BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1509_g1_i1 len=632 path=[1:0-631]

Length=632
                                                                      Score     E

gb|EYU36619.1|  hypothetical protein MIMGU_mgv1a0073512mg               203   1e-62   
ref|XP_004155432.1|  PREDICTED: rab GDP dissociation inhibitor al...    211   5e-62   
ref|XP_004137066.1|  PREDICTED: rab GDP dissociation inhibitor al...    211   7e-62   
ref|XP_011092452.1|  PREDICTED: guanosine nucleotide diphosphate ...    209   1e-61   
gb|EPS65861.1|  hypothetical protein M569_08910                         209   2e-61   
gb|EYU36626.1|  hypothetical protein MIMGU_mgv1a0068452mg               199   4e-61   
ref|XP_008455143.1|  PREDICTED: guanosine nucleotide diphosphate ...    208   4e-61   
gb|EYU39113.1|  hypothetical protein MIMGU_mgv1a006401mg                207   7e-61   
gb|KHG03270.1|  Rab GDP dissociation inhibitor alpha                    202   2e-60   
gb|EPS59445.1|  hypothetical protein M569_15362                         199   2e-60   
ref|XP_009790990.1|  PREDICTED: guanosine nucleotide diphosphate ...    206   4e-60   
ref|XP_007042843.1|  GDP dissociation inhibitor family protein / ...    204   2e-59   
ref|XP_007042842.1|  GDP dissociation inhibitor family protein / ...    204   2e-59   
ref|XP_009364258.1|  PREDICTED: guanosine nucleotide diphosphate ...    204   2e-59   
ref|XP_008385671.1|  PREDICTED: guanosine nucleotide diphosphate ...    204   2e-59   
ref|XP_006423751.1|  hypothetical protein CICLE_v10029979mg             203   3e-59   
ref|XP_008237140.1|  PREDICTED: guanosine nucleotide diphosphate ...    203   3e-59   
ref|XP_006487500.1|  PREDICTED: rab GDP dissociation inhibitor al...    203   4e-59   
ref|XP_009593951.1|  PREDICTED: guanosine nucleotide diphosphate ...    203   5e-59   
ref|XP_003635640.2|  PREDICTED: guanosine nucleotide diphosphate ...    193   7e-59   
emb|CAB94202.1|  GDP dissociation inhibitor                             201   2e-58   Solanum lycopersicum
ref|XP_002522655.1|  protein with unknown function                      201   2e-58   Ricinus communis
ref|XP_004230543.1|  PREDICTED: guanosine nucleotide diphosphate ...    201   2e-58   
ref|XP_002310487.1|  hypothetical protein POPTR_0007s03250g             201   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011023058.1|  PREDICTED: guanosine nucleotide diphosphate ...    201   3e-58   
ref|XP_006351732.1|  PREDICTED: rab GDP dissociation inhibitor al...    201   3e-58   
ref|XP_008236115.1|  PREDICTED: guanosine nucleotide diphosphate ...    199   8e-58   
ref|XP_007205201.1|  hypothetical protein PRUPE_ppa005809mg             199   9e-58   
emb|CDX69899.1|  BnaA10g22480D                                          196   1e-57   
ref|XP_007199860.1|  hypothetical protein PRUPE_ppa005763mg             199   1e-57   
ref|XP_011074031.1|  PREDICTED: guanosine nucleotide diphosphate ...    199   1e-57   
ref|XP_009345712.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    199   2e-57   
ref|XP_008363741.1|  PREDICTED: guanosine nucleotide diphosphate ...    198   2e-57   
ref|XP_002461825.1|  hypothetical protein SORBIDRAFT_02g008810          198   2e-57   Sorghum bicolor [broomcorn]
ref|XP_006584965.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   3e-57   
ref|XP_009410720.1|  PREDICTED: guanosine nucleotide diphosphate ...    198   3e-57   
gb|EYU22361.1|  hypothetical protein MIMGU_mgv1a006444mg                198   3e-57   
ref|XP_010030005.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-57   
ref|XP_010101319.1|  Rab GDP dissociation inhibitor alpha               195   3e-57   
gb|KDO49754.1|  hypothetical protein CISIN_1g013352mg                   196   4e-57   
ref|XP_004288515.1|  PREDICTED: rab GDP dissociation inhibitor al...    197   4e-57   
ref|XP_006654412.1|  PREDICTED: rab GDP dissociation inhibitor al...    197   4e-57   
ref|XP_008354312.1|  PREDICTED: guanosine nucleotide diphosphate ...    197   5e-57   
ref|XP_009131116.1|  PREDICTED: guanosine nucleotide diphosphate ...    197   5e-57   
ref|XP_006289683.1|  hypothetical protein CARUB_v10003247mg             197   5e-57   
ref|XP_010067402.1|  PREDICTED: guanosine nucleotide diphosphate ...    197   5e-57   
ref|XP_004504841.1|  PREDICTED: rab GDP dissociation inhibitor al...    197   5e-57   
ref|XP_002513702.1|  protein with unknown function                      197   6e-57   Ricinus communis
ref|XP_010452948.1|  PREDICTED: guanosine nucleotide diphosphate ...    197   6e-57   
gb|KCW87999.1|  hypothetical protein EUGRSUZ_A00408                     196   8e-57   
ref|XP_010254526.1|  PREDICTED: guanosine nucleotide diphosphate ...    197   8e-57   
ref|XP_006584964.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   8e-57   
emb|CDY56553.1|  BnaA03g55960D                                          197   9e-57   
ref|XP_006372308.1|  GDP dissociation inhibitor family protein          197   9e-57   
ref|XP_009122523.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   1e-56   
emb|CDY21587.1|  BnaC09g47050D                                          196   1e-56   
ref|XP_006399435.1|  hypothetical protein EUTSA_v10013547mg             196   1e-56   
ref|XP_006584963.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   2e-56   
ref|XP_010422972.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    196   2e-56   
ref|XP_003531017.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   2e-56   
ref|XP_004984243.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   2e-56   
gb|ACU24317.1|  unknown                                                 190   2e-56   Glycine max [soybeans]
ref|XP_006852946.1|  hypothetical protein AMTR_s00033p00239520          196   2e-56   
gb|KCW56943.1|  hypothetical protein EUGRSUZ_I02620                     196   2e-56   
ref|XP_009366269.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   2e-56   
ref|XP_006441986.1|  hypothetical protein CICLE_v10020158mg             196   2e-56   
ref|XP_010067212.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   2e-56   
ref|XP_006478491.1|  PREDICTED: rab GDP dissociation inhibitor al...    196   2e-56   
gb|AAR06264.1|  GDP dissociation inhibitor protein                      196   2e-56   Hordeum vulgare [barley]
ref|XP_011014748.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   2e-56   
ref|XP_011004551.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
ref|XP_009404932.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
ref|XP_008349850.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    191   3e-56   
ref|XP_009620915.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
ref|NP_001140939.1|  uncharacterized protein LOC100273017               196   3e-56   Zea mays [maize]
ref|XP_011005244.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
ref|XP_008812865.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
ref|XP_002268877.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   Vitis vinifera
ref|XP_002310371.1|  GDP dissociation inhibitor family protein          196   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_008788293.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   3e-56   
gb|AHF81486.1|  small GTP Rab-GDI                                       195   3e-56   
ref|NP_196517.3|  RAB GDP-dissociation inhibitor                        195   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030006.1|  PREDICTED: guanosine nucleotide diphosphate ...    196   4e-56   
ref|XP_009416240.1|  PREDICTED: guanosine nucleotide diphosphate ...    195   4e-56   
ref|XP_011074023.1|  PREDICTED: guanosine nucleotide diphosphate ...    195   4e-56   
ref|XP_010908336.1|  PREDICTED: guanosine nucleotide diphosphate ...    195   4e-56   
ref|XP_004138948.1|  PREDICTED: rab GDP dissociation inhibitor al...    195   4e-56   
ref|XP_009125364.1|  PREDICTED: guanosine nucleotide diphosphate ...    195   5e-56   
ref|XP_010930328.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   5e-56   
ref|XP_007202054.1|  hypothetical protein PRUPE_ppa005772mg             195   6e-56   
ref|XP_010101313.1|  Rab GDP dissociation inhibitor alpha               195   6e-56   
ref|XP_008441682.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   7e-56   
gb|EMT13930.1|  Rab GDP dissociation inhibitor alpha                    194   7e-56   
ref|XP_006351084.1|  PREDICTED: rab GDP dissociation inhibitor al...    194   8e-56   
ref|XP_008801349.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   9e-56   
gb|KFK25257.1|  hypothetical protein AALP_AA8G088700                    194   9e-56   
gb|KDP45816.1|  hypothetical protein JCGZ_17423                         194   9e-56   
gb|ABK24357.1|  unknown                                                 190   1e-55   Picea sitchensis
ref|XP_004244786.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   1e-55   
gb|ACN65853.1|  Rab GDP dissociation inhibitor                          194   1e-55   Nicotiana benthamiana
ref|XP_008394248.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   1e-55   
ref|XP_008801341.1|  PREDICTED: guanosine nucleotide diphosphate ...    194   1e-55   
ref|XP_002871374.1|  rab GDP-dissociation inhibitor                     194   2e-55   
gb|EMS53635.1|  Rab GDP dissociation inhibitor alpha                    193   2e-55   
ref|XP_008243091.1|  PREDICTED: guanosine nucleotide diphosphate ...    193   2e-55   
gb|AFK40299.1|  unknown                                                 191   2e-55   
ref|XP_010526899.1|  PREDICTED: guanosine nucleotide diphosphate ...    193   2e-55   
ref|XP_007026462.1|  Guanosine nucleotide diphosphate dissociatio...    193   2e-55   
ref|XP_007026461.1|  Guanosine nucleotide diphosphate dissociatio...    193   2e-55   
ref|XP_007159565.1|  hypothetical protein PHAVU_002G248100g             193   3e-55   
gb|KHG05683.1|  Rab GDP dissociation inhibitor alpha                    193   3e-55   
ref|XP_010067325.1|  PREDICTED: guanosine nucleotide diphosphate ...    193   3e-55   
ref|NP_001055142.1|  Os05g0304400                                       193   3e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AAB69871.1|  GDP dissociation inhibitor protein OsGDI2               193   3e-55   Oryza sativa [red rice]
ref|XP_010691404.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   4e-55   
ref|XP_006344947.1|  PREDICTED: rab GDP dissociation inhibitor al...    192   4e-55   
ref|NP_001274860.1|  rab GDP dissociation inhibitor alpha-like          192   4e-55   
ref|XP_004251972.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   4e-55   
ref|XP_002280606.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   4e-55   Vitis vinifera
ref|XP_003529259.1|  PREDICTED: rab GDP dissociation inhibitor al...    192   6e-55   
ref|XP_006657603.1|  PREDICTED: rab GDP dissociation inhibitor al...    192   6e-55   
ref|XP_010524208.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   6e-55   
ref|XP_009784522.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   6e-55   
ref|XP_003531293.1|  PREDICTED: rab GDP dissociation inhibitor al...    192   6e-55   
dbj|BAJ91005.1|  predicted protein                                      186   8e-55   
gb|ABU98948.1|  GDP-dissociation inhibitor                              192   8e-55   Lupinus albus
ref|XP_009629496.1|  PREDICTED: guanosine nucleotide diphosphate ...    192   9e-55   
ref|XP_002533685.1|  protein with unknown function                      192   9e-55   Ricinus communis
ref|XP_010646794.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
ref|XP_010469257.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
emb|CAN64340.1|  hypothetical protein VITISV_031564                     191   1e-54   Vitis vinifera
ref|XP_010413620.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
ref|XP_010547647.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
gb|ABK25073.1|  unknown                                                 191   1e-54   Picea sitchensis
ref|XP_010512285.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
ref|XP_009104231.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   1e-54   
emb|CDX98399.1|  BnaC06g17600D                                          191   1e-54   
ref|XP_010907542.1|  PREDICTED: guanosine nucleotide diphosphate ...    191   2e-54   
ref|NP_001151199.1|  LOC100284832                                       191   2e-54   Zea mays [maize]
dbj|BAJ93199.1|  predicted protein                                      191   2e-54   
gb|ABR16699.1|  unknown                                                 191   2e-54   Picea sitchensis
ref|XP_004287194.1|  PREDICTED: rab GDP dissociation inhibitor al...    191   3e-54   
gb|KDP29973.1|  hypothetical protein JCGZ_18740                         191   3e-54   
ref|XP_003568439.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   3e-54   
ref|XP_010251442.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   3e-54   
ref|XP_008649650.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   3e-54   
ref|NP_001276273.1|  rab GDP dissociation inhibitor alpha-like          190   4e-54   
emb|CDY05962.1|  BnaA09g38180D                                          190   4e-54   
gb|EMS53287.1|  Rab GDP dissociation inhibitor alpha                    190   4e-54   
ref|XP_004962065.1|  PREDICTED: rab GDP dissociation inhibitor al...    190   4e-54   
ref|XP_006858694.1|  hypothetical protein AMTR_s00066p00096020          190   4e-54   
ref|XP_009116668.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   5e-54   
emb|CDX81131.1|  BnaC03g03850D                                          190   5e-54   
ref|XP_003557314.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   5e-54   
ref|XP_010937652.1|  PREDICTED: guanosine nucleotide diphosphate ...    190   5e-54   
ref|NP_001059344.1|  Os07g0271000                                       190   5e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CDY44805.1|  BnaC02g00820D                                          193   5e-54   
ref|XP_004962068.1|  PREDICTED: rab GDP dissociation inhibitor al...    189   6e-54   
ref|XP_006654244.1|  PREDICTED: rab GDP dissociation inhibitor al...    189   7e-54   
ref|XP_002876528.1|  ATGDI2                                             189   7e-54   
ref|NP_191551.1|  RAB GDP dissociation inhibitor 2                      189   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402639.1|  hypothetical protein EUTSA_v10005975mg             189   9e-54   
ref|XP_010520728.1|  PREDICTED: guanosine nucleotide diphosphate ...    189   1e-53   
gb|AAW78520.1|  GDP dissociation inhibitor 1                            189   1e-53   Solanum chilense
ref|XP_010277857.1|  PREDICTED: guanosine nucleotide diphosphate ...    188   1e-53   
ref|NP_001266078.1|  rab GDP dissociation inhibitor alpha-like          188   2e-53   
ref|XP_006291137.1|  hypothetical protein CARUB_v10017252mg             188   2e-53   
ref|XP_006649851.1|  PREDICTED: rab GDP dissociation inhibitor be...    188   2e-53   
ref|XP_003629947.1|  Rab GDP dissociation inhibitor                     188   2e-53   
gb|EMT30538.1|  Rab GDP dissociation inhibitor alpha                    188   2e-53   
ref|XP_002439812.1|  hypothetical protein SORBIDRAFT_09g020540          188   3e-53   Sorghum bicolor [broomcorn]
ref|XP_010672532.1|  PREDICTED: guanosine nucleotide diphosphate ...    187   3e-53   
ref|XP_009138891.1|  PREDICTED: guanosine nucleotide diphosphate ...    187   3e-53   
emb|CDY45775.1|  BnaC04g22610D                                          187   4e-53   
ref|XP_002987358.1|  hypothetical protein SELMODRAFT_271917             187   4e-53   
ref|XP_002989142.1|  hypothetical protein SELMODRAFT_159958             187   5e-53   
ref|NP_001183437.1|  Rab GDP dissociation inhibitor alpha               187   5e-53   
emb|CDP11069.1|  unnamed protein product                                187   5e-53   
ref|XP_009380662.1|  PREDICTED: guanosine nucleotide diphosphate ...    187   7e-53   
ref|XP_003608428.1|  Rab-GDP dissociation inhibitor                     186   8e-53   
emb|CAF02075.1|  GDP dissociation inhibitor                             186   9e-53   Medicago truncatula
ref|XP_010517995.1|  PREDICTED: guanosine nucleotide diphosphate ...    186   1e-52   
ref|XP_006397585.1|  hypothetical protein EUTSA_v10001450mg             186   1e-52   
dbj|BAK00943.1|  predicted protein                                      186   1e-52   
ref|XP_010506315.1|  PREDICTED: guanosine nucleotide diphosphate ...    186   1e-52   
ref|XP_010508340.1|  PREDICTED: guanosine nucleotide diphosphate ...    186   1e-52   
gb|AAB69870.1|  GDP dissociation inhibitor protein OsGDI1               186   1e-52   Oryza sativa [red rice]
emb|CDO97391.1|  unnamed protein product                                186   1e-52   
ref|XP_006294223.1|  hypothetical protein CARUB_v10023221mg             186   1e-52   
ref|NP_001055566.1|  Os05g0418000                                       186   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002880083.1|  ATGDI1                                             186   1e-52   
ref|XP_003568438.1|  PREDICTED: guanosine nucleotide diphosphate ...    186   2e-52   
ref|XP_009116667.1|  PREDICTED: guanosine nucleotide diphosphate ...    185   2e-52   
ref|XP_009420147.1|  PREDICTED: guanosine nucleotide diphosphate ...    185   3e-52   
gb|KFK35202.1|  hypothetical protein AALP_AA5G253800                    185   3e-52   
ref|NP_181938.1|  guanosine nucleotide diphosphate dissociation i...    185   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37228.1|  hypothetical protein AALP_AA4G230400                    185   3e-52   
gb|EMT13931.1|  Rab GDP dissociation inhibitor alpha                    187   4e-52   
ref|XP_008784526.1|  PREDICTED: guanosine nucleotide diphosphate ...    184   7e-52   
ref|XP_004983945.1|  PREDICTED: rab GDP dissociation inhibitor al...    184   8e-52   
ref|XP_007159145.1|  hypothetical protein PHAVU_002G212600g             184   8e-52   
ref|XP_010920623.1|  PREDICTED: guanosine nucleotide diphosphate ...    184   1e-51   
ref|XP_010277493.1|  PREDICTED: guanosine nucleotide diphosphate ...    183   1e-51   
gb|AAL38263.1|  GDP dissociation inhibitor                              183   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288917.1|  guanosine nucleotide diphosphate dissociatio...    183   1e-51   
gb|AIK01834.1|  GDP dissociation inhibitor                              183   2e-51   
ref|XP_010277492.1|  PREDICTED: guanosine nucleotide diphosphate ...    182   2e-51   
emb|CAA69258.1|  GDP-associated inhibitor                               183   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277491.1|  PREDICTED: guanosine nucleotide diphosphate ...    183   2e-51   
gb|EMS53634.1|  Rab GDP dissociation inhibitor alpha                    184   3e-51   
ref|XP_010107286.1|  Rab GDP dissociation inhibitor alpha               182   7e-51   
gb|AAM64484.1|  GDP dissociation inhibitor                              181   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150143.1|  rab GDP dissociation inhibitor alpha               179   4e-50   Zea mays [maize]
gb|ACL54441.1|  unknown                                                 179   4e-50   Zea mays [maize]
ref|XP_009419946.1|  PREDICTED: guanosine nucleotide diphosphate ...    179   7e-50   
ref|XP_003558226.1|  PREDICTED: guanosine nucleotide diphosphate ...    178   1e-49   
ref|XP_001766609.1|  predicted protein                                  177   3e-49   
gb|EEC81843.1|  hypothetical protein OsI_25604                          177   4e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_001773747.1|  predicted protein                                  177   4e-49   
ref|XP_001768163.1|  predicted protein                                  176   6e-49   
ref|XP_002465085.1|  hypothetical protein SORBIDRAFT_01g031830          176   6e-49   Sorghum bicolor [broomcorn]
ref|NP_001049717.1|  Os03g0277000                                       176   9e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372309.1|  hypothetical protein POPTR_0017s00420g             176   1e-48   
ref|XP_010067472.1|  PREDICTED: guanosine nucleotide diphosphate ...    174   7e-48   
gb|KHG21656.1|  Rab GDP dissociation inhibitor alpha                    173   7e-48   
ref|XP_010930327.1|  PREDICTED: guanosine nucleotide diphosphate ...    173   1e-47   
ref|XP_008657544.1|  PREDICTED: guanosine nucleotide diphosphate ...    167   2e-47   
gb|KHN06485.1|  Rab GDP dissociation inhibitor alpha                    174   8e-47   
ref|XP_004962066.1|  PREDICTED: rab GDP dissociation inhibitor al...    169   1e-46   
ref|XP_004962067.1|  PREDICTED: rab GDP dissociation inhibitor al...    169   3e-46   
ref|NP_001078054.1|  guanosine nucleotide diphosphate dissociatio...    167   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001755959.1|  predicted protein                                  167   1e-45   
ref|XP_007153833.1|  hypothetical protein PHAVU_003G068600g             160   6e-45   
ref|XP_010927878.1|  PREDICTED: guanosine nucleotide diphosphate ...    161   1e-44   
emb|CAN75023.1|  hypothetical protein VITISV_007044                     149   3e-40   Vitis vinifera
gb|ABR25630.1|  rab gdp dissociation inhibitor alpha                    143   7e-40   Oryza sativa Indica Group [Indian rice]
gb|EEE59061.1|  hypothetical protein OsJ_10849                          151   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009116663.1|  PREDICTED: uncharacterized protein LOC103841842    150   1e-39   
ref|XP_008370508.1|  PREDICTED: guanosine nucleotide diphosphate ...    143   2e-39   
emb|CDX71860.1|  BnaC08g30140D                                          146   7e-38   
gb|EMT22946.1|  Rab GDP dissociation inhibitor alpha                    140   5e-37   
emb|CDY05966.1|  BnaA09g38140D                                          144   5e-37   
gb|KHG17909.1|  Rab GDP dissociation inhibitor alpha                    143   2e-36   
ref|XP_002501191.1|  predicted protein                                  142   4e-36   Micromonas commoda
gb|AAB09058.1|  GDP dissociation inhibitor protein GDIV1p               139   3e-35   Volvox carteri f. nagariensis
ref|XP_002955697.1|  hypothetical protein VOLCADRAFT_83359              139   3e-35   
ref|XP_007135176.1|  hypothetical protein PHAVU_010G1075001g            131   4e-35   
emb|CDY65664.1|  BnaC09g54770D                                          138   5e-35   
gb|KCW87997.1|  hypothetical protein EUGRSUZ_A00406                     137   3e-34   
gb|KDO49751.1|  hypothetical protein CISIN_1g013352mg                   135   6e-34   
ref|XP_005647685.1|  rab GDP dissociation inhibitor protein             135   1e-33   
ref|XP_008370509.1|  PREDICTED: guanosine nucleotide diphosphate ...    127   2e-33   
gb|KDD75407.1|  Rab GDP dissociation inhibitor                          134   2e-33   
ref|XP_007143966.1|  hypothetical protein PHAVU_007G117500g             128   2e-33   
emb|CDY42416.1|  BnaC02g22920D                                          125   6e-33   
ref|XP_001694920.1|  rab GDP dissociation inhibitor protein             132   1e-32   Chlamydomonas reinhardtii
ref|XP_003064630.1|  predicted protein                                  132   2e-32   
emb|CDX71865.1|  BnaC08g30090D                                          129   3e-32   
gb|KDP29761.1|  hypothetical protein JCGZ_18696                         130   5e-32   
gb|KFM24244.1|  putative secretory pathway GDP dissociation inhib...    130   8e-32   
ref|XP_005847470.1|  hypothetical protein CHLNCDRAFT_35621              129   2e-31   
ref|XP_001422173.1|  predicted protein                                  125   5e-30   Ostreococcus lucimarinus CCE9901
ref|XP_007511045.1|  predicted protein                                  124   1e-29   
emb|CEG00803.1|  HSP20-like chaperone                                   120   2e-28   
ref|XP_009162479.1|  hypothetical protein T265_00442                    119   4e-28   
dbj|GAA55898.1|  Rab GDP dissociation inhibitor alpha                   119   4e-28   
ref|XP_002739493.1|  PREDICTED: rab GDP dissociation inhibitor be...    117   2e-27   Saccoglossus kowalevskii
emb|CCA14701.1|  rab GDP dissociation inhibitor alpha putative          116   4e-27   
ref|XP_002599716.1|  hypothetical protein BRAFLDRAFT_131482             115   8e-27   Branchiostoma floridae
emb|CCD77451.1|  putative rab GDP-dissociation inhibitor                115   1e-26   
emb|CDR96347.1|  GDP dissociation inhibitor rabGDI, putative            115   2e-26   
ref|XP_001611247.1|  GDP dissociation inhibitor rabGDI                  114   2e-26   Babesia bovis T2Bo
emb|CCI39957.1|  unnamed protein product                                115   3e-26   
ref|XP_004261039.1|  Rab GDP dissociation inhibitor alpha, putative     114   3e-26   
dbj|BAB97381.1|  rab GDP-dissociation inhibitor                         114   3e-26   Branchiostoma belcheri
gb|KGB37203.1|  Rab GDP dissociation inhibitor alpha                    114   3e-26   
emb|CCD77450.1|  putative rab GDP-dissociation inhibitor                114   4e-26   
dbj|BAN40148.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
ref|XP_655209.2|  rab GDP dissociation inhibitor alpha                  114   4e-26   Entamoeba histolytica HM-1:IMSS
ref|XP_001737423.1|  Rab GDP dissociation inhibitor alpha               114   4e-26   
ref|XP_001913575.1|  rab GDP dissociation inhibitor alpha               114   4e-26   
gb|KGB37204.1|  Rab GDP dissociation inhibitor alpha                    113   4e-26   
dbj|BAN39547.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
dbj|BAN39325.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
dbj|BAN38116.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
dbj|BAN37793.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
gb|EMD47254.1|  Rab GDP dissociation inhibitor alpha, putative          114   4e-26   
ref|XP_001740658.1|  Rab GDP dissociation inhibitor alpha               114   4e-26   
dbj|BAN37800.1|  rab GDP dissociation inhibitor alpha, putative         114   4e-26   
dbj|BAN39409.1|  rab GDP dissociation inhibitor alpha, putative         113   4e-26   
dbj|BAN38914.1|  rab GDP dissociation inhibitor alpha, putative         113   5e-26   
dbj|BAN38050.1|  rab GDP dissociation inhibitor alpha, putative         113   5e-26   
ref|XP_647506.1|  Rab GDP dissociation inhibitor alpha                  113   6e-26   
ref|XP_796204.2|  PREDICTED: rab GDP dissociation inhibitor alpha...    113   9e-26   
ref|XP_006815070.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    112   1e-25   
ref|XP_004349102.1|  rab GDP dissociation inhibitor beta                112   1e-25   
dbj|BAN39838.1|  rab GDP dissociation inhibitor alpha, putative         112   2e-25   
emb|CDJ02825.1|  rab gdp dissociation inhibitor                         112   2e-25   
gb|KDR21130.1|  Rab GDP dissociation inhibitor alpha                    113   2e-25   
dbj|BAN39109.1|  rab GDP dissociation inhibitor alpha, putative         112   2e-25   
dbj|BAN40431.1|  Rab GDP dissociation inhibitor alpha, putative         111   2e-25   
ref|XP_006903631.1|  PREDICTED: rab GDP dissociation inhibitor al...    107   2e-25   
emb|CCF73485.1|  unnamed protein product                                111   3e-25   
gb|EHJ69256.1|  putative rab gdp-dissociation inhibitor                 111   3e-25   
gb|ETI38254.1|  hypothetical protein F443_15969                         109   4e-25   
ref|XP_007884589.1|  PREDICTED: rab GDP dissociation inhibitor alpha    108   4e-25   
gb|EZA53783.1|  Rab GDP dissociation inhibitor beta                     110   4e-25   
dbj|BAM17989.1|  GDP dissociation inhibitor                             110   5e-25   
emb|CBK23726.2|  unnamed protein product                                110   5e-25   
emb|CBK23953.2|  unnamed protein product                                110   5e-25   
gb|ELU17873.1|  hypothetical protein CAPTEDRAFT_148575                  110   6e-25   
ref|XP_002111911.1|  expressed hypothetical protein                     110   7e-25   
ref|XP_011051189.1|  PREDICTED: rab GDP dissociation inhibitor beta     110   8e-25   
gb|EFA86431.1|  Rab GDP dissociation inhibitor alpha                    110   9e-25   
ref|XP_002788047.1|  Rab GDP dissociation inhibitor alpha, putative     110   9e-25   
ref|XP_002769829.1|  Rab GDP dissociation inhibitor alpha, putative     110   9e-25   
ref|XP_004339226.1|  GDPassociated inhibitor, putative                  109   1e-24   
ref|XP_009516088.1|  hypothetical protein PHYSODRAFT_284351             109   1e-24   
gb|EUB57627.1|  Rab GDP dissociation inhibitor alpha                    109   2e-24   
ref|XP_008547480.1|  PREDICTED: rab GDP dissociation inhibitor alpha    109   2e-24   
dbj|BAN21234.1|  rab gdp-dissociation inhibitor                         109   2e-24   
ref|XP_002130815.1|  PREDICTED: rab GDP dissociation inhibitor al...    108   2e-24   
ref|XP_008895595.1|  hypothetical protein PPTG_04978                    108   2e-24   
gb|EFN63854.1|  Rab GDP dissociation inhibitor beta                     108   2e-24   
emb|CBK20501.2|  unnamed protein product                                109   2e-24   
ref|XP_002906912.1|  rab GDP dissociation inhibitor alpha               108   2e-24   
ref|XP_005106186.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    108   3e-24   
gb|AAW27297.1|  SJCHGC01783 protein                                     108   3e-24   
dbj|GAM18823.1|  hypothetical protein SAMD00019534_019980               108   3e-24   
ref|XP_968281.1|  PREDICTED: rab GDP dissociation inhibitor alpha       108   4e-24   
ref|XP_007888513.1|  PREDICTED: rab GDP dissociation inhibitor al...    108   4e-24   
emb|CDS30282.1|  rab gdp dissociation inhibitor                         108   4e-24   
gb|KDO24155.1|  hypothetical protein SPRG_10582                         108   4e-24   
ref|XP_002779722.1|  Rab GDP dissociation inhibitor alpha, putative     106   4e-24   
ref|XP_002433122.1|  Rab GDP dissociation inhibitor alpha, putative     108   4e-24   
gb|EDL84977.1|  guanosine diphosphate dissociation inhibitor 1, i...    105   4e-24   
emb|CBY40936.1|  unnamed protein product                                107   5e-24   
ref|XP_003882498.1|  GK15875, related                                   107   6e-24   
dbj|BAG64332.1|  unnamed protein product                                104   6e-24   
ref|XP_005992613.1|  PREDICTED: rab GDP dissociation inhibitor al...    107   6e-24   
dbj|GAA55896.1|  Rab GDP dissociation inhibitor alpha                   107   7e-24   
ref|XP_003731905.1|  PREDICTED: rab GDP dissociation inhibitor be...    102   7e-24   
ref|XP_009035335.1|  hypothetical protein AURANDRAFT_71109              109   7e-24   
ref|XP_001436251.1|  hypothetical protein                               107   8e-24   
gb|AEE63143.1|  unknown                                                 107   1e-23   
emb|CBY21345.1|  unnamed protein product                                106   1e-23   
ref|NP_001135205.1|  Rab GDP dissociation inhibitor beta                106   1e-23   
emb|CDQ78596.1|  unnamed protein product                                106   1e-23   
ref|XP_009018122.1|  hypothetical protein HELRODRAFT_79884              106   1e-23   
ref|XP_009162477.1|  hypothetical protein T265_00440                    105   2e-23   
ref|XP_005707712.1|  Rab GDP-dissociation inhibitor isoform 1           106   2e-23   
gb|ACO09349.1|  Rab GDP dissociation inhibitor beta                     106   2e-23   
emb|CBN77809.1|  rab GDP dissociation inhibitor protein                 106   2e-23   
emb|CAX74272.1|  Rab GDP dissociation inhibitor alpha                   106   2e-23   
ref|XP_007252464.1|  PREDICTED: rab GDP dissociation inhibitor be...    106   2e-23   
ref|XP_008617569.1|  acetyltransferase                                  106   2e-23   
ref|XP_010735220.1|  PREDICTED: rab GDP dissociation inhibitor be...    106   2e-23   
gb|KFG45654.1|  putative rab GDI alpha                                  104   2e-23   
emb|CDQ81740.1|  unnamed protein product                                107   2e-23   
ref|XP_002632610.1|  C. briggsae CBR-GDI-1 protein                      105   2e-23   
ref|XP_006219614.1|  PREDICTED: rab GDP dissociation inhibitor al...    105   3e-23   
gb|EFX87450.1|  hypothetical protein DAPPUDRAFT_207615                  105   3e-23   
ref|XP_002929734.1|  PREDICTED: v-type proton ATPase subunit S1-like    108   3e-23   
emb|CDQ60388.1|  unnamed protein product                                105   3e-23   
gb|EPY77252.1|  rab GDP dissociation inhibitor alpha                    105   3e-23   
ref|XP_006189977.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    105   3e-23   
ref|XP_006219613.1|  PREDICTED: rab GDP dissociation inhibitor al...    105   4e-23   
ref|XP_003286368.1|  Rab GDP dissociation inhibitor alpha               105   4e-23   
ref|XP_001357244.1|  GA18172                                            105   4e-23   
ref|XP_003421761.1|  PREDICTED: rab GDP dissociation inhibitor alpha    107   4e-23   
gb|ERL86573.1|  hypothetical protein D910_03980                         105   4e-23   
gb|ENN81299.1|  hypothetical protein YQE_02302                          105   4e-23   
gb|AAA28567.1|  GDP dissociation inhibitor                              105   4e-23   
gb|ADF97610.1|  GDP dissociation inhibitor 2                            105   4e-23   
ref|XP_001449183.1|  hypothetical protein                               105   4e-23   
gb|EGT45089.1|  CBN-GDI-1 protein                                       105   4e-23   
gb|ABZ10492.1|  ATPase, H+ transporting, lysosomal accessory prot...    107   4e-23   
ref|XP_001092845.2|  PREDICTED: rab GDP dissociation inhibitor al...    107   5e-23   
ref|XP_005701402.1|  PREDICTED: rab GDP dissociation inhibitor alpha    105   5e-23   
ref|XP_006877272.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   5e-23   
ref|XP_004390648.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   5e-23   
ref|XP_007955332.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   6e-23   
dbj|BAE88768.1|  unnamed protein product                                103   6e-23   
ref|XP_010885348.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   6e-23   
ref|XP_006043686.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
ref|XP_004717612.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
gb|AAB16907.1|  GDP-dissociation inhibitor                              103   7e-23   
ref|XP_007955331.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
ref|XP_002406620.1|  GDI-1 GDP dissociation inhibitor, putative         104   7e-23   
ref|XP_006877271.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
ref|XP_004390647.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
ref|XP_319173.1|  AGAP010025-PA                                         104   7e-23   
ref|XP_006373016.1|  hypothetical protein POPTR_0017s07190g             104   7e-23   
ref|XP_004914151.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   7e-23   
ref|NP_955949.1|  rab GDP dissociation inhibitor beta                   104   8e-23   
gb|AAQ91240.1|  GDP dissociation inhibitor 2                            104   8e-23   
ref|XP_004443399.1|  PREDICTED: rab GDP dissociation inhibitor alpha    104   8e-23   
ref|XP_004914152.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   8e-23   
ref|XP_004695296.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   8e-23   
ref|XP_002682172.1|  rab gdp dissociation inhibitor alpha               104   8e-23   
ref|XP_003462186.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   8e-23   
ref|XP_005614708.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   8e-23   
gb|AAD25536.1|  RAB GDP dissociation inhibitor alpha                    103   9e-23   
ref|XP_006806591.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   9e-23   
ref|XP_005614707.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   9e-23   
ref|XP_005340704.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   9e-23   
ref|XP_005965191.1|  PREDICTED: rab GDP dissociation inhibitor alpha    104   9e-23   
emb|CDW77704.1|  rab gdp dissociation inhibitor                         104   9e-23   
ref|XP_005742674.1|  PREDICTED: rab GDP dissociation inhibitor be...    103   9e-23   
ref|XP_004414561.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   9e-23   
gb|KFM69832.1|  Rab GDP dissociation inhibitor beta                     104   9e-23   
pdb|1LV0|A  Chain A, Crystal Structure Of The Rab Effector Guanin...    104   9e-23   
ref|XP_004717611.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   9e-23   
ref|NP_776489.1|  rab GDP dissociation inhibitor alpha                  104   9e-23   
ref|XP_005935395.1|  PREDICTED: rab GDP dissociation inhibitor be...    103   9e-23   
ref|XP_006633347.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   9e-23   
gb|ELR45814.1|  Rab GDP dissociation inhibitor alpha                    104   1e-22   
gb|KFB52589.1|  AGAP010025-PA-like protein                              104   1e-22   
ref|XP_009494546.1|  hypothetical protein H696_02370                    104   1e-22   
ref|XP_006167052.1|  PREDICTED: rab GDP dissociation inhibitor alpha    104   1e-22   
ref|XP_003449794.1|  PREDICTED: rab GDP dissociation inhibitor be...    103   1e-22   
ref|XP_008157491.1|  PREDICTED: rab GDP dissociation inhibitor alpha    104   1e-22   
gb|ELV11382.1|  Rab GDP dissociation inhibitor alpha                    103   1e-22   
ref|XP_005886169.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
emb|CAA64439.1|  GDP-dissociation inhibitor                             104   1e-22   
gb|ELK36938.1|  Rab GDP dissociation inhibitor alpha                    103   1e-22   
ref|XP_004914150.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   1e-22   
ref|XP_005742673.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   1e-22   
ref|XP_003449793.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   1e-22   
ref|XP_004695295.1|  PREDICTED: rab GDP dissociation inhibitor al...    104   1e-22   
ref|XP_004575313.1|  PREDICTED: rab GDP dissociation inhibitor be...    104   1e-22   
ref|XP_004286715.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
gb|EFB13348.1|  hypothetical protein PANDA_019987                       103   1e-22   
ref|XP_004672173.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_005713443.1|  GDP dissociation inhibitor                         104   1e-22   
ref|XP_001623557.1|  predicted protein                                  104   1e-22   
ref|XP_007457498.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_005641042.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_008707437.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_004598931.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_005280180.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    103   1e-22   
ref|XP_005370750.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_003462185.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_006739409.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_005086965.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_008587159.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_007538360.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_005340703.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_003802617.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
gb|EGW11375.1|  Rab GDP dissociation inhibitor alpha                    103   1e-22   
ref|XP_001964879.1|  GF21994                                            103   1e-22   
ref|NP_523524.2|  GDP dissociation inhibitor, isoform A                 103   1e-22   
ref|XP_004065179.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_006754857.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_004414560.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_007626277.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
gb|EPQ20175.1|  Rab GDP dissociation inhibitor alpha                    103   1e-22   
ref|XP_002036337.1|  GM12441                                            103   1e-22   
ref|XP_003279339.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_004892665.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_001969306.1|  GG24025                                            103   1e-22   
gb|ELK09749.1|  Rab GDP dissociation inhibitor alpha                    103   1e-22   
ref|XP_007185586.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_005886170.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_004875061.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_004031815.1|  rab gdp dissociation inhibitor, putative           103   1e-22   
ref|XP_004319581.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
gb|ABN12048.1|  putative GDP dissociation inhibitor                   99.8    1e-22   
ref|XP_010879263.1|  PREDICTED: rab GDP dissociation inhibitor be...    103   1e-22   
ref|XP_005414258.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_010879264.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_008884523.1|  rab GDI alpha, putative                            103   1e-22   
ref|XP_010637113.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_005595044.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_002367523.1|  rab GDP dissociation inhibitor alpha, putative     103   1e-22   
ref|XP_006915369.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   1e-22   
ref|XP_004286714.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   1e-22   
ref|XP_003512331.2|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|XP_008827816.1|  PREDICTED: rab GDP dissociation inhibitor alpha    103   2e-22   
gb|AAL60197.1|  guanosine diphosphate dissociation inhibitor 1          103   2e-22   
gb|ACC68908.1|  GDP dissociation inhibitor 1 (predicted)                103   2e-22   
gb|AAK49815.1|AF251042_1  rab GDP dissociation inhibitor alpha          103   2e-22   
gb|AAV74274.1|  GDP dissociation inhibitor 1                            103   2e-22   
ref|XP_007457497.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
gb|ERE63095.1|  rab GDP dissociation inhibitor alpha-like protein       103   2e-22   
ref|XP_005935394.1|  PREDICTED: rab GDP dissociation inhibitor be...    103   2e-22   
ref|XP_007626276.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|XP_005086964.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
dbj|BAE42320.1|  unnamed protein product                                103   2e-22   
ref|XP_004001071.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|XP_007538359.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|NP_058784.2|  rab GDP dissociation inhibitor alpha                  103   2e-22   
ref|NP_001003185.1|  rab GDP dissociation inhibitor alpha               103   2e-22   
dbj|BAK62169.1|  rab GDP dissociation inhibitor alpha                   103   2e-22   
emb|CAA52413.1|  rab GDI alpha                                          103   2e-22   
ref|XP_005370748.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|XP_004598930.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
ref|XP_004892664.1|  PREDICTED: rab GDP dissociation inhibitor al...    103   2e-22   
gb|EHH31218.1|  hypothetical protein EGK_21106                          103   2e-22   
ref|NP_001484.1|  rab GDP dissociation inhibitor alpha                  103   2e-22   



>gb|EYU36619.1| hypothetical protein MIMGU_mgv1a0073512mg, partial [Erythranthe 
guttata]
Length=153

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  37   GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDNPENELKPGIDLLGPVDEIFFETYDR  96

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            + P+N+++ DNCFISASYDA+THFESTV DVL MY+ ITGK +DL+VDLSAASA 
Sbjct  97   FEPVNEASVDNCFISASYDATTHFESTVVDVLNMYSMITGKILDLNVDLSAASAA  151



>ref|XP_004155432.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN43758.1| hypothetical protein Csa_7G065170 [Cucumis sativus]
Length=445

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVPIN+   DNCFIS SYD STHFESTV DVLAMY+KITGKAVDLSVDLSAASA  ++
Sbjct  388  YVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSKITGKAVDLSVDLSAASAASEE  445



>ref|XP_004137066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
Length=469

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIFYETYDR
Sbjct  352  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYETYDR  411

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVPIN+   DNCFIS SYD STHFESTV DVLAMY+KITGKAVDLSVDLSAASA  ++
Sbjct  412  YVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSKITGKAVDLSVDLSAASAASEE  469



>ref|XP_011092452.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Sesamum indicum]
Length=445

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNPE ELKPGVDLLG VDEIFYETY R
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVLTEAETDNPETELKPGVDLLGKVDEIFYETYHR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            +VP ND +ADNCFIS SYDA+THFESTV DVL+MYT ITGK +DLSVDLSAASAG
Sbjct  388  FVPTNDGSADNCFISTSYDATTHFESTVMDVLSMYTNITGKVLDLSVDLSAASAG  442



>gb|EPS65861.1| hypothetical protein M569_08910, partial [Genlisea aurea]
Length=449

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTE E+DNPE+ELKPGV+LLG VDEIFYE+YDR
Sbjct  332  GRKSDMYLFCCSYAHNVAPKGKYIAFVLTEGESDNPEEELKPGVELLGGVDEIFYESYDR  391

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGD  352
            +VP NDS ADNCFIS SYDASTHFESTV DVL +YTKITGK +DLSVDLSAASAG D
Sbjct  392  FVPTNDSVADNCFISKSYDASTHFESTVLDVLELYTKITGKVLDLSVDLSAASAGSD  448



>gb|EYU36626.1| hypothetical protein MIMGU_mgv1a0068452mg, partial [Erythranthe 
guttata]
 gb|EYU36627.1| hypothetical protein MIMGU_mgv1a0068452mg, partial [Erythranthe 
guttata]
Length=138

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  22   GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDDPESELKPGIDLLGPVDEIFFETYDR  81

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            + P+N+ + DNCFISASYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA 
Sbjct  82   FEPVNEPSLDNCFISASYDATTHFESTVVDVLNMYTLITGKVLDLNVDLSAASAA  136



>ref|XP_008455143.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Cucumis melo]
Length=445

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y+PIN+   D+CFIS SYD STHFESTVKDVLAMY+ ITGKAVDLSVDLSAASA  ++
Sbjct  388  YIPINNHETDSCFISTSYDGSTHFESTVKDVLAMYSNITGKAVDLSVDLSAASAASEE  445



>gb|EYU39113.1| hypothetical protein MIMGU_mgv1a006401mg [Erythranthe guttata]
Length=445

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFVLTEAETDNPE ELKPGVDLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPRGKYIAFVLTEAETDNPEVELKPGVDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            +VP ND+  D+C+IS SYDA+THFESTV DVLAMYTKITGK ++LSVDLS ASAG
Sbjct  388  FVPTNDTDVDHCYISTSYDATTHFESTVTDVLAMYTKITGKVLNLSVDLSEASAG  442



>gb|KHG03270.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=284

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE ELKPGVDLLGPV+EIFY+TYDR
Sbjct  167  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEVELKPGVDLLGPVEEIFYDTYDR  226

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP ND AAD+CFISASYD +THFE+TV DV+ MYTKITGK +DLSVDLSAA+A  ++
Sbjct  227  YVPTNDHAADSCFISASYDPTTHFETTVNDVIEMYTKITGKVLDLSVDLSAANAASEE  284



>gb|EPS59445.1| hypothetical protein M569_15362, partial [Genlisea aurea]
Length=187

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPGVDLLGPVDEIF+ETYDR
Sbjct  71   GRRSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPEVELKPGVDLLGPVDEIFFETYDR  130

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            + P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK VDL+VDLSAASA 
Sbjct  131  FEPVNEPSLDNCFISNSYDATTHFESTVADVLNMYTLITGKVVDLNVDLSAASAA  185



>ref|XP_009790990.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana sylvestris]
Length=445

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPGVD+LGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPETELKPGVDILGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            +VP +DSAADNCFIS SYD++THFESTV DVL MY+KITGK VDLSVDLSAASA  ++
Sbjct  388  FVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVVDLSVDLSAASATAEE  445



>ref|XP_007042843.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
 gb|EOX98674.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
Length=445

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  329  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  388

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N+  ADNCFISASYD +THFE+TV DV+ MY+KITGKA+DLSVDLSAASA
Sbjct  389  YVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYSKITGKALDLSVDLSAASA  442



>ref|XP_007042842.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
 gb|EOX98673.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N+  ADNCFISASYD +THFE+TV DV+ MY+KITGKA+DLSVDLSAASA
Sbjct  388  YVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYSKITGKALDLSVDLSAASA  441



>ref|XP_009364258.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELKPG DLLG VDEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N  A DNCFISASYDA+THFE+TV+DV+AMY+KITGKA+DLSVDLSAASA
Sbjct  387  YEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASA  440



>ref|XP_008385671.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
 ref|XP_008359208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
Length=443

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELKPG DLLG VDEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N  A DNCFISASYDA+THFE+TV+DV+AMY+KITGKA+DLSVDLSAASA
Sbjct  387  YEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASA  440



>ref|XP_006423751.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
 gb|ESR36991.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
Length=445

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP G+YIAFV TEAETDNPE ELKPG+DLLGPVDEIF++TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPEVELKPGIDLLGPVDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            +VP N+  AD+CFIS+SYDA+THFESTV+DVL MYTKITGKAVDLSVDLSAASA
Sbjct  388  FVPTNNHEADHCFISSSYDATTHFESTVQDVLEMYTKITGKAVDLSVDLSAASA  441



>ref|XP_008237140.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Prunus mume]
Length=445

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELKPG+DLLGP+DEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQVELKPGIDLLGPLDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP ND  AD+C+IS+SYDA+THFESTV+DVLAMYTK+TGKA+DLSVDLSAASA  ++
Sbjct  388  YVPTNDHQADSCYISSSYDATTHFESTVQDVLAMYTKLTGKALDLSVDLSAASATAEE  445



>ref|XP_006487500.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO51543.1| hypothetical protein CISIN_1g036458mg [Citrus sinensis]
Length=445

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP G+YIAFV TEAETDNPE ELKPG+DLLGPVDEIF++TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPEVELKPGIDLLGPVDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            +VP N+  AD+CFIS SYDA+THFESTV+DVL MYTKITGKAVDLSVDLSAASA
Sbjct  388  FVPTNNHEADHCFISTSYDATTHFESTVQDVLEMYTKITGKAVDLSVDLSAASA  441



>ref|XP_009593951.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana tomentosiformis]
Length=445

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD+P+ ELKPGVD+LGPVDEIFYETYD+
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPQTELKPGVDILGPVDEIFYETYDQ  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            +VP +DSAADNCFIS SYD++THFESTV DVL MY+KITGK VDLSVDLSAASA  ++
Sbjct  388  FVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVVDLSVDLSAASATAEE  445



>ref|XP_003635640.2| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Vitis vinifera]
 emb|CBI29595.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETDNPE ELKPG++LLG VDEIF++ YDR
Sbjct  24   GRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPEIELKPGIELLGQVDEIFFDAYDR  83

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P N    DNCFIS SYDA+THFESTV+DV+AMY++ITGK +DL+VDLSAASA  ++
Sbjct  84   YEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSRITGKNLDLTVDLSAASAADEE  141



>emb|CAB94202.1| GDP dissociation inhibitor [Solanum lycopersicum]
Length=438

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPGVD+LG VDEIFYETYDR
Sbjct  321  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYETYDR  380

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            ++P +DSAADNCFIS SYD++THFESTV DVL MY+KITGK +DLSVDLSAASA  ++
Sbjct  381  FIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSAASATAEE  438



>ref|XP_002522655.1| protein with unknown function [Ricinus communis]
 gb|EEF39742.1| protein with unknown function [Ricinus communis]
Length=443

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFV TEAETD PE ELKPG+DLLGPVDEI YETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPRGKYIAFVTTEAETDTPEVELKPGIDLLGPVDEILYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y+P N+  ADNCFIS SYDA+THFE+TV DV+AMY+KITGK +DLSVDLSAASA
Sbjct  388  YIPANNPEADNCFISTSYDATTHFETTVDDVIAMYSKITGKTLDLSVDLSAASA  441



>ref|XP_004230543.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Solanum lycopersicum]
 emb|CAM97308.1| Rab-GDP dissociation inhibitor [Solanum lycopersicum]
Length=445

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPGVD+LG VDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            ++P +DSAADNCFIS SYD++THFESTV DVL MY+KITGK +DLSVDLSAASA  ++
Sbjct  388  FIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSAASATAEE  445



>ref|XP_002310487.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
 gb|EEE90937.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
Length=444

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GK+IAFV  EAETDNPE ELKPG+DLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPQGKFIAFVSAEAETDNPEIELKPGIDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGD  352
            YVPIN    DNCFIS SYDA+THFE+TV+DV+AMY++ITGK +DLSVDLSAASA  +
Sbjct  388  YVPINTMKDDNCFISTSYDATTHFETTVQDVIAMYSEITGKTLDLSVDLSAASAAAE  444



>ref|XP_011023058.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Populus euphratica]
Length=444

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFV  EAETDNPE ELKPG+DLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPQGKYIAFVSAEAETDNPELELKPGIDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVPIN    DNCFIS SYDA+THFE+TV+DV+A+Y++ITGK +DLSVDLSAASA
Sbjct  388  YVPINTMKEDNCFISTSYDATTHFETTVQDVIAIYSEITGKTLDLSVDLSAASA  441



>ref|XP_006351732.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=445

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPGVD+LG VDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            +VP +DSAADNCFIS SYD++THFESTV DVL MY+KITGK +DLSVDLS+ASA  ++
Sbjct  388  FVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSSASATAEE  445



>ref|XP_008236115.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Prunus mume]
Length=443

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELK G DLLGP+DEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKAGTDLLGPIDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N +  DNCFISASYDA+THFE+TV+DV+AMY+KITGK +DLSVDLSAASA
Sbjct  387  YEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSKITGKTLDLSVDLSAASA  440



>ref|XP_007205201.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
 gb|EMJ06400.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
Length=443

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELK G DLLGP+DEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKAGTDLLGPIDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N +  DNCFISASYDA+THFE+TV+DV+AMY+KITGK +DLSVDLSAASA
Sbjct  387  YEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSKITGKTLDLSVDLSAASA  440



>emb|CDX69899.1| BnaA10g22480D [Brassica napus]
Length=315

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  198  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDT  257

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N    DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA
Sbjct  258  YVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTLDLSVDLSAASA  311



>ref|XP_007199860.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
 gb|EMJ01059.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
Length=445

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELK G+DLLGP+DEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQVELKSGIDLLGPLDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP ND   D+C+IS+SYDA+THFESTV+DVLAMYTKITGKA+DLSVDLSAASA  ++
Sbjct  388  YVPTNDHQVDSCYISSSYDATTHFESTVQDVLAMYTKITGKALDLSVDLSAASATAEE  445



>ref|XP_011074031.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Sesamum indicum]
Length=444

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGIDLLGPVDEIFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL +YT ITGK +DL+VDLSAASA
Sbjct  388  YEPVNEPGQDNCFISTSYDATTHFESTVVDVLNLYTSITGKVLDLNVDLSAASA  441



>ref|XP_009345712.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFVLTEAETDNP+ ELKPG DLLG VDEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N    DNCFISASYDA+THFE+TV+DV+AMY+KITGKA+DLSVDLSAASA
Sbjct  387  YEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASA  440



>ref|XP_008363741.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Malus domestica]
Length=443

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFVLTEAETDNP+ ELKPG DLLG VDEIF++TYDR
Sbjct  327  GRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N    DNCFISASYDA+THFE+TV+DV+AMY+KITGKA+DLSVDLSAASA
Sbjct  387  YEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASA  440



>ref|XP_002461825.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
 gb|EER98346.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
Length=446

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+A KGKYIAFV  +AETDNPEKELKPG+DLLG VDE+F +TYDR
Sbjct  328  GRRSDMYVFCCSYSHNVASKGKYIAFVSAQAETDNPEKELKPGIDLLGTVDELFIDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P NDS+ADNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  YEPSNDSSADNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAADDD  445



>ref|XP_006584965.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X4 [Glycine max]
Length=371

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  254  GRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  313

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND  AD CFIS SYDA+THFE+TVKDV+ +Y+KITGK +DLSVDLSAASA  ++
Sbjct  314  FEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  371



>ref|XP_009410720.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P+ ELKPG+DLLGPVDE+F+ETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPDVELKPGIDLLGPVDELFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + D+CFISASYDA+THFESTV DVL+MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDHCFISASYDATTHFESTVTDVLSMYTMITGKTVDLSVDLSAASA  441



>gb|EYU22361.1| hypothetical protein MIMGU_mgv1a006444mg [Erythranthe guttata]
Length=444

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDDPESELKPGIDLLGPVDEIFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFISASYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISASYDATTHFESTVVDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_010030005.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Eucalyptus grandis]
Length=374

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFV  EAETDNP++ELKPG++LLGPVDE+F++ YDR
Sbjct  254  GRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELLGPVDEMFFDIYDR  313

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDDE  358
            YVP N+   DNCFIS SYDASTHFE+TV DVLAMY+KITGK ++LSVDL+AASA  + +
Sbjct  314  YVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSVDLNAASAATEQQ  372



>ref|XP_010101319.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88266.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=334

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG DLLGPVDEIFY+ YDR
Sbjct  218  GRISDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGTDLLGPVDEIFYDMYDR  277

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA 
Sbjct  278  YEPVNEPTLDNCFISTSYDATTHFESTVIDVLNMYTLITGKVVDLSVDLSAASAA  332



>gb|KDO49754.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=370

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELKPG+DLLGPVDEIFY+ YDR
Sbjct  254  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYDIYDR  313

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA 
Sbjct  314  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAA  368



>ref|XP_004288515.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELKPG DLLGPVD+IF++TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGPVDDIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N S AD+CFIS SYDA+THFE+TV+DV+AMY  ITGK +DL+VDLSAASA
Sbjct  388  YEPTNQSEADHCFISGSYDATTHFETTVQDVIAMYGNITGKVLDLTVDLSAASA  441



>ref|XP_006654412.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLGPVDE+F++TYDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGPVDELFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>ref|XP_008354312.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV T+AETD+PE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELKPGIDLLGPVDEIFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ A DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPALDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_009131116.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N    DNCFIS SYDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNQQEEDNCFISGSYDATTHFESTVSDVLEMYTKITGKTLDLSVDLSAASAAAEN  445



>ref|XP_006289683.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
 gb|EOA22581.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
Length=445

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV   AETDNPE+ELKPG++LLGPVDEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIELLGPVDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N+   DNCFISA+YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAAEN  445



>ref|XP_010067402.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X2 [Eucalyptus grandis]
 gb|KCW87998.1| hypothetical protein EUGRSUZ_A00407 [Eucalyptus grandis]
Length=444

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCS  H +APKGK+IAFV  EAETD PE ELKPGV+LLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPEIELKPGVNLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+S+ DNCFIS+SYDA+THFESTVKDVL MYTKITGK +DLSVDLSAASA
Sbjct  388  YEPVNESSVDNCFISSSYDATTHFESTVKDVLNMYTKITGKVLDLSVDLSAASA  441



>ref|XP_004504841.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
Length=445

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD PE ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND A D CFIS SYDA+THFE+TVKDV+ MY+KITGK +DLSVDLSAASA  ++
Sbjct  388  FEPTNDHATDGCFISTSYDATTHFETTVKDVVQMYSKITGKVLDLSVDLSAASATAEE  445



>ref|XP_002513702.1| protein with unknown function [Ricinus communis]
 gb|EEF48649.1| protein with unknown function [Ricinus communis]
Length=444

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGKYIAFV +EAETDNPE ELKPG+DLLGPVDEIF+E YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKYIAFVSSEAETDNPEVELKPGIDLLGPVDEIFFEVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MY+ ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSMITGKVLDLSVDLSAASA  441



>ref|XP_010452948.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Camelina sativa]
Length=445

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV   AETDNPE+ELKPG++LLGPVDEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIELLGPVDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N+   DNCFISA+YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAAEN  445



>gb|KCW87999.1| hypothetical protein EUGRSUZ_A00408 [Eucalyptus grandis]
Length=417

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV  EAETD PE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  301  GRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGLDLLGPVDEIFYDTYDR  360

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  361  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  414



>ref|XP_010254526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Nelumbo nucifera]
Length=445

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD PE ELKPG+ LLGPVDE+F++ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSTEAETDQPEVELKPGIGLLGPVDEMFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y PIN+  ADNCFIS SYDA+THFESTVKDV+AMY++ITGK +DL+VDLSAASA  ++
Sbjct  388  YEPINNHDADNCFISTSYDATTHFESTVKDVIAMYSQITGKTLDLTVDLSAASAASEE  445



>ref|XP_006584964.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X3 [Glycine max]
Length=413

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  296  GRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  355

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND  AD CFIS SYDA+THFE+TVKDV+ +Y+KITGK +DLSVDLSAASA  ++
Sbjct  356  FEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  413



>emb|CDY56553.1| BnaA03g55960D [Brassica napus]
Length=445

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N    DNCFIS SYDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAASATAEN  445



>ref|XP_006372308.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|ABK93982.1| unknown [Populus trichocarpa]
 gb|ABK95445.1| unknown [Populus trichocarpa]
 gb|ERP50105.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVVDLSVDLSAASA  441



>ref|XP_009122523.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Brassica rapa]
Length=445

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N    DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA
Sbjct  388  YVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTLDLSVDLSAASA  441



>emb|CDY21587.1| BnaC09g47050D [Brassica napus]
Length=445

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N    DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA
Sbjct  388  YVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTLDLSVDLSAASA  441



>ref|XP_006399435.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
 gb|ESQ40888.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
Length=445

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP GKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPNGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N+   DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNNQEEDNCFISGTYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAASAAAEN  445



>ref|XP_006584963.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Glycine max]
Length=451

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  334  GRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  393

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND  AD CFIS SYDA+THFE+TVKDV+ +Y+KITGK +DLSVDLSAASA  ++
Sbjct  394  FEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  451



>ref|XP_010422972.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Camelina sativa]
Length=445

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV   AETDNPE+ELKPG+ LLGPVDEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIXLLGPVDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N+   DNCFISA+YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAAEN  445



>ref|XP_003531017.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Glycine max]
 gb|KHN46259.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=445

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND  AD CFIS SYDA+THFE+TVKDV+ +Y+KITGK +DLSVDLSAASA  ++
Sbjct  388  FEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  445



>ref|XP_004984243.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=446

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+A KGK+IAFV  +AETDNPE ELKPG+DLLGPVDE+F +TYDRY
Sbjct  329  RKSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPETELKPGIDLLGPVDELFIDTYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             P NDS++DNC+IS SYDA+THFESTV DVL++YTKITGKAVDLSVDLSAASA  DD
Sbjct  389  EPTNDSSSDNCYISTSYDATTHFESTVMDVLSLYTKITGKAVDLSVDLSAASASEDD  445



>gb|ACU24317.1| unknown [Glycine max]
Length=237

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  121  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDIYDR  180

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCF+S SYDA+THFESTV DVL MYT ITGK +DLSVD SAASA
Sbjct  181  YEPVNEPTLDNCFVSTSYDATTHFESTVDDVLNMYTLITGKVIDLSVDFSAASA  234



>ref|XP_006852946.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
 gb|ERN14413.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
Length=448

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD PE ELKPG+DLLGPVDE F++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDEPEVELKPGIDLLGPVDEKFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDDED  361
            Y P N    DNCFIS SYDASTHFESTV+DVLAMY+KITGK +DL+VDLS ASA G++ +
Sbjct  388  YEPTNKHDGDNCFISTSYDASTHFESTVEDVLAMYSKITGKVLDLTVDLSGASASGEESE  447



>gb|KCW56943.1| hypothetical protein EUGRSUZ_I02620 [Eucalyptus grandis]
Length=427

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFV  EAETDNP++ELKPG++LLGPVDE+F++ YDR
Sbjct  307  GRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELLGPVDEMFFDIYDR  366

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDDE  358
            YVP N+   DNCFIS SYDASTHFE+TV DVLAMY+KITGK ++LSVDL+AASA  + +
Sbjct  367  YVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSVDLNAASAATEQQ  425



>ref|XP_009366269.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Pyrus x bretschneideri]
Length=444

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV T+AETD+PE ELKPG+DLLGPVDEIF+ETYDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELKPGIDLLGPVDEIFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_006441986.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
 gb|ESR55226.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
Length=444

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_010067212.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Eucalyptus grandis]
Length=444

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV  EAETD PE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGLDLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_006478491.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO49750.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=444

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>gb|AAR06264.1| GDP dissociation inhibitor protein [Hordeum vulgare]
Length=445

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+A KGK+IAFV  +AE+DNPE ELKPG+DLLGPVDE+F++TYDR
Sbjct  328  GRRSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  YEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAAEDD  445



>ref|XP_011014748.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Populus euphratica]
Length=444

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_011004551.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Populus euphratica]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_009404932.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPVDE+F+ETYD 
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPEVELKPGIDLLGPVDELFFETYDI  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL+MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLSMYTMITGKTLDLSVDLSAASA  441



>ref|XP_008349850.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Malus domestica]
Length=279

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  20   YLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPIND  199
            YLFCCSY HN+APKGKYIAFVLTEAETDNP+ ELKPG DLLG VDEIF++TYDRY P N 
Sbjct  169  YLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDRYEPTNQ  228

Query  200  SAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             A DNCFISASYDA+THFE+TV+DV+AMY+KITGKA+DLSVDLSAASA
Sbjct  229  DAGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASA  276



>ref|XP_009620915.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Nicotiana tomentosiformis]
 ref|XP_009757991.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
 gb|AAB80717.1| GDP dissociation inhibitor [Nicotiana tabacum]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELK GV+LLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKQGVNLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+ + DNCFIS SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA
Sbjct  388  SEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASA  441



>ref|NP_001140939.1| uncharacterized protein LOC100273017 [Zea mays]
 gb|ACF85003.1| unknown [Zea mays]
 tpg|DAA39802.1| TPA: hypothetical protein ZEAMMB73_457429 [Zea mays]
Length=446

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+A KGK+IAFV  +AETDNPEKELKPG+DLLG VDE+F + YDR
Sbjct  328  GRRSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPEKELKPGIDLLGKVDELFIDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P NDS+ADNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  YEPTNDSSADNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAAEDD  445



>ref|XP_011005244.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
 ref|XP_011005245.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPEVELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_008812865.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Phoenix dactylifera]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GK+IAFV TEAETD PE ELKPG+DLLGPVDE+F++TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPRGKFIAFVSTEAETDRPEIELKPGIDLLGPVDELFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            +VP+N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLSAASA
Sbjct  388  FVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKNVDLSVDLSAASA  441



>ref|XP_002268877.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
 emb|CBI34015.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD PE ELK GVDLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDQPEVELKRGVDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P ND   D+CFIS SYDA+THFESTVK+V+AMY+KITG+ +DL+VDLSAASA
Sbjct  388  FEPKNDHEVDHCFISTSYDATTHFESTVKNVIAMYSKITGEELDLTVDLSAASA  441



>ref|XP_002310371.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|EEE90821.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPEVELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_008788293.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Phoenix dactylifera]
Length=444

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDE+F++TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPEMELKPGIDLLGPVDELFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            +VP+N+ + DNCFIS SYD +THFESTV DVL MY  ITGK VDLSVDLSAASA
Sbjct  388  FVPVNEPSLDNCFISTSYDGTTHFESTVMDVLHMYRMITGKDVDLSVDLSAASA  441



>gb|AHF81486.1| small GTP Rab-GDI [Mangifera indica]
Length=444

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE EL+PG+DLLGPVDE+F+E  DR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPEAELRPGIDLLGPVDEMFFEVLDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|NP_196517.3| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
 sp|Q9LXC0.1|GDI_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550; Short=AtGDI [Arabidopsis thaliana]
 emb|CAB89375.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AED91409.1| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N    DNCFISA+YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNIQEEDNCFISATYDATTHFESTVVDVLDMYTKITGKTLDLSVDLSAASAAAEN  445



>ref|XP_010030006.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Eucalyptus grandis]
Length=457

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP+GKYIAFV  EAETDNP++ELKPG++LLGPVDE+F++ YDR
Sbjct  337  GRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELLGPVDEMFFDIYDR  396

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDDE  358
            YVP N+   DNCFIS SYDASTHFE+TV DVLAMY+KITGK ++LSVDL+AASA  + +
Sbjct  397  YVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSVDLNAASAATEQQ  455



>ref|XP_009416240.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGKYIAFV TEAETD+PE ELKPG+DLLGPVDE F++ YDR
Sbjct  328  GRRSDMYVFCCSYAHNVAPKGKYIAFVSTEAETDHPETELKPGIDLLGPVDETFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P N    DNCFIS SYDA+THFESTV+DV++MY KITGK +DLSVDLSAASA G+D
Sbjct  388  YEPANHDEQDNCFISTSYDATTHFESTVQDVISMYKKITGKELDLSVDLSAASAAGED  445



>ref|XP_011074023.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Sesamum indicum]
Length=444

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++TYDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_010908336.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Elaeis guineensis]
Length=444

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK++AFV TEAETD+PE ELKPG+DLLGPVDE+F+ETYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFVAFVSTEAETDHPEIELKPGIDLLGPVDELFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             VP+N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLSAASA
Sbjct  388  SVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKDVDLSVDLSAASA  441



>ref|XP_004138948.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 ref|XP_004168317.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN61451.1| hypothetical protein Csa_2G123620 [Cucumis sativus]
Length=444

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV TEAETD+PE ELKPG+DLLG VDEIF++TYDR
Sbjct  328  GRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPESELKPGIDLLGAVDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGKAVDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTMITGKAVDLSVDLSAASA  441



>ref|XP_009125364.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETD+PE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPEEELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N    DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA
Sbjct  388  YVPTNKQEEDNCFISGTYDATTHFESTVSDVLEMYTKITGKTLDLSVDLSAASA  441



>ref|XP_010930328.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Elaeis guineensis]
Length=412

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAET+ PE ELKPG+DLLGPVD IF++TYDR
Sbjct  296  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDR  355

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   D+CFIS SYDA+THFESTV DVLA+YTKITGK VDLSVDLSAASA
Sbjct  356  YEPVNEPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGKTVDLSVDLSAASA  409



>ref|XP_007202054.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
 gb|EMJ03253.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
Length=444

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPV+EIF++ YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVEEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y+P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YLPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_010101313.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88260.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=452

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG DLLGPVDEIFY+ YDR
Sbjct  336  GRISDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGTDLLGPVDEIFYDMYDR  395

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA
Sbjct  396  YEPVNEPTLDNCFISTSYDATTHFESTVIDVLNMYTLITGKVVDLSVDLSAASA  449



>ref|XP_008441682.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Cucumis melo]
Length=444

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV TEAETD+PE ELKPG+DLLG +DEIF++TYDR
Sbjct  328  GRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPESELKPGIDLLGAIDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGKAVDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTMITGKAVDLSVDLSAASA  441



>gb|EMT13930.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=424

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  307  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFDMYDR  366

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGD  352
            Y P+N+ + DNCF+S+SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA  D
Sbjct  367  YEPVNEPSLDNCFVSSSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAAED  423



>ref|XP_006351084.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPGV LLGPVDEI YETYDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPENELKPGVSLLGPVDEIVYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+   DNCF+S SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA
Sbjct  388  SEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASA  441



>ref|XP_008801349.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Phoenix dactylifera]
Length=416

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAET+ P+ ELKPG+DLLGPVDEIF++TYDR
Sbjct  300  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQVELKPGIDLLGPVDEIFFDTYDR  359

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+   DNCFIS SYDA+THFESTV DVLA+YTKITGK +DLSVDLSAASA
Sbjct  360  CEPVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTKITGKTIDLSVDLSAASA  413



>gb|KFK25257.1| hypothetical protein AALP_AA8G088700 [Arabis alpina]
Length=445

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            YVP N+   DNCFIS +Y ASTHFESTV DVL MYTKITGK +DLSVDLSAASA
Sbjct  388  YVPTNNQEEDNCFISGTYCASTHFESTVVDVLEMYTKITGKTLDLSVDLSAASA  441



>gb|KDP45816.1| hypothetical protein JCGZ_17423 [Jatropha curcas]
Length=444

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV +EAETD+PE ELKPG+DLLGPVDEIFYE YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDHPEVELKPGIDLLGPVDEIFYEIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MY+ ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSLITGKELDLSVDLSAASA  441



>gb|ABK24357.1| unknown [Picea sitchensis]
Length=299

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCS+ HN+APKGKYIAFV TEAETD PEKEL+PG++LLG VDE+F++TYD 
Sbjct  183  GRKSDMYVFCCSHSHNVAPKGKYIAFVSTEAETDQPEKELQPGLNLLGAVDEMFFDTYDI  242

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFE+TV+DVLAMYT+ITGK +DLSVDLSAASA
Sbjct  243  YEPVNEPSLDNCFISKSYDATTHFETTVQDVLAMYTQITGKVLDLSVDLSAASA  296



>ref|XP_004244786.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPGV LLGPVDEI YETYDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPENELKPGVSLLGPVDEIVYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+   DNCF+S SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA
Sbjct  388  SEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASA  441



>gb|ACN65853.1| Rab GDP dissociation inhibitor [Nicotiana benthamiana]
Length=444

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE EL+ GV+LLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELEQGVNLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+ + DNCFIS SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA
Sbjct  388  SEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASA  441



>ref|XP_008394248.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV T+AETD+PE EL+PG+DLLGPVDEIF+E YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELRPGIDLLGPVDEIFFEMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_008801341.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Phoenix dactylifera]
Length=444

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAET+ P+ ELKPG+DLLGPVDEIF++TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQVELKPGIDLLGPVDEIFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
              P+N+   DNCFIS SYDA+THFESTV DVLA+YTKITGK +DLSVDLSAASA
Sbjct  388  CEPVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTKITGKTIDLSVDLSAASA  441



>ref|XP_002871374.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47633.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLG +DEIFY +Y+ 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGSIDEIFYHSYET  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N+   DNCFISA+YDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  ++
Sbjct  388  YVPTNNQEEDNCFISATYDATTHFESTVVDVLDMYTKITGKTLDLSVDLSAASAAAEN  445



>gb|EMS53635.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=424

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  307  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFDMYDR  366

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S+SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  367  YEPVNEPSLDNCFVSSSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASA  420



>ref|XP_008243091.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Prunus mume]
Length=444

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPV+EIF++ YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVEEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  441



>gb|AFK40299.1| unknown [Lotus japonicus]
Length=370

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  254  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDMYDR  313

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  314  FEPVNEPSLDNCFISTSYDATTHFESTVVDVLNMYTMITGKVLDLSVDLSAASA  367



>ref|XP_010526899.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Tarenaya hassleriana]
Length=444

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPGVDLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGVDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFETTVVDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_007026462.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
 gb|EOY06964.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
Length=445

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV TEAETD+PE EL+PG+DLLGPVDEIF++ YDR
Sbjct  329  GRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPETELRPGIDLLGPVDEIFFDIYDR  388

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASA  442



>ref|XP_007026461.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
 gb|EOY06963.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
Length=444

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV TEAETD+PE EL+PG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPETELRPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_007159565.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
 gb|ESW31559.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
Length=445

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV +EAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDQPAIELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+ A DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  ++
Sbjct  388  YEPVNEPALDNCFISMSYDATTHFESTVDDVLNMYTMITGKVIDLSVDLSAASAAEEE  445



>gb|KHG05683.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=444

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGP DEIF++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPFDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YKPVNEPSLDNCFISTSYDATTHFESTVSDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_010067325.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X1 [Eucalyptus grandis]
Length=444

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCS  H +APKGK+IAFV  EAETD PE ELKPGV+LLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPEIELKPGVNLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+S+ DNCFIS+SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNESSVDNCFISSSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|NP_001055142.1| Os05g0304400 [Oryza sativa Japonica Group]
 dbj|BAF17056.1| Os05g0304400 [Oryza sativa Japonica Group]
 gb|EAY97451.1| hypothetical protein OsI_19382 [Oryza sativa Indica Group]
 dbj|BAG93308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63167.1| hypothetical protein OsJ_17976 [Oryza sativa Japonica Group]
Length=445

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV TEAETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQSELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKAVDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKAVDLSVDLSAASA  441



>gb|AAB69871.1| GDP dissociation inhibitor protein OsGDI2 [Oryza sativa]
Length=445

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV TEAETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQSELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKAVDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKAVDLSVDLSAASA  441



>ref|XP_010691404.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETDNPE ELKPG+DLLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAAKGKYIAFVTTEAETDNPEAELKPGIDLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P N    D+CFIS SYDA+THFESTVKDV+ +Y KITGK +DL+VDL+AASA  ++
Sbjct  388  YEPTNSPETDSCFISTSYDATTHFESTVKDVIGLYNKITGKELDLTVDLNAASAAPEE  445



>ref|XP_006344947.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSD+YLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG VDEIF+E YDR
Sbjct  328  GRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|NP_001274860.1| rab GDP dissociation inhibitor alpha-like [Solanum tuberosum]
 gb|ABB87112.1| GDP dissociation inhibitor 1-like [Solanum tuberosum]
Length=444

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSD+YLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG VDEIF+E YDR
Sbjct  328  GRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_004251972.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSD+YLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG VDEIF+E YDR
Sbjct  328  GRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_002280606.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Vitis vinifera]
 emb|CAN70679.1| hypothetical protein VITISV_044153 [Vitis vinifera]
 emb|CBI24770.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIFY+ Y+R
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFYDIYER  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + D CFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  FEPVNEPSLDQCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASA  441



>ref|XP_003529259.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
Length=445

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+A KGKYIAFV TEAETD PE ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND  AD CFIS SYDA+THFE+TVKDV+ +Y+KITGK +DLSVDLSAASA  ++
Sbjct  388  FEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  445



>ref|XP_006657603.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=446

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+A KGK+IAFV  +AE++NPE ELKPG+DLLGPVDE+F +TYDR
Sbjct  328  GRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPEAELKPGIDLLGPVDELFIDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  FEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAAEDD  445



>ref|XP_010524208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Tarenaya hassleriana]
Length=444

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+AP+GK+IAFV T+AETDNP+ ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPRGKFIAFVSTDAETDNPQTELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFETTVADVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_009784522.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
Length=444

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG VDEIF+E YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_003531293.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
 gb|KHN48088.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=444

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCF+S SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPTLDNCFVSTSYDATTHFESTVDDVLNMYTLITGKVIDLSVDLSAASA  441



>dbj|BAJ91005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=237

 Score =   186 bits (472),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMY+FCCSY HN+APKGK+IAFV  EAE+DN + ELKPG+DLLGPVDE+F++ YDR
Sbjct  119  GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  178

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGKA+DL+VDLSAASA  ++
Sbjct  179  YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKAIDLTVDLSAASAAEEE  236



>gb|ABU98948.1| GDP-dissociation inhibitor [Lupinus albus]
Length=444

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV  EAET +PE ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETGHPESELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASA  441



>ref|XP_009629496.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana tomentosiformis]
Length=444

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG +DEIF+E YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQIDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_002533685.1| protein with unknown function [Ricinus communis]
 gb|EEF28701.1| protein with unknown function [Ricinus communis]
Length=445

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
             RKSDMYLFCCSY HN+APKGKYIAFV TEAETD+P+ ELKPG+DLLGPVDE+F+ETYDR
Sbjct  328  ARKSDMYLFCCSYTHNVAPKGKYIAFVTTEAETDDPQTELKPGLDLLGPVDEMFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P N    DNCFIS SYDA+THFE+TV+DV+AMY+KITGK +DL+VDL+AA A  ++
Sbjct  388  YEPTNQHDVDNCFISTSYDATTHFETTVQDVIAMYSKITGKTLDLTVDLNAAGAATEE  445



>ref|XP_010646794.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
Length=445

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETDNPE ELKPG++LLG VDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPEIELKPGIELLGQVDEIFFDAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N    DNCFIS SYDA+THFESTV+DV+AMY++ITGK +DL+VDLSAASA
Sbjct  388  YEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSRITGKNLDLTVDLSAASA  441



>ref|XP_010469257.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Camelina sativa]
Length=444

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>emb|CAN64340.1| hypothetical protein VITISV_031564 [Vitis vinifera]
Length=445

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETDNPE ELKPG++LLG VDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPEIELKPGIELLGQVDEIFFDAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P N    DNCFIS SYDA+THFESTV+DV+AMY++ITGK +DL+VDLSAASA
Sbjct  388  YEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSRITGKNLDLTVDLSAASA  441



>ref|XP_010413620.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|XP_010547647.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Tarenaya hassleriana]
Length=445

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPGVDLLGPVDEIFY++YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGVDLLGPVDEIFYDSYDI  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y+P ND+  D+CFISA+YDASTHFESTV DVL MYTKITGK +DLSVDL
Sbjct  388  YLPSNDAEKDHCFISATYDASTHFESTVVDVLQMYTKITGKTLDLSVDL  436



>gb|ABK25073.1| unknown [Picea sitchensis]
 gb|ABR17192.1| unknown [Picea sitchensis]
 gb|ACN40669.1| unknown [Picea sitchensis]
Length=444

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGKYIAFV  EA+TD PE EL+PG+ LLGPVDE+F++TYDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKYIAFVSAEADTDQPEVELQPGIALLGPVDEMFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            +VP+N+ + DNCFIS SYDA+THFE+TV+DVLAMYT ITGK +DL+VDLSAASA
Sbjct  388  FVPVNEPSLDNCFISTSYDATTHFETTVQDVLAMYTHITGKVLDLTVDLSAASA  441



>ref|XP_010512285.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|XP_009104231.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brassica rapa]
Length=444

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>emb|CDX98399.1| BnaC06g17600D [Brassica napus]
 emb|CDX67817.1| BnaA07g18570D [Brassica napus]
Length=444

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|XP_010907542.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Elaeis guineensis]
Length=444

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV +EAETD PE ELKPG+DLLGPVDE+F++TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSSEAETDRPEIELKPGIDLLGPVDELFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLS ASA
Sbjct  388  FEPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKNVDLSVDLSVASA  441



>ref|NP_001151199.1| LOC100284832 [Zea mays]
 gb|ACF87775.1| unknown [Zea mays]
 gb|ACG41958.1| rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGQVDELFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL+MYT ITGK VDLSVDLSAASA
Sbjct  388  YKPVNEPSLDNCFVSMSYDATTHFETTVTDVLSMYTAITGKTVDLSVDLSAASA  441



>dbj|BAJ93199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ +  NCF+S+SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLGNCFVSSSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASA  441



>gb|ABR16699.1| unknown [Picea sitchensis]
Length=444

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCS+ HN+APKGKYIAFV TEAETD PEKEL+PG++LLG VDE+F++TYD 
Sbjct  328  GRKSDMYVFCCSHSHNVAPKGKYIAFVSTEAETDQPEKELQPGLNLLGAVDEMFFDTYDI  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFE+TV+DVLAMYT+ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISKSYDATTHFETTVQDVLAMYTQITGKVLDLSVDLSAASA  441



>ref|XP_004287194.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFC SY HN+APKGK+IAFV TEAETDNP+ ELKPG+DLLGPV+EIF++ YDR
Sbjct  328  GRRSDMYLFCSSYSHNVAPKGKFIAFVSTEAETDNPQTELKPGIDLLGPVEEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPVLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASA  441



>gb|KDP29973.1| hypothetical protein JCGZ_18740 [Jatropha curcas]
Length=446

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD PE ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDTPEVELKPGLDLLGPVDEIFYDAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y PIN+S  DNCF+SASYDA++HFE+TV DV+AMY KITGKA+DLSVDL
Sbjct  388  YEPINNSEDDNCFVSASYDATSHFETTVDDVIAMYCKITGKALDLSVDL  436



>ref|XP_003568439.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brachypodium distachyon]
Length=445

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGSVDELFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+SASYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSASYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>ref|XP_010251442.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
 ref|XP_010251443.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAET+ PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYAHNVAPKGKFIAFVTTEAETNQPEVELKPGIDLLGPVDEIFFDVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT I GK +DL VDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMIIGKVLDLGVDLSAASA  441



>ref|XP_008649650.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Zea mays]
 gb|AFW78025.1| hypothetical protein ZEAMMB73_176599 [Zea mays]
Length=445

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETDNP+ ELKPG+DLLG VDEIFY+ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGIDLLGSVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>ref|NP_001276273.1| rab GDP dissociation inhibitor alpha-like [Glycine max]
 gb|ACU21333.1| unknown [Glycine max]
Length=444

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P   LKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIGLKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVIDLSVDLSAASA  441



>emb|CDY05962.1| BnaA09g38180D [Brassica napus]
Length=444

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A+DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>gb|EMS53287.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=447

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             P+N +  DNCF++ SYDA+THFE+TVKDVLA+Y+KITGK +DLSVDL+AASAG +D
Sbjct  389  EPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSKITGKELDLSVDLNAASAGEND  445



>ref|XP_004962065.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=445

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ EL+PG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELRPGIDLLGQVDELFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL+MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTAITGKTVDLSVDLSAASA  441



>ref|XP_006858694.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
 gb|ERN20161.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
Length=444

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY H +APKGK+IAFV  +AET+ PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHMVAPKGKFIAFVAADAETNKPEIELKPGIDLLGPVDEIFFDVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV+DVL+MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVQDVLSMYTMITGKVLDLSVDLSAASA  441



>ref|XP_009116668.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X2 [Brassica rapa]
Length=444

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A+DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>emb|CDX81131.1| BnaC03g03850D [Brassica napus]
Length=445

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETDNPE+ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYHSYDA  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            YVP N    DNCFIS SYDA+THFESTV DVL MYTKITGK +DLSVDLSAASA  D+
Sbjct  388  YVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAASAAADN  445



>ref|XP_003557314.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brachypodium distachyon]
Length=446

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+A KGK+IAFV  +AE+DNPE ELKPG+DLLGPVDE+F + YDR
Sbjct  328  GRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFIDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
              P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  SEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAAEDD  445



>ref|XP_010937652.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Elaeis guineensis]
Length=446

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGKYIAFV TEAETD PE ELKPG+DLLG VDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPEVELKPGIDLLGSVDEIFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             PIN    DNCFIS SYDA+THFESTV+DV++MY++ITGK +DL+VDLSAASA  +D
Sbjct  389  EPINKHDEDNCFISTSYDATTHFESTVQDVISMYSRITGKELDLTVDLSAASAAPED  445



>ref|NP_001059344.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAC79568.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF21258.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAG91529.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+A KGK+IAFV  +AE++NP  ELKPG+DLLGPVDE+F +TYDR
Sbjct  328  GRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPAAELKPGIDLLGPVDELFIDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  388  FEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASAAEDD  445



>emb|CDY44805.1| BnaC02g00820D [Brassica napus]
Length=629

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETD+PE ELKPG++LLGP+DEIFY +YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPEDELKPGIELLGPIDEIFYHSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAAS  340
            YVP N    DNCFIS +YDA+THFESTV DVL MYTKITGK +DLSVDLSAAS
Sbjct  388  YVPTNKQEEDNCFISGTYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAAS  440



>ref|XP_004962068.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=445

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETDNP+ ELKPG+DLLG VDEIFY+ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGLDLLGSVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>ref|XP_006654244.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+F CSY HN+APKGK+IAFV  EAETDNPE ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFGCSYTHNVAPKGKFIAFVSAEAETDNPESELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASA  441



>ref|XP_002876528.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52787.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPELDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|NP_191551.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
 sp|O24653.1|GDI2_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
2; Short=AtGDI2 [Arabidopsis thaliana]
 dbj|BAA22504.1| AtGDI2 [Arabidopsis thaliana]
 emb|CAA04727.1| GDI2 [Arabidopsis thaliana]
 emb|CAB75811.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAL91158.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAN15330.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEE79985.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
Length=444

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPELDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|XP_006402639.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
 gb|ESQ44092.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
Length=444

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLG VDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGAVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  441



>ref|XP_010520728.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Tarenaya hassleriana]
Length=445

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV  EAETD+PE ELKPGVDLLGPVDEIFY++YD 
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDDPEAELKPGVDLLGPVDEIFYDSYDT  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y+P ND   D+CFISA+YDASTHFESTV DVL MYTKITGK +DLSVDL
Sbjct  388  YLPSNDPEKDHCFISATYDASTHFESTVMDVLQMYTKITGKTLDLSVDL  436



>gb|AAW78520.1| GDP dissociation inhibitor 1 [Solanum chilense]
Length=444

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSD+YLFCCSY HN+APKGK+IAFV TEAETDNPE ELKPG+DLLG VDEIF+E YDR
Sbjct  328  GRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFEAYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+ + + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVIEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASA  441



>ref|XP_010277857.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFC SY HN+APKGK+IAFV TEAET+ PE ELKPG+DLLGP+DEIF++ YDR
Sbjct  328  GRRSDMYLFCSSYAHNVAPKGKFIAFVTTEAETNQPEVELKPGIDLLGPIDEIFFDVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLS+ASA
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSSASA  441



>ref|NP_001266078.1| rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
 emb|CAA06731.1| GDP dissociation inhibitor [Cicer arietinum]
Length=444

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+   DNCF+S SYDA+THFESTV DVL MYT ITGK +DLSVDLSAA A
Sbjct  388  FEPVNEPTLDNCFVSTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAAGA  441



>ref|XP_006291137.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
 gb|EOA24035.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
Length=444

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            R+SDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG DLLGPVDEIF++ YDRY
Sbjct  329  RRSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DL+VDLSAASA
Sbjct  389  EPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLTVDLSAASA  441



>ref|XP_006649851.1| PREDICTED: rab GDP dissociation inhibitor beta-like [Oryza brachyantha]
Length=447

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            VP N S  DNCF++ SYDA+THFE+TVKDVL +Y+KITGK +DLSVDL+AASAG
Sbjct  389  VPANASEDDNCFVTNSYDATTHFETTVKDVLGLYSKITGKELDLSVDLNAASAG  442



>ref|XP_003629947.1| Rab GDP dissociation inhibitor [Medicago truncatula]
 gb|AET04423.1| GDP dissociation inhibitor [Medicago truncatula]
 gb|AFK41459.1| unknown [Medicago truncatula]
Length=444

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+ PKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  FEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLTVDLSAASA  441



>gb|EMT30538.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=447

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK++AFV TEAETD PE ELKPG+DLLGPV+E F++ YDR+
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFVAFVSTEAETDKPEIELKPGIDLLGPVEETFFDMYDRF  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             P+N +  DNCF++ SYDA+THFE+TVKDVLA+Y+KITGK +DLSVDL+AASAG +D
Sbjct  389  EPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSKITGKELDLSVDLNAASAGEND  445



>ref|XP_002439812.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
 gb|EES18242.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
Length=445

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETD+P+ ELKPG+DLLG VDEIFY+ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDSPQSELKPGIDLLGSVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>ref|XP_010672532.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV TEAETDNP+ ELK G+DLLGPVDE+F++ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQTELKAGIDLLGPVDEMFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDL+AASA
Sbjct  388  YEPVNEPSLDNCFISTSYDGTTHFESTVTDVLNMYTMITGKVLDLNVDLNAASA  441



>ref|XP_009138891.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brassica rapa]
 emb|CDX89038.1| BnaA04g01480D [Brassica napus]
Length=444

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDVYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAAS  340
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAAS
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAAS  440



>emb|CDY45775.1| BnaC04g22610D [Brassica napus]
Length=444

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDVYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAAS  340
             P+N+ A DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAAS
Sbjct  389  EPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAAS  440



>ref|XP_002987358.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
 gb|EFJ11673.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
Length=444

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV TE ET  PEKEL+PG+ LLGPVDE+F + YDR
Sbjct  328  GRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPEKELQPGLSLLGPVDEMFIDVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            + P+ND   DNCFIS SYD +THFE+TV+DVLAMYT+ITGK +DLSVDLSAASA 
Sbjct  388  FEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTRITGKVLDLSVDLSAASAA  442



>ref|XP_002989142.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
 gb|EFJ09736.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
Length=444

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGK+IAFV TE ET  PEKEL+PG+ LLGPVDE+F + YDR
Sbjct  328  GRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPEKELQPGLSLLGPVDEMFIDVYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            + P+ND   DNCFIS SYD +THFE+TV+DVLAMYT+ITGK +DLSVDLSAASA 
Sbjct  388  FEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTRITGKVLDLSVDLSAASAA  442



>ref|NP_001183437.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACR36809.1| unknown [Zea mays]
 gb|AFW81914.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|AFW81915.1| Rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETDNP+ ELKPG+DLLG VDEI Y+ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGIDLLGSVDEILYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF++ SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVTTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  441



>emb|CDP11069.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FC SY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYVFCSSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTSYDPTTHFESTVVDVLNMYTMITGKVLDLNVDLSAASA  441



>ref|XP_009380662.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Musa acuminata subsp. malaccensis]
Length=446

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMYLFCCSY HN+APKGKYIAFV TEAETD+PE ELKPG+DLLG VDE F+  YDRY
Sbjct  329  RKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDHPEMELKPGIDLLGLVDETFFHIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             P N+   DNCFIS SYDA+THFESTV+DV++MY KITGK  DL+VDLSAASA  +D
Sbjct  389  EPTNNHEHDNCFISTSYDATTHFESTVQDVISMYRKITGKEPDLTVDLSAASAATED  445



>ref|XP_003608428.1| Rab-GDP dissociation inhibitor [Medicago truncatula]
 gb|AES90625.1| GDP dissociation inhibitor [Medicago truncatula]
Length=445

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFV TEAETD P+ ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPQVELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            + P ND A D CFIS SYD +THFE+TVKDV+ MY+KITGK +DLSVDL
Sbjct  388  FEPTNDHATDGCFISTSYDPTTHFETTVKDVVQMYSKITGKVLDLSVDL  436



>emb|CAF02075.1| GDP dissociation inhibitor [Medicago truncatula]
Length=444

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+ PKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            + P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLS ASA
Sbjct  388  FEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLTVDLSVASA  441



>ref|XP_010517995.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Camelina sativa]
Length=444

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQSELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>ref|XP_006397585.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
 gb|ESQ39038.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
Length=444

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>dbj|BAK00943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMY+FCCSY HN+APKGK+IAFV  EAE+DN + ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGKA+DL+VDLSAASA  ++
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKAIDLTVDLSAASAAEEE  445



>ref|XP_010506315.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>ref|XP_010508340.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>gb|AAB69870.1| GDP dissociation inhibitor protein OsGDI1 [Oryza sativa]
Length=445

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+F CSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASA  441



>emb|CDO97391.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+AP GKYIAFV TEAETD+P+ ELKPGVDLLGPVDEIFYETYDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPNGKYIAFVATEAETDDPQAELKPGVDLLGPVDEIFYETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            + P N   AD CFIS+SYD +THFESTV DV++MY+KITGKA+DLSVDL
Sbjct  388  FEPTNCPDADGCFISSSYDGTTHFESTVVDVISMYSKITGKALDLSVDL  436



>ref|XP_006294223.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
 gb|EOA27121.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
Length=444

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>ref|NP_001055566.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|AAU10789.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 gb|AAV25637.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF17480.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|EAY98071.1| hypothetical protein OsI_19989 [Oryza sativa Indica Group]
 gb|EEE63749.1| hypothetical protein OsJ_18568 [Oryza sativa Japonica Group]
Length=445

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+F CSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASA  441



>ref|XP_002880083.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56342.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQSELKPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAEEE  445



>ref|XP_003568438.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Brachypodium distachyon]
Length=444

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV TEAE+D+   EL PGVDLLGP+DE+F++ YDR
Sbjct  327  GRKSDMYIFCCSYTHNVAPKGKFIAFVSTEAESDDIRSELMPGVDLLGPIDELFFDMYDR  386

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA
Sbjct  387  YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASA  440



>ref|XP_009116667.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X1 [Brassica rapa]
Length=445

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK-AVDLSVDLSAASA  343
             P+N+ A+DNCFIS SYDA+THFE+TV DVL MYT ITGK  +DLSVDLSAASA
Sbjct  389  EPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQQLDLSVDLSAASA  442



>ref|XP_009420147.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY H +APKGK+IAFV TEAETD PE ELKPG+DLLGPVDE+F+ETYDR
Sbjct  328  GRKSDMYLFCCSYLHKVAPKGKFIAFVSTEAETDRPEVELKPGIDLLGPVDELFFETYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAAS  340
            Y PIN  ++D+C+IS S+DA+THFESTV DVL+MYT ITGK +DL++D SAA 
Sbjct  388  YKPINTPSSDHCYISTSHDATTHFESTVMDVLSMYTMITGKTIDLNMDPSAAG  440



>gb|KFK35202.1| hypothetical protein AALP_AA5G253800 [Arabis alpina]
Length=444

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AET NP+ ELK G+DLLGPVDEIF++ YDRY
Sbjct  329  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETGNPQTELKAGIDLLGPVDEIFFDMYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  389  EPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTLITGKELDLSVDLSAASA  441



>ref|NP_181938.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 sp|Q96254.1|GDI1_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
1; Short=AtGDI1 [Arabidopsis thaliana]
 gb|AAK32814.1|AF361801_1 At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAA11944.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAC23429.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAK91434.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 gb|AAM47344.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAE98797.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 dbj|BAE99631.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEC10374.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=445

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAEEE  445



>gb|KFK37228.1| hypothetical protein AALP_AA4G230400 [Arabis alpina]
Length=445

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAEEE  445



>gb|EMT13931.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=541

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMY+FCCSY HN+APKGK+IAFV  EAE+DN + ELKPG+DLLGPVDE+F++ YDR
Sbjct  423  GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  482

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  ++
Sbjct  483  YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDLSAASAAEEE  540



>ref|XP_008784526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Phoenix dactylifera]
Length=446

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+AP+GKYIAFV TEAETD PE ELKPG++LLG VDE F++ YD 
Sbjct  328  GRKSDMYVFCCSYTHNVAPRGKYIAFVSTEAETDQPEVELKPGINLLGSVDETFFDIYDI  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N    DNCFIS SYDA+THFESTV+DVL+MY++ITGK +DL+VDLSAASA  +D
Sbjct  388  YDPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYSRITGKELDLTVDLSAASATAED  445



>ref|XP_004983945.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=447

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             PIN+   D+CF++ SYDASTHFE+TVKDVL++Y KITGK +DLSVDL+AASA
Sbjct  389  EPINNPEEDSCFLTNSYDASTHFETTVKDVLSLYNKITGKELDLSVDLNAASA  441



>ref|XP_007159145.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
 gb|ESW31139.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
Length=445

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKFIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYDMYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            + P ND  AD CFIS SYD +THFE+TVKDV+ MY+KITGK +DL VDL
Sbjct  388  FEPCNDHEADGCFISTSYDPTTHFETTVKDVVGMYSKITGKILDLCVDL  436



>ref|XP_010920623.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Elaeis guineensis]
Length=446

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGKYIAFV TEAETD PE ELKPG+DLLGPVDE F++ YDR
Sbjct  328  GRKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPEVELKPGIDLLGPVDETFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N    DNCFIS SYDA+THFESTV+DVL+MY +ITGK +DL+VDLSAASA  +D
Sbjct  388  YEPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYGRITGKELDLTVDLSAASAASED  445



>ref|XP_010277493.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
 ref|XP_010277494.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
Length=413

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVL EAET+ PE ELKPG++LLGPV+E+F++ YDR
Sbjct  296  GRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFDIYDR  355

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y PIN    DNC+IS SYDA+THFESTVKDV++MY++ITGK +DLSVDL
Sbjct  356  YEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  404



>gb|AAL38263.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK  DLSVDL+AASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKEPDLSVDLNAASAAEEE  445



>ref|NP_001288917.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Brassica 
rapa]
 dbj|BAF81523.1| GDP dissociation inhibitor [Brassica rapa]
 gb|AIK01835.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDX79782.1| BnaA05g03740D [Brassica napus]
Length=444

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>gb|AIK01834.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDY17885.1| BnaC04g03340D [Brassica napus]
Length=444

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELKPG+DLLG VDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGQVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASA  441



>ref|XP_010277492.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Nelumbo nucifera]
Length=426

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVL EAET+ PE ELKPG++LLGPV+E+F++ YDR
Sbjct  309  GRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFDIYDR  368

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y PIN    DNC+IS SYDA+THFESTVKDV++MY++ITGK +DLSVDL
Sbjct  369  YEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  417



>emb|CAA69258.1| GDP-associated inhibitor [Arabidopsis thaliana]
Length=445

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+ ASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNPASAAEEE  445



>ref|XP_010277491.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Nelumbo nucifera]
Length=445

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGKYIAFVL EAET+ PE ELKPG++LLGPV+E+F++ YDR
Sbjct  328  GRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDL  328
            Y PIN    DNC+IS SYDA+THFESTVKDV++MY++ITGK +DLSVDL
Sbjct  388  YEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  436



>gb|EMS53634.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=544

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR SDMY+FCCSY HN+APKGK+IAFV  EAE+DN + ELKPG+DLLGPVDE+F++ YDR
Sbjct  426  GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  485

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  ++
Sbjct  486  YEPVNEPYLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDLSAASAAEEE  543



>ref|XP_010107286.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXC14619.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=463

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 107/129 (83%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSD YLFCCSY HNIAPKGKYIAFVLTEAETD+P+ ELKPG+DLLGPVDEIF++ YDR
Sbjct  335  GRKSDTYLFCCSYSHNIAPKGKYIAFVLTEAETDDPKVELKPGIDLLGPVDEIFFDMYDR  394

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKA---------VDLSVDLSA  334
            + P N + ADNCFIS SYDA+THFE+TV+DV+AMY+KITGK          +DLSVDLSA
Sbjct  395  FEPTNQNDADNCFISTSYDATTHFETTVQDVIAMYSKITGKMLIIAINLQDLDLSVDLSA  454

Query  335  ASAGGDDED  361
            ASA  D E+
Sbjct  455  ASAAADSEE  463



>gb|AAM64484.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FC SY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCFSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  ++
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAEEE  445



>ref|NP_001150143.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACG38018.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACN33222.1| unknown [Zea mays]
 tpg|DAA45893.1| TPA: Rab GDP dissociation inhibitor alpha [Zea mays]
Length=447

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   D CF++ SYD++THFE+TVKDVLA+Y KITGK +DLSVDL+AASA
Sbjct  389  EPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLNAASA  441



>gb|ACL54441.1| unknown [Zea mays]
Length=447

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
             P+N+   D CF++ SYD++THFE+TVKDVLA+Y KITGK +DLSVDL+AASA
Sbjct  389  EPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLNAASA  441



>ref|XP_009419946.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+APKGKYIAFV TEAETD+PE ELKPG+DLLGPV+E F++TYDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDHPETELKPGIDLLGPVNETFFDTYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLS  331
            Y P N+   D+CFIS SYDA+THFE+TV+DV++MY KITGK  DL+VDL+
Sbjct  388  YEPTNNHEEDSCFISTSYDATTHFETTVEDVISMYRKITGKEPDLTVDLN  437



>ref|XP_003558226.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brachypodium distachyon]
Length=447

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLS  331
             P+N    DNCF++ SYDA+THFE+TVKDVLA+Y+KITGK +DLSVDL+
Sbjct  389  EPVNTPEEDNCFLTNSYDATTHFETTVKDVLALYSKITGKDLDLSVDLN  437



>ref|XP_001766609.1| predicted protein [Physcomitrella patens]
 gb|EDQ68674.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCS+ HN+APKGKYIAFV  E ET+NPE EL+PG+ LLG +DE   + YD 
Sbjct  328  GRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELQPGLSLLGQIDEKIIDMYDM  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+NDS+ DNCFIS SYD +THFE+TV+DVL+MYT+ITGK +DLSVDLSAASA
Sbjct  388  YEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTRITGKNLDLSVDLSAASA  441



>gb|EEC81843.1| hypothetical protein OsI_25604 [Oryza sativa Indica Group]
Length=469

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  20   YLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPIND  199
            Y+FCCSY HN+A KGK+IAFV  +AE++NP  ELKPG+DLLGPVDE+F +TYDR+ P ND
Sbjct  357  YVFCCSYSHNVASKGKFIAFVSAQAESENPAAELKPGIDLLGPVDELFIDTYDRFEPTND  416

Query  200  SAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
             ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  417  PSSDNCFISTSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASAAEDD  468



>ref|XP_001773747.1| predicted protein [Physcomitrella patens]
 gb|EDQ61364.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCS+ HN+APKGKYIAFV  E ET+NPE EL+PG+ LLG +DE   + YD 
Sbjct  328  GRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELQPGLALLGQIDEKIIDMYDM  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+NDS+ DNCFIS SYD +THFE+TV+DVL+MYT+ITGK +DLSVDLSAASA
Sbjct  388  YEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTRITGKNLDLSVDLSAASA  441



>ref|XP_001768163.1| predicted protein [Physcomitrella patens]
 gb|EDQ67036.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCS+ HN+APKGKYIAFV  E ET+NPE EL+PG+ LLG +DE   + YD 
Sbjct  328  GRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELEPGLALLGKIDEKIIDMYDM  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+NDS+ DNCFIS SYD +THFE+TV+DVL+MYTKITGK +DLSVDLSAASA
Sbjct  388  YEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTKITGKNLDLSVDLSAASA  441



>ref|XP_002465085.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
 gb|EER92083.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
Length=447

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAETD PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLS  331
             PIN+   D+CF++ SYD++THFE+TVKDVLA+Y KITGK +DLSVDL+
Sbjct  389  EPINNPEEDSCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLN  437



>ref|NP_001049717.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|ABF95264.1| Rab GDP dissociation inhibitor alpha, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11631.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|EAY89454.1| hypothetical protein OsI_10987 [Oryza sativa Indica Group]
 gb|EAZ26447.1| hypothetical protein OsJ_10334 [Oryza sativa Japonica Group]
 dbj|BAG94640.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV TEAE D PE ELKPG+DLLGPV+E F++ YDRY
Sbjct  329  RKSDMYVFCCSYAHNVAPKGKFIAFVSTEAEADKPEIELKPGIDLLGPVEETFFDIYDRY  388

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLS  331
             P N +  DNCF++ SYDA+THFE+TVKDVLA+Y+KITGK +DLSVDL+
Sbjct  389  EPTNTADEDNCFVTNSYDATTHFETTVKDVLALYSKITGKELDLSVDLN  437



>ref|XP_006372309.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
 gb|ERP50106.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
Length=454

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+PE ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKA  307
            Y P+N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK 
Sbjct  388  YEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKV  429



>ref|XP_010067472.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X3 [Eucalyptus grandis]
Length=450

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 95/120 (79%), Gaps = 6/120 (5%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV  EAETD PE ELKPGVDLLGPVDEIFY+TYDR
Sbjct  328  GRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGVDLLGPVDEIFYDTYDR  387

Query  182  YVPINDSAADNCFISA------SYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+N+ + DNCFIS            + FESTV DVL MYT ITGK +DLSVDLSAASA
Sbjct  388  YEPVNEPSLDNCFISTVTINYIDIMLISCFESTVMDVLNMYTMITGKVLDLSVDLSAASA  447



>gb|KHG21656.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=426

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ EL+PG+ LLGPVDEIFY+ YDR
Sbjct  325  GRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPKVELEPGIKLLGPVDEIFYDNYDR  384

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P ND  ADNCFISASYD +THFE+TV DV+ MYTKITGK
Sbjct  385  YEPTNDHTADNCFISASYDPTTHFETTVNDVIQMYTKITGK  425



>ref|XP_010930327.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Elaeis guineensis]
Length=444

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAET+ PE ELKPG+DLLGPVD IF++TYDR
Sbjct  296  GRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDR  355

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P+N+   D+CFIS SYDA+THFESTV DVLA+YTKITGK
Sbjct  356  YEPVNEPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGK  396



>ref|XP_008657544.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Zea mays]
Length=242

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETDNP+ ELKPG+DLLG VDEIFY+ YDR
Sbjct  39   GRRSDMYVFCCSYTHNVAPRGKFIAFVSVEAETDNPQSELKPGIDLLGSVDEIFYDIYDR  98

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT  TGK
Sbjct  99   YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMTTGK  139



>gb|KHN06485.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=761

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV TEAETD P  ELKPG+DLLGPVDEIF++ YDR
Sbjct  328  GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKA  307
            Y P+N+   DNCFIS SYDA+THFESTV DVL MYT ITGKA
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTLITGKA  429



>ref|XP_004962066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=374

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV  EAETDNP+ EL+PG+DLLG VDE+F++ YDR
Sbjct  249  GRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELRPGIDLLGQVDELFFDMYDR  308

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKA  307
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL+MYT ITGK 
Sbjct  309  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTAITGKV  350



>ref|XP_004962067.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=462

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCSY HN+AP+GK+IAFV  EAETDNP+ ELKPG+DLLG VDEIFY+ YDR
Sbjct  328  GRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGLDLLGSVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLS  319
            Y P+N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK   +S
Sbjct  388  YEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKVTYIS  433



>ref|NP_001078054.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 dbj|BAH19638.1| AT2G44100 [Arabidopsis thaliana]
 gb|AEC10375.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=431

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ EL+PG+DLLGPVDE+F++ YDR
Sbjct  328  GRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAV  310
            Y P+N+   DNCFIS SYDA+THF++TV DVL MY  ITGK +
Sbjct  388  YEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKVM  430



>ref|XP_001755959.1| predicted protein [Physcomitrella patens]
 gb|EDQ79244.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+FCCS+ HNIA K KYIAFV  E ETD PE EL+PG+ LLG +DE   + YD 
Sbjct  328  GRRSDMYVFCCSHSHNIAAKDKYIAFVSAEVETDTPEAELEPGLALLGHIDEKIIDMYDM  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            Y P+ND + DNCFIS SYD +THFE+TV+DVL+MYTKITGK +DLSVDLSAASA
Sbjct  388  YEPVNDPSLDNCFISKSYDPTTHFETTVQDVLSMYTKITGKNLDLSVDLSAASA  441



>ref|XP_007153833.1| hypothetical protein PHAVU_003G068600g [Phaseolus vulgaris]
 gb|ESW25827.1| hypothetical protein PHAVU_003G068600g [Phaseolus vulgaris]
Length=219

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  17   MYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPIN  196
             YL C SY HN+APKGK+IAFV TE ETD PE++LKPG++LLG V+EIFY+ YDR+ P N
Sbjct  107  WYLLCYSYAHNVAPKGKFIAFVTTEVETDQPEEDLKPGINLLGSVNEIFYDMYDRFEPCN  166

Query  197  DSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            D   D CFIS SYD +THFE TVKDV+ MY+KITGK +DL VDLSA SA  ++
Sbjct  167  DHEVDGCFISTSYDPTTHFEITVKDVVGMYSKITGKILDLFVDLSAVSAAAEE  219



>ref|XP_010927878.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Elaeis guineensis]
Length=290

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV +EAETD PE ELKPG+DLLGPVDE+F+++Y  
Sbjct  110  GRKSDMYLFCCSYSHNVAPKGKFIAFVSSEAETDRPEIELKPGIDLLGPVDELFFDSYVS  169

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSV  322
            + P+N+ + DNCFIS SYDA THFESTV DVL MY  IT K  DL V
Sbjct  170  FEPVNEPSLDNCFISTSYDAMTHFESTVMDVLHMYRMITRK--DLPV  214



>emb|CAN75023.1| hypothetical protein VITISV_007044 [Vitis vinifera]
Length=271

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  65   KYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPINDSAADNCFISASYDAS  244
            KYIAFV TEAETD PE ELK G DLLGPVDEIFYETYDR+ P ND   D+CFIS SYDA+
Sbjct  175  KYIAFVTTEAETDQPEVELKRGXDLLGPVDEIFYETYDRFEPKNDHEVDHCFISTSYDAT  234

Query  245  THFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            THFESTVK+V+AMY+KITG+ +DL+VDLSAASA
Sbjct  235  THFESTVKNVIAMYSKITGEELDLTVDLSAASA  267



>gb|ABR25630.1| rab gdp dissociation inhibitor alpha [Oryza sativa Indica Group]
Length=93

 Score =   143 bits (360),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  77   FVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPINDSAADNCFISASYDASTHFE  256
            FV TEAETDNP+ ELKPG+DLLG VDE+F++ YDRY P+N+ + DNCF+S SYDA+THFE
Sbjct  1    FVSTEAETDNPQSELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFE  60

Query  257  STVKDVLAMYTKITGKAVDLSVDLSAASAG  346
            +TV DVL MYT ITGKAVDLSVDLSAASA 
Sbjct  61   TTVTDVLNMYTLITGKAVDLSVDLSAASAA  90



>gb|EEE59061.1| hypothetical protein OsJ_10849 [Oryza sativa Japonica Group]
Length=431

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 15/118 (13%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDM               ++IAFV  +AE++NP  ELKPG+DLLGPVDE+F +TYDR
Sbjct  328  GRKSDM---------------QFIAFVSAQAESENPAAELKPGIDLLGPVDELFIDTYDR  372

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAGGDD  355
            + P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK VDLSVDLSAASA  DD
Sbjct  373  FEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASAAEDD  430



>ref|XP_009116663.1| PREDICTED: uncharacterized protein LOC103841842 [Brassica rapa]
Length=412

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
              KSDMY+FC  Y HN+A KGK+IAF  T+AETDNP+ ELK G+DLLGPVDEIF++ YDR
Sbjct  242  AHKSDMYVFCL-YSHNVAAKGKFIAFASTDAETDNPQTELKAGIDLLGPVDEIFFDMYDR  300

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P+N+ A+DNCFIS SYDA+THFE+TV DVL MYT ITG+
Sbjct  301  YEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGE  341



>ref|XP_008370508.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X1 [Malus domestica]
Length=135

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  59   KGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPINDSAADNCFISASYD  238
            KGK+IAFV T+AETD+ E ELKPG+DLLGPVDEIF++TYD Y P+N+   DNCFIS SYD
Sbjct  41   KGKFIAFVSTDAETDHLETELKPGIDLLGPVDEIFFKTYDIYEPVNEPTLDNCFISTSYD  100

Query  239  ASTHFESTVKDVLAMYTKITGKAVDLSVDLSAA  337
            A+THFESTV DVL MYT ITGK  DLSVDLS A
Sbjct  101  ATTHFESTVLDVLNMYTLITGKVJDLSVDLSEA  133



>emb|CDX71860.1| BnaC08g30140D [Brassica napus]
Length=409

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 20/113 (18%)
 Frame = +2

Query  5    RKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRY  184
            RKSDMY+FCCSY HN+APKGK+IAFV T+AETDNP+ ELK G+DLLGPVDEIF++     
Sbjct  314  RKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFDI----  369

Query  185  VPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
                            YDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  370  ----------------YDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  406



>gb|EMT22946.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=227

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 13/101 (13%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDM             +GK+IAFV  +AE+DNPE ELKPG+DLLGPVDE+F++TYDR
Sbjct  135  GRRSDM-------------QGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFFDTYDR  181

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P ND ++DNCFIS SYDA+THFESTV DVL++YTKITGK
Sbjct  182  YEPTNDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGK  222



>emb|CDY05966.1| BnaA09g38140D [Brassica napus]
Length=406

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
              KSDMY+FC  Y HN+A KGK+IAFV T+AET+NP+ ELK G+DLL PVDEIF+  YDR
Sbjct  190  AHKSDMYVFCL-YSHNVAAKGKFIAFVSTDAETENPQTELKAGIDLLCPVDEIFFYLYDR  248

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGK  304
            Y P+N+  +DNCFISASYDA+ HFE+TV DVL MYT ITG+
Sbjct  249  YEPVNEPTSDNCFISASYDATAHFETTVADVLNMYTLITGE  289



>gb|KHG17909.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=532

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+APKGKYIAFV  EAETDNPE+ELKPGVDLLG VDEIFY+TYDR
Sbjct  335  GRKSDMYVFCCSYAHNVAPKGKYIAFVSAEAETDNPEQELKPGVDLLGSVDEIFYDTYDR  394

Query  182  YVPINDSAADNCFISASYDASTHFESTVK  268
            YVP ND  ADNCFISA      + E  ++
Sbjct  395  YVPTNDHQADNCFISALPSCPCNIERILR  423


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  179  RYVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASA  343
            RY+ + +  A++     SYD++THFE+TV DV+ MYTKITGK +DLSVDLSAASA
Sbjct  478  RYLSVRELLAESW---KSYDSTTHFETTVIDVMEMYTKITGKVLDLSVDLSAASA  529



>ref|XP_002501191.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62449.1| predicted protein [Micromonas sp. RCC299]
Length=445

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMY+F CS+ HN+  KGKY+AFV T  ET NP  EL PG+ LLG +DE F +  D 
Sbjct  328  GRQSDMYVFGCSFAHNVCAKGKYLAFVSTAVETANPTAELIPGLQLLGAIDEYFVQVSDV  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSVDLSAASAG  346
              P+ND + D C+IS  YDA+THF+STV+DVL MY KITGK V+L  D  AA+AG
Sbjct  388  MEPVNDGSEDGCYISKGYDATTHFQSTVEDVLEMYKKITGKDVNLDADDPAATAG  442



>gb|AAB09058.1| GDP dissociation inhibitor protein GDIV1p [Volvox carteri f. 
nagariensis]
Length=443

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+A K K++AFV T  ET NPE +L PG+ LLGPVDE F E  + 
Sbjct  328  GRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNPEVDLAPGLALLGPVDEKFVEVREV  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSV-DLS  331
              P+ D A D C+IS  YDA+THFE+TV+DVL MY +ITG+ +DL+  DLS
Sbjct  388  CEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYRRITGRDLDLTAKDLS  438



>ref|XP_002955697.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
 gb|EFJ43337.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
Length=443

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMY+FCCSY HN+A K K++AFV T  ET NPE +L PG+ LLGPVDE F E  + 
Sbjct  328  GRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNPEVDLAPGLALLGPVDEKFVEVREV  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMYTKITGKAVDLSV-DLS  331
              P+ D A D C+IS  YDA+THFE+TV+DVL MY +ITG+ +DL+  DLS
Sbjct  388  CEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYRRITGRDLDLTAKDLS  438



>ref|XP_007135176.1| hypothetical protein PHAVU_010G1075001g, partial [Phaseolus vulgaris]
 gb|ESW07170.1| hypothetical protein PHAVU_010G1075001g, partial [Phaseolus vulgaris]
Length=105

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 8/101 (8%)
 Frame = +2

Query  65   KYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDRYVPINDSAADNCFISASYDAS  244
            K+IAFV TEAETD PE++LKPG+DLLG V+E FY+ YDR+ P ND   D CFIS SYD +
Sbjct  1    KFIAFVTTEAETDQPEEDLKPGIDLLGSVNEKFYDMYDRFEPCNDHEVDGCFISTSYDPT  60

Query  245  THFESTVKDVLAMYTKITGK--------AVDLSVDLSAASA  343
            THFE TVKDV+ MY+KITGK         +DLSVDLSAASA
Sbjct  61   THFEITVKDVVGMYSKITGKHHFCLLFQILDLSVDLSAASA  101



>emb|CDY65664.1| BnaC09g54770D [Brassica napus]
Length=410

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    GRKSDMYLFCC----SYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYE  169
            GRKSD+    C    S  HN+APKGKYIAFV  EAETDNPE+ELK G++LLGP+DEIFY 
Sbjct  297  GRKSDINHSDCVGTYSVAHNVAPKGKYIAFVSAEAETDNPEEELKAGIELLGPIDEIFYH  356

Query  170  TYDRYVPINDSAADNCFISASYDASTHFESTVKDVLAMYT  289
            +YD YVP N    DNCFIS +YDA+THFESTV DVL MYT
Sbjct  357  SYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYT  396



>gb|KCW87997.1| hypothetical protein EUGRSUZ_A00406, partial [Eucalyptus grandis]
Length=475

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GRKSDMYLFCCSY HN+APKGK+IAFV  EAETD PE ELKPGVDLLGPVDEIFY+TYDR
Sbjct  400  GRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGVDLLGPVDEIFYDTYDR  459

Query  182  YVPINDSAADNCFIS  226
            Y P+N+ + DNCFIS
Sbjct  460  YEPVNEPSLDNCFIS  474



>gb|KDO49751.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=419

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = +2

Query  2    GRKSDMYLFCCSYYHNIAPKGKYIAFVLTEAETDNPEKELKPGVDLLGPVDEIFYETYDR  181
            GR+SDMYLFCCSY HN+APKGK+IAFV TEAETD+P+ ELKPG+DLLGPVDEIFY+ YDR
Sbjct  328  GRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYDIYDR  387

Query  182  YVPINDSAADNCFISASYDASTHFESTVKDVLAMY  286
            Y P+N+ + DNCFIS       H   T+  +  MY
Sbjct  388  YEPVNEPSLDNCFISTVTMMPQH---TLSQLSRMY  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 851710770112