BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15052_g2_i1 len=1073 path=[3225:0-741 522:742-772 1370:773-1072]

Length=1073
                                                                      Score     E

ref|XP_006345610.1|  PREDICTED: ethylene-responsive transcription...    151   5e-40   
ref|XP_009781921.1|  PREDICTED: ethylene-responsive transcription...    145   1e-37   
gb|ADH04266.1|  ERF1                                                    144   3e-37   
ref|XP_009609535.1|  PREDICTED: ethylene-responsive transcription...    144   4e-37   
ref|XP_010325364.1|  PREDICTED: ethylene-responsive transcription...    142   6e-37   
ref|XP_009593489.1|  PREDICTED: ethylene-responsive transcription...    142   9e-37   
ref|XP_009787891.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
ref|XP_009609536.1|  PREDICTED: ethylene-responsive transcription...    142   2e-36   
ref|XP_009798817.1|  PREDICTED: ethylene-responsive transcription...    141   4e-36   
ref|XP_009593488.1|  PREDICTED: ethylene-responsive transcription...    140   4e-36   
ref|XP_010321615.1|  PREDICTED: ethylene-responsive transcription...    140   5e-36   
dbj|BAN58167.1|  ethylene response factor 168                           141   5e-36   
ref|XP_006348008.1|  PREDICTED: ethylene-responsive transcription...    140   6e-36   
dbj|BAN58169.1|  ethylene response factor 91                            137   1e-35   
dbj|BAN58165.1|  ethylene response factor 115                           140   2e-35   
ref|XP_009794568.1|  PREDICTED: ethylene-responsive transcription...    140   2e-35   
ref|XP_009781920.1|  PREDICTED: ethylene-responsive transcription...    139   5e-35   
ref|XP_004231147.1|  PREDICTED: ethylene-responsive transcription...    137   1e-34   
ref|XP_009625878.1|  PREDICTED: ethylene-responsive transcription...    137   2e-34   
dbj|BAN58166.1|  ethylene response factor 179                           136   6e-34   
ref|XP_009759672.1|  PREDICTED: ethylene-responsive transcription...    135   7e-34   
ref|XP_009598140.1|  PREDICTED: ethylene-responsive transcription...    134   1e-33   
ref|XP_009628238.1|  PREDICTED: ethylene-responsive transcription...    134   2e-33   
ref|XP_008232505.1|  PREDICTED: ethylene-responsive transcription...    134   2e-33   
gb|ADP37426.1|  ethylene-responsive-element-binding factor 11           133   3e-33   
gb|KEH17838.1|  AP2 domain class transcription factor                   132   4e-33   
ref|XP_011094418.1|  PREDICTED: ethylene-responsive transcription...    131   9e-33   
ref|XP_007203292.1|  hypothetical protein PRUPE_ppa025748mg             130   4e-32   
ref|XP_010508240.1|  PREDICTED: ethylene-responsive transcription...    131   5e-32   
ref|XP_010508242.1|  PREDICTED: ethylene-responsive transcription...    130   5e-32   
ref|XP_007052303.1|  Ethylene-responsive element binding factor 1...    130   6e-32   
ref|XP_007052302.1|  Ethylene-responsive element binding factor 1...    131   6e-32   
ref|XP_009625877.1|  PREDICTED: ethylene-responsive transcription...    129   8e-32   
ref|XP_010508241.1|  PREDICTED: ethylene-responsive transcription...    130   9e-32   
ref|XP_010089318.1|  Ethylene-responsive transcription factor 13        130   1e-31   
ref|NP_182011.1|  ethylene-responsive transcription factor 13           129   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65925.1|  putative ethylene response element binding protei...    129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518091.1|  PREDICTED: ethylene-responsive transcription...    130   2e-31   
ref|XP_010506419.1|  PREDICTED: ethylene-responsive transcription...    129   2e-31   
ref|XP_006294915.1|  hypothetical protein CARUB_v10023967mg             129   2e-31   
emb|CDP09437.1|  unnamed protein product                                128   2e-31   
ref|XP_002880142.1|  hypothetical protein ARALYDRAFT_903921             129   2e-31   
ref|XP_007052301.1|  Ethylene-responsive element binding factor 1...    127   3e-31   
emb|CDY56473.1|  BnaC04g53270D                                          129   3e-31   
gb|KCW62805.1|  hypothetical protein EUGRSUZ_G00396                     127   4e-31   
gb|KCW62801.1|  hypothetical protein EUGRSUZ_G00393                     128   4e-31   
ref|XP_010089316.1|  Ethylene-responsive transcription factor 13        129   4e-31   
emb|CDY23459.1|  BnaC04g49870D                                          128   4e-31   
emb|CDX74692.1|  BnaA05g04380D                                          128   5e-31   
ref|XP_009144089.1|  PREDICTED: ethylene-responsive transcription...    128   5e-31   
ref|XP_006397665.1|  hypothetical protein EUTSA_v10001758mg             128   5e-31   
ref|XP_010065366.1|  PREDICTED: ethylene-responsive transcription...    128   5e-31   
ref|XP_006375127.1|  hypothetical protein POPTR_0014s04610g             127   6e-31   
gb|KDP43273.1|  hypothetical protein JCGZ_22825                         127   6e-31   
ref|XP_008363915.1|  PREDICTED: ethylene-responsive transcription...    126   8e-31   
ref|XP_008345528.1|  PREDICTED: ethylene-responsive transcription...    126   9e-31   
ref|XP_004308507.1|  PREDICTED: ethylene-responsive transcription...    127   9e-31   
ref|XP_006347953.1|  PREDICTED: ethylene-responsive transcription...    127   1e-30   
emb|CDY30489.1|  BnaA04g25900D                                          127   1e-30   
ref|XP_010068081.1|  PREDICTED: ethylene-responsive transcription...    127   1e-30   
ref|XP_002511592.1|  Ethylene-responsive transcription factor, pu...    126   1e-30   Ricinus communis
ref|XP_011042382.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
ref|XP_011016089.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
ref|XP_011016088.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
gb|KCW62806.1|  hypothetical protein EUGRSUZ_G00397                     125   2e-30   
gb|KDP28852.1|  hypothetical protein JCGZ_14623                         126   2e-30   
ref|XP_011031966.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
gb|KDP28854.1|  hypothetical protein JCGZ_14625                         125   2e-30   
ref|XP_010315446.1|  PREDICTED: ethylene-responsive transcription...    125   2e-30   
ref|XP_007203094.1|  hypothetical protein PRUPE_ppa023698mg             125   3e-30   
ref|XP_002511589.1|  Ethylene-responsive transcription factor, pu...    125   3e-30   Ricinus communis
gb|KDO85528.1|  hypothetical protein CISIN_1g039729mg                   124   3e-30   
ref|XP_006375130.1|  hypothetical protein POPTR_0014s04640g             124   4e-30   
ref|XP_009142287.1|  PREDICTED: ethylene-responsive transcription...    125   4e-30   
ref|XP_002511588.1|  Ethylene-responsive transcription factor, pu...    125   4e-30   Ricinus communis
gb|KCW62512.1|  hypothetical protein EUGRSUZ_G00002                     125   5e-30   
ref|XP_010067932.1|  PREDICTED: ethylene-responsive transcription...    126   5e-30   
gb|KDP22469.1|  hypothetical protein JCGZ_26300                         125   5e-30   
gb|KCW62799.1|  hypothetical protein EUGRSUZ_G00391                     124   5e-30   
ref|XP_008232472.1|  PREDICTED: ethylene-responsive transcription...    124   5e-30   
gb|AFI98122.1|  ethylene-responsive element-binding protein 6           124   6e-30   
gb|KDP28855.1|  hypothetical protein JCGZ_14626                         125   7e-30   
ref|XP_004308505.1|  PREDICTED: ethylene-responsive transcription...    125   7e-30   
ref|XP_010068083.1|  PREDICTED: ethylene-responsive transcription...    125   7e-30   
ref|XP_007204071.1|  hypothetical protein PRUPE_ppb014367mg             125   8e-30   
ref|XP_010068077.1|  PREDICTED: ethylene-responsive transcription...    126   8e-30   
ref|XP_006445414.1|  hypothetical protein CICLE_v10022025mg             124   9e-30   
ref|XP_010068078.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   
ref|XP_009606945.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   
gb|AFK42966.1|  unknown                                                 124   1e-29   
gb|AFB35653.1|  ERF8                                                    125   1e-29   
ref|XP_006347956.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   
ref|XP_004492940.1|  PREDICTED: ethylene-responsive transcription...    123   1e-29   
ref|XP_010068075.1|  PREDICTED: ethylene-responsive transcription...    123   1e-29   
ref|XP_010089319.1|  Ethylene-responsive transcription factor 13        123   1e-29   
ref|XP_004308504.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   
gb|EPS69901.1|  ethylene-responsive transcription factor 2              122   2e-29   
gb|KDO85532.1|  hypothetical protein CISIN_1g044584mg                   123   2e-29   
ref|XP_009335609.1|  PREDICTED: ethylene-responsive transcription...    123   2e-29   
ref|XP_009607861.1|  PREDICTED: ethylene-responsive transcription...    122   2e-29   
ref|XP_007038272.1|  AP2/ERF domain-containing transcription fact...    124   2e-29   
ref|XP_010068071.1|  PREDICTED: ethylene-responsive transcription...    124   3e-29   
ref|XP_011076437.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    123   3e-29   
ref|XP_006375126.1|  hypothetical protein POPTR_0014s04600g             123   3e-29   
gb|ADJ67441.1|  ethylene response factor 12                             123   3e-29   
ref|XP_010065367.1|  PREDICTED: ethylene-responsive transcription...    123   3e-29   
ref|XP_010068079.1|  PREDICTED: ethylene-responsive transcription...    124   3e-29   
gb|AGS80336.1|  ethylene response factor                                123   4e-29   
gb|EYU20174.1|  hypothetical protein MIMGU_mgv1a018364mg                123   4e-29   
ref|XP_008232503.1|  PREDICTED: ethylene-responsive transcription...    123   4e-29   
gb|AFI98121.1|  ethylene-responsive element-binding protein 5           121   4e-29   
ref|XP_008232470.1|  PREDICTED: ethylene-responsive transcription...    123   5e-29   
ref|XP_006421523.1|  hypothetical protein CICLE_v10005891mg             122   5e-29   
ref|XP_007203750.1|  hypothetical protein PRUPE_ppa016903mg             123   5e-29   
gb|KCW62802.1|  hypothetical protein EUGRSUZ_G00394                     124   5e-29   
gb|KDO39173.1|  hypothetical protein CISIN_1g028566mg                   121   6e-29   
ref|XP_004229751.1|  PREDICTED: ethylene-responsive transcription...    122   6e-29   
emb|CBJ55933.1|  ethylene response factor 2.2                           122   6e-29   
gb|KCW62798.1|  hypothetical protein EUGRSUZ_G00390                     122   6e-29   
ref|XP_007052304.1|  Ethylene-responsive element binding factor 1...    121   8e-29   
ref|NP_001236246.1|  uncharacterized protein LOC100527194               122   8e-29   
ref|XP_002872976.1|  hypothetical protein ARALYDRAFT_912253             120   9e-29   
gb|KEH23454.1|  AP2-domain DNA-binding protein                          121   9e-29   
gb|ABU40945.1|  AP2-domain DNA-binding protein                          121   9e-29   Datura metel
ref|XP_006445417.1|  hypothetical protein CICLE_v10023677mg             122   9e-29   
ref|XP_009335578.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
ref|XP_011022365.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
ref|XP_008344394.1|  PREDICTED: ethylene-responsive transcription...    122   1e-28   
ref|XP_006490017.1|  PREDICTED: ethylene-responsive transcription...    120   1e-28   
ref|XP_002304592.2|  hypothetical protein POPTR_0003s15030g             122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011031988.1|  PREDICTED: ethylene-responsive transcription...    120   1e-28   
emb|CEF82730.1|  binding protein                                        120   1e-28   
gb|ABW77571.1|  AP2-domain DNA-binding protein ORCA3                    120   1e-28   Catharanthus roseus [chatas]
emb|CAB96899.1|  AP2-domain DNA-binding protein                         120   2e-28   Catharanthus roseus [chatas]
gb|ADE41124.1|  AP2 domain class transcription factor                   122   2e-28   
ref|XP_008232471.1|  PREDICTED: ethylene-responsive transcription...    120   2e-28   
gb|KHN40954.1|  Ethylene-responsive transcription factor 13             120   2e-28   
gb|KEH17839.1|  ethylene response factor                                120   2e-28   
ref|XP_009765938.1|  PREDICTED: ethylene-responsive transcription...    120   2e-28   
ref|XP_006606323.1|  PREDICTED: ethylene-responsive transcription...    116   3e-28   
ref|XP_009589160.1|  PREDICTED: ethylene-responsive transcription...    118   3e-28   
gb|AGT21474.1|  ethylene responsive element binding factor-like         120   3e-28   
ref|XP_002297926.1|  hypothetical protein POPTR_0001s11770g             120   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004515359.1|  PREDICTED: ethylene-responsive transcription...    119   4e-28   
ref|XP_008376227.1|  PREDICTED: ethylene-responsive transcription...    121   4e-28   
ref|XP_004493050.1|  PREDICTED: ethylene-responsive transcription...    119   4e-28   
ref|XP_010523200.1|  PREDICTED: ethylene-responsive transcription...    118   4e-28   
gb|ACM49848.1|  ethylene responsive transcription factor 1b             120   4e-28   Prunus salicina [Japanese plum]
gb|EYU28602.1|  hypothetical protein MIMGU_mgv1a022521mg                120   4e-28   
ref|XP_011026732.1|  PREDICTED: ethylene-responsive transcription...    120   4e-28   
gb|KDO85527.1|  hypothetical protein CISIN_1g026607mg                   120   5e-28   
ref|XP_006445418.1|  hypothetical protein CICLE_v10021995mg             120   5e-28   
dbj|BAN45684.1|  ethylene response factor                               119   5e-28   
ref|XP_007218833.1|  hypothetical protein PRUPE_ppa010186mg             120   5e-28   
gb|ADU76350.1|  ethylene responsive factor                              120   5e-28   
gb|ADL36574.1|  AP2D domain class transcription factor                  122   5e-28   
ref|NP_001280848.1|  ethylene-responsive transcription factor 2-like    122   6e-28   
ref|XP_009611801.1|  PREDICTED: ethylene-responsive transcription...    119   6e-28   
ref|XP_009335577.1|  PREDICTED: ethylene-responsive transcription...    119   6e-28   
ref|XP_007134480.1|  hypothetical protein PHAVU_010G050800g             117   6e-28   
gb|KHN34531.1|  Ethylene-responsive transcription factor 2              119   6e-28   
ref|NP_001275603.1|  ethylene-responsive transcription factor 1-like    120   6e-28   
ref|XP_003529037.1|  PREDICTED: ethylene-responsive transcription...    119   6e-28   
ref|XP_007204029.1|  hypothetical protein PRUPE_ppa020417mg             119   7e-28   
ref|XP_004235186.2|  PREDICTED: ethylene-responsive transcription...    120   7e-28   
ref|XP_006348007.1|  PREDICTED: ethylene-responsive transcription...    119   7e-28   
ref|XP_011094429.1|  PREDICTED: ethylene-responsive transcription...    118   7e-28   
ref|XP_010109127.1|  Ethylene-responsive transcription factor 2         120   7e-28   
ref|XP_011031975.1|  PREDICTED: ethylene-responsive transcription...    119   8e-28   
ref|XP_010025350.1|  PREDICTED: ethylene-responsive transcription...    120   8e-28   
ref|XP_010426455.1|  PREDICTED: ethylene-responsive transcription...    117   8e-28   
gb|EPS62607.1|  hypothetical protein M569_12181                         117   8e-28   
ref|XP_008234446.1|  PREDICTED: ethylene-responsive transcription...    120   9e-28   
ref|XP_004307778.1|  PREDICTED: ethylene-responsive transcription...    120   9e-28   
gb|AGH62003.1|  ethylene-responsive transcription factor                118   9e-28   
gb|AHA93900.1|  ethylene response factor 10                             120   9e-28   
ref|XP_009362713.1|  PREDICTED: ethylene-responsive transcription...    121   1e-27   
sp|Q40476.1|ERF1_TOBAC  RecName: Full=Ethylene-responsive transcr...    119   1e-27   Nicotiana tabacum [American tobacco]
ref|XP_010424028.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_009370422.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
gb|AHB33881.1|  ERF transcription factor 10                             119   1e-27   
ref|XP_003530145.2|  PREDICTED: ethylene-responsive transcription...    118   1e-27   
emb|CDP05380.1|  unnamed protein product                                119   1e-27   
ref|XP_010068070.1|  PREDICTED: ethylene-responsive transcription...    119   1e-27   
ref|XP_010544359.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_009372828.1|  PREDICTED: ethylene-responsive transcription...    120   2e-27   
dbj|BAN45683.1|  ethylene response factor                               118   2e-27   
ref|XP_009370421.1|  PREDICTED: ethylene-responsive transcription...    120   2e-27   
ref|XP_004239983.1|  PREDICTED: ethylene-responsive transcription...    118   2e-27   
ref|XP_003524070.1|  PREDICTED: ethylene-responsive transcription...    118   2e-27   
ref|XP_008370005.1|  PREDICTED: ethylene-responsive transcription...    118   2e-27   
ref|XP_002279585.2|  PREDICTED: ethylene-responsive transcription...    118   2e-27   Vitis vinifera
ref|XP_009771895.1|  PREDICTED: ethylene-responsive transcription...    118   2e-27   
gb|KEH23452.1|  AP2-domain DNA-binding protein                          117   3e-27   
ref|XP_009335608.1|  PREDICTED: ethylene-responsive transcription...    117   3e-27   
ref|XP_007134479.1|  hypothetical protein PHAVU_010G050700g             117   3e-27   
gb|AAC50047.1|  Pti4                                                    117   3e-27   Solanum lycopersicum
gb|AID51422.1|  ethylene response factor 17                             118   3e-27   
gb|KFK42581.1|  hypothetical protein AALP_AA1G014000                    115   3e-27   
gb|AGB07589.1|  ethylene-responsive transcription factor 6              117   3e-27   
ref|XP_002511013.1|  Ethylene-responsive transcription factor, pu...    118   3e-27   Ricinus communis
ref|XP_010068073.1|  PREDICTED: ethylene-responsive transcription...    118   3e-27   
gb|KCW62796.1|  hypothetical protein EUGRSUZ_G00388                     117   4e-27   
gb|KHN34529.1|  Ethylene-responsive transcription factor 13             115   4e-27   
ref|XP_002870100.1|  hypothetical protein ARALYDRAFT_493126             115   5e-27   
sp|Q84XB3.1|ERF1_SOLLC  RecName: Full=Ethylene-responsive transcr...    117   6e-27   Solanum lycopersicum
ref|XP_003549934.1|  PREDICTED: ethylene-responsive transcription...    117   6e-27   
ref|XP_010559083.1|  PREDICTED: ethylene-responsive transcription...    117   6e-27   
emb|CAB93940.1|  AP2-domain DNA-binding protein                         116   7e-27   Catharanthus roseus [chatas]
ref|XP_008376369.1|  PREDICTED: ethylene-responsive transcription...    119   7e-27   
ref|XP_010275428.1|  PREDICTED: ethylene-responsive transcription...    118   7e-27   
emb|CDX76569.1|  BnaA08g08310D                                          115   9e-27   
ref|XP_006365341.1|  PREDICTED: ethylene-responsive transcription...    117   9e-27   
ref|XP_010434656.1|  PREDICTED: ethylene-responsive transcription...    117   9e-27   
gb|AHZ31603.1|  ethylene-responsive transcription factor                115   1e-26   
ref|XP_010258782.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
ref|XP_009341335.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
ref|XP_004134277.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_003520430.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_011081402.1|  PREDICTED: ethylene-responsive transcription...    116   1e-26   
ref|XP_010449604.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
gb|KFK24043.1|  hypothetical protein AALP_AAs42697U000400               116   1e-26   
ref|XP_009341338.1|  PREDICTED: ethylene-responsive transcription...    115   1e-26   
ref|XP_008809462.1|  PREDICTED: ethylene-responsive transcription...    115   1e-26   
ref|NP_001275437.1|  Pti4                                               115   2e-26   
ref|NP_001237801.1|  ethylene-responsive element binding protein 1      115   2e-26   
ref|XP_006414077.1|  hypothetical protein EUTSA_v10027189mg             112   2e-26   
ref|XP_003521070.1|  PREDICTED: ethylene-responsive transcription...    114   2e-26   
emb|CDY27923.1|  BnaCnng05080D                                          116   2e-26   
ref|XP_003534472.1|  PREDICTED: ethylene-responsive transcription...    114   2e-26   
gb|AID55127.1|  ethylene responsive factor 70                           113   2e-26   
emb|CDP10018.1|  unnamed protein product                                115   2e-26   
ref|XP_006396194.1|  hypothetical protein EUTSA_v10029212mg             112   2e-26   
ref|XP_006375128.1|  ethylene-responsive element binding protein 1      112   2e-26   
gb|ACU15472.1|  unknown                                                 114   2e-26   Aspergillus carbonarius
gb|AEQ93554.1|  AP2/ERF transcription factor                            115   2e-26   
ref|XP_010439993.1|  PREDICTED: ethylene-responsive transcription...    115   2e-26   
ref|XP_009108325.1|  PREDICTED: ethylene-responsive transcription...    115   3e-26   
ref|XP_006284323.1|  hypothetical protein CARUB_v10005497mg             115   3e-26   
ref|XP_007134477.1|  hypothetical protein PHAVU_010G050500g             114   3e-26   
ref|XP_011031947.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|KFK37282.1|  hypothetical protein AALP_AA4G236900                    115   3e-26   
ref|XP_006282733.1|  hypothetical protein CARUB_v10005868mg             113   3e-26   
emb|CDY38401.1|  BnaC01g10100D                                          114   3e-26   
ref|XP_009775795.1|  PREDICTED: ethylene-responsive transcription...    114   4e-26   
ref|XP_009617605.1|  PREDICTED: ethylene-responsive transcription...    114   4e-26   
ref|XP_009108637.1|  PREDICTED: ethylene-responsive transcription...    114   5e-26   
ref|XP_004152388.1|  PREDICTED: ethylene-responsive transcription...    114   5e-26   
ref|XP_009130667.1|  PREDICTED: ethylene-responsive transcription...    114   5e-26   
ref|XP_006577645.1|  PREDICTED: ethylene-responsive transcription...    112   5e-26   
ref|XP_003521071.1|  PREDICTED: ethylene-responsive transcription...    113   5e-26   
ref|XP_010441485.1|  PREDICTED: ethylene-responsive transcription...    114   6e-26   
emb|CDY65883.1|  BnaAnng21280D                                          114   6e-26   
ref|XP_009796413.1|  PREDICTED: ethylene-responsive transcription...    114   6e-26   
ref|XP_010055446.1|  PREDICTED: ethylene-responsive transcription...    115   6e-26   
ref|XP_010518707.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
ref|XP_009761318.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
ref|XP_006359239.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
ref|XP_002271521.1|  PREDICTED: ethylene-responsive transcription...    113   7e-26   Vitis vinifera
ref|XP_006368978.1|  hypothetical protein POPTR_0001s15390g             115   7e-26   
ref|XP_010494952.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
ref|XP_003538752.2|  PREDICTED: ethylene-responsive transcription...    114   8e-26   
ref|XP_006398419.1|  hypothetical protein EUTSA_v10001003mg             114   8e-26   
gb|AGL08720.1|  ERF1                                                    112   8e-26   
ref|XP_008437026.1|  PREDICTED: ethylene-responsive transcription...    115   8e-26   
gb|ACY74382.1|  ERF2 transcription factor                               114   9e-26   Brassica carinata [Abyssinian mustard]
gb|ADC55527.1|  ERF transcription factor                                113   9e-26   Camellia sinensis [black tea]
ref|XP_010058509.1|  PREDICTED: ethylene-responsive transcription...    112   9e-26   
ref|XP_004300354.1|  PREDICTED: ethylene-responsive transcription...    115   9e-26   
ref|XP_002304302.1|  hypothetical protein POPTR_0003s07910g             114   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004515377.1|  PREDICTED: ethylene-responsive transcription...    112   1e-25   
ref|XP_006359238.1|  PREDICTED: ethylene-responsive transcription...    113   1e-25   
ref|XP_009628437.1|  PREDICTED: ethylene-responsive transcription...    113   1e-25   
ref|XP_006414221.1|  hypothetical protein EUTSA_v10027401mg             113   1e-25   
gb|ACY74383.1|  ERF2 transcription factor                               113   1e-25   Brassica carinata [Abyssinian mustard]
ref|XP_009611402.1|  PREDICTED: ethylene-responsive transcription...    113   1e-25   
ref|XP_006279696.1|  hypothetical protein CARUB_v10027108mg             112   1e-25   
ref|XP_010677103.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
ref|XP_006358332.1|  PREDICTED: ethylene-responsive transcription...    112   1e-25   
gb|KEH17840.1|  ethylene response factor                                112   1e-25   
ref|XP_004245806.1|  PREDICTED: ethylene-responsive transcription...    113   1e-25   
ref|XP_006477125.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
gb|KCW73110.1|  hypothetical protein EUGRSUZ_E01561                     111   1e-25   
gb|ABD65036.1|  ethylene responsive element binding factor, putative    112   1e-25   
ref|XP_004244707.2|  PREDICTED: ethylene-responsive transcription...    112   2e-25   
gb|EYU33029.1|  hypothetical protein MIMGU_mgv1a022878mg                113   2e-25   
dbj|BAP92132.1|  ethylene-responsive transcription factor homolog       108   2e-25   
gb|KDO61316.1|  hypothetical protein CISIN_1g044938mg                   113   2e-25   
emb|CDY68787.1|  BnaCnng60520D                                          112   2e-25   
ref|XP_003520428.1|  PREDICTED: ethylene-responsive transcription...    111   2e-25   
ref|XP_010058508.1|  PREDICTED: ethylene-responsive transcription...    111   2e-25   
ref|XP_009111538.1|  PREDICTED: ethylene-responsive transcription...    111   2e-25   
ref|XP_006440234.1|  hypothetical protein CICLE_v10021652mg             113   2e-25   
gb|KHN26289.1|  Ethylene-responsive transcription factor 13             111   2e-25   
gb|AAC62619.1|  ethylene response element binding protein 1             112   2e-25   
ref|XP_008439350.1|  PREDICTED: ethylene-responsive transcription...    110   2e-25   
ref|XP_007039732.1|  AP2/ERF domain-containing transcription fact...    113   2e-25   
gb|KFK31389.1|  hypothetical protein AALP_AA6G105600                    113   2e-25   
dbj|BAP93298.1|  ethylene-responsive transcription factor homolog       108   2e-25   
ref|XP_010325512.1|  PREDICTED: ethylene-responsive transcription...    112   2e-25   
emb|CDY25978.1|  BnaC09g20090D                                          112   3e-25   
gb|AHA33628.1|  ERF2 transcription factor protein                       113   3e-25   
emb|CDY43434.1|  BnaAnng07060D                                          112   3e-25   
ref|XP_010058507.1|  PREDICTED: ethylene-responsive transcription...    111   3e-25   
ref|XP_003633905.1|  PREDICTED: ethylene-responsive transcription...    111   3e-25   
ref|XP_011094406.1|  PREDICTED: ethylene-responsive transcription...    111   3e-25   
ref|XP_007157259.1|  hypothetical protein PHAVU_002G055700g             113   3e-25   
ref|XP_009114286.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
gb|ABD64951.1|  ethylene responsive element binding factor, putative    112   3e-25   
emb|CDX77750.1|  BnaC07g20040D                                          112   3e-25   
ref|XP_010053513.1|  PREDICTED: ethylene-responsive transcription...    114   3e-25   
gb|AGL34965.1|  ethylene-responsive transcription factor 6              112   3e-25   
dbj|BAA87068.2|  ethylene-responsive element binding protein1 hom...    112   4e-25   
ref|XP_010538473.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
ref|XP_007209449.1|  hypothetical protein PRUPE_ppa009707mg             112   4e-25   
gb|KHN11565.1|  Ethylene-responsive transcription factor 2              110   4e-25   
ref|XP_008370115.1|  PREDICTED: ethylene-responsive transcription...    111   4e-25   
gb|ADU76349.1|  ethylene responsive factor                              112   5e-25   
ref|XP_010481346.1|  PREDICTED: ethylene-responsive transcription...    111   5e-25   
gb|ACM49849.1|  ethylene responsive transcription factor 1a             112   5e-25   
gb|KDP28853.1|  hypothetical protein JCGZ_14624                         110   5e-25   
emb|CDY33523.1|  BnaA06g35500D                                          110   6e-25   
ref|NP_199533.1|  ethylene-responsive transcription factor 2            111   6e-25   
ref|XP_010104817.1|  Ethylene-responsive transcription factor 2         112   6e-25   
ref|XP_009608915.1|  PREDICTED: ethylene-responsive transcription...    111   6e-25   
ref|XP_010540289.1|  PREDICTED: ethylene-responsive transcription...    108   6e-25   
ref|NP_567530.4|  ethylene-responsive transcription factor 1A           112   7e-25   
dbj|BAA32418.1|  ethylene responsive element binding factor 1           111   8e-25   
ref|XP_010089315.1|  Ethylene-responsive transcription factor 13        109   8e-25   
gb|AAX07459.1|  ethylene-responsive element binding protein ERF5        109   9e-25   
emb|CBJ55932.1|  ethylene response factor 2.1                           110   9e-25   
ref|XP_007139636.1|  hypothetical protein PHAVU_008G046400g             110   1e-24   
emb|CAN82632.1|  hypothetical protein VITISV_028134                     109   1e-24   
ref|XP_004508948.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
ref|XP_010056401.1|  PREDICTED: ethylene-responsive transcription...    109   1e-24   
ref|XP_009128950.1|  PREDICTED: ethylene-responsive transcription...    110   1e-24   
emb|CDY28965.1|  BnaA02g25110D                                          110   1e-24   
emb|CAB45963.1|  EREBP-2 protein                                        110   1e-24   
ref|XP_004511721.1|  PREDICTED: ethylene-responsive transcription...    110   1e-24   
ref|XP_009333695.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
gb|ACY74381.1|  ERF2 transcription factor                               110   1e-24   
ref|XP_002532361.1|  Ethylene-responsive transcription factor 1A,...    111   1e-24   
ref|XP_010934650.1|  PREDICTED: ethylene-responsive transcription...    110   1e-24   
emb|CAN81895.1|  hypothetical protein VITISV_007029                     109   1e-24   
gb|ACY74380.1|  ERF2 transcription factor                               110   1e-24   
dbj|BAG15867.1|  transcription factor                                   111   1e-24   
gb|KDP39921.1|  hypothetical protein JCGZ_03452                         111   2e-24   
gb|ACJ54440.1|  AP2/EREBP transcription factor                          110   2e-24   
ref|XP_009800922.1|  PREDICTED: ethylene-responsive transcription...    110   2e-24   
dbj|BAP92157.1|  ethylene-responsive transcription factor homolog       105   2e-24   
ref|XP_009405057.1|  PREDICTED: ethylene-responsive transcription...    108   2e-24   
gb|AAF63205.1|AF245119_1  AP2-related transcription factor              110   2e-24   
gb|ABN50365.2|  ethylene responsive element binding protein 1           110   2e-24   
gb|ADE41134.1|  AP2 domain class transcription factor                   110   2e-24   
dbj|BAP92178.1|  ethylene-responsive transcription factor homolog       105   2e-24   
gb|ADE41120.1|  AP2 domain class transcription factor                   110   2e-24   
gb|AEQ64867.1|  ethylene response factor 11                             110   3e-24   
ref|XP_008337947.1|  PREDICTED: ethylene-responsive transcription...    110   3e-24   
ref|XP_003608658.1|  Ethylene-responsive transcription factor 1A        110   3e-24   
ref|XP_008352414.1|  PREDICTED: ethylene-responsive transcription...    110   3e-24   
gb|AAM64544.1|  ethylene responsive element binding factor 2 (ATE...    109   3e-24   
dbj|BAG50059.1|  transcription factor AP2-EREBP                         110   3e-24   
gb|EYU31898.1|  hypothetical protein MIMGU_mgv1a020883mg                107   3e-24   
ref|XP_009369100.1|  PREDICTED: ethylene-responsive transcription...    110   3e-24   
ref|XP_002270581.2|  PREDICTED: ethylene-responsive transcription...    110   3e-24   
ref|XP_008448804.1|  PREDICTED: ethylene-responsive transcription...    110   4e-24   
ref|XP_007134478.1|  hypothetical protein PHAVU_010G050600g             108   4e-24   
ref|XP_006445416.1|  hypothetical protein CICLE_v10022734mg             106   4e-24   
ref|XP_002511590.1|  DNA binding protein, putative                      108   4e-24   
ref|XP_011047596.1|  PREDICTED: ethylene-responsive transcription...    109   5e-24   
gb|KDO52459.1|  hypothetical protein CISIN_1g043029mg                   105   5e-24   
ref|XP_004164449.1|  PREDICTED: ethylene-responsive transcription...    109   6e-24   
ref|XP_004147226.1|  PREDICTED: ethylene-responsive transcription...    109   6e-24   
gb|AES92926.1|  transcription factor ERF1                               109   6e-24   
gb|AHY84694.1|  ethylene responsive factor 1-like protein               107   7e-24   
ref|XP_009400592.1|  PREDICTED: ethylene-responsive transcription...    109   8e-24   
gb|AEQ93555.1|  AP2/ERF transcription factor                            107   8e-24   
ref|XP_009401653.1|  PREDICTED: ethylene-responsive transcription...    109   8e-24   
ref|XP_009402135.1|  PREDICTED: ethylene-responsive transcription...    107   8e-24   
ref|XP_008439349.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   
ref|XP_009389467.1|  PREDICTED: ethylene-responsive transcription...    107   1e-23   
gb|EPS73235.1|  hypothetical protein M569_01526                         105   1e-23   
ref|XP_008337240.1|  PREDICTED: ethylene-responsive transcription...    108   1e-23   
gb|AHN92189.1|  ERF protein 1                                           108   1e-23   
ref|XP_008352246.1|  PREDICTED: ethylene-responsive transcription...    108   1e-23   
ref|XP_011101097.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   
gb|AHG95101.1|  2-3 ethylene-responsive transcription factor 1B         103   1e-23   
ref|XP_010686479.1|  PREDICTED: pathogenesis-related genes transc...    104   2e-23   
ref|XP_009101439.1|  PREDICTED: ethylene-responsive transcription...    106   2e-23   
dbj|BAI52953.1|  ethylene responsive transcription factor 1a            108   2e-23   
ref|XP_006445413.1|  hypothetical protein CICLE_v10021132mg             108   2e-23   
ref|XP_006442923.1|  hypothetical protein CICLE_v10023286mg             105   2e-23   
ref|XP_006385827.1|  hypothetical protein POPTR_0003s15060g             106   3e-23   
gb|KCW77824.1|  hypothetical protein EUGRSUZ_D02111                     107   3e-23   
ref|XP_011096383.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    104   3e-23   
ref|XP_007145843.1|  hypothetical protein PHAVU_007G272900g             103   3e-23   
ref|XP_006445419.1|  hypothetical protein CICLE_v10024298mg             104   3e-23   
ref|XP_004134276.1|  PREDICTED: pathogenesis-related genes transc...    103   4e-23   
gb|AGE97361.1|  ethylene response factor 6                              104   4e-23   
gb|KDO85526.1|  hypothetical protein CISIN_1g045684mg                   102   4e-23   
pdb|2GCC|A  Chain A, Solution Structure Of The Gcc-Box Binding Do...    101   5e-23   
ref|XP_004247349.1|  PREDICTED: ethylene-responsive transcription...    103   5e-23   
ref|XP_010053512.1|  PREDICTED: ethylene-responsive transcription...    107   5e-23   
gb|AHG95118.1|  2-3 ethylene-responsive transcription factor 1B         102   5e-23   
gb|AHG95100.1|  2-3 ethylene-responsive transcription factor 1B         102   5e-23   
ref|XP_011076436.1|  PREDICTED: ethylene-responsive transcription...    107   6e-23   
ref|XP_002271494.1|  PREDICTED: ethylene-responsive transcription...    104   6e-23   
dbj|BAF75651.1|  transcription factor DcERF1                            106   6e-23   
gb|AHG95117.1|  2-3 ethylene-responsive transcription factor 1B         102   6e-23   
gb|AAX20035.1|  ethylene responsive element binding protein C2          106   6e-23   
gb|AHG95104.1|  2-3 ethylene-responsive transcription factor 1B         102   6e-23   
ref|XP_006442925.1|  hypothetical protein CICLE_v10023730mg             103   7e-23   
ref|XP_009389258.1|  PREDICTED: ethylene-responsive transcription...    105   7e-23   
gb|AHG95102.1|  2-3 ethylene-responsive transcription factor 1B         102   7e-23   
ref|XP_003530143.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
emb|CDO99221.1|  unnamed protein product                                103   1e-22   
pdb|1GCC|A  Chain A, Solution Nmr Structure Of The Complex Of Gcc...  99.8    1e-22   
ref|XP_006653641.1|  PREDICTED: ethylene-responsive transcription...    106   1e-22   
ref|NP_001142230.1|  AP2-EREBP transcription factor                     105   1e-22   
ref|XP_010260390.1|  PREDICTED: pathogenesis-related genes transc...    103   1e-22   
gb|AFK37508.1|  unknown                                                 104   1e-22   
gb|KDP21036.1|  hypothetical protein JCGZ_21507                         103   1e-22   
tpg|DAA36591.1|  TPA: putative AP2/EREBP transcription factor sup...    105   1e-22   
ref|XP_003593690.1|  Ethylene-responsive transcription factor           102   2e-22   
gb|AEX12092.1|  hypothetical protein 0_3792_01                          102   2e-22   
gb|AHG95099.1|  2-3 ethylene-responsive transcription factor 1B         101   2e-22   
ref|XP_010935880.1|  PREDICTED: ethylene-responsive transcription...    103   2e-22   
ref|NP_001149871.1|  ethylene responsive protein                        105   2e-22   
ref|XP_002448280.1|  hypothetical protein SORBIDRAFT_06g024355          105   2e-22   
ref|XP_007145470.1|  hypothetical protein PHAVU_007G241800g             103   2e-22   
ref|XP_006442922.1|  hypothetical protein CICLE_v10023352mg             101   2e-22   
ref|XP_004956406.1|  PREDICTED: ethylene-responsive transcription...    105   2e-22   
gb|AEX12093.1|  hypothetical protein 0_3792_01                          101   2e-22   
gb|KEH30939.1|  ethylene response factor                                100   2e-22   
ref|XP_007038275.1|  AP2/ERF domain-containing transcription fact...    104   2e-22   
ref|XP_010918982.1|  PREDICTED: pathogenesis-related genes transc...    102   2e-22   
gb|AET99098.2|  ethylene response factor ERF6                           103   2e-22   
ref|XP_002271614.1|  PREDICTED: ethylene-responsive transcription...    103   2e-22   
gb|AGB07588.1|  ethylene-responsive transcription factor 5              104   3e-22   
ref|NP_001235847.1|  uncharacterized protein LOC100305726               103   3e-22   
ref|XP_009407828.1|  PREDICTED: ethylene-responsive transcription...    103   3e-22   
ref|NP_001233987.1|  pathogenesis-related genes transcriptional a...    101   3e-22   
ref|XP_009384458.1|  PREDICTED: ethylene-responsive transcription...    104   3e-22   
ref|XP_010933605.1|  PREDICTED: ethylene-responsive transcription...    104   3e-22   
ref|XP_011027742.1|  PREDICTED: pathogenesis-related genes transc...    102   3e-22   
gb|ADP37424.1|  ethylene-responsive-element-binding factor 9            102   3e-22   
ref|XP_007148088.1|  hypothetical protein PHAVU_006G179800g             102   3e-22   
gb|KHN31934.1|  Ethylene-responsive transcription factor ERF106         103   3e-22   
ref|XP_010057052.1|  PREDICTED: pathogenesis-related genes transc...    102   4e-22   
ref|XP_006467696.1|  PREDICTED: pathogenesis-related genes transc...    101   4e-22   
gb|ADP37427.1|  ethylene-responsive-element-binding factor 12           104   4e-22   
ref|XP_010057324.1|  PREDICTED: pathogenesis-related genes transc...    102   4e-22   
ref|NP_001235286.1|  uncharacterized protein LOC100500502               102   4e-22   
ref|XP_008238480.1|  PREDICTED: ethylene-responsive transcription...    102   4e-22   
gb|KHN30258.1|  Ethylene-responsive transcription factor ERF106         102   4e-22   
ref|XP_006449444.1|  hypothetical protein CICLE_v10016995mg             101   4e-22   
gb|ABQ52686.1|  ethylene-responsive factor                              104   4e-22   
gb|ABK21764.1|  unknown                                                 102   4e-22   
gb|AAG49031.1|  ripening regulated protein DDTFR10/A                    102   5e-22   
gb|EAZ31532.1|  hypothetical protein OsJ_15672                          103   5e-22   
ref|XP_006351651.1|  PREDICTED: ethylene-responsive transcription...    100   5e-22   
gb|EPS63334.1|  hypothetical protein M569_11452                         102   5e-22   
gb|AID61741.1|  pathogenesis-related gene transcriptional activator     101   5e-22   
ref|XP_004953322.1|  PREDICTED: ethylene-responsive transcription...    103   5e-22   
ref|XP_006368164.1|  PREDICTED: ethylene-responsive transcription...  99.0    5e-22   
ref|XP_011101098.1|  PREDICTED: ethylene-responsive transcription...    103   5e-22   
ref|NP_001053474.1|  Os04g0546800                                       104   5e-22   
emb|CAH67263.1|  OSIGBa0101C23.15                                       104   5e-22   
gb|EAY95058.1|  hypothetical protein OsI_16873                          104   5e-22   
ref|XP_006358219.1|  PREDICTED: ethylene-responsive transcription...    103   5e-22   
ref|XP_006367196.1|  PREDICTED: pathogenesis-related genes transc...    101   6e-22   
gb|EAY95061.1|  hypothetical protein OsI_16877                          104   6e-22   
ref|XP_009346116.1|  PREDICTED: pathogenesis-related genes transc...    101   6e-22   
ref|XP_002967934.1|  hypothetical protein SELMODRAFT_37123            98.2    6e-22   
dbj|BAK05766.1|  predicted protein                                      103   6e-22   
ref|XP_008786269.1|  PREDICTED: ethylene-responsive transcription...    103   6e-22   
ref|NP_001053475.1|  Os04g0547600                                       104   6e-22   
gb|ABA39426.1|  putative ethylene responsive element-DREB               102   6e-22   
gb|EAZ24048.1|  hypothetical protein OsJ_07777                          103   6e-22   
ref|XP_003591657.1|  Ethylene-responsive transcription factor           101   6e-22   
ref|XP_008646008.1|  PREDICTED: ethylene-responsive transcription...    103   7e-22   
ref|XP_011091225.1|  PREDICTED: ethylene-responsive transcription...  99.8    7e-22   
ref|XP_004307779.1|  PREDICTED: ethylene-responsive transcription...    103   7e-22   
gb|ACN40073.1|  unknown                                                 104   7e-22   
ref|XP_011030513.1|  PREDICTED: ethylene-responsive transcription...    100   8e-22   
ref|XP_004239984.1|  PREDICTED: ethylene-responsive transcription...    103   8e-22   
ref|XP_010546131.1|  PREDICTED: ethylene-responsive transcription...    104   8e-22   
emb|CDP05379.1|  unnamed protein product                                103   8e-22   
ref|NP_001152050.1|  ethylene-responsive transcription factor 2         103   8e-22   
ref|XP_009605887.1|  PREDICTED: ethylene-responsive transcription...    101   8e-22   
dbj|BAJ99544.1|  predicted protein                                      103   9e-22   
ref|XP_006358220.1|  PREDICTED: ethylene-responsive transcription...    102   9e-22   
ref|XP_009611800.1|  PREDICTED: ethylene-responsive transcription...    102   9e-22   
ref|XP_003551715.1|  PREDICTED: ethylene-responsive transcription...    100   9e-22   
ref|XP_008798289.1|  PREDICTED: ethylene-responsive transcription...    102   9e-22   
gb|AHA93911.1|  ethylene response factor 12                             102   9e-22   
ref|XP_003535939.1|  PREDICTED: ethylene-responsive transcription...    103   9e-22   
gb|AAX20037.1|  ethylene responsive element binding protein C4          102   1e-21   
ref|NP_001140538.1|  putative AP2/EREBP transcription factor supe...    103   1e-21   
ref|XP_009383947.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   



>ref|XP_006345610.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=189

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W+RY+GVRRRPWGKFAAEIRDP RKGARLWLGTY  PEDAALAYDR AFKLRG RALLNF
Sbjct  61   WKRYRGVRRRPWGKFAAEIRDPKRKGARLWLGTYATPEDAALAYDRTAFKLRGTRALLNF  120

Query  618  PHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVN  454
            PHLIG+NV    RV+P+RRS     +      E  I +PKRR   +INS+ AKVN
Sbjct  121  PHLIGTNVAELNRVRPKRRSRSTEIIK-----EEEIPSPKRRNPQLINSI-AKVN  169



>ref|XP_009781921.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=223

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
             ARE  +P    + WRRY GV+RRPWG F+AE+RDP+R+GARLWLGTYE  EDAALAYD+
Sbjct  91   VARENNAP----EDWRRYIGVKRRPWGTFSAEMRDPDRRGARLWLGTYETAEDAALAYDQ  146

Query  660  EAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
             AFK+RG+RA LNFPHLIGSN+P P RV  RR         S  ST S +  P++RKI +
Sbjct  147  AAFKIRGSRARLNFPHLIGSNMPKPARVTARRSRTRSPEPLSSSSTSSSVNVPRKRKIDV  206

Query  480  INSVA  466
            INS+A
Sbjct  207  INSIA  211



>gb|ADH04266.1| ERF1 [Nicotiana benthamiana]
Length=223

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D WRRY GV+RRPWG F+AEIRDPNR+GARLWLGTYE  EDAALAYD+ AFK+RG+RA
Sbjct  98   PQD-WRRYIGVKRRPWGTFSAEIRDPNRRGARLWLGTYETAEDAALAYDQAAFKIRGSRA  156

Query  630  LLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAA  463
             LNFPHLIGSN+  P RV  RR        SS  ST S +  P++RKI +INS+A 
Sbjct  157  RLNFPHLIGSNMRKPARVTERRSRTRSPEPSSSSSTSSSVNVPRKRKIDVINSIAT  212



>ref|XP_009609535.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=217

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = -3

Query  876  EGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTY  697
            + + E Q     AARE  +    +  WRRY GVR RPWGKFAAEIRDP+R+GARLWLGTY
Sbjct  70   QSETEEQTQGGKAARERNT----KQDWRRYIGVRWRPWGKFAAEIRDPDRRGARLWLGTY  125

Query  696  ERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTES  517
            E PEDAALAYD+ AFK+RG+RA LNFPHLIGSN+P P RVK  R +      SS  ST  
Sbjct  126  ETPEDAALAYDQAAFKIRGSRARLNFPHLIGSNMPEPARVKGSRHNSCSLEPSSSSSTPL  185

Query  516  GIGTPKRRKISIINSVA  466
                 ++R I +INS+A
Sbjct  186  SENGTRKRNIDVINSIA  202



>ref|XP_010325364.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=180

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 94/145 (65%), Gaps = 19/145 (13%)
 Frame = -3

Query  957  PEIFAAIDR-------------CGNSSAVIGGAGGSPESWEGDGEVQKAAIGAAREECSP  817
            P IF+AID               G  + +I  +     + + + E  +  + + +     
Sbjct  23   PNIFSAIDSNNTPTDFTQNNFDYGELTPLINSSTTLQANEKSEVEESETVVASVKH----  78

Query  816  PLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGA  637
              P+D W+RY+GVRRRPWGKFAAEIRDP++K ARLWLGTYE PEDAALAYD+ AFK+RG+
Sbjct  79   -APKD-WKRYRGVRRRPWGKFAAEIRDPDKKNARLWLGTYETPEDAALAYDQAAFKIRGS  136

Query  636  RALLNFPHLIGSNVPAPIRVKPRRR  562
            +A LNFPHLIGS VP P RV PRRR
Sbjct  137  KARLNFPHLIGSGVPEPARVNPRRR  161



>ref|XP_009593489.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN58168.1| ethylene response factor 163 [Nicotiana tabacum]
Length=186

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D W+RY+GVRRRPWGKFAAEIRDPN+K ARLWLGTYE PEDAALAYD+ AFK+RG++A
Sbjct  87   PQD-WKRYRGVRRRPWGKFAAEIRDPNKKNARLWLGTYETPEDAALAYDQAAFKIRGSKA  145

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHL+GS +P P RV PRRR
Sbjct  146  RLNFPHLVGSGMPEPARVNPRRR  168



>ref|XP_009787891.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=187

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 95/152 (63%), Gaps = 25/152 (16%)
 Frame = -3

Query  957  PEIFAAIDR------------------CGNSSAVIGGA--GGSPESWEGDGEVQKAAIGA  838
            PEIF+A+D                    G  + +I     G + +S E +    K  + A
Sbjct  23   PEIFSAMDSNSPSSSFSNSPSTENNFYYGELTPLINPTLVGATEKSHEFEETNNKETVAA  82

Query  837  AREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDRE  658
                     P+D W+RY+GVRRRPWGKFAAEIRDPN+K ARLWLGTYE PEDAALAYD+ 
Sbjct  83   KVANA----PQD-WKRYRGVRRRPWGKFAAEIRDPNKKNARLWLGTYETPEDAALAYDQA  137

Query  657  AFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            AFK+RG++A LNFPHL+GS +P P RV PRRR
Sbjct  138  AFKIRGSKARLNFPHLVGSGMPEPARVNPRRR  169



>ref|XP_009609536.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana tomentosiformis]
Length=215

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            AAREE +    + YWRRY GVRRRPWGKFAAEIRDP R+GARLWLGTY+ PEDAALAYD+
Sbjct  79   AAREENT----KQYWRRYIGVRRRPWGKFAAEIRDPERRGARLWLGTYQTPEDAALAYDQ  134

Query  660  EAFKLRGARALLNFPHLIGS-NVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKIS  484
             AFK+RG+RA LNFPHLIGS N+P P RV   R +      SS  ST S     ++R I 
Sbjct  135  AAFKIRGSRARLNFPHLIGSNNMPEPTRVTGIRHNSRSLEPSSTSSTTSSENGTRKRNIE  194

Query  483  IINSVA  466
            +INS+A
Sbjct  195  VINSIA  200



>ref|XP_009798817.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798818.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X2 [Nicotiana sylvestris]
Length=210

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 99/152 (65%), Gaps = 23/152 (15%)
 Frame = -3

Query  954  EIFAAIDRCGNSSAVIGG----AGGSPE---SWEGDGEV------QKAAIGAAREECSP-  817
            +I++  D+C +++ +I       G SP    SW GD         Q+      +EE    
Sbjct  30   QIYSTFDQCFSNAEIINSPDSSFGSSPTEEISW-GDMLTSVNTTWQRVDNLEYKEETKKN  88

Query  816  -------PLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDRE  658
                     P+D W RY+GVRRRPWGKFAAEIR+P+RKGARLWLGTYE PEDAALAYD+ 
Sbjct  89   HVVARGVHAPQD-WNRYRGVRRRPWGKFAAEIRNPDRKGARLWLGTYETPEDAALAYDQA  147

Query  657  AFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            A+K+RG++A LNFPHLIGSN+  P+RV PRRR
Sbjct  148  AYKIRGSKARLNFPHLIGSNISEPVRVAPRRR  179



>ref|XP_009593488.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=204

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 95/150 (63%), Gaps = 23/150 (15%)
 Frame = -3

Query  954  EIFAAIDRCGNSSAVIGG----AGGSP--------------ESWE-GDGEVQKAAIGAAR  832
            +IF+  D+C +++  I       G SP               SWE  D    K     AR
Sbjct  30   QIFSTFDQCFSNAENINSPNSSFGSSPTAEISWGDMLTSINSSWERVDKLEHKEEHVVAR  89

Query  831  EECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAF  652
               +P      W RY+GVRRRPWGKFAAEIR+P+RKGARLWLGTYE PEDAALAYD+ A+
Sbjct  90   GVHAP----QDWNRYRGVRRRPWGKFAAEIRNPDRKGARLWLGTYETPEDAALAYDQAAY  145

Query  651  KLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            K+RG++A LNFPHLIGSN+  P+RV PRRR
Sbjct  146  KIRGSKARLNFPHLIGSNISEPVRVAPRRR  175



>ref|XP_010321615.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=189

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 6/115 (5%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W+RY+GVRRRPWGKFAAEIRDP +KGARLWLGTY  PEDAALAYDR AFKL+G RALLNF
Sbjct  61   WKRYRGVRRRPWGKFAAEIRDPKKKGARLWLGTYVTPEDAALAYDRTAFKLKGTRALLNF  120

Query  618  PHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVN  454
            PHLI +NV    RV+P++RS     +         I +PKRR   +IN++ AKVN
Sbjct  121  PHLIDTNVAELNRVRPKQRSRLSEIIKGEE-----IPSPKRRNPQLINNI-AKVN  169



>dbj|BAN58167.1| ethylene response factor 168 [Nicotiana tabacum]
Length=217

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -3

Query  876  EGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTY  697
            + + E Q     AARE  +    +  WRRY GVR RPWGKFAAEIRDP+R+GARLWLGTY
Sbjct  70   QSETEEQTQGGKAARERNT----KQDWRRYIGVRWRPWGKFAAEIRDPDRRGARLWLGTY  125

Query  696  ERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTES  517
            E PEDAALAYD+ AFK+RG+RA LNFPHLIGSN+P P RVK    +      SS  ST  
Sbjct  126  ETPEDAALAYDQAAFKIRGSRARLNFPHLIGSNMPEPARVKGSCHNSCSLEPSSSSSTPL  185

Query  516  GIGTPKRRKISIINSVA  466
                 ++R I +INS+A
Sbjct  186  SENGTRKRNIDVINSIA  202



>ref|XP_006348008.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=202

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RY+GVRRRPWGKFAAEIRDP+RKGARLWLGTYE PEDAALAYD+ A+K+RG++A LNF
Sbjct  105  WNRYRGVRRRPWGKFAAEIRDPDRKGARLWLGTYETPEDAALAYDQAAYKIRGSKARLNF  164

Query  618  PHLIGSNVPAPIRVKPRRR  562
            PHLIGSN   PIRV PRRR
Sbjct  165  PHLIGSNKSEPIRVAPRRR  183



>dbj|BAN58169.1| ethylene response factor 91 [Nicotiana tabacum]
Length=144

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D W RY+GVRRRPWGKFAAEIR+P+RKGARLWLGTYE PEDAALAYD+ A+K+RG++A
Sbjct  34   PQD-WNRYRGVRRRPWGKFAAEIRNPDRKGARLWLGTYETPEDAALAYDQAAYKIRGSKA  92

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGSN+  P+RV PRRR
Sbjct  93   RLNFPHLIGSNISEPVRVAPRRR  115



>dbj|BAN58165.1| ethylene response factor 115 [Nicotiana tabacum]
Length=229

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            WRRY GV+RRPWG F+AEIRDP R+GARLWLGTYE PEDAALAYD+ AFK+R +RA LNF
Sbjct  104  WRRYIGVKRRPWGTFSAEIRDPERRGARLWLGTYETPEDAALAYDQAAFKIRSSRARLNF  163

Query  618  PHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
            PHLIGSN+P P RV  RR        SS   T S     ++RKI +INS+A
Sbjct  164  PHLIGSNMPKPARVTARRSRTRSPEPSSSSCTSSSEKGTRKRKIDLINSIA  214



>ref|XP_009794568.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=239

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 106/175 (61%), Gaps = 14/175 (8%)
 Frame = -3

Query  936  DRCGNSSAVIGGAGGSPESWE--GDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPW  763
            D     + +      S ES E   + E +    G ARE+ +P   RD W RY GV+RRPW
Sbjct  68   DENSEETLIPTDQNPSHESHEKYSESEEKTQCPGVAREKNAP---RD-WTRYIGVKRRPW  123

Query  762  GKFAAEIRDPNRKG--ARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPA  589
            G F+AE RDP+RKG  ARLWLGTYE  EDAALAYD+ AFK+RG+RA LNFPHLIGSN+P 
Sbjct  124  GTFSAETRDPSRKGEGARLWLGTYETAEDAALAYDQAAFKIRGSRARLNFPHLIGSNMPK  183

Query  588  PIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAA------KVNLDRV  442
            P RV  RR        SS  ST S    P++R I +INS+A        +NL R+
Sbjct  184  PARVTARRSRTRSPEPSSSSSTSSSENVPRKRNIDVINSIAKAKFLCHSLNLQRL  238



>ref|XP_009781920.1| PREDICTED: ethylene-responsive transcription factor 1-like [Nicotiana 
sylvestris]
Length=227

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            WRRY GV+RRPWG F+AEIRDP R+GARLWLGTYE PEDAALAYD+ AFK+RG+RA LNF
Sbjct  102  WRRYIGVKRRPWGTFSAEIRDPERRGARLWLGTYETPEDAALAYDQAAFKIRGSRARLNF  161

Query  618  PHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
            PHLIGSN+P P RV  RR        SS   T S     ++RKI +INS+A
Sbjct  162  PHLIGSNMPKPARVTARRSRRRSPEPSSSSCTSSSENGTRKRKIDVINSIA  212



>ref|XP_004231147.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=202

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RY+GVRRRPWGKFAAEIRDP+RKGARLWLGTY  PEDAALAYD+ A+K+RG++A LNF
Sbjct  105  WNRYRGVRRRPWGKFAAEIRDPDRKGARLWLGTYGTPEDAALAYDQAAYKIRGSKARLNF  164

Query  618  PHLIGSNVPAPIRVKPRRR  562
            PHLIGS++  P+RV PR+R
Sbjct  165  PHLIGSDISEPVRVAPRKR  183



>ref|XP_009625878.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN57618.1| ethylene response factor 189 [Nicotiana tabacum]
Length=232

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 97/152 (64%), Gaps = 12/152 (8%)
 Frame = -3

Query  873  GDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKG--ARLWLGT  700
             + E Q       RE+ +P   RD W RY GV+RRPWG F+AE RDP+RKG  ARLWLGT
Sbjct  84   SESEEQTQGPAVVREKNAP---RD-WTRYIGVKRRPWGTFSAETRDPSRKGEGARLWLGT  139

Query  699  YERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTE  520
            YE  EDAALAYD+ AFK+RG+RA LNFPHLIGSN+P P RV  RR        SS  ST 
Sbjct  140  YETAEDAALAYDQAAFKIRGSRARLNFPHLIGSNMPKPARVTARRSRTRSPEPSSSSSTS  199

Query  519  SGIGTPKRRKISIINSVAA------KVNLDRV  442
            S    P++R I +INS+A        +NL R+
Sbjct  200  SSENVPRKRNIDVINSIAKAKFLCHSLNLQRL  231



>dbj|BAN58166.1| ethylene response factor 179 [Nicotiana tabacum]
Length=236

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 5/89 (6%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            AAREE +    + YWRRY GVRRRPWGKFAAEIRDP R+GARLWLGTY+ PEDAALAYD+
Sbjct  79   AAREENT----KQYWRRYIGVRRRPWGKFAAEIRDPERRGARLWLGTYQTPEDAALAYDQ  134

Query  660  EAFKLRGARALLNFPHLIGS-NVPAPIRV  577
             AFK+RG+RA LNFPHLIGS N+P P RV
Sbjct  135  AAFKIRGSRARLNFPHLIGSNNMPEPTRV  163



>ref|XP_009759672.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=221

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 108/185 (58%), Gaps = 20/185 (11%)
 Frame = -3

Query  957  PEIFAAIDRCGNSSAVIGGAGG------------SPESWEGDGEV--QKAAIGAAREECS  820
            P+IF+ ++   N+       G             + E +  D  V  QK +    +E  S
Sbjct  27   PQIFSELNSFNNTIQTPRNPGSENTIFAQNMVQRNQEKYADDHIVPLQKTSSENDKEPSS  86

Query  819  PPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRG  640
              +P +  ++YKGVRRRPWGK+AAEIRDP RKGARLWLGTYE PEDAALAYDR AFKLRG
Sbjct  87   DQVPLEK-KKYKGVRRRPWGKYAAEIRDPERKGARLWLGTYETPEDAALAYDRTAFKLRG  145

Query  639  ARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIG-TPKRRKISIINSVAA  463
            +RA+LNFPHLI SNV     +   R      +    LS++   G   KRR + +INS+A 
Sbjct  146  SRAVLNFPHLIESNV---TEINRVRPRRRSRSPDIELSSDQNDGPISKRRNVDLINSLAT  202

Query  462  KVNLD  448
              NLD
Sbjct  203  -ANLD  206



>ref|XP_009598140.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=213

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 84/116 (72%), Gaps = 2/116 (2%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            ++YKGVRRRPWGK+AAEIRDP RKGARLWLGTYE PEDAALAYDR AFKLRG+RA+LNFP
Sbjct  85   KKYKGVRRRPWGKYAAEIRDPERKGARLWLGTYETPEDAALAYDRTAFKLRGSRAVLNFP  144

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLD  448
            HLI SNV   I     RR   +  +    S+     + KRR + +INS+A   NLD
Sbjct  145  HLIESNV-TEINRVRPRRRSRELDIELSSSSLGDAPSSKRRNVELINSLAT-ANLD  198



>ref|XP_009628238.1| PREDICTED: ethylene-responsive transcription factor 1-like, partial 
[Nicotiana tomentosiformis]
Length=218

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAA---EIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARAL  628
            WRRY GV+RRPWG F+A   EIRDP R+GARLWLGTYE PEDAALAYD+ AFK+R +RA 
Sbjct  90   WRRYIGVKRRPWGTFSAFSVEIRDPERRGARLWLGTYETPEDAALAYDQAAFKIRSSRAR  149

Query  627  LNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
            LNFPHLIGSN+P P RV  RR        SS   T S     ++RKI +INS+A
Sbjct  150  LNFPHLIGSNMPKPARVTARRSRTRSPEPSSSSCTSSSEKGTRKRKIDLINSIA  203



>ref|XP_008232505.1| PREDICTED: ethylene-responsive transcription factor 1-like [Prunus 
mume]
Length=217

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDA LAYDR AFK+RG +A LNFP
Sbjct  104  RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKIRGCKAKLNFP  163

Query  615  HLIGSNVPAPIRVKPRRR---slpkaalssplSTESGIGTPKRRKISIINSVAA  463
            HLIGS+   P+RV P+RR       ++ SS  ++++G   PKRR+  + N +AA
Sbjct  164  HLIGSSNVEPVRVTPKRRRSPDQCSSSSSSAYTSDNGSSKPKRREAGVDNHLAA  217



>gb|ADP37426.1| ethylene-responsive-element-binding factor 11 [Petunia x hybrida]
Length=207

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W+RY+GVRRRPWGKFAAEIRDP RK ARLWLGTYE  EDAALAYDR A+KLRGARA LNF
Sbjct  104  WQRYRGVRRRPWGKFAAEIRDPTRKRARLWLGTYETSEDAALAYDRAAYKLRGARASLNF  163

Query  618  PHLIGSNVPAPIRVKPRRR  562
            PHLI SNV    RVKP+RR
Sbjct  164  PHLISSNVSEINRVKPKRR  182



>gb|KEH17838.1| AP2 domain class transcription factor [Medicago truncatula]
Length=199

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -3

Query  849  AIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALA  670
            ++ A+RE  +PP     W+RYKGVRRRPWGKFAAEIRDPN+ GAR+WLGTYE  EDAALA
Sbjct  80   SLPASREAHAPPC----WQRYKGVRRRPWGKFAAEIRDPNKNGARVWLGTYESAEDAALA  135

Query  669  YDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            YDR AFK+RG++A LNFPHLI S+V   + V  +RR
Sbjct  136  YDRAAFKMRGSKAKLNFPHLIDSDVSESMVVTAKRR  171



>ref|XP_011094418.1| PREDICTED: ethylene-responsive transcription factor 13-like [Sesamum 
indicum]
Length=187

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W+RY+GVRRRPWGKFAAEIRDP +KG+R+WLGTYE PE+AALAYDR AFKLRGARA +NF
Sbjct  81   WKRYRGVRRRPWGKFAAEIRDPVKKGSRMWLGTYETPEEAALAYDRAAFKLRGARARVNF  140

Query  618  PHLIGSNVPAPIRVKPRRR  562
            P+LIGS  P PIRV  R R
Sbjct  141  PNLIGSGAPEPIRVTKRCR  159



>ref|XP_007203292.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
 gb|EMJ04491.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
Length=223

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 95/152 (63%), Gaps = 13/152 (9%)
 Frame = -3

Query  909  IGGAGGSPESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPN  730
            +G      E    + +V   A+ A REE          R Y+GVRRRPWGKFAAEIRDP 
Sbjct  78   VGCVVSDDEVQLKEQQVAAGAVHAPREE----------RHYRGVRRRPWGKFAAEIRDPA  127

Query  729  RKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR---s  559
            + GAR+WLGTYE PEDA LAYD+ AFK+RG +A LNFPHLIGS+   P+RV P+RR    
Sbjct  128  KNGARVWLGTYETPEDAGLAYDQAAFKIRGCKAKLNFPHLIGSSNMEPVRVTPKRRRSPD  187

Query  558  lpkaalssplSTESGIGTPKRRKISIINSVAA  463
               ++ SS  + ++G   PK R+  + N +AA
Sbjct  188  QCSSSSSSAYTLDNGSPKPKLREAGVDNHLAA  219



>ref|XP_010508240.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X1 [Camelina sativa]
Length=252

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  112  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  171

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  172  KLNFPHLIGSCKYEPVRIRPRRR  194



>ref|XP_010508242.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X3 [Camelina sativa]
Length=236

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  112  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  171

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  172  KLNFPHLIGSCKYEPVRIRPRRR  194



>ref|XP_007052303.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96460.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=229

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 94/146 (64%), Gaps = 11/146 (8%)
 Frame = -3

Query  864  EVQKAAIGAAREECSP---PLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYE  694
            EV  + +G A    +P    LP+     Y+GVRRRPWG +AAEIRDP + GAR+WLGTYE
Sbjct  68   EVITSELGTATTATAPKLQALPKKV--HYRGVRRRPWGTYAAEIRDPKKNGARVWLGTYE  125

Query  693  RPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESG  514
             PEDAALAYDR AFK+RGA+A LNFPHLIGS+   P+RV   +R     + +   S  S 
Sbjct  126  TPEDAALAYDRAAFKMRGAKAKLNFPHLIGSDQVEPVRVTNNKRRSSSQSSAQSASCSSY  185

Query  513  I---GTP--KRRKISIINSVAAKVNL  451
            I   GTP  KRR IS INS A K  L
Sbjct  186  ISDNGTPKSKRRMISEINS-AVKTEL  210



>ref|XP_007052302.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96459.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=270

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 85/116 (73%), Gaps = 8/116 (7%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             +KGVRRRPWGK+AAEIRDP R GAR+WLGTYE PEDAALAYDR AFK+RGA+A LNFPH
Sbjct  133  HFKGVRRRPWGKYAAEIRDPKRNGARIWLGTYETPEDAALAYDRAAFKMRGAKAKLNFPH  192

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIG--TPKRRKISIINS--VAAKV  457
            LIGSN   PIRV  RRR    +  SS  +T S +   + KRRK S  NS  V AK+
Sbjct  193  LIGSNTWEPIRVGGRRR----SPESSAPTTASSLSDCSRKRRKSSASNSDQVTAKL  244



>ref|XP_009625877.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=206

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D WRRY GVRRR WG F AEIRDPNR+GARLWLGTYE PEDAALAYD+ AF++RG++A
Sbjct  81   PQD-WRRYIGVRRRQWGTFTAEIRDPNRRGARLWLGTYESPEDAALAYDQAAFEIRGSKA  139

Query  630  LLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
             LNFPHLIGS +  P RV  R R         P S+ S     ++ KI +INS+A
Sbjct  140  RLNFPHLIGSTITKPARVTTRCR----MRSPEPSSSASSENRTRKSKIDVINSIA  190



>ref|XP_010508241.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X2 [Camelina sativa]
Length=237

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  112  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  171

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  172  KLNFPHLIGSCKYEPVRIRPRRR  194



>ref|XP_010089318.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37643.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=254

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
             ARE  +PP  +    R++GVRRRPWGK+AAEIRDP + G R+WLGTYE PEDAALAYDR
Sbjct  114  TARESHAPPH-QGMNTRFRGVRRRPWGKYAAEIRDPKKNGKRVWLGTYETPEDAALAYDR  172

Query  660  EAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
             AF++RGA+A LNFPHLIGS  P P+R+ P+RR
Sbjct  173  AAFEMRGAKAKLNFPHLIGSEAPEPVRITPKRR  205



>ref|NP_182011.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
 sp|Q8L9K1.2|ERF99_ARATH RecName: Full=Ethylene-responsive transcription factor 13; Short=AtERF13; 
AltName: Full=Ethylene-responsive element-binding 
factor 13; Short=EREBP-13 [Arabidopsis thaliana]
 gb|AAK17157.1|AF325089_1 putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAK48967.1|AF370540_1 putative ethylene response element binding protein; EREBP [Arabidopsis 
thaliana]
 gb|AAC31840.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAL66886.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AEC10473.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
Length=226

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 76/103 (74%), Gaps = 8/103 (8%)
 Frame = -3

Query  846  IGAAREECSPPL--------PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYER  691
            + +  EE  PP         PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE 
Sbjct  65   VTSPAEENKPPATKASGSHAPRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYET  124

Query  690  PEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            PEDAA+AYDR AF+LRG++A LNFPHLIGS    P+R++PRRR
Sbjct  125  PEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRR  167



>gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
Length=226

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  85   PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  144

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  145  KLNFPHLIGSCKYEPVRIRPRRR  167



>ref|XP_010518091.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=252

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  115  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  174

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  175  KLNFPHLIGSCKYEPVRIRPRRR  197



>ref|XP_010506419.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=250

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  113  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  172

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  173  KLNFPHLIGSCKYEPVRIRPRRR  195



>ref|XP_006294915.1| hypothetical protein CARUB_v10023967mg [Capsella rubella]
 gb|EOA27813.1| hypothetical protein CARUB_v10023967mg [Capsella rubella]
Length=237

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  100  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  159

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  160  KLNFPHLIGSCKYEPVRIRPRRR  182



>emb|CDP09437.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RY+GVRRRPWGKFAAEIRD   KG+R+WLGTYE PEDAALAYD+ AF++RGA+A LNF
Sbjct  101  WTRYRGVRRRPWGKFAAEIRDLKMKGSRIWLGTYETPEDAALAYDQAAFEMRGAKARLNF  160

Query  618  PHLIGSNVPAPIRVKPRRR  562
            P+L GSN   P+RV PR+R
Sbjct  161  PNLFGSNTLQPVRVNPRKR  179



>ref|XP_002880142.1| hypothetical protein ARALYDRAFT_903921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56401.1| hypothetical protein ARALYDRAFT_903921 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A
Sbjct  99   PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKA  158

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIGS    P+R++PRRR
Sbjct  159  KLNFPHLIGSCKYEPVRIRPRRR  181



>ref|XP_007052301.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96458.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=188

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR     Y+GVRRRPWGK+AAEIRDP +KGARLWLGTYE PEDAALAYD+ AF++RG++A
Sbjct  99   PRGKGVNYRGVRRRPWGKYAAEIRDPKKKGARLWLGTYETPEDAALAYDKAAFEIRGSKA  158

Query  630  LLNFPHLIG-SNVPAPIRVKPRRR  562
             LNFPHLIG SN   P+RV PRRR
Sbjct  159  KLNFPHLIGSSNSTEPVRVCPRRR  182



>emb|CDY56473.1| BnaC04g53270D [Brassica napus]
Length=231

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A
Sbjct  105  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKA  164

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIG+    P+R++PRRR
Sbjct  165  KLNFPHLIGTCKYEPVRIRPRRR  187



>gb|KCW62805.1| hypothetical protein EUGRSUZ_G00396, partial [Eucalyptus grandis]
Length=181

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            EVQ  A    RE  +P         Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PE
Sbjct  40   EVQTRAEMVKREMKAPA----RMTHYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPE  95

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            DAALAYDR AFK+RG++A LNFPHLIGS    P+RV P+RR
Sbjct  96   DAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPVRVSPKRR  136



>gb|KCW62801.1| hypothetical protein EUGRSUZ_G00393 [Eucalyptus grandis]
Length=226

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPHL
Sbjct  122  YRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHL  181

Query  609  IGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            IGS    P+RV P+RR    +   S  S++ G+   KRRK
Sbjct  182  IGSVEYEPVRVSPKRR----STEPSSPSSDDGLTGTKRRK  217



>ref|XP_010089316.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37641.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=260

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             ++GVRRRPWGK+AAEIRDP + G R+WLGTYE PEDAALAYDR AF++RGA+A LNFPH
Sbjct  133  HFRGVRRRPWGKYAAEIRDPKKNGKRIWLGTYETPEDAALAYDRAAFEMRGAKAKLNFPH  192

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLD  448
            LIGS    P+R+KP+RRS   +  SS     S +   KRR+I + +S   K + D
Sbjct  193  LIGSEAREPVRIKPKRRSPEPSTSSSMWEF-SSLSPAKRRQIGVGSSEDIKFSDD  246



>emb|CDY23459.1| BnaC04g49870D [Brassica napus]
Length=237

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  816  PLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGA  637
            P PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G+
Sbjct  98   PAPRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGS  157

Query  636  RALLNFPHLIGSNVPAPIRVKPRRR  562
            +A LNFPHLIG+    P+R++PRRR
Sbjct  158  KAKLNFPHLIGTCEYEPVRIRPRRR  182



>emb|CDX74692.1| BnaA05g04380D [Brassica napus]
Length=232

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A
Sbjct  102  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKA  161

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIG+    P+R++PRRR
Sbjct  162  KLNFPHLIGTCKYEPVRIRPRRR  184



>ref|XP_009144089.1| PREDICTED: ethylene-responsive transcription factor 13-like [Brassica 
rapa]
Length=232

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A
Sbjct  102  PRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKA  161

Query  630  LLNFPHLIGSNVPAPIRVKPRRR  562
             LNFPHLIG+    P+R++PRRR
Sbjct  162  KLNFPHLIGTCKYEPVRIRPRRR  184



>ref|XP_006397665.1| hypothetical protein EUTSA_v10001758mg [Eutrema salsugineum]
 gb|ESQ39118.1| hypothetical protein EUTSA_v10001758mg [Eutrema salsugineum]
Length=234

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A LNFPH
Sbjct  106  QYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPH  165

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+R++PRRR
Sbjct  166  LIGSCKYEPVRIRPRRR  182



>ref|XP_010065366.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=231

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPHL
Sbjct  127  YRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHL  186

Query  609  IGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            IGS    P+RV P+RR    +   S  S++ G+   KRRK
Sbjct  187  IGSVEYEPVRVSPKRR----STEPSSPSSDDGLTGTKRRK  222



>ref|XP_006375127.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
 gb|ERP52924.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
Length=227

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 86/140 (61%), Gaps = 13/140 (9%)
 Frame = -3

Query  954  EIFAAIDRCGNSSAVIGGAGGSPES----WEGDGEVQKAAIGA------AREECSPPLPR  805
            +I   ID   NSS  +      PES    W    +V      +      + E+ S  LP 
Sbjct  57   DILLQID---NSSQTMACDTQVPESLDMQWSLWNQVDSMTTTSNYEFEVSVEDASNYLPP  113

Query  804  DYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALL  625
               R YKGVRRRPWGK+AAEIRDP + GAR WLGTYE PEDAA+AYDR AFK+RGA+A L
Sbjct  114  PKGRNYKGVRRRPWGKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAFKMRGAKAKL  173

Query  624  NFPHLIGSNVPAPIRVKPRR  565
            NFPHLIGS+   P+RV  +R
Sbjct  174  NFPHLIGSSNYEPVRVTNKR  193



>gb|KDP43273.1| hypothetical protein JCGZ_22825 [Jatropha curcas]
Length=210

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 77/102 (75%), Gaps = 9/102 (9%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +YKGVRRRPWGK+AAEIR+P + GARLWLGTYE PEDAALAYD  AFK+RG +A LNFPH
Sbjct  117  KYKGVRRRPWGKYAAEIRNPKKNGARLWLGTYETPEDAALAYDEAAFKMRGCKAKLNFPH  176

Query  612  LIGS-NVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGS +   P+RV P+RR        SP ST    G+PKRRK
Sbjct  177  LIGSTDYQPPVRVSPKRR--------SPESTLFEDGSPKRRK  210



>ref|XP_008363915.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVRRRPWGK+AAEIRDP + GARLWLGTYE PEDA LAYDR AFKLRG +A LNFP
Sbjct  88   KHYRGVRRRPWGKYAAEIRDPAKNGARLWLGTYETPEDAGLAYDRAAFKLRGCKAKLNFP  147

Query  615  HLIGSNVPAPIRVKPRR  565
            HLIGS+   P+RV P+R
Sbjct  148  HLIGSSSIEPVRVTPKR  164



>ref|XP_008345528.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVRRRPWGK+AAEIRDP + GARLWLGTYE PEDA LAYDR AFKLRG +A LNFP
Sbjct  88   KHYRGVRRRPWGKYAAEIRDPAKNGARLWLGTYETPEDAGLAYDRAAFKLRGCKAKLNFP  147

Query  615  HLIGSNVPAPIRVKPRR  565
            HLIGS+   P+RV P+R
Sbjct  148  HLIGSSSIEPVRVTPKR  164



>ref|XP_004308507.1| PREDICTED: ethylene-responsive transcription factor 13-like [Fragaria 
vesca subsp. vesca]
Length=213

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDA LAYDR AFKLRG +A LNFP
Sbjct  111  RHFRGVRRRPWGKYAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKLRGRKAKLNFP  170

Query  615  HLIGSNVPAPIRVKPRRR  562
            HLIGSN   P+RV P+RR
Sbjct  171  HLIGSNNVEPVRVTPKRR  188



>ref|XP_006347953.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=228

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            ++YKGVRRRPWGK+AAEIRDP RKG RLWLGTYE PEDAALAYDR AFKLRG+RA+LNFP
Sbjct  82   KKYKGVRRRPWGKYAAEIRDPERKGCRLWLGTYETPEDAALAYDRTAFKLRGSRAVLNFP  141

Query  615  HLIGSNV  595
            HLI SNV
Sbjct  142  HLIESNV  148



>emb|CDY30489.1| BnaA04g25900D [Brassica napus]
Length=232

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A LNFPH
Sbjct  101  QYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPH  160

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+R++PRRR
Sbjct  161  LIGSCEYEPVRIRPRRR  177



>ref|XP_010068081.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            EVQ  A    RE  +P         Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PE
Sbjct  101  EVQTRAEMVKREMKAPA----RMTHYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPE  156

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            DAALAYDR AFK+RG++A LNFPHLIGS    P+RV P+RR
Sbjct  157  DAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPVRVSPKRR  197



>ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=223

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 73/102 (72%), Gaps = 11/102 (11%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y GVR+RPWG +AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG +A LNFP
Sbjct  98   RNYMGVRKRPWGTYAAEIRDPKKNGARVWLGTYETPEDAALAYDRAAFKMRGTKAKLNFP  157

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            HLIGS+   P+RV  RRRS            ES   +PKRRK
Sbjct  158  HLIGSDDLEPVRVSNRRRSP-----------ESDESSPKRRK  188



>ref|XP_011042382.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=225

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            A RE  +PPL ++   +YKGVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR
Sbjct  101  APRESGAPPL-KEKGLQYKGVRRRPWGKYAAEIRDPKKNGARMWLGTYETPEDAALAYDR  159

Query  660  EAFKLRGARALLNFPHLIGSNVP-APIRVKPRRR  562
             AFK+RG++A LNFPHLIGSN    P RV  ++R
Sbjct  160  AAFKMRGSKAKLNFPHLIGSNNNWEPARVTSKKR  193



>ref|XP_011016089.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -3

Query  831  EECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAF  652
            E+ S  LP    R YKGVRRRPWGK+AAEIRDP + GAR WLGTYE PEDAA+AYDR AF
Sbjct  105  EDASNYLPPPKGRNYKGVRRRPWGKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAF  164

Query  651  KLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            K+RGA+A LNFPHLIGS+   P+RV  +R
Sbjct  165  KMRGAKAKLNFPHLIGSSNYEPVRVTNKR  193



>ref|XP_011016088.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=225

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            A RE  +PPL ++   +YKGVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR
Sbjct  101  APRESGAPPL-KEKGLQYKGVRRRPWGKYAAEIRDPKKNGARMWLGTYETPEDAALAYDR  159

Query  660  EAFKLRGARALLNFPHLIGSNVP-APIRVKPRRR  562
             AFK+RG++A LNFPHLIGSN    P RV  ++R
Sbjct  160  AAFKMRGSKAKLNFPHLIGSNNNWEPARVTSKKR  193



>gb|KCW62806.1| hypothetical protein EUGRSUZ_G00397 [Eucalyptus grandis]
Length=190

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEI+DP + GAR+WLGTYE PEDA LAYDR AFK+RG++A LNFPHL
Sbjct  62   YRGVRRRPWGKYAAEIKDPKKNGARIWLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPHL  121

Query  609  IGSNVPAPIRVKPRRR  562
            IGS    P+RV P+RR
Sbjct  122  IGSAEHEPVRVSPKRR  137



>gb|KDP28852.1| hypothetical protein JCGZ_14623 [Jatropha curcas]
Length=229

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (71%), Gaps = 8/119 (7%)
 Frame = -3

Query  846  IGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAY  667
            +  AR   +PPL R   R Y GVRRRPWG +AAEIRDP + GAR+WLGTYE PEDAA+AY
Sbjct  77   VPVARPNHTPPLRR---RNYIGVRRRPWGTYAAEIRDPKKNGARVWLGTYETPEDAAVAY  133

Query  666  DREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            DR AF++RG++A LNFPHLIGS+   P R+  +RR    ++L+   S     G+PKRRK
Sbjct  134  DRAAFEMRGSKAKLNFPHLIGSDNVEPARLSHKRRVPESSSLAVKSS-----GSPKRRK  187



>ref|XP_011031966.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -3

Query  831  EECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAF  652
            E+ S  LP    R YKGVRRRPWGK+AAEIRDP + GAR WLGTYE PEDAA+AYDR AF
Sbjct  105  EDASNYLPPPKGRNYKGVRRRPWGKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAF  164

Query  651  KLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            K+RGA+A LNFPHLIGS+   P+RV  +R
Sbjct  165  KMRGAKAKLNFPHLIGSSNYEPVRVTNKR  193



>gb|KDP28854.1| hypothetical protein JCGZ_14625 [Jatropha curcas]
Length=196

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y GVRRRPWGK+AAEIRDP + G+R+WLGTYE PEDAALAYDR AFK+RG++A LNFPH
Sbjct  112  QYTGVRRRPWGKYAAEIRDPKKNGSRIWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPH  171

Query  612  LIGSNVPAPIRVKPRR  565
            LIGS+   PIRV  +R
Sbjct  172  LIGSDDYEPIRVTNKR  187



>ref|XP_010315446.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=205

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 83/131 (63%), Gaps = 17/131 (13%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            ++YKGVRRRPWGK+AAEIRDP RKG RLWLGTYE PEDAALAYDR AF+LRG++A+LNFP
Sbjct  61   KKYKGVRRRPWGKYAAEIRDPERKGCRLWLGTYETPEDAALAYDRTAFRLRGSKAVLNFP  120

Query  615  HLIGSNVP---------------APIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
            HLI +NV                      P     P    S+  +T+  I   KRR + +
Sbjct  121  HLIETNVTEINRVRPRRRPRSPEFSSSSPPPPPPPPYVDESNNNNTDGSIS--KRRNVEL  178

Query  480  INSVAAKVNLD  448
            INS+A   NLD
Sbjct  179  INSLATVNNLD  189



>ref|XP_007203094.1| hypothetical protein PRUPE_ppa023698mg [Prunus persica]
 gb|EMJ04293.1| hypothetical protein PRUPE_ppa023698mg [Prunus persica]
Length=216

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDA LAYDR AFKLRG +A LNFP
Sbjct  106  RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKLRGCKAKLNFP  165

Query  615  HLIGSNVPAPIRVKPR  568
            HLIGS+   P+RV P+
Sbjct  166  HLIGSSNVEPVRVNPK  181



>ref|XP_002511589.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50258.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=225

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE+PEDAALAYDR AFK+RGARA LNFPH
Sbjct  118  QYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEKPEDAALAYDRAAFKMRGARAKLNFPH  177

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS+   PIR    +R
Sbjct  178  LIGSDEYEPIRAGNNKR  194



>gb|KDO85528.1| hypothetical protein CISIN_1g039729mg [Citrus sinensis]
Length=179

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRK-GARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            Y+GVRRRPWGKFAAEIRDPN+K GAR+WLGTY+ PE AALAYDR AF +RG++A LNFPH
Sbjct  68   YRGVRRRPWGKFAAEIRDPNKKNGARVWLGTYDTPEGAALAYDRAAFNMRGSKAKLNFPH  127

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGSNV  P+RV  +R S   +  +  L +ES     KRRK
Sbjct  128  LIGSNVAPPLRVTKKRGSSSSSNYTLHLQSES--PNSKRRK  166



>ref|XP_006375130.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
 gb|ERP52927.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
Length=193

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYD+ AFK+RG++A LNFPH
Sbjct  99   QYRGVRRRPWGKYAAEIRDPKKNGARMWLGTYETPEDAALAYDQAAFKIRGSKAKLNFPH  158

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGS    P+R+  +RRS     +          G+PKRRK
Sbjct  159  LIGSEEYEPVRLSSKRRSPEPELVHD--------GSPKRRK  191



>ref|XP_009142287.1| PREDICTED: ethylene-responsive transcription factor 13-like [Brassica 
rapa]
Length=235

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A LNFPH
Sbjct  104  QYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPH  163

Query  612  LIGSNVPAPIRVKPRRR  562
            LIG+    P+R++PRRR
Sbjct  164  LIGTCEYEPVRIRPRRR  180



>ref|XP_002511588.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50257.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=221

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYD+ AFK+RG +A LNFPH
Sbjct  126  QYRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPH  185

Query  612  LIGSN-VPAPIRVKPRRR  562
            LIGSN    P+RV P+RR
Sbjct  186  LIGSNDYQPPVRVSPKRR  203



>gb|KCW62512.1| hypothetical protein EUGRSUZ_G00002 [Eucalyptus grandis]
Length=212

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = -3

Query  951  IFAAIDRCGNSSAVIGGAGGSPESWEGDGEVQKAAIGAAREECSPPLPRDYW-----RRY  787
            +++A+    NS   +  A      +E    +   ++G   EE    + R+        RY
Sbjct  32   VYSALRDALNSRWTVPQASSRELDFER-TTIDYNSVGLVTEEKQETVEREVQVPVKKTRY  90

Query  786  KGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLI  607
            +GVRRRPWGK+AAE+RDP + GAR+WLGTYE PEDAALAYDR AFK+RG +A LNFP+LI
Sbjct  91   RGVRRRPWGKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFKMRGCKAKLNFPNLI  150

Query  606  GSNVPAPIRVKPRRR  562
            GS    PIRV P+RR
Sbjct  151  GSTDYEPIRVSPKRR  165



>ref|XP_010067932.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=257

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            RY+GVRRRPWGK+AAE+RDP + GAR+WLGTYE PEDAALAYDR AFK+RG +A LNFP+
Sbjct  134  RYRGVRRRPWGKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFKMRGCKAKLNFPN  193

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    PIRV P+RR
Sbjct  194  LIGSTDYEPIRVSPKRR  210



>gb|KDP22469.1| hypothetical protein JCGZ_26300 [Jatropha curcas]
Length=254

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG+RALLNFP
Sbjct  128  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFRMRGSRALLNFP  187

Query  615  HLIGSNVPAPIRVKPRR  565
            H IGSN P P+R+  +R
Sbjct  188  HKIGSNEPEPVRITSKR  204



>gb|KCW62799.1| hypothetical protein EUGRSUZ_G00391 [Eucalyptus grandis]
Length=208

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 97/158 (61%), Gaps = 11/158 (7%)
 Frame = -3

Query  900  AGGSPESWEGDGE---VQKAAIGAAREECSPPLPRDYW-----RRYKGVRRRPWGKFAAE  745
             G    S E D E   +   ++G A EE    + R+         Y+GVRRRPWGK+AAE
Sbjct  32   TGPQASSQELDFERTTIDYNSVGLATEEKQETVEREVQVPVKKTHYRGVRRRPWGKYAAE  91

Query  744  IRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            +RDP + GAR+WLGTYE PEDAALAYD+ AFK+RG +A LNFPHLIGS    PIRV  +R
Sbjct  92   MRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPIRVSLKR  151

Query  564  RslpkaalssplSTESGIGTPKRRKISIINSVAAKVNL  451
            RS   ++ S+        GT KRRK  +  +V AKV+ 
Sbjct  152  RSAEPSSPSTSSGESFLTGT-KRRKREV--NVDAKVDF  186



>ref|XP_008232472.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Prunus 
mume]
Length=215

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE PEDA LAYDR AFKLRG +A LNFP
Sbjct  106  RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKLRGCKARLNFP  165

Query  615  HLIGSNVPAPIRVKPR  568
            HLIGS+   P+RV P+
Sbjct  166  HLIGSSNVEPVRVSPK  181



>gb|AFI98122.1| ethylene-responsive element-binding protein 6 [Gossypium barbadense]
Length=222

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             YKGVRRRPWG +AAEIRDP + GAR+WLGTYE  EDAALAYDR AFK+RG++A LNFPH
Sbjct  104  HYKGVRRRPWGTYAAEIRDPKKNGARIWLGTYETLEDAALAYDRAAFKMRGSKAKLNFPH  163

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPK-RRKISIINS  472
            LIGS+   P+R+   +R  P+    S  S+ S  GTPK +R+IS + S
Sbjct  164  LIGSDQVQPVRLSNNKRQSPEPCSPSSSSSMSDDGTPKSKRRISELGS  211



>gb|KDP28855.1| hypothetical protein JCGZ_14626 [Jatropha curcas]
Length=232

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 7/102 (7%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYD+ AFK+RG++A LNFPH
Sbjct  137  QYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGSKAKLNFPH  196

Query  612  LIGS-NVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGS +   P+RV P+RR       S   ST S  G+PKRRK
Sbjct  197  LIGSADYQPPVRVSPKRR------SSEMESTSSEDGSPKRRK  232



>ref|XP_004308505.1| PREDICTED: ethylene-responsive transcription factor 2-like [Fragaria 
vesca subsp. vesca]
Length=238

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            AAR++ +P  P      ++GVRRRPWGK+AAEIRDP + G R+WLGTYE  EDA LAYDR
Sbjct  72   AARDDHAPSAPN----HFRGVRRRPWGKYAAEIRDPKKNGTRVWLGTYETAEDAGLAYDR  127

Query  660  EAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
             AF++RG++A LNFPHLIG++     RV P+R S   ++ SS +S+E G   PKR + S 
Sbjct  128  AAFRMRGSKAKLNFPHLIGTHDMEVGRVLPKRASPEPSSPSSTMSSEDGSPKPKRMRRSG  187

Query  480  INSVAAKVNLD  448
             +S AAK  LD
Sbjct  188  GDSAAAKAKLD  198



>ref|XP_010068083.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=255

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEI+DP + GAR+WLGTYE PEDA LAYDR AFK+RG++A LNFPH
Sbjct  126  HYRGVRRRPWGKYAAEIKDPKKNGARIWLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPH  185

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+RV P+RR
Sbjct  186  LIGSAEHEPVRVSPKRR  202



>ref|XP_007204071.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
 gb|EMJ05270.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
Length=237

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDA LAYDR AFK+RG++A LNFP
Sbjct  90   RHFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAEDAGLAYDRAAFKMRGSKAKLNFP  149

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
            HLIGS+   P RV P+R S   +  S+  S + G  T KRRK  +
Sbjct  150  HLIGSHDSEPGRVAPKRGSPEPSFSSATSSDDGGCPTLKRRKSGV  194



>ref|XP_010068077.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=303

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 91/138 (66%), Gaps = 8/138 (6%)
 Frame = -3

Query  849  AIGAAREECSPPLPRDYW-----RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            ++G A EE    + R+         Y+GVRRRPWGK+AAE+RDP + GAR+WLGTYE PE
Sbjct  147  SVGLATEEKQETVEREVQVPVKKTHYRGVRRRPWGKYAAEMRDPKKNGARIWLGTYETPE  206

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGT  505
            DAALAYD+ AFK+RG +A LNFPHLIGS    PIRV  +RRS   ++ S+        GT
Sbjct  207  DAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPIRVSLKRRSAEPSSPSTSSGESFLTGT  266

Query  504  PKRRKISIINSVAAKVNL  451
             KRRK  +  +V AKV+ 
Sbjct  267  -KRRKREV--NVDAKVDF  281



>ref|XP_006445414.1| hypothetical protein CICLE_v10022025mg [Citrus clementina]
 gb|ESR58654.1| hypothetical protein CICLE_v10022025mg [Citrus clementina]
 gb|KDO85531.1| hypothetical protein CISIN_1g047100mg [Citrus sinensis]
Length=233

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            +Y+GVRRRPWGKFAAEIRDP + GAR+WLGTY+ PE AA AYDR AFK+RG++A LNFPH
Sbjct  134  QYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYDTPEGAAFAYDRAAFKMRGSKAKLNFPH  193

Query  612  LIGSNVPAPIRVKPRR  565
            LIGSNV  P+RV  +R
Sbjct  194  LIGSNVEPPVRVTKKR  209



>ref|XP_010068078.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=242

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 97/158 (61%), Gaps = 11/158 (7%)
 Frame = -3

Query  900  AGGSPESWEGDGE---VQKAAIGAAREECSPPLPRDYW-----RRYKGVRRRPWGKFAAE  745
             G    S E D E   +   ++G A EE    + R+         Y+GVRRRPWGK+AAE
Sbjct  66   TGPQASSQELDFERTTIDYNSVGLATEEKQETVEREVQVPVKKTHYRGVRRRPWGKYAAE  125

Query  744  IRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            +RDP + GAR+WLGTYE PEDAALAYD+ AFK+RG +A LNFPHLIGS    PIRV  +R
Sbjct  126  MRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPIRVSLKR  185

Query  564  RslpkaalssplSTESGIGTPKRRKISIINSVAAKVNL  451
            RS   ++ S+        GT KRRK  +  +V AKV+ 
Sbjct  186  RSAEPSSPSTSSGESFLTGT-KRRKREV--NVDAKVDF  220



>ref|XP_009606945.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
tomentosiformis]
 sp|Q40479.1|ERF2_TOBAC RecName: Full=Ethylene-responsive transcription factor 2; Short=NtERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana tabacum]
 dbj|BAA07324.1| ethylene-responsive element binding protein [Nicotiana tabacum]
 dbj|BAN58170.1| ethylene response factor 32 [Nicotiana tabacum]
Length=233

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 6/112 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD+ A+++RG++ALLNFP
Sbjct  97   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFP  156

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAK  460
            H IG N P P+R+  +RRS   A+ S   + E+  G+PKRR+     +VAAK
Sbjct  157  HRIGLNEPEPVRLTAKRRSPEPASSSISSALEN--GSPKRRR----KAVAAK  202



>gb|AFK42966.1| unknown [Medicago truncatula]
 gb|KEH23453.1| AP2-domain DNA-binding protein [Medicago truncatula]
Length=208

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 4/88 (5%)
 Frame = -3

Query  849  AIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALA  670
             I  ARE  +PP+    W+RYKGVRRRPWGKFAAEIRDP + GAR+WLGTY   E+AALA
Sbjct  45   TIVEAREVNTPPI----WKRYKGVRRRPWGKFAAEIRDPKKNGARVWLGTYVTEEEAALA  100

Query  669  YDREAFKLRGARALLNFPHLIGSNVPAP  586
            YD+ AFK+RG +A LNFPHLIGS+V  P
Sbjct  101  YDKAAFKMRGRKAKLNFPHLIGSDVFTP  128



>gb|AFB35653.1| ERF8 [Gossypium hirsutum]
Length=265

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRD  + GAR+WLGTYE  E+AALAYDR AFK+RG+RALLNFP
Sbjct  136  RHYRGVRQRPWGKFAAEIRDSAKNGARVWLGTYETAEEAALAYDRAAFKMRGSRALLNFP  195

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG+N PAP+R+  +RR
Sbjct  196  HRIGNNEPAPVRITAKRR  213



>ref|XP_006347956.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum 
tuberosum]
Length=222

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 22/180 (12%)
 Frame = -3

Query  954  EIFAAIDRCGNSSAVIGGAGGSPESWEG----DGEVQKAAIGAAREECSPPLPRDYWRRY  787
            + F  +      S  +     +P S E     +G  ++  +    EE +P      WRR+
Sbjct  32   DFFETLSPMSLDSTTLLPNNPTPNSLESPVRPEG-TKETFVAREHEESAP----QDWRRF  86

Query  786  KGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLI  607
             GVRRR WG F+AEIRDPNR+GARLWLGTYE P+DAALAYD+ A+K+RG +A LNFP LI
Sbjct  87   IGVRRRQWGTFSAEIRDPNRRGARLWLGTYESPQDAALAYDQAAYKIRGTKARLNFPDLI  146

Query  606  GSNVPAPIRV-------------KPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
            GS+VP P RV             +P   S   ++ SS  S+ S     K+RKI +INS+A
Sbjct  147  GSDVPMPPRVTARRRTRSRSRSPEPSTTSSSSSSSSSSSSSSSMENGTKKRKIDLINSIA  206



>ref|XP_004492940.1| PREDICTED: ethylene-responsive transcription factor 1-like [Cicer 
arietinum]
Length=210

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = -3

Query  837  AREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDRE  658
             RE  +PP     W+RYKGVRRRPWGKFAAEIRDP + GAR+WLGTY   E+AALAYD+ 
Sbjct  49   TREVNAPPT----WKRYKGVRRRPWGKFAAEIRDPKKNGARVWLGTYVTEEEAALAYDKA  104

Query  657  AFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            AFK+RG +A LNFPHLIGS+VP     KP R
Sbjct  105  AFKMRGRKAKLNFPHLIGSDVPTS---KPER  132



>ref|XP_010068075.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=208

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = -3

Query  828  ECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFK  649
            EC   LP +  + Y+GVRRRPWGK+AAE+RDP + GAR+WLGTYE PEDAALAYDR AFK
Sbjct  78   ECEVQLPVEK-KHYRGVRRRPWGKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFK  136

Query  648  LRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            +RG++A LNFPHLIG     P+RV+ +R+
Sbjct  137  MRGSKAKLNFPHLIGLAEYDPVRVRSKRQ  165



>ref|XP_010089319.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37644.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=195

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 7/116 (6%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDAALAYDR AFK+RG++A LNFPH
Sbjct  68   HFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETQEDAALAYDRAAFKMRGSKAKLNFPH  127

Query  612  LIGSNVPAPI-RVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLD  448
            LIGS+    + RV P+RR           ++    G+PKRRK      V AKV LD
Sbjct  128  LIGSSHELELARVTPKRR------SPETSASSGDGGSPKRRKSGNGFEVEAKVELD  177



>ref|XP_004308504.1| PREDICTED: ethylene-responsive transcription factor 13-like [Fragaria 
vesca subsp. vesca]
Length=237

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 18/166 (11%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK++AEIRDP +KG R+WLGTYER EDA LAYDR AFK+RG++A LNFP
Sbjct  89   RNFRGVRRRPWGKYSAEIRDPKKKGMRVWLGTYERAEDAGLAYDRAAFKMRGSKAKLNFP  148

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLDRVsm  436
            HLIG++     RV P+R     +   S  S+E G   PKRR+ S ++S A K  LD  + 
Sbjct  149  HLIGTHDMEVGRVLPKR----ASPEPSSPSSEDGSPKPKRRRRSGVDSAATKDKLDEAAK  204

Query  435  ldmlts*ds*lLQNHVLESIAVNLQDNSLGNRNISSSTSASCVLTF  298
                         +HV +  ++   D  +    + S +  S +L+F
Sbjct  205  EF-----------HHVFQVDSITFGDEDMV---LLSPSECSDILSF  236



>gb|EPS69901.1| ethylene-responsive transcription factor 2, partial [Genlisea 
aurea]
Length=179

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP RKGAR+WLGTYE  E+AA AYDR A+++RG +ALLNFP
Sbjct  83   RHYRGVRQRPWGKFAAEIRDPARKGARVWLGTYETAEEAASAYDRAAYRMRGCKALLNFP  142

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            H IGS  P PIR+ P+RR             +S  G+PKR +
Sbjct  143  HKIGSGEPEPIRISPKRR---------SPEPDSDAGSPKRTR  175



>gb|KDO85532.1| hypothetical protein CISIN_1g044584mg [Citrus sinensis]
Length=223

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAE+RDP + GAR WLGTYE PEDAA+AYDR AFKLRGA+A LNFPHL
Sbjct  103  YRGVRRRPWGKYAAEMRDPKKNGARAWLGTYETPEDAAMAYDRAAFKLRGAKAKLNFPHL  162

Query  609  IGS-NVPAPIRVKPRRR  562
            IGS +   PIRV PRRR
Sbjct  163  IGSAHCREPIRVNPRRR  179



>ref|XP_009335609.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
 ref|XP_009335623.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
Length=198

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVRRRPWGK+AAEIRDP + GARLWLG YE P DA LAYDR AFKLRG +A LNFP
Sbjct  88   KHYRGVRRRPWGKYAAEIRDPAKNGARLWLGIYETPVDAGLAYDRAAFKLRGCKAKLNFP  147

Query  615  HLIGSNVPAPIRVKPRRR  562
            HLIGS+   P+RV P+RR
Sbjct  148  HLIGSSSIEPVRVTPKRR  165



>ref|XP_009607861.1| PREDICTED: ethylene-responsive transcription factor 1-like [Nicotiana 
tomentosiformis]
Length=204

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            WRRY+GVRRRPWG FA EIRDP RKGARLWLGTYE  ED ALAYDR  +KLRGARALLNF
Sbjct  65   WRRYRGVRRRPWGTFATEIRDPIRKGARLWLGTYETSEDVALAYDRSTYKLRGARALLNF  124

Query  618  PHLIGSNVPAPIRVKPRRRslpkaals-splSTESGIGTPKRRKISIINSVAAKVNLD  448
            PHLIGSNV    RVKP++R         S  +TE      K+R +++INS+  K N +
Sbjct  125  PHLIGSNVVELNRVKPKKRLRSLELSFPSQTTTECTTPNLKKRNVALINSL-TKANFN  181



>ref|XP_007038272.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY22773.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=272

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG+RALLNFP
Sbjct  142  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSRALLNFP  201

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG+N P P+RV  +RR
Sbjct  202  HRIGNNEPEPVRVTAKRR  219



>ref|XP_010068071.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             YKGVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPH
Sbjct  118  HYKGVRRRPWGKYAAEIRDPKKNGARIWLGTYEAPEDAALAYDRAAFKMRGSKAKLNFPH  177

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGS    P+RV  R+R   + +  S  S +S +   KRRK
Sbjct  178  LIGSAEYEPVRVG-RKRLSSEPSSPSTCSDDSLMTRMKRRK  217



>ref|XP_011076437.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 2-like [Sesamum indicum]
Length=240

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  861  VQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPED  682
            V+   +GA     +P +     R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  E+
Sbjct  85   VRTEFVGAPPVSVAPVVAGPKGRHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETAEE  144

Query  681  AALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            AALAYDR A+K+RG++ALLNFPH IG N P P+RV  +R+
Sbjct  145  AALAYDRAAYKMRGSKALLNFPHKIGLNEPEPVRVTAKRK  184



>ref|XP_006375126.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
 gb|ERP52923.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
Length=226

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            A RE    PL ++   +YKGVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR
Sbjct  102  APRESGPQPL-KEKGLQYKGVRRRPWGKYAAEIRDPKKNGARMWLGTYETPEDAALAYDR  160

Query  660  EAFKLRGARALLNFPHLIGSNVP-APIRVKPRRR  562
             AFK+RG++A LNFPHLIGSN    P RV  ++R
Sbjct  161  AAFKMRGSKAKLNFPHLIGSNNNWEPTRVTSKKR  194



>gb|ADJ67441.1| ethylene response factor 12 [Actinidia deliciosa]
Length=248

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG+RALLNFP
Sbjct  115  RHFRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDKAAYRMRGSRALLNFP  174

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLDR  445
            H IGS+ P P+RV  +RRS    + S      S  G+PKRR+     +  A++ ++R
Sbjct  175  HRIGSDEPEPVRVTSKRRSPEPTSPS------SESGSPKRRRKGFAAAKQAELGVER  225



>ref|XP_010065367.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=239

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPH
Sbjct  110  HYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPH  169

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+RV  +RR
Sbjct  170  LIGSVEYEPVRVSSKRR  186



>ref|XP_010068079.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
 gb|KCW62800.1| hypothetical protein EUGRSUZ_G00392 [Eucalyptus grandis]
Length=276

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAE+RDP +KGAR+WLGTYE P+DAALAYDR AFK+RG++A LNFPHL
Sbjct  154  YRGVRRRPWGKYAAEMRDPKKKGARIWLGTYETPQDAALAYDRAAFKMRGSKAKLNFPHL  213

Query  609  IGSNVPAPIRVKPRRR  562
            I S+   PIRV  +RR
Sbjct  214  ISSSDYEPIRVSTKRR  229



>gb|AGS80336.1| ethylene response factor [Actinidia eriantha]
Length=248

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG+RALLNFP
Sbjct  115  RHFRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDKAAYRMRGSRALLNFP  174

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLDR  445
            H IGS+ P PIRV  +RRS    + +      S  G+PKRR+     +  A++ ++R
Sbjct  175  HRIGSDDPEPIRVTSKRRSPEPTSPA------SESGSPKRRRKGFAAAKQAELGVER  225



>gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Erythranthe guttata]
Length=243

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  102  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFRMRGSKALLNFP  161

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+R+  +RR
Sbjct  162  HKIGLNEPEPVRITAKRR  179



>ref|XP_008232503.1| PREDICTED: ethylene-responsive transcription factor 13-like [Prunus 
mume]
Length=241

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDA+LAYDR A+K+RG++A LNFP
Sbjct  94   RHFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAEDASLAYDRAAYKMRGSKAKLNFP  153

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
            HLIGS+   P RV P+R S   +  S+  S + G  T K+RK  +
Sbjct  154  HLIGSHDSEPGRVAPKRGSPEPSFSSATSSDDGGSPTLKKRKSGV  198



>gb|AFI98121.1| ethylene-responsive element-binding protein 5 [Gossypium barbadense]
Length=190

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRDP + G R WLGTY+ PEDAALAYD+ AFK+RG++A LNFPHL
Sbjct  91   YRGVRRRPWGKYAAEIRDPKKNGLRNWLGTYQTPEDAALAYDKAAFKIRGSKAKLNFPHL  150

Query  609  IGSNVPAPIRVKPRRR  562
            IGS+   P+RV PRRR
Sbjct  151  IGSSNVEPVRVGPRRR  166



>ref|XP_008232470.1| PREDICTED: ethylene-responsive transcription factor 2-like [Prunus 
mume]
Length=272

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDAALAYD+ AFK+RG++A LNFP
Sbjct  126  RHFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAEDAALAYDKAAFKMRGSKAKLNFP  185

Query  615  HLIGSNVPAPIRVKPRRR  562
            HLIGS    P+R+ P+RR
Sbjct  186  HLIGSEGCEPVRITPKRR  203



>ref|XP_006421523.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
 gb|ADI34108.1| putative ethylene-responsive element binding protein [Citrus 
unshiu]
 gb|ESR34763.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
Length=207

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF +RG++ALLNFP
Sbjct  95   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFP  154

Query  615  HLIGSNVPAPIRVKPRR  565
            H IGS+ P P+RV  +R
Sbjct  155  HRIGSDEPPPVRVTAKR  171



>ref|XP_007203750.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
 gb|EMJ04949.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
Length=256

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            EV    I  ARE  +P       R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  E
Sbjct  107  EVVLERIEVARETHAP----SSGRHFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAE  162

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            DAALAYD+ AFK+RG++A LNFPHLIGS    P+R+ P+RR
Sbjct  163  DAALAYDKAAFKMRGSKAKLNFPHLIGSEGCEPVRITPKRR  203



>gb|KCW62802.1| hypothetical protein EUGRSUZ_G00394 [Eucalyptus grandis]
Length=321

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPH
Sbjct  126  HYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPH  185

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+RV  +RR
Sbjct  186  LIGSVEYEPVRVSSKRR  202



>gb|KDO39173.1| hypothetical protein CISIN_1g028566mg [Citrus sinensis]
Length=207

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF +RG++ALLNFP
Sbjct  95   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFP  154

Query  615  HLIGSNVPAPIRVKPRR  565
            H IGS+ P P+RV  +R
Sbjct  155  HRIGSDEPPPVRVTAKR  171



>ref|XP_004229751.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum 
lycopersicum]
Length=219

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 16/129 (12%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D WRR+ GVRRR WG F+AEIRDPNR+GARLWLGTYE P DAALAYD+ A+K+RG + 
Sbjct  77   PQD-WRRFIGVRRRQWGTFSAEIRDPNRRGARLWLGTYESPRDAALAYDQAAYKIRGTKV  135

Query  630  LLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGI--------------GTPKRR  493
             LNFP LIGS+VP P RV  RRR+  ++    PL+T S                GT K+R
Sbjct  136  RLNFPDLIGSDVPMPPRVTARRRTRSRSRSPEPLTTSSSSSSSSSSSSSSSSENGT-KKR  194

Query  492  KISIINSVA  466
            KI +INS+A
Sbjct  195  KIDLINSIA  203



>emb|CBJ55933.1| ethylene response factor 2.2 [Bupleurum kaoi]
Length=233

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  98   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFP  157

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            H  GSN P P+R+  +R+         P  + SG  +PKRRK
Sbjct  158  HRAGSNEPDPVRITAKRK-----CSPEPTGSGSGSESPKRRK  194



>gb|KCW62798.1| hypothetical protein EUGRSUZ_G00390 [Eucalyptus grandis]
Length=237

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 8/145 (6%)
 Frame = -3

Query  900  AGGSPESWEGDGE---VQKAAIGAAREECSPPLPRDYW-----RRYKGVRRRPWGKFAAE  745
             G    S E D E   +   ++G A EE    + R+         Y+GVRRRPWGK+AAE
Sbjct  49   TGPQASSQELDFERTTIDYNSVGLATEEKQETVEREVQVPVKKTHYRGVRRRPWGKYAAE  108

Query  744  IRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            +RDP + GAR+WLGTYE PEDAALAYD+ AFK+RG +A LNFPHLIGS    PIRV  +R
Sbjct  109  MRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPIRVSLKR  168

Query  564  RslpkaalssplSTESGIGTPKRRK  490
            RS   ++ S+        GT +R++
Sbjct  169  RSAEPSSPSTSSGESFLTGTKRRKR  193



>ref|XP_007052304.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96461.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=210

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 8/104 (8%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEIRDP + G+R+WLGTYE PEDAALAYD+ AFK+RG++A LNFPH
Sbjct  112  HYRGVRRRPWGKYAAEIRDPKKNGSRVWLGTYETPEDAALAYDQAAFKMRGSKAKLNFPH  171

Query  612  LIGS---NVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            LIGS    +  PIR  P+RR     +   P +T     TPKRR+
Sbjct  172  LIGSGDLELVEPIRASPKRR-----SPEQPSTTSLSKDTPKRRR  210



>ref|NP_001236246.1| uncharacterized protein LOC100527194 [Glycine max]
 gb|ACU16246.1| unknown [Glycine max]
Length=223

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 5/101 (5%)
 Frame = -3

Query  876  EGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTY  697
            EG    ++      RE  +PP     W+RY+GVRRRPWGKFAAEIRDP + GAR+WLGT 
Sbjct  61   EGSLACKREHPKVEREFHAPPA----WKRYRGVRRRPWGKFAAEIRDPKKNGARIWLGTC  116

Query  696  ERPEDAALAYDREAFKLRGARALLNFPHLIGSNVP-APIRV  577
            E  E+A LAYDR AFK+RG++A LNFPHLIGS+ P  PIRV
Sbjct  117  ETEEEAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPLKPIRV  157



>ref|XP_002872976.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49235.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 9/91 (10%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRR---YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALA  670
             A++  SPP      RR   YKGVRRRPWGK+AAEIRDPN+ GAR+WLGTYE PE+AA+A
Sbjct  31   TAQDSSSPP------RRSANYKGVRRRPWGKYAAEIRDPNKNGARIWLGTYETPEEAAVA  84

Query  669  YDREAFKLRGARALLNFPHLIGSNVPAPIRV  577
            YD+ AFK+RG++A LNFPHLIG +   P+RV
Sbjct  85   YDQAAFKMRGSKAKLNFPHLIGIDQAEPVRV  115



>gb|KEH23454.1| AP2-domain DNA-binding protein [Medicago truncatula]
Length=207

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 4/81 (5%)
 Frame = -3

Query  837  AREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDRE  658
            ARE   PP+    W+RYKGVRRRPWGKFAAEIRDP + GAR+WLGTY   E+AALAYD+ 
Sbjct  49   AREVSMPPV----WKRYKGVRRRPWGKFAAEIRDPKKNGARVWLGTYVTEEEAALAYDKA  104

Query  657  AFKLRGARALLNFPHLIGSNV  595
            AFK+RG +A LNFPHLIGS+V
Sbjct  105  AFKMRGRKAKLNFPHLIGSDV  125



>gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel]
Length=203

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RYKGVRRRPWGKFAAEIRDP +KG+R+WLGTYE PEDAALAYD  AF +RGA+A LNF
Sbjct  97   WNRYKGVRRRPWGKFAAEIRDPKKKGSRIWLGTYETPEDAALAYDAAAFNMRGAKARLNF  156

Query  618  PHLIGSNVPAPIRVKPRRR  562
            PHLIGSN+  P+RV PR+R
Sbjct  157  PHLIGSNISGPVRVNPRKR  175



>ref|XP_006445417.1| hypothetical protein CICLE_v10023677mg [Citrus clementina]
 gb|ESR58657.1| hypothetical protein CICLE_v10023677mg [Citrus clementina]
Length=233

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRK-GARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            Y+GVRRRPWGKF AEIRDPN+K GAR+WLGTY+ PE  ALAYDR AF +RG++A LNFPH
Sbjct  105  YRGVRRRPWGKFTAEIRDPNKKNGARVWLGTYDTPEGDALAYDRAAFNMRGSKAKLNFPH  164

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVN  454
            LIGSNV  P+RV  +R S   +  +  L +ES    P  ++   I+S +A  N
Sbjct  165  LIGSNVAPPLRVTKKRGSSSSSNYTLHLQSES----PNSKRRKDIDSSSAANN  213



>ref|XP_009335578.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009335605.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=263

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 8/109 (7%)
 Frame = -3

Query  888  PESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLW  709
            P+ WE    + +  I  ARE  +PP      + ++GVRRRPWGK+AAEIRDP +KGAR+W
Sbjct  105  PKPWE----IVREEIVVARETHTPP----SRQHFRGVRRRPWGKYAAEIRDPKKKGARVW  156

Query  708  LGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            LGTYE  E AALAYD+ AFK+RG++A LNFPHLIGS    P+RV  +RR
Sbjct  157  LGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGSEGCEPVRVTAKRR  205



>ref|XP_011022365.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=252

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 16/112 (14%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+A LAYDR A+++RG++ALLNFP
Sbjct  123  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAGLAYDRAAYRMRGSKALLNFP  182

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGI-----GTPKRRKISIIN  475
            H IGSN P P+RV  +RR             E+G+     G+ K R+I + N
Sbjct  183  HKIGSNEPDPVRVTTKRR-----------EPETGLPAVDSGSAKTRRILVAN  223



>ref|XP_008344394.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=269

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 5/101 (5%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            EV +  I  ARE C+P L +     ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  E
Sbjct  106  EVVREEIVVARETCTPLLGQ----HFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAE  161

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
             AALAYD+ AFK+RG++A LNFPHLIGS    P+RV  +RR
Sbjct  162  GAALAYDQAAFKMRGSKAKLNFPHLIGSGC-EPVRVTGKRR  201



>ref|XP_006490017.1| PREDICTED: ethylene-responsive transcription factor 2-like [Citrus 
sinensis]
Length=207

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF +RG++ALLNFP
Sbjct  95   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFP  154

Query  615  HLIGSNVPAPIRVKPRR  565
            H IGS+ P P+RV  +R
Sbjct  155  HRIGSDEPPPVRVTAKR  171



>ref|XP_002304592.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
 gb|EEE79571.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
Length=259

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+A LAYDR A+++RG++ALLNFP
Sbjct  123  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAGLAYDRAAYRMRGSKALLNFP  182

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IGSN P P+RV  +RR
Sbjct  183  HKIGSNEPDPVRVTTKRR  200



>ref|XP_011031988.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=191

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRDP + GAR WLGTYE PEDAALAYD+ AFK+RG++A LNFPHL
Sbjct  100  YRGVRRRPWGKYAAEIRDPKKNGARRWLGTYETPEDAALAYDQAAFKIRGSKAKLNFPHL  159

Query  609  IGSNVPAPIRVKPRRR  562
            IGS    P+R+  +RR
Sbjct  160  IGSKEYEPVRLSSKRR  175



>emb|CEF82730.1| binding protein [Catharanthus roseus]
Length=200

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RYKGVRRRPWGKFAAEIRDP +KG+R+WLGTYE PEDAALAYD  AF +RGA+A LNF
Sbjct  97   WNRYKGVRRRPWGKFAAEIRDPKKKGSRIWLGTYETPEDAALAYDAAAFNMRGAKARLNF  156

Query  618  PHLIGSNVPAPIRVKPRRR  562
            PHLIGSN+  P+RV PR+R
Sbjct  157  PHLIGSNISGPVRVNPRKR  175



>gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthus roseus]
Length=200

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -3

Query  945  AAIDRCGNSSAVIGGAGGSPESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRP  766
            + I + G+ S+    +    ES + D  V      AA   CS    +D W RYKGVRRRP
Sbjct  53   SEIQKRGSPSSESCQSNSMAESCQEDSVVGTPPEAAAGGGCS----KD-WNRYKGVRRRP  107

Query  765  WGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAP  586
            WGKFAAEIRDP +KG+R+WLGTYE PEDAALAYD  AF +RGA+A LNFPHLIGSN+  P
Sbjct  108  WGKFAAEIRDPKKKGSRIWLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGSNISGP  167

Query  585  IRVKPRRR  562
            +RV PR+R
Sbjct  168  VRVNPRKR  175



>emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus roseus]
 emb|CAB96900.1| AP2-domain DNA-binding protein [Catharanthus roseus]
Length=203

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -3

Query  945  AAIDRCGNSSAVIGGAGGSPESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRP  766
            + I + G+ S+    +    ES + D  V      AA   CS    +D W RYKGVRRRP
Sbjct  53   SEIQKRGSPSSESCQSNSMAESCQEDSVVGTPPEAAAGGGCS----KD-WNRYKGVRRRP  107

Query  765  WGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAP  586
            WGKFAAEIRDP +KG+R+WLGTYE PEDAALAYD  AF +RGA+A LNFPHLIGSN+  P
Sbjct  108  WGKFAAEIRDPKKKGSRIWLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGSNISGP  167

Query  585  IRVKPRRR  562
            +RV PR+R
Sbjct  168  VRVNPRKR  175



>gb|ADE41124.1| AP2 domain class transcription factor [Malus domestica]
Length=278

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 8/117 (7%)
 Frame = -3

Query  912  VIGGAGGSPESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDP  733
            VI      PE WE    V +  I   RE  +PP      + ++GVRRRPWGK+AAEIRDP
Sbjct  97   VIESTPVKPEPWE----VVRQEIVVVRETHTPP----SRQHFRGVRRRPWGKYAAEIRDP  148

Query  732  NRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
             + GAR+WLGTYE  E AALAYD+ AFK+RG++A LNFPHLIGS    P+RV  +RR
Sbjct  149  KKNGARVWLGTYETAEGAALAYDQAAFKIRGSKAKLNFPHLIGSEGYEPVRVTVKRR  205



>ref|XP_008232471.1| PREDICTED: ethylene-responsive transcription factor 13-like [Prunus 
mume]
Length=218

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = -3

Query  906  GGAGGSPESWEGDGEVQKAAIG--AAREECSPPLPRDYWRR-YKGVRRRPWGKFAAEIRD  736
            G A  +P +W    EV+       AARE  +PP     WR+ Y+GVR+RPWGK+AAEIRD
Sbjct  72   GVAEPAPATWADTTEVKDNVQPKLAARETHAPP----RWRQNYRGVRQRPWGKYAAEIRD  127

Query  735  PNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGS  601
            P + GAR+WLGTYE  EDAALAYDR AFK+RG++ALLNFPHLIGS
Sbjct  128  PAKNGARMWLGTYETAEDAALAYDRAAFKIRGSKALLNFPHLIGS  172



>gb|KHN40954.1| Ethylene-responsive transcription factor 13 [Glycine soja]
Length=223

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 5/101 (5%)
 Frame = -3

Query  876  EGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTY  697
            EG    ++      RE  +PP     W+RY+GVRRRPWGKFAAEIRDP + GAR+WLGTY
Sbjct  61   EGSLACKREHPKVEREVHAPPA----WKRYRGVRRRPWGKFAAEIRDPKKNGARIWLGTY  116

Query  696  ERPEDAALAYDREAFKLRGARALLNFPHLIGSNVP-APIRV  577
            E  E+A LAYD  AF++RG++A LNFPHLIGS+ P  PIRV
Sbjct  117  ETEEEAGLAYDGAAFEMRGSKAKLNFPHLIGSHAPLKPIRV  157



>gb|KEH17839.1| ethylene response factor [Medicago truncatula]
Length=209

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -3

Query  843  GAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYD  664
            G++     P +P   W+RY+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  E+A LAYD
Sbjct  78   GSSSMIHKPHIPIPEWKRYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETEEEAGLAYD  137

Query  663  REAFKLRGARALLNFPHLIGSNVPAPIRV  577
            R  FK+RG +A LNFPHLIGS  P  + V
Sbjct  138  RATFKIRGRKAKLNFPHLIGSKEPTNVVV  166



>ref|XP_009765938.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
sylvestris]
 sp|Q9LW50.1|ERF2_NICSY RecName: Full=Ethylene-responsive transcription factor 2; Short=NsERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana sylvestris]
 dbj|BAA97122.1| ethylene-responsive element binding factor [Nicotiana sylvestris]
Length=237

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 6/112 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD+ A+++RG++ALLNFP
Sbjct  101  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFP  160

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAK  460
            H IG N P P+R+  +RRS   A+ S   ++E+ +  PKRR+     +VAAK
Sbjct  161  HRIGLNEPEPVRLTVKRRSPEPASSSISPASENSL--PKRRR----KAVAAK  206



>ref|XP_006606323.1| PREDICTED: ethylene-responsive transcription factor 2-like [Glycine 
max]
Length=91

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVR+RPWGKF AEIRDP R GAR WLGTY+  EDAALAYDR AFKLRG++ALLNFPH 
Sbjct  5    YRGVRQRPWGKFTAEIRDPARNGARAWLGTYQTAEDAALAYDRAAFKLRGSKALLNFPHR  64

Query  609  IGSNVPAPIRVKPRRR  562
            I  N P P+RV  ++R
Sbjct  65   INFNEPPPVRVTAKKR  80



>ref|XP_009589160.1| PREDICTED: ethylene-responsive transcription factor 13-like, 
partial [Nicotiana tomentosiformis]
Length=166

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            P+D WRRY GVRR  WG F AEIRDPNR+GARLWLGTYE PED  LAY++ AF++RG++A
Sbjct  81   PQD-WRRYIGVRRPQWGTFTAEIRDPNRRGARLWLGTYESPEDVKLAYNQAAFEIRGSKA  139

Query  630  LLNFPHLIGSNVPAPIRV  577
             LNFPHLIGSN+  P RV
Sbjct  140  RLNFPHLIGSNITKPARV  157



>gb|AGT21474.1| ethylene responsive element binding factor-like [Carica papaya]
Length=247

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA AYDR A+++RG++ALLNFP
Sbjct  115  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAFAYDRAAYRMRGSKALLNFP  174

Query  615  HLIGSNVPAPIRVKPRRR  562
            H +GSN P P+R+  +RR
Sbjct  175  HRLGSNEPEPVRITAKRR  192



>ref|XP_002297926.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
 gb|EEE82731.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
Length=262

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAE RDP + GAR+WLGTYE  ++AALAYDR A+++RG++ALLNFP
Sbjct  131  RHYRGVRQRPWGKFAAETRDPAKNGARVWLGTYETAKEAALAYDRAAYRMRGSKALLNFP  190

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IGSN P P+R+  +RR
Sbjct  191  HKIGSNEPDPVRITAKRR  208



>ref|XP_004515359.1| PREDICTED: ethylene-responsive transcription factor 13-like [Cicer 
arietinum]
Length=184

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = -3

Query  837  AREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDRE  658
            ARE  + P     W++YKGVRRRPWGKFAAEIRD N+ GAR+WLGTY+  EDAALAYDR 
Sbjct  71   ARETHAAPC----WQKYKGVRRRPWGKFAAEIRDSNKNGARVWLGTYDLAEDAALAYDRA  126

Query  657  AFKLRGARALLNFPHLIGSN  598
            AFK+RG++A +NFPHLIGS+
Sbjct  127  AFKMRGSKAKVNFPHLIGSS  146



>ref|XP_008376227.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=278

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 74/100 (74%), Gaps = 4/100 (4%)
 Frame = -3

Query  861  VQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPED  682
            V +  I AARE  +PP      + ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  E 
Sbjct  110  VVREEIVAARETHTPP----SRQHFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAEG  165

Query  681  AALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            AALAYD+ AFK+RG++A LNFPHLIGS    P+RV  +RR
Sbjct  166  AALAYDQAAFKMRGSKAKLNFPHLIGSEGYEPVRVTXKRR  205



>ref|XP_004493050.1| PREDICTED: ethylene-responsive transcription factor 1-like [Cicer 
arietinum]
Length=209

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = -3

Query  849  AIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALA  670
               AAR+  +PP+    W+RY+GVRRRPWGKFAAEIRDP + GAR+WLGTY   E+A LA
Sbjct  46   TTAAARKVHAPPI----WKRYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYVTEEEAGLA  101

Query  669  YDREAFKLRGARALLNFPHLIGSNV  595
            YD+ AFK+RG +A LNFPHLIGS+V
Sbjct  102  YDKAAFKMRGRKAKLNFPHLIGSDV  126



>ref|XP_010523200.1| PREDICTED: ethylene-responsive transcription factor 13-like [Tarenaya 
hassleriana]
Length=179

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 75/111 (68%), Gaps = 10/111 (9%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKGVRRRPWGK+AAEIRDP + G R+WLGTYE PEDAALAYDR AF++RGA+A LNFPHL
Sbjct  47   YKGVRRRPWGKYAAEIRDPKKNGGRIWLGTYETPEDAALAYDRAAFEMRGAKAKLNFPHL  106

Query  609  IGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKV  457
            +G +   P RV  +RR           S E  I   KRR    I ++ A++
Sbjct  107  VGIDAFQPPRVTNKRR----------RSPEEPISNSKRRTTPHIINLTARL  147



>gb|ACM49848.1| ethylene responsive transcription factor 1b [Prunus salicina]
Length=261

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  885  ESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWL  706
            E    D + Q   + AA +  +P       R Y+GVR+RPWGKFAAEIRDP + GAR+WL
Sbjct  94   EHHHRDDQKQVQVVDAADQNKAPKSGVARGRHYRGVRQRPWGKFAAEIRDPAKNGARVWL  153

Query  705  GTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            GTYE  E+AALAYDR A+++RG +ALLNFPH IG N P P+RV  +R+
Sbjct  154  GTYETSEEAALAYDRAAYRMRGCKALLNFPHRIGLNEPPPVRVTGKRK  201



>gb|EYU28602.1| hypothetical protein MIMGU_mgv1a022521mg [Erythranthe guttata]
Length=247

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -3

Query  864  EVQKAAIGAAREE----CSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTY  697
            E+  A     RE+     +P   R   R ++GVR+RPWGKFAAEIRDP + GAR+WLGTY
Sbjct  83   EMSFATTTTVREDDYVAAAPAATRPKGRHFRGVRQRPWGKFAAEIRDPAKNGARVWLGTY  142

Query  696  ERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            E  E+AALAYDR A+++RG++ALLNFPH  GSN P P+RV  +RR
Sbjct  143  ETAEEAALAYDRAAYRIRGSKALLNFPHRAGSNEPEPVRVAGKRR  187



>ref|XP_011026732.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=262

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAE RDP + GAR+WLGTYE  ++AALAYDR A+++RG++ALLNFP
Sbjct  131  RHYRGVRQRPWGKFAAETRDPAKNGARVWLGTYETAKEAALAYDRAAYRMRGSKALLNFP  190

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IGSN P P+R+  +RR
Sbjct  191  HKIGSNEPDPVRITAKRR  208



>gb|KDO85527.1| hypothetical protein CISIN_1g026607mg [Citrus sinensis]
Length=236

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            RY+GVRRRPWGKF AEIRDP + G R+WLGTY  PEDAALAYDR AF +RG++A LNFPH
Sbjct  109  RYRGVRRRPWGKFVAEIRDPKKNGTRIWLGTYNTPEDAALAYDRAAFNMRGSKAKLNFPH  168

Query  612  LIGSNV-PAPI-RVKPRR  565
            LIGSNV P P+ RV  +R
Sbjct  169  LIGSNVEPVPLGRVTKKR  186



>ref|XP_006445418.1| hypothetical protein CICLE_v10021995mg [Citrus clementina]
 ref|XP_006464838.1| PREDICTED: ethylene-responsive transcription factor 13-like [Citrus 
sinensis]
 gb|ESR58658.1| hypothetical protein CICLE_v10021995mg [Citrus clementina]
Length=237

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
            RY+GVRRRPWGKF AEIRDP + G R+WLGTY  PEDAALAYDR AF +RG++A LNFPH
Sbjct  109  RYRGVRRRPWGKFVAEIRDPKKNGTRIWLGTYNTPEDAALAYDRAAFNMRGSKAKLNFPH  168

Query  612  LIGSNV-PAPI-RVKPRR  565
            LIGSNV P P+ RV  +R
Sbjct  169  LIGSNVEPVPLGRVTKKR  186



>dbj|BAN45684.1| ethylene response factor [Nicotiana umbratica]
Length=216

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD+ A+++RG++ALLNFP
Sbjct  80   RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETGEEAALAYDKAAYRMRGSKALLNFP  139

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAK  460
            H IG N P P+R+  +RRS   A+ S   ++E+  G+PKRR+     +VAAK
Sbjct  140  HRIGLNEPEPVRLTIKRRSPEPASSSISSASEN--GSPKRRR----KAVAAK  185



>ref|XP_007218833.1| hypothetical protein PRUPE_ppa010186mg [Prunus persica]
 gb|EMJ20032.1| hypothetical protein PRUPE_ppa010186mg [Prunus persica]
Length=260

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  124  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFP  183

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISII  478
            H IG N P P+RV  +R+     A ++  ++ +   + KR K S +
Sbjct  184  HRIGLNEPPPVRVTGKRKEPEAEAAAAADASTTTPKSAKRTKASSV  229



>gb|ADU76350.1| ethylene responsive factor, partial [Prunus persica]
Length=260

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  124  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFP  183

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISII  478
            H IG N P P+RV  +R+     A ++  ++ +   + KR K S +
Sbjct  184  HRIGLNEPPPVRVTGKRKEPEAEAAAAADASTTTPKSAKRTKASSV  229



>gb|ADL36574.1| AP2D domain class transcription factor [Malus domestica]
 gb|AGI41322.1| ethylene response factor [Malus domestica]
Length=334

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  190  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  249

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  250  HRIGLNEPPPVRVTGKRK  267



>ref|NP_001280848.1| ethylene-responsive transcription factor 2-like [Malus domestica]
 dbj|BAF43420.1| ethylene response factor [Malus domestica]
Length=334

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  190  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  249

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  250  HRIGLNEPPPVRVTGKRK  267



>ref|XP_009611801.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
tomentosiformis]
Length=236

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -3

Query  813  LPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGAR  634
            LPR   R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  EDAA+AYD+ A+++RG++
Sbjct  99   LPRG--RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEDAAIAYDKAAYRMRGSK  156

Query  633  ALLNFPHLIGSNVPAPIRVKPRRR  562
            A LNFPH IG N P P+RV  +RR
Sbjct  157  AHLNFPHRIGLNEPEPVRVTAKRR  180



>ref|XP_009335577.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=237

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDA LAYDR AFK+RG++A LNFP
Sbjct  93   RHFRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETAEDAGLAYDRAAFKMRGSKAKLNFP  152

Query  615  HLIGSNVPAPIRVKPRR  565
            HLIG++   P RV P+R
Sbjct  153  HLIGTHDSEPGRVAPKR  169



>ref|XP_007134480.1| hypothetical protein PHAVU_010G050800g [Phaseolus vulgaris]
 gb|ESW06474.1| hypothetical protein PHAVU_010G050800g [Phaseolus vulgaris]
Length=164

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 10/117 (9%)
 Frame = -3

Query  927  GNSSAVIGGAGGSPESWEGDGEVQKAA----IGAAREECSPPLPRDYWRRYKGVRRRPWG  760
            G++S +   A  SP +  G       A       AR   +P      ++ +KGVRRRPWG
Sbjct  50   GSTSTLFTSAVNSPSASLGQSTTTSTAARGEYTVARGGNAP------YQNFKGVRRRPWG  103

Query  759  KFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPA  589
            KFAAEIRDP R GAR+WLGTYE  E AALAYDR AF++RG++A LNFPHLIGS+ P+
Sbjct  104  KFAAEIRDPKRNGARVWLGTYESAESAALAYDRAAFEMRGSKAKLNFPHLIGSHEPS  160



>gb|KHN34531.1| Ethylene-responsive transcription factor 2 [Glycine soja]
Length=205

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = -3

Query  834  REECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREA  655
            RE  +PP+    W+ Y+GVRRR WGKFAAEIRDP + GAR+WLGTYE  E A LAYDR A
Sbjct  75   REVHAPPV----WKHYRGVRRRTWGKFAAEIRDPKKNGARIWLGTYETEEAAGLAYDRAA  130

Query  654  FKLRGARALLNFPHLIGSNV-PAPIRV  577
            FK+RG++A LNFPHLIGS+  P P+RV
Sbjct  131  FKMRGSKAKLNFPHLIGSHAPPQPVRV  157



>ref|NP_001275603.1| ethylene-responsive transcription factor 1-like [Solanum tuberosum]
 gb|ABP35567.1| ERF transcription factor [Solanum tuberosum]
Length=247

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD+ AF++RG +ALLNFP
Sbjct  110  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYDKAAFRMRGTKALLNFP  169

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  170  HRIGLNEPEPVRVTVKRR  187



>ref|XP_003529037.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=205

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = -3

Query  834  REECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREA  655
            RE  +PP+    W+ Y+GVRRR WGKFAAEIRDP + GAR+WLGTYE  E A LAYDR A
Sbjct  75   REVHAPPV----WKHYRGVRRRTWGKFAAEIRDPKKNGARIWLGTYETEEAAGLAYDRAA  130

Query  654  FKLRGARALLNFPHLIGSNV-PAPIRV  577
            FK+RG++A LNFPHLIGS+  P P+RV
Sbjct  131  FKMRGSKAKLNFPHLIGSHAPPQPVRV  157



>ref|XP_007204029.1| hypothetical protein PRUPE_ppa020417mg [Prunus persica]
 gb|EMJ05228.1| hypothetical protein PRUPE_ppa020417mg [Prunus persica]
Length=206

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            AARE  +PP  R   + Y+GVR+RPWGK+AAEIRDP + GAR+WLGTYE  EDAALAYDR
Sbjct  96   AARETHAPPRGR---QNYRGVRQRPWGKYAAEIRDPAKNGARMWLGTYETAEDAALAYDR  152

Query  660  EAFKLRGARALLNFPHLIGSN  598
             AFK+RG++ALLNFPHLIGS+
Sbjct  153  AAFKIRGSKALLNFPHLIGSD  173



>ref|XP_004235186.2| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=277

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD+ AF++RG +ALLNFP
Sbjct  140  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYDKAAFRMRGTKALLNFP  199

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  200  HRIGLNEPEPVRVTVKRR  217



>ref|XP_006348007.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=226

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -3

Query  813  LPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGAR  634
            +P D WRRY GVRRR WG FAAEIRDPNRKGARLWLGTYE P+DAALAYD  AFK+RG++
Sbjct  80   VPEDDWRRYIGVRRRQWGTFAAEIRDPNRKGARLWLGTYETPKDAALAYDDAAFKIRGSK  139

Query  633  ALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVA  466
            A LNFPHL GSN+  P RVK  R     ++ S   S+ S  G  ++RKI +INS+A
Sbjct  140  ARLNFPHLAGSNISKPARVKGSRCLPSPSSSSLSSSSTSENGA-RKRKIDVINSIA  194



>ref|XP_011094429.1| PREDICTED: ethylene-responsive transcription factor 1-like [Sesamum 
indicum]
Length=185

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = -3

Query  840  AAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDR  661
            A R   +PP+    WRRY+GVRRRPWGKFAAEIRDP +KG+R+WLGTYE PE+AALAYD+
Sbjct  65   AQRSVKAPPVE---WRRYRGVRRRPWGKFAAEIRDPVKKGSRMWLGTYETPEEAALAYDK  121

Query  660  EAFKLRGARALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
             AFKLRG+RA +NFPHL+GS+ P PIRV  R  ++     ++  S+ S   T   RK
Sbjct  122  AAFKLRGSRARVNFPHLVGSDAPEPIRVTKRSHAMSSDQPTTLFSSPSSTETSVSRK  178



>ref|XP_010109127.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
 gb|EXC21056.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
Length=275

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF +RG++ALLNFP
Sbjct  146  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFGMRGSKALLNFP  205

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IGS  P P+R+  +RR
Sbjct  206  HRIGSGEPPPVRITAKRR  223



>ref|XP_011031975.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=230

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -3

Query  825  CSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKL  646
             SP   R+    Y GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYD  +FK+
Sbjct  107  ASPTPARERGNNYTGVRRRPWGKYAAEIRDPKKNGARIWLGTYETPEDAALAYDHASFKM  166

Query  645  RGARALLNFPHLIGSNVPAPIRVKPRR  565
            RGA+A LNFPHLIG +   P+RV  +R
Sbjct  167  RGAKAKLNFPHLIGFSDYQPVRVTHKR  193



>ref|XP_010025350.1| PREDICTED: ethylene-responsive transcription factor 2-like [Eucalyptus 
grandis]
 gb|KCW90884.1| hypothetical protein EUGRSUZ_A02924 [Eucalyptus grandis]
Length=281

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGK+AAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RGA+ALLNFP
Sbjct  148  RHFRGVRQRPWGKYAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGAKALLNFP  207

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IGS  PAP+RV  +R+
Sbjct  208  HRIGSGEPAPVRVTAKRK  225



>ref|XP_010426455.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=175

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKGVRRRPWGK+AAEIRDPN+ GAR+WLGTYE  E+AA+AYDR AFK+RG++A LNFPHL
Sbjct  57   YKGVRRRPWGKYAAEIRDPNKNGARMWLGTYETSEEAAVAYDRAAFKMRGSKAKLNFPHL  116

Query  609  IGSNVPAPIRV  577
            IG +   P+RV
Sbjct  117  IGIDQAEPVRV  127



>gb|EPS62607.1| hypothetical protein M569_12181, partial [Genlisea aurea]
Length=175

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP R G+R+WLGTYE  E+AALAYDR A+K+RG +ALLNFP
Sbjct  89   RHFRGVRQRPWGKFAAEIRDPARNGSRVWLGTYETAEEAALAYDRAAYKIRGTKALLNFP  148

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+R+  +RR
Sbjct  149  HKIGLNEPEPVRITAKRR  166



>ref|XP_008234446.1| PREDICTED: ethylene-responsive transcription factor 2-like [Prunus 
mume]
Length=263

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  127  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFP  186

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISII  478
            H IG N P P+RV  +R+     A ++  ++ +   + KR K S +
Sbjct  187  HRIGLNEPPPVRVTGKRKEPEAEAAAAADASTTTPKSAKRTKASSV  232



>ref|XP_004307778.1| PREDICTED: ethylene-responsive transcription factor 2-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYDR A+++RGA+ALLNFP
Sbjct  141  RHYRGVRQRPWGKFAAEIRDPKKNGARVWLGTYETSEEAAVAYDRAAYRMRGAKALLNFP  200

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  201  HRIGLNEPPPVRVTGKRK  218



>gb|AGH62003.1| ethylene-responsive transcription factor [Arachis hypogaea]
Length=196

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = -3

Query  861  VQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPED  682
            +Q+        E +PP     W+RY+GVRRRPWGKFAAEIRDP R GAR+WLGTYE+ E+
Sbjct  48   LQEQERDTNENEHAPPT----WKRYRGVRRRPWGKFAAEIRDPKRNGARVWLGTYEKEEE  103

Query  681  AALAYDREAFKLRGARALLNFPHLIGSN  598
            AALAYDR AFKLRG +A LNFP+L GS+
Sbjct  104  AALAYDRAAFKLRGQKAKLNFPNLFGSD  131



>gb|AHA93900.1| ethylene response factor 10 [Coffea arabica]
 gb|AHB33880.1| ERF transcription factor 09 [Coffea arabica]
Length=264

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP++ GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  118  RHFRGVRQRPWGKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFP  177

Query  615  HLIGSNVPAPIRVKPRRR  562
            H +G N P P+RV  +RR
Sbjct  178  HRVGLNEPEPVRVTAKRR  195



>ref|XP_009362713.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
Length=335

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  190  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  249

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  250  HRIGLNEPPPVRVTGKRK  267



>sp|Q40476.1|ERF1_TOBAC RecName: Full=Ethylene-responsive transcription factor 1; Short=NtERF1; 
AltName: Full=Ethylene-responsive element-binding 
factor 1; Short=EREBP-1 [Nicotiana tabacum]
 dbj|BAA07321.1| ERF1 [Nicotiana tabacum]
Length=236

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = -3

Query  813  LPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGAR  634
            LPR   R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++
Sbjct  99   LPRG--RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSK  156

Query  633  ALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVN  454
            A LNFPH IG N P P+RV  +RR       S   ++ S   +PKRR+ ++    +  V 
Sbjct  157  AHLNFPHRIGLNEPEPVRVTAKRR------ASPEPASSSENSSPKRRRKAVATEKSEAVE  210

Query  453  LD  448
            ++
Sbjct  211  VE  212



>ref|XP_010424028.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=175

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKGVRRRPWGK+AAEIRDPN+ GAR+WLGTYE  E+AA+AYDR AFK+RG++A LNFPHL
Sbjct  57   YKGVRRRPWGKYAAEIRDPNKNGARMWLGTYETSEEAAVAYDRAAFKMRGSKAKLNFPHL  116

Query  609  IGSNVPAPIRV  577
            IG +   P+RV
Sbjct  117  IGIDQAEPVRV  127



>ref|XP_009370422.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=315

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  162  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  221

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  222  HRIGLNEPPPVRVTGKRK  239



>gb|AHB33881.1| ERF transcription factor 10 [Coffea arabica]
Length=264

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP++ GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  118  RHFRGVRQRPWGKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFP  177

Query  615  HLIGSNVPAPIRVKPRRR  562
            H +G N P P+RV  +RR
Sbjct  178  HRVGLNEPEPVRVTAKRR  195



>ref|XP_003530145.2| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=216

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + YKGVRRRPWGKFAAEIRDPNR GAR+WLGTY   EDAALAYDR AF++RG++A LNFP
Sbjct  141  QNYKGVRRRPWGKFAAEIRDPNRNGARVWLGTYNSAEDAALAYDRAAFEMRGSKAKLNFP  200

Query  615  HLIGSNVPAPIR  580
            HLIG +   P R
Sbjct  201  HLIGCSDAEPSR  212



>emb|CDP05380.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVR+RPWGKFAAEIRDP++ GAR+WLGTYE  E+AALAYDR A+++RG++ALLNFP
Sbjct  118  RHFRGVRQRPWGKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFP  177

Query  615  HLIGSNVPAPIRVKPRRR  562
            H +G N P P+RV  +RR
Sbjct  178  HRVGLNEPEPVRVTAKRR  195



>ref|XP_010068070.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=248

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEIRDP + GAR+WLGTY+ P+DAALAYDR AFK++G++A LNFP 
Sbjct  116  HYRGVRRRPWGKYAAEIRDPKKNGARMWLGTYKTPQDAALAYDRAAFKMKGSKAKLNFPL  175

Query  612  LIGSNVPAPIRVKPRRR  562
            LIGS    P+RV P+RR
Sbjct  176  LIGSAEYEPVRVNPKRR  192



>ref|XP_010544359.1| PREDICTED: ethylene-responsive transcription factor 13-like [Tarenaya 
hassleriana]
Length=165

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDAA+AYDR AF++RGA+A LNFPHL
Sbjct  57   YRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETAEDAAMAYDRAAFEMRGAKAKLNFPHL  116

Query  609  IGSNVPAPIRVKPRRR  562
            IG++   P RV  RRR
Sbjct  117  IGTDGVEPARVSNRRR  132



>ref|XP_009372828.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=343

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  192  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  251

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  252  HRIGLNEPPPVRVTGKRK  269



>dbj|BAN45683.1| ethylene response factor, partial [Nicotiana umbratica]
Length=233

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 6/116 (5%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++A LNFP
Sbjct  103  RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFP  162

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLD  448
            H IG N P P+RV  +RR       S   ++ S   +PKRR+ ++    +  V ++
Sbjct  163  HRIGLNEPEPVRVTAKRR------ASPEPASSSENSSPKRRRKAVAAEKSEAVEVE  212



>ref|XP_009370421.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=360

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  207  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  266

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  267  HRIGLNEPPPVRVTGKRK  284



>ref|XP_004239983.1| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=234

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 6/105 (6%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++A LNFP
Sbjct  104  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFP  163

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
            H IG N P P+RV  +RR       S   ++ SG G+ KRR+ ++
Sbjct  164  HRIGLNEPEPVRVTAKRR------ASPEPASSSGNGSMKRRRKAV  202



>ref|XP_003524070.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine 
max]
Length=255

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR A+++RG+RALLNFP
Sbjct  136  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFP  195

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTP-KRRKISIINSVAAKV  457
              + S  P P+RVK +R            S ES    P KR+K+ ++ +V  +V
Sbjct  196  LRVNSGEPDPVRVKSKR----------SSSPESAAALPAKRKKVVVVGTVQEQV  239



>ref|XP_008370005.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=237

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  E+A LAYDR AFK+RG++A LNFP
Sbjct  93   RHFRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETAEBAGLAYDRAAFKMRGSKAKLNFP  152

Query  615  HLIGSNVPAPIRVKPRR  565
            HLIG++   P RV P+R
Sbjct  153  HLIGTHDSEPGRVAPKR  169



>ref|XP_002279585.2| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis 
vinifera]
Length=240

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYDR A+++RG+RALLNFP
Sbjct  114  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDRAAYRMRGSRALLNFP  173

Query  615  HLIGSNVPAPIRVKPRRR  562
            H +GS  P P+R+  +RR
Sbjct  174  HRVGSGEPDPVRITAKRR  191



>ref|XP_009771895.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
sylvestris]
Length=236

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = -3

Query  813  LPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGAR  634
            LPR   R Y+GVRRRPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++
Sbjct  99   LPRG--RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSK  156

Query  633  ALLNFPHLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVN  454
            A LNFPH IG N P P+RV  +RR       S   ++ S   +PKRR+ ++    +  V 
Sbjct  157  AHLNFPHRIGLNEPEPVRVTAKRR------ASPEPASSSENSSPKRRRKAVAAEKSEAVE  210

Query  453  LD  448
            ++
Sbjct  211  VE  212



>gb|KEH23452.1| AP2-domain DNA-binding protein [Medicago truncatula]
Length=206

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 84/131 (64%), Gaps = 7/131 (5%)
 Frame = -3

Query  849  AIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALA  670
               + RE  +PP     W+RY+GVRRRPWGKFAAEIRDP + GAR+WLGTY   E+A  A
Sbjct  44   TTASKREVKAPPT----WKRYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYVTEEEAGFA  99

Query  669  YDREAFKLRGARALLNFPHLIGSNV---PAPIRVKPRRRslpkaalssplSTESGIGTPK  499
            YD+ AFK+RG +A LNFPHLIGS+V    +  +V  +R S   ++ S      S  G+ +
Sbjct  100  YDKAAFKMRGQKAKLNFPHLIGSDVYMSESKRKVALKRESPEPSSSSEDSCESSSPGSKR  159

Query  498  RRKISIINSVA  466
            R  + ++N +A
Sbjct  160  RSMVDLLNKLA  170



>ref|XP_009335608.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=229

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -3

Query  825  CSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKL  646
            C   +P+  W  ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  EDA LAYDR AFK+
Sbjct  84   CVVQVPQRGWN-FRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETAEDAGLAYDRAAFKM  142

Query  645  RGARALLNFPHLIGSNVPAPIRVKPRR  565
            RG++A LNFPHLIG++   P RV  +R
Sbjct  143  RGSKAKLNFPHLIGTHDSEPGRVASKR  169



>ref|XP_007134479.1| hypothetical protein PHAVU_010G050700g [Phaseolus vulgaris]
 gb|ESW06473.1| hypothetical protein PHAVU_010G050700g [Phaseolus vulgaris]
Length=211

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 11/99 (11%)
 Frame = -3

Query  870  DGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYER  691
            D EV+      ARE  +PP+    W+R++GVRRRPWGKFAAEIRDP + GAR+WLGTYE 
Sbjct  59   DAEVK------AREGHAPPV----WKRFRGVRRRPWGKFAAEIRDPKKNGARIWLGTYES  108

Query  690  PEDAALAYDREAFKLRGARALLNFPHLIGSNVPA-PIRV  577
             E+A LAYD+ AF++RG +A LNFPHLI S++   P+R+
Sbjct  109  EEEAGLAYDKAAFEMRGNKAKLNFPHLIDSDMAMKPVRI  147



>gb|AAC50047.1| Pti4 [Solanum lycopersicum]
Length=234

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 6/105 (6%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++A LNFP
Sbjct  104  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFP  163

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISI  481
            H IG N P P+RV  +RR       S   ++ SG G+ KRR+ ++
Sbjct  164  HRIGLNEPEPVRVTAKRR------ASPEPASSSGNGSMKRRRKAV  202



>gb|AID51422.1| ethylene response factor 17 [Diospyros kaki]
Length=242

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR A+++RG+RALLNFP
Sbjct  108  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSRALLNFP  167

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG + P P+R+  +RR
Sbjct  168  HRIGLDEPEPVRITAKRR  185



>gb|KFK42581.1| hypothetical protein AALP_AA1G014000 [Arabis alpina]
Length=163

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            +KGVRRRPWGK+AAEIRDPN+ GAR+WLGTYE   +AA+AYDR AFK+RGA+A LNFPHL
Sbjct  41   FKGVRRRPWGKYAAEIRDPNKHGARIWLGTYETAHEAAVAYDRAAFKMRGAKAKLNFPHL  100

Query  609  IGSNVPAPIRVKPRR  565
            I  + P P RV  RR
Sbjct  101  ISIDSPEPARVTKRR  115



>gb|AGB07589.1| ethylene-responsive transcription factor 6 [Artemisia annua]
Length=207

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            +++ A   A   E   P+P    + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E
Sbjct  71   KIEPATTTAQLPEVVAPIPVK-GKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAE  129

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
            +AA+AYDR A+++RG++AL+NFPH +G N P P+RV  +R+
Sbjct  130  EAAIAYDRAAYRMRGSKALVNFPHRVGLNEPEPVRVTSKRK  170



>ref|XP_002511013.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF51615.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=256

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 11/102 (11%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYD  AF++RG+RALLNFP
Sbjct  133  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDIAAFRMRGSRALLNFP  192

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
            H +GS  P P+RV  +RR    A          G G+ KRRK
Sbjct  193  HRVGS--PEPVRVTAKRRESEMA---------PGSGSAKRRK  223



>ref|XP_010068073.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=270

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAALAYDR AFK++G++A +NFPH
Sbjct  138  HYRGVRRRPWGKYAAEIRDPKKNGARIWLGTYETPEDAALAYDRAAFKMKGSKAKVNFPH  197

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNL  451
            LIG+    P+RV  R+R   + +  S    +  +   KRRK  +  +V A+V+ 
Sbjct  198  LIGAAEYEPVRVS-RKRFSAEHSSPSTPGDDGLVTRTKRRKGEV--NVDAEVDF  248



>gb|KCW62796.1| hypothetical protein EUGRSUZ_G00388 [Eucalyptus grandis]
Length=242

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  786  KGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLI  607
            +GVRRRPWGK+AAE+RDP + GAR+WLGTYE PEDAALAYDR AFK+RG++A LNFPHLI
Sbjct  125  EGVRRRPWGKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLI  184

Query  606  GSNVPAPIRVKPRRR  562
            G     P+RV+ +R+
Sbjct  185  GLAEYDPVRVRSKRQ  199



>gb|KHN34529.1| Ethylene-responsive transcription factor 13 [Glycine soja]
Length=155

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + YKGVRRRPWGKFAAEIRDP+R GAR+WLGTY   EDAALAYDR AF++RG++A LNFP
Sbjct  80   QNYKGVRRRPWGKFAAEIRDPSRNGARVWLGTYNSAEDAALAYDRAAFEMRGSKAKLNFP  139

Query  615  HLIGSNVPAPIR  580
            HLIG +   P R
Sbjct  140  HLIGCSDAEPSR  151



>ref|XP_002870100.1| hypothetical protein ARALYDRAFT_493126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46359.1| hypothetical protein ARALYDRAFT_493126 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -3

Query  834  REECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREA  655
            ++E + P+P    + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR A
Sbjct  49   KKETTSPVPAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAA  108

Query  654  FKLRGARALLNFPHLIGSNVPAPIRV  577
            F++RG+RALLNFP  + S  P P+R+
Sbjct  109  FRMRGSRALLNFPLRVNSGEPDPVRI  134



>sp|Q84XB3.1|ERF1_SOLLC RecName: Full=Ethylene-responsive transcription factor 1; Short=LeERF1; 
AltName: Full=ERF1-like protein; AltName: Full=Ethylene-responsive 
element-binding factor 1; Short=EREBP-1 [Solanum 
lycopersicum]
 gb|AAO34703.1| ethylene response factor 1 [Solanum lycopersicum]
Length=244

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAY + AF++RG +ALLNFP
Sbjct  105  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFP  164

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  165  HRIGLNEPEPVRVTVKRR  182



>ref|XP_003549934.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine 
max]
Length=251

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 94/158 (59%), Gaps = 20/158 (13%)
 Frame = -3

Query  897  GGSPESWEGDG---EVQKAAIGAAREECSPPLPRDYWRR--------YKGVRRRPWGKFA  751
             GSPES        +++   + A    C PP P    ++        Y+GVR+RPWGKFA
Sbjct  87   AGSPESVSSGFPAVKLEPDVMPALINPCPPPAPAVEEKKVVPPKGKHYRGVRQRPWGKFA  146

Query  750  AEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKP  571
            AEIRDP + GAR+WLGT+E  EDAALAYDR A+++RG+RALLNFP  + S  P P+RV  
Sbjct  147  AEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPVRVTS  206

Query  570  RRRslpkaalssplSTESGIGTPKRRKISIINSVAAKV  457
            +R S P++              PKR+K+ ++ +V  +V
Sbjct  207  KRSSSPESM---------AAAAPKRKKVMVVGTVQEQV  235



>ref|XP_010559083.1| PREDICTED: ethylene-responsive transcription factor 13 [Tarenaya 
hassleriana]
Length=236

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -3

Query  861  VQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPED  682
            V    +G A    +PP  +    +Y+GVRRRPWGKFAAEIRDP + G+R+WLGTYE  ED
Sbjct  81   VAAEEVGGASGSHAPPQRQRKGMQYRGVRRRPWGKFAAEIRDPKKNGSRVWLGTYETSED  140

Query  681  AALAYDREAFKLRGARALLNFPHLIGSN  598
            AALAYDR AF+LRG++A LNFPHLIGS 
Sbjct  141  AALAYDRAAFELRGSKAKLNFPHLIGST  168



>emb|CAB93940.1| AP2-domain DNA-binding protein [Catharanthus roseus]
Length=210

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W RY+GVRRRPWGKFAAEIRDP RKG+R+WLGTYE  EDAALA+D+ AF+LRG+RA LNF
Sbjct  124  WIRYRGVRRRPWGKFAAEIRDPKRKGSRIWLGTYETAEDAALAFDQAAFQLRGSRARLNF  183

Query  618  PHLIGS  601
            P+LIGS
Sbjct  184  PNLIGS  189



>ref|XP_008376369.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=336

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + ++GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AALAYDR AF++RG++ALLNFP
Sbjct  192  KHFRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFP  251

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +R+
Sbjct  252  HRIGLNEPPPVRVTGKRK  269



>ref|XP_010275428.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nelumbo 
nucifera]
Length=304

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAA+AYDR A+++RG+RALLNFP
Sbjct  158  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAAMAYDRAAYRMRGSRALLNFP  217

Query  615  HLIGSNVPAPIRVKPRR  565
              IGSN P P+RV  +R
Sbjct  218  LRIGSNEPEPVRVTSKR  234



>emb|CDX76569.1| BnaA08g08310D [Brassica napus]
Length=180

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  58   KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  117

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+RVK +R
Sbjct  118  LRVNSGEPDPVRVKSKR  134



>ref|XP_006365341.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum 
tuberosum]
Length=270

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++A LNFP
Sbjct  140  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFP  199

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  200  HRIGLNEPEPVRVTAKRR  217



>ref|XP_010434656.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=269

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 6/97 (6%)
 Frame = -3

Query  837  AREECSPPLPRDYW------RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAA  676
            A+ E SP LP          + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAA
Sbjct  128  AKIETSPVLPVAAAVAAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAA  187

Query  675  LAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            LAYDR AF++RG+RALLNFP  + S  P P+R+K +R
Sbjct  188  LAYDRAAFRMRGSRALLNFPLRVNSGEPDPVRIKSKR  224



>gb|AHZ31603.1| ethylene-responsive transcription factor [Brassica juncea var. 
tumida]
Length=221

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 7/113 (6%)
 Frame = -3

Query  792  RYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPH  613
             Y+GVR RPWGKFAAEIRDP +KGAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP 
Sbjct  114  HYRGVRHRPWGKFAAEIRDPAKKGARVWLGTFETGEDAALAYDRAAFRMRGSRALLNFPL  173

Query  612  LIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPK-RRKISIINSVAAKV  457
             + S  P P+R+K +R     ++ SS        G PK RRK   ++S   +V
Sbjct  174  RVNSGEPDPVRIKSKRSYNTSSSSSSEN------GKPKQRRKTETVSSEQCEV  220



>ref|XP_010258782.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nelumbo 
nucifera]
Length=309

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAA+AYDR A+++RG+RALLNFP
Sbjct  162  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAAMAYDRAAYRMRGSRALLNFP  221

Query  615  HLIGSNVPAPIRVKPRR  565
              IGSN P P+RV  +R
Sbjct  222  LRIGSNDPEPVRVTAKR  238



>ref|XP_009341335.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009341336.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009348378.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=273

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 73/101 (72%), Gaps = 5/101 (5%)
 Frame = -3

Query  864  EVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPE  685
            EV +  I  ARE  +P   +     ++GVRRRPWGK+AAEIRDP + GAR+WLGTYE  E
Sbjct  109  EVVREEIAVARETRTPLTGQ----HFRGVRRRPWGKYAAEIRDPKKNGARVWLGTYETAE  164

Query  684  DAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
             AALAYD+ AFK+RG++A LNFPHLIGS    P+RV  +RR
Sbjct  165  GAALAYDQAAFKMRGSKAKLNFPHLIGSGC-EPVRVTAKRR  204



>ref|XP_004134277.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis 
sativus]
 ref|XP_004155267.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis 
sativus]
 gb|KGN56336.1| hypothetical protein Csa_3G116730 [Cucumis sativus]
Length=157

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = -3

Query  831  EECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAF  652
            EE S P PR    +++GVRRRPWGK+AAEIRDP++KGAR+WLGTY   +DAALAYDR AF
Sbjct  79   EEKSQPRPRGL--QFRGVRRRPWGKYAAEIRDPSKKGARIWLGTYHTAQDAALAYDRAAF  136

Query  651  KLRGARALLNFPHLIGSN  598
            ++RGA+A LNFPH+I SN
Sbjct  137  QMRGAKAKLNFPHIISSN  154



>ref|XP_003520430.1| PREDICTED: ethylene-responsive transcription factor 1-like [Glycine 
max]
 gb|KHN12237.1| Ethylene-responsive transcription factor 1 [Glycine soja]
Length=187

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -3

Query  798  WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNF  619
            W+ Y+GVRRRPWGKFAAEIRDPN+  AR+WLGTY   E+A LAYDR AFK+ G++A LNF
Sbjct  61   WKHYRGVRRRPWGKFAAEIRDPNKNSARVWLGTYVTEEEAGLAYDRAAFKIHGSKAKLNF  120

Query  618  PHLIGSNV--PAPIRV  577
            PHLIGS+V    P+RV
Sbjct  121  PHLIGSDVSLSEPMRV  136



>ref|XP_011081402.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Sesamum 
indicum]
Length=238

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -3

Query  825  CSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKL  646
             SP  PR   + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  EDAALAYDR A+++
Sbjct  110  VSPVPPRG--KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRM  167

Query  645  RGARALLNFPHLIGSNVPAPIRVKPRR  565
            RG+RA+LNFP  I S  PAP+R+  +R
Sbjct  168  RGSRAMLNFPLRINSGEPAPVRITVKR  194



>ref|XP_010449604.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=270

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 6/97 (6%)
 Frame = -3

Query  837  AREECSPPLPRDYW------RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAA  676
            A+++ SP LP          + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAA
Sbjct  129  AKKKTSPVLPVAAAAVAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAA  188

Query  675  LAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            LAYDR AF++RG+RALLNFP  + S  P P+R+K +R
Sbjct  189  LAYDRAAFRMRGSRALLNFPLRVNSGEPDPVRIKSKR  225



>gb|KFK24043.1| hypothetical protein AALP_AAs42697U000400 [Arabis alpina]
Length=248

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  134  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  193

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIINSVAAKVNLDRV  442
              + S  P P+RVK +R            S+ S  G  KRR+  + +    K  +  V
Sbjct  194  LRVNSGEPDPVRVKSKR-----------ASSSSDNGATKRRRTVVGHGTEVKCEVVEV  240



>ref|XP_009341338.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=239

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = -3

Query  870  DGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYER  691
            D E      GAA E+ +P       + ++GVRRRPWGK+AAEIRDP + GAR+W+GTYE 
Sbjct  70   DLETSNILEGAAHEQHAP----QKGQHFRGVRRRPWGKYAAEIRDPMKNGARVWIGTYET  125

Query  690  PEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPR  568
              DA LAYDR AFK+RG++A LNFPHLIG++   P RV P+
Sbjct  126  AADAGLAYDRAAFKMRGSKAKLNFPHLIGTHGLEPGRVAPK  166



>ref|XP_008809462.1| PREDICTED: ethylene-responsive transcription factor 2-like [Phoenix 
dactylifera]
Length=234

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVRRRPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  93   RHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  152

Query  615  HLIGSNVPAPIRVK  574
             L+GS+  AP  VK
Sbjct  153  LLVGSHDAAPAPVK  166



>ref|NP_001275437.1| Pti4 [Solanum tuberosum]
 gb|ACF57857.1| Pti4 [Solanum tuberosum]
Length=234

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ A+++RG++A LNFP
Sbjct  104  RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFP  163

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  164  HRIGLNEPEPVRVTAKRR  181



>ref|NP_001237801.1| ethylene-responsive element binding protein 1 [Glycine max]
 gb|AAM45475.1| ethylene-responsive element binding protein 1 [Glycine max]
 gb|KHN40556.1| Ethylene-responsive transcription factor 2 [Glycine soja]
Length=202

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 12/117 (10%)
 Frame = -3

Query  888  PESWEGDGEVQKAAIGAAREECSPPLPRDY----WRRYKGVRRRPWGKFAAEIRDPNRKG  721
            P   +GD       I    E+ +  + RD+    W+ Y+GVRRRPWGKFAAEIRDP + G
Sbjct  44   PNKCDGDS----GNIAFRSEDATAVVARDHAPPTWKHYRGVRRRPWGKFAAEIRDPKKNG  99

Query  720  ARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSN----VPAPIRVKPRRR  562
            AR+WLGTY+  E AALAYD+ AFK+RG +A LNFPHLI S+    +  P+ +   +R
Sbjct  100  ARVWLGTYDTEEKAALAYDKAAFKMRGQKAKLNFPHLIDSDNSDELSEPVMMTTSKR  156



>ref|XP_006414077.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
 gb|ESQ55530.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
Length=136

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  774  RRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNV  595
            +  WGKFAAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+LRG++A LNFPHLIGS  
Sbjct  14   KETWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCK  73

Query  594  PAPIRVKPRRR  562
              P+R++PRRR
Sbjct  74   YEPVRIRPRRR  84



>ref|XP_003521070.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=195

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -3

Query  870  DGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYER  691
            + E Q +   AAR   +PP        Y+GVRRRPWGK+AAEIRD  R G R+WLGTYE 
Sbjct  97   ENEGQNSKTTAARGTRTPP---KKGLSYRGVRRRPWGKYAAEIRDTKRNGVRVWLGTYET  153

Query  690  PEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRRR  562
             EDAALAYDR AFK+RG++A LNFPHLIGS+   PI+V  ++ 
Sbjct  154  AEDAALAYDRAAFKMRGSKAKLNFPHLIGSD-HEPIKVTLKKH  195



>emb|CDY27923.1| BnaCnng05080D [Brassica napus]
Length=255

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 11/107 (10%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  132  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  191

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKISIIN  475
              + S  P P+RVK +R            S+E G G+ +RR ++ +N
Sbjct  192  LRVNSGEPDPVRVKSKR----------GSSSEIG-GSKRRRTVASVN  227



>ref|XP_003534472.1| PREDICTED: ethylene-responsive transcription factor 1-like [Glycine 
max]
Length=203

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -3

Query  858  QKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDA  679
            + A    AR+  +PP     W+ Y+GVRRRPWGKFAAEIRDP + GAR+WLGTY+  E A
Sbjct  59   EDATAVVARDVHAPPT----WKHYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYDTEEKA  114

Query  678  ALAYDREAFKLRGARALLNFPHLIGSNV  595
            ALAYD+ AFK+RG +A LNFPHLI S++
Sbjct  115  ALAYDKAAFKMRGRKAKLNFPHLIDSDM  142



>gb|AID55127.1| ethylene responsive factor 70, partial [Solanum melongena]
Length=154

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = -3

Query  816  PLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGA  637
            P PR   R Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA+AYD+ AF++RG+
Sbjct  76   PAPRG--RHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAFRMRGS  133

Query  636  RALLNFPHLIGSNVPAPIRV  577
            +A LNFPH IG N P P+RV
Sbjct  134  KAHLNFPHRIGLNEPEPVRV  153



>emb|CDP10018.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVRRRPWGKFAAEIRDP + GAR+WLGT+E  EDAA+AYDR A+++RGARALLNFP
Sbjct  87   KHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTFETAEDAAIAYDRAAYRMRGARALLNFP  146

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
              I S  P P+R+  +R S+     SS  S     GTPKR+K
Sbjct  147  LRINSGEPEPVRITSKRSSVSPDHSSSSASEN---GTPKRKK  185



>ref|XP_006396194.1| hypothetical protein EUTSA_v10029212mg, partial [Eutrema salsugineum]
 gb|ESQ37647.1| hypothetical protein EUTSA_v10029212mg, partial [Eutrema salsugineum]
Length=141

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 10/86 (12%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKGVRRRPWGK+AAEIRDPN+ GAR+WLGT++ PE+AALAYDR AFKLRG++A LNFPHL
Sbjct  29   YKGVRRRPWGKYAAEIRDPNKNGARMWLGTFQTPEEAALAYDRAAFKLRGSKAKLNFPHL  88

Query  609  IGSN----------VPAPIRVKPRRR  562
            I +            P P    P+RR
Sbjct  89   ITTEETTCGNKRQRSPEPTSPPPKRR  114



>ref|XP_006375128.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
 gb|ERP52925.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
Length=123

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKG RR+PW K+AAEIRDP + GAR+WLGTYE PEDAALAYD+ AFK+RGA+A L+FPHL
Sbjct  42   YKGARRKPWEKYAAEIRDPTKNGARIWLGTYETPEDAALAYDQAAFKMRGAKAKLDFPHL  101

Query  609  IGSNVP-APIRV  577
            IGS +   P+RV
Sbjct  102  IGSIIAHQPVRV  113



>gb|ACU15472.1| unknown [Glycine max]
Length=187

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = -3

Query  831  EECSPPLPRDY----WRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYD  664
            E+ +  + RD+    W+ Y+GVRRRPWGKFAAEIRDP + GAR+WLGTY+  E AALAYD
Sbjct  59   EDATAVVARDHAPPTWKHYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYDTEEKAALAYD  118

Query  663  REAFKLRGARALLNFPHLIGSN----VPAPIRVKPRRR  562
            + AFK+RG +A LNFPHLI S+    +  P+ +   +R
Sbjct  119  KAAFKMRGQKAKLNFPHLIDSDNSDELSEPVMMTTSKR  156



>gb|AEQ93554.1| AP2/ERF transcription factor [Artemisia annua]
Length=253

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  E+AA AYD  A+++RG++ALLNFP
Sbjct  132  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAATAYDIAAYRMRGSKALLNFP  191

Query  615  HLIGSNVPAPIRVKPRRR  562
            H IG N P P+RV  +RR
Sbjct  192  HRIGLNEPEPVRVTSKRR  209



>ref|XP_010439993.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=269

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  148  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  207

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+R+K +R
Sbjct  208  LRVNSGEPDPVRIKSKR  224



>ref|XP_009108325.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=254

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  132  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  191

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+RVK +R
Sbjct  192  LRVNSGEPDPVRVKSKR  208



>ref|XP_006284323.1| hypothetical protein CARUB_v10005497mg [Capsella rubella]
 gb|EOA17221.1| hypothetical protein CARUB_v10005497mg [Capsella rubella]
Length=268

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 12/103 (12%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  149  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  208

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKI  487
              + S  P P+R+K +R            ++ S  G PK+R+ 
Sbjct  209  LRVNSGEPDPVRIKSKR------------ASSSENGAPKKRRT  239



>ref|XP_007134477.1| hypothetical protein PHAVU_010G050500g [Phaseolus vulgaris]
 gb|ESW06471.1| hypothetical protein PHAVU_010G050500g [Phaseolus vulgaris]
Length=217

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            Y+GVRRRPWGK+AAEIRD  R G R+WLGTYE  EDAALAYDR AFK+ G++A LNFPHL
Sbjct  107  YRGVRRRPWGKYAAEIRDAKRNGGRVWLGTYESAEDAALAYDRAAFKMHGSKAKLNFPHL  166

Query  609  IGSNVPAPIRVKPRRR  562
            IGS+    IRV  ++R
Sbjct  167  IGSDDAELIRVTSKKR  182



>ref|XP_011031947.1| PREDICTED: ethylene-responsive transcription factor 2 [Populus 
euphratica]
Length=280

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 7/102 (7%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  149  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  208

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRK  490
              + S  P P+RV  +R S   ++           G+PKRRK
Sbjct  209  LRVNSGEPDPVRVTSKRSSPEPSSSVDS-------GSPKRRK  243



>gb|KFK37282.1| hypothetical protein AALP_AA4G236900 [Arabis alpina]
Length=228

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  810  PRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARA  631
            PR    +Y+GVRRRPWGK+AAEIRDP + GAR+WLGTYE PEDAA+AYDR AF+L+G++A
Sbjct  108  PRQNGVQYRGVRRRPWGKYAAEIRDPKKNGARVWLGTYESPEDAAVAYDRAAFQLKGSKA  167

Query  630  LLNFPHLIGS  601
             LNFPHLIG+
Sbjct  168  KLNFPHLIGT  177



>ref|XP_006282733.1| hypothetical protein CARUB_v10005868mg [Capsella rubella]
 gb|EOA15631.1| hypothetical protein CARUB_v10005868mg [Capsella rubella]
Length=176

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = -3

Query  789  YKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFPHL  610
            YKGVRRRPWGK+AAEIRDPN+ GARLWLGTYE  E+AA+AYD+ AFK+RG++A LNFPHL
Sbjct  59   YKGVRRRPWGKYAAEIRDPNKNGARLWLGTYETAEEAAVAYDKAAFKMRGSKAKLNFPHL  118

Query  609  IGS-NVPAPIRV  577
            IG  +   P+RV
Sbjct  119  IGCIDQAEPVRV  130



>emb|CDY38401.1| BnaC01g10100D [Brassica napus]
Length=227

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYD+ AF++RG+RALLNFP
Sbjct  121  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAFRMRGSRALLNFP  180

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+R+K +R
Sbjct  181  LRVNSGEPDPVRIKSKR  197



>ref|XP_009775795.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=242

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = -3

Query  891  SPESWEGDGEVQKAAIGAAREECSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARL  712
            SPE W    E       AA  +  PP P+   + Y+GVR RPWGKFAAEIRDP + GAR+
Sbjct  101  SPEIW-NLPEFVAPPETAAEVKLEPPAPQKA-KHYRGVRVRPWGKFAAEIRDPAKNGARV  158

Query  711  WLGTYERPEDAALAYDREAFKLRGARALLNFPHLIGSNVPAPIRVKPRR  565
            WLGTYE  EDAA AYD+ AF++RG+RALLNFP  I S  P PIRV  +R
Sbjct  159  WLGTYETAEDAAFAYDKAAFRMRGSRALLNFPLRINSGEPDPIRVGSKR  207



>ref|XP_009617605.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=245

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -3

Query  825  CSPPLPRDYWRRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKL  646
             +PP P+   + Y+GVR RPWGKFAAEIRDP + GAR+WLGTYE  EDAALAYD+ AF++
Sbjct  127  TTPPPPKG--KHYRGVRVRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRM  184

Query  645  RGARALLNFPHLIGSNVPAPIRVKPRR  565
            RG+RALLNFP  + S  P PIRV  +R
Sbjct  185  RGSRALLNFPLRVNSGEPEPIRVASKR  211



>ref|XP_009108637.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=239

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYDR AF++RG+RALLNFP
Sbjct  117  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP  176

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+RVK +R
Sbjct  177  LRVNSGEPDPVRVKSKR  193



>ref|XP_004152388.1| PREDICTED: ethylene-responsive transcription factor 2-like [Cucumis 
sativus]
 gb|KGN50290.1| AP2/ERF domain-containing transcription factor [Cucumis sativus]
Length=250

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 14/116 (12%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR+RPWGKFAAEIRDP + GAR+WLGTYE  EDAALAYDR A+++RG+RALLNFP
Sbjct  130  KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFP  189

Query  615  HLIGSNVPAPIRVKPRRRslpkaalssplSTESGIGTPKRRKI--SIINSVAAKVN  454
              + S  P P+RV  +R S   +             +PKRRK   S + SV  +V 
Sbjct  190  LRVNSGEPEPVRVTSKRSSPEVS------------SSPKRRKKVGSAVESVGVQVE  233



>ref|XP_009130667.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=240

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + Y+GVR RPWGKFAAEIRDP + GAR+WLGT+E  EDAALAYD+ AF++RG+RALLNFP
Sbjct  131  KHYRGVRERPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAFRMRGSRALLNFP  190

Query  615  HLIGSNVPAPIRVKPRR  565
              + S  P P+R+K +R
Sbjct  191  LRVNSGEPDPVRIKSKR  207



>ref|XP_006577645.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=151

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -3

Query  795  RRYKGVRRRPWGKFAAEIRDPNRKGARLWLGTYERPEDAALAYDREAFKLRGARALLNFP  616
            + YKGVRRRPWGKFAAEIRDPN K  R+WLGTYE  EDAALAYDR AF++RG++A LNFP
Sbjct  79   QNYKGVRRRPWGKFAAEIRDPN-KNVRVWLGTYESAEDAALAYDRAAFEMRGSKAKLNFP  137

Query  615  HLIGSNVPAP  586
            HLIG N   P
Sbjct  138  HLIGCNDAEP  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2496906446688