
Length=217

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 2/214 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+K++G+  + C  RV+ CL E  +DFEL+ +DL + EHK P FL + PFGQ+PA+E+ 
Sbjct  1    MVLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A K+   G +L+  + ++E   V  W EVES+ YN  +  +V Q  
Sbjct  61   DLTLFESRAITSYLAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFM  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D +++    EKLGKVLD+YE +LS +KYLAGDF+SLADL HLP   +L   
Sbjct  121  VAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                 +V+ER  + AW+ DIS+RPA+ KV + +N
Sbjct  181  PA-ASVVNERPHVKAWWEDISSRPAFKKVAEGMN  213



>ref|XP_006386755.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|ERP64552.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=217

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 2/214 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+K++G+  + C  RV+ CL E  +DFEL+ +DL + EHK P FL + PFGQ+PA+E+ 
Sbjct  1    MVLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A K+   G +L+  + ++E   V  W EVES+ YN  +  +V Q  
Sbjct  61   DLTLFESRAITSYIAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFM  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D +++    EKLGKVLD+YE +LS +KYLAGDF+SLADL HLP   +L   
Sbjct  121  VAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                 +V+ER  + AW+ DIS+RPA+ KV + +N
Sbjct  181  PA-ASVVNERPHVKAWWEDISSRPAFKKVAEGMN  213



>gb|KDP28123.1| hypothetical protein JCGZ_13894 [Jatropha curcas]
Length=217

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 136/214 (64%), Gaps = 2/214 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +K++G+A +     V+ CL E  VDFE I +DL + EHK P F  + PFGQVP +EDG
Sbjct  1    MALKLYGAAMSTSTSLVLTCLHEKEVDFEFIPVDLFAGEHKQPHFGAKNPFGQVPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y   KY E G +L   K +EE  +V  W+EVES  YN  +  +V Q++
Sbjct  61   DLTLFESRAITAYITEKYKEPGYDLTRHKKLEEAAMVKVWIEVESQRYNPAIAPIVYQLY  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D +++    EKL KVLD+YEERLS SKYLAGDFFSLADL HLP   +L   
Sbjct  121  VGPLKGVAPDEAIIDTNIEKLRKVLDIYEERLSCSKYLAGDFFSLADLHHLPYTYYLMKT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                 +++ER  + AW+ DIS+RPA+ KV + +N
Sbjct  181  SA-ASVINERPRVKAWWDDISSRPAFKKVAEGMN  213



>ref|XP_007223949.1| hypothetical protein PRUPE_ppa011153mg [Prunus persica]
 gb|EMJ25148.1| hypothetical protein PRUPE_ppa011153mg [Prunus persica]
Length=221

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 136/210 (65%), Gaps = 1/210 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VKV+G   +    RV+ACL E GVD++LI +++   EHK P++L+ QPFGQVPA +D D 
Sbjct  6    VKVYGPPISTAVSRVLACLLEKGVDYQLISVNMSKGEHKKPDYLKIQPFGQVPAFQDEDI  65

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAI RY   KYA++G K L G     +  +DQWLE E  +++     +V Q+   
Sbjct  66   SLFESRAICRYICDKYADRGNKGLYGTNPLAKASIDQWLEAEGQSFSPPSSTLVFQLAFA  125

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P M    D  V+++  EKL KVLDVYE+RL +S++LAGD FSLADLSHLP+  +L N   
Sbjct  126  PRMKLKQDQGVIRQNEEKLKKVLDVYEKRLGESRFLAGDEFSLADLSHLPNGHYLVNATD  185

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDL  720
             G L + R  +  W+++IS R +W KV+++
Sbjct  186  RGELFTSRNNVGRWWTEISTRDSWEKVVEM  215



>ref|XP_010090797.1| Glutathione S-transferase [Morus notabilis]
 gb|EXB40830.1| Glutathione S-transferase [Morus notabilis]
Length=223

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 143/214 (67%), Gaps = 2/214 (1%)
 Frame = +1

Query  91   VVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGD  270
             +KV+G+A +    RV+A L E G+D+EL+H+D+ + EHK   ++ R PFGQVPA EDGD
Sbjct  3    AIKVYGAAYSTAAARVLATLHEKGLDYELVHVDMITGEHKKESYISRNPFGQVPAFEDGD  62

Query  271  FKLFESRAIIRYYATKYAEKGKNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             KLFESRAI RY + +YA+KG +L     +++ V + W+EVE+++++     +  ++ V 
Sbjct  63   LKLFESRAITRYISQQYADKGTSLEFSDPKKQAVANLWIEVEAHHFDPNAQKLNYELTVK  122

Query  451  PS-MGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEG  627
            P  +G  +D SVV +   K  KVLDVYEERLS+S+YL GD F+LADL HLP++++L    
Sbjct  123  PVILGLETDHSVVAEYEPKFEKVLDVYEERLSQSRYLGGDSFTLADLHHLPTIQYLLGSS  182

Query  628  GFGHLVSERKCLNAWYSDISARPAWNKVLDLINN  729
                L   R  +NAW  DI++RP+W KV++L N 
Sbjct  183  A-KKLFESRPRVNAWVDDITSRPSWTKVVELRNQ  215



>ref|XP_002263386.1| PREDICTED: glutathione S-transferase F13 [Vitis vinifera]
 emb|CBI32223.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +K+ G   + C  RV+ CL E G+DFEL+ ++L + EHK P FL + PFGQ+P +EDG
Sbjct  1    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKT-VEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A KY E G +L+    ++E  +V  WLEVES  Y+  +Y +V Q F
Sbjct  61   DLTLFESRAITAYLAEKYKETGCDLLRHNDLKEAALVKVWLEVESQQYHPAIYQIVYQFF  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G+ +D +++    EKLGKVLDVYE RL  +K LAGDF+SLADL HL S  +   +
Sbjct  121  VLPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAGDFYSLADLHHL-SYTYYFMK  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
              +  L++ R  + AW+ DIS+RPA+ KV
Sbjct  180  TPWASLINSRPNVKAWWEDISSRPAFKKV  208



>ref|XP_008445310.1| PREDICTED: glutathione S-transferase F11-like [Cucumis melo]
Length=220

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 136/212 (64%), Gaps = 1/212 (0%)
 Frame = +1

Query  94   VKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDGDF  273
            VKV+G   +    RV+ACL E  V F+L+ +++   EHK+PE+L+ QPFGQVPA +D   
Sbjct  5    VKVYGPPLSTAVSRVLACLLEKDVQFQLLPVNMAKGEHKSPEYLKIQPFGQVPAFQDESI  64

Query  274  KLFESRAIIRYYATKYAEKG-KNLMGKTVEERGVVDQWLEVESNNYNDLVYNMVLQMFVF  450
             LFESRAI RY   K+AEKG K L G     +  ++QW+E E  N+N     +V Q+   
Sbjct  65   SLFESRAICRYICEKHAEKGNKGLYGLDQLGKASIEQWIEAEGQNFNPASSILVFQLAFA  124

Query  451  PSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNEGG  630
            P M  P D   +K+  EKL KVLDVYE+RL +S+YLAGD FSLADLSHLP+  +L N   
Sbjct  125  PRMKLPQDEKAIKQNEEKLSKVLDVYEQRLGESRYLAGDEFSLADLSHLPNGHYLVNNAD  184

Query  631  FGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
               L + RK +  W+++IS+R +W +V++L N
Sbjct  185  RAELFTSRKNVERWWNEISSRESWKEVVELQN  216



>ref|XP_011010721.1| PREDICTED: glutathione S-transferase F13-like [Populus euphratica]
Length=217

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 2/214 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            MV+K++G+  + C  RV+ CL E  +DFEL+ +DL + EHK P FL + PFGQ+PA+E+ 
Sbjct  1    MVLKLYGTPMSTCTSRVLTCLHEKSLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLM-GKTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A K+   G +L+  + ++E   V  W EVES+ YN  +  +V Q  
Sbjct  61   DLTLFESRAITSYVAEKFKGSGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFL  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
            V P  G   D +++    EKLGKVLDVYE +L+ +KYLAGDF+SLADL HLP   +L   
Sbjct  121  VAPLQGNLPDQTIIDANLEKLGKVLDVYEAKLTSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKVLDLIN  726
                 +V+ER  + AW+ DIS+RPA+ KV + +N
Sbjct  181  PA-ASVVNERPHVKAWWEDISSRPAFKKVAEGMN  213



>ref|XP_002263424.1| PREDICTED: glutathione S-transferase F13 [Vitis vinifera]
 emb|CBI32222.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +K+ G   + C  RV+ CL E G+DFEL+ ++L + EHK P FL + PFGQ+P +EDG
Sbjct  1    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMGKT-VEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            DF LFESRAI  Y A KY E G +L+    ++E  +V  WLEVES +Y   +Y +V Q F
Sbjct  61   DFTLFESRAITAYLAEKYKETGCDLLRHNDLKEAALVKVWLEVESQHYYPAIYQIVYQFF  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
              P  G+ +D +++    EKLGKVLDVYE RL  +K LAGDF+SLADL HL S  +   +
Sbjct  121  ALPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAGDFYSLADLHHL-SYTYYFMK  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
              +  L++ R  + AW+ DIS+RPA+ KV
Sbjct  180  TPWASLINSRPNVKAWWDDISSRPAFKKV  208



>gb|KHG13410.1| Glutathione S-transferase F13 -like protein [Gossypium arboreum]
Length=219

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 139/209 (67%), Gaps = 2/209 (1%)
 Frame = +1

Query  88   MVVKVFGSATAACPQRVMACLFELGVDFELIHIDLQSFEHKTPEFLRRQPFGQVPAIEDG  267
            M +K++G+A + C  RVM CL E   DFELI IDL + EHK   FL + PFGQ+PA+EDG
Sbjct  1    MALKLYGAAMSPCTSRVMTCLHEKEADFELIPIDLFAGEHKQLPFLAKNPFGQIPALEDG  60

Query  268  DFKLFESRAIIRYYATKYAEKGKNLMG-KTVEERGVVDQWLEVESNNYNDLVYNMVLQMF  444
            D  LFESRAI  Y A KY E G +L+  ++++E   V  W+EVES  Y+  +  ++ Q F
Sbjct  61   DLSLFESRAISAYVAEKYKEAGHDLIRYQSLKESAEVKVWMEVESQQYHPAISPIIFQFF  120

Query  445  VFPSMGQPSDMSVVKKCAEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPSLRFLTNE  624
              P  G+  D +++ +  EKLG VL VYEE+LS++KYLAGDF+SLADL HL S  +   +
Sbjct  121  AAPLQGKVPDQAIIDENLEKLGNVLTVYEEKLSRTKYLAGDFYSLADLFHL-SFTYYFMK  179

Query  625  GGFGHLVSERKCLNAWYSDISARPAWNKV  711
                +L++ER  + AW+ DIS+RPA+ KV
Sbjct  180  TPCANLINERPHVKAWWEDISSRPAFQKV  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1703386041640