BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1504_g1_i1 len=1298 path=[1:0-829 831:830-1297]

Length=1298
                                                                      Score     E

ref|XP_006358849.1|  PREDICTED: agamous-like MADS-box protein AGL...    205   2e-59   
ref|XP_011071972.1|  PREDICTED: agamous-like MADS-box protein AGL19     204   3e-59   
ref|XP_011081162.1|  PREDICTED: MADS-box protein SOC1                   204   3e-59   
ref|XP_009772098.1|  PREDICTED: agamous-like MADS-box protein AGL19     202   1e-58   
ref|XP_004245665.1|  PREDICTED: agamous-like MADS-box protein AGL19     203   1e-58   
ref|XP_009626499.1|  PREDICTED: MADS-box protein SOC1-like              202   2e-58   
gb|ABX90015.1|  SOC1-like protein 2                                     201   5e-58   Sinningia speciosa [Brazilian gloxinia]
ref|XP_010053874.1|  PREDICTED: MADS-box protein SOC1                   200   9e-58   
ref|XP_009777755.1|  PREDICTED: agamous-like MADS-box protein AGL...    198   5e-57   
ref|XP_002304455.1|  hypothetical protein POPTR_0003s11960g             197   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011029143.1|  PREDICTED: agamous-like MADS-box protein AGL19     196   3e-56   
ref|XP_009777750.1|  PREDICTED: agamous-like MADS-box protein AGL...    196   4e-56   
ref|XP_009802625.1|  PREDICTED: MADS-box protein SOC1-like isofor...    195   6e-56   
ref|XP_009802617.1|  PREDICTED: MADS-box protein SOC1-like isofor...    195   6e-56   
ref|XP_009607136.1|  PREDICTED: agamous-like MADS-box protein AGL19     194   2e-55   
ref|XP_006477355.1|  PREDICTED: agamous-like MADS-box protein AGL...    193   2e-55   
gb|ABF51526.1|  MADS box transcription factor                           194   3e-55   Populus tomentosa [Chinese white poplar]
emb|CDP17592.1|  unnamed protein product                                193   6e-55   
ref|XP_002275695.2|  PREDICTED: agamous-like MADS-box protein AGL19     192   7e-55   Vitis vinifera
gb|AHW58028.1|  TM3-2                                                   192   7e-55   
gb|ADU56825.1|  MADS-box protein TM3 subfamily                          191   2e-54   
ref|XP_010272601.1|  PREDICTED: MADS-box protein SOC1-like              191   2e-54   
gb|ACZ36915.1|  MADS-box transcription factor 2                         191   3e-54   Hevea brasiliensis [jebe]
gb|AEF32132.1|  MADS-box protein                                        189   5e-54   
ref|XP_006829116.1|  hypothetical protein AMTR_s00001p00266470          190   9e-54   
dbj|BAK18785.2|  MADS-box protein                                       189   1e-53   
gb|EYU32030.1|  hypothetical protein MIMGU_mgv1a013555mg                188   3e-53   
dbj|BAJ53133.1|  JHL05D22.4                                             188   6e-53   
gb|AHI85950.1|  SOC1                                                    187   7e-53   
ref|XP_010255589.1|  PREDICTED: MADS-box protein SOC1                   187   7e-53   
ref|XP_011033831.1|  PREDICTED: agamous-like MADS-box protein AGL19     187   7e-53   
ref|XP_010523711.1|  PREDICTED: MADS-box protein SOC1-like              187   1e-52   
ref|XP_010934920.1|  PREDICTED: MADS-box transcription factor 50-...    187   1e-52   
gb|KDP25539.1|  hypothetical protein JCGZ_20695                         187   1e-52   
ref|XP_010053361.1|  PREDICTED: agamous-like MADS-box protein AGL19     186   2e-52   
ref|XP_008232833.1|  PREDICTED: MADS-box protein SOC1                   186   2e-52   
ref|XP_006477351.1|  PREDICTED: agamous-like MADS-box protein AGL...    186   2e-52   
gb|AEO20232.1|  SOC1-like protein                                       186   2e-52   
ref|XP_004252597.1|  PREDICTED: MADS-box protein SOC1-like              186   2e-52   
ref|NP_001236377.1|  SOC1                                               186   3e-52   
ref|XP_010661478.1|  PREDICTED: MADS-box protein isoform X1             186   4e-52   
gb|AHW58027.1|  TM3-1                                                   185   4e-52   
gb|AEO20229.1|  SOC1-like protein                                       185   4e-52   
emb|CDP09831.1|  unnamed protein product                                185   5e-52   
ref|XP_003623807.1|  MADS-box transcription factor                      185   5e-52   
gb|ACO40488.1|  SOC1                                                    185   5e-52   
gb|AGD88523.1|  SOC1                                                    185   6e-52   
gb|KDO85931.1|  hypothetical protein CISIN_1g027691mg                   184   8e-52   
ref|XP_007040082.1|  AGAMOUS-like 14                                    184   9e-52   
ref|XP_009133734.1|  PREDICTED: MADS-box protein SOC1-like isofor...    184   2e-51   
gb|AFO68796.1|  suppressor of overexpression of constans 1              182   2e-51   
ref|NP_001280855.1|  MADS-box protein SOC1-like                         183   2e-51   
ref|XP_010941169.1|  PREDICTED: MADS-box transcription factor 50-...    183   3e-51   
ref|XP_010934923.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   3e-51   
emb|CDY27368.1|  BnaC04g50370D                                          183   3e-51   
gb|ADU56826.1|  MADS-box protein TM3 subfamily                          181   4e-51   
gb|KCW77637.1|  hypothetical protein EUGRSUZ_D01939                     181   4e-51   
gb|AGS32267.1|  SOC1-1                                                  183   4e-51   
ref|XP_010934925.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   5e-51   
gb|AAP20425.1|  MADS-box protein                                        181   5e-51   Draba nemorosa var. hebecarpa
ref|XP_003534598.1|  PREDICTED: MADS-box protein SOC1-like isofor...    182   5e-51   
ref|XP_009142352.1|  PREDICTED: MADS-box protein SOC1-like              182   5e-51   
ref|XP_011002079.1|  PREDICTED: MADS-box protein SOC1                   182   5e-51   
gb|AGB51002.1|  MADS box transcription factor SOC1 variant 5            182   6e-51   
ref|XP_006294978.1|  hypothetical protein CARUB_v10024046mg             182   6e-51   
ref|XP_010941170.1|  PREDICTED: MADS-box protein SOC1-like isofor...    182   6e-51   
ref|XP_010518187.1|  PREDICTED: MADS-box protein SOC1                   182   7e-51   
gb|AFM77891.1|  MADS-box protein AGL20/SOC1                             182   7e-51   
ref|XP_004492667.1|  PREDICTED: MADS-box protein SOC1-like              182   7e-51   
ref|XP_010508131.1|  PREDICTED: MADS-box protein SOC1-like              182   8e-51   
gb|AFM77896.1|  MADS-box protein AGL20/SOC1                             182   8e-51   
ref|NP_001275772.1|  SOC1-like protein 1                                182   8e-51   
ref|NP_001267909.1|  MADS-box protein                                   182   8e-51   
ref|XP_010506539.1|  PREDICTED: MADS-box protein SOC1-like              182   8e-51   
ref|XP_006397744.1|  hypothetical protein EUTSA_v10001632mg             182   9e-51   
ref|XP_010934922.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   9e-51   
ref|XP_008356915.1|  PREDICTED: MADS-box protein SOC1-like              182   1e-50   
ref|XP_006583359.1|  PREDICTED: MADS-box protein SOC1-like isofor...    182   1e-50   
dbj|BAK18558.1|  suppressor of overexpression of constans 1-like ...    181   1e-50   
ref|XP_010941171.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   1e-50   
ref|XP_010544676.1|  PREDICTED: MADS-box protein SOC1-like              181   1e-50   
dbj|BAK18559.1|  suppressor of overexpression of constans 1-like ...    181   1e-50   
ref|XP_004515788.1|  PREDICTED: agamous-like MADS-box protein AGL...    181   2e-50   
gb|AGB50999.1|  MADS box transcription factor SOC1 variant 15           181   2e-50   
ref|XP_010676581.1|  PREDICTED: agamous-like MADS-box protein AGL19     181   2e-50   
gb|AGK07583.1|  SOC1                                                    181   2e-50   
gb|AAB41526.1|  transcription factor SaMADS A                           181   2e-50   Sinapis alba [bai jie]
gb|AGB51012.1|  MADS box transcription factor SOC1 variant 8            181   2e-50   
gb|AAP46287.1|AF377868_1  MADS-box protein PTM5                         181   2e-50   Populus tremuloides
gb|AGB51146.1|  MADS box transcription factor SOC1 variant 8            181   2e-50   
gb|AEH43352.1|  SOC1                                                    181   2e-50   
ref|XP_009143158.1|  PREDICTED: MADS-box protein SOC1                   181   2e-50   
gb|AFM77895.1|  MADS-box protein AGL20/SOC1                             181   2e-50   
gb|AGB51017.1|  MADS box transcription factor SOC1 variant 7            181   2e-50   
emb|CDY69077.1|  BnaC04g53290D                                          181   3e-50   
emb|CDY53886.1|  BnaA03g56880D                                          181   3e-50   
ref|NP_001288813.1|  MADS-box protein SOC1-like                         181   3e-50   
dbj|BAN19217.1|  suppressor of overexpression of CO1 like protein       181   3e-50   
ref|XP_011034922.1|  PREDICTED: MADS-box protein SOC1-like              181   3e-50   
dbj|BAL14663.1|  suppressor of overexpression of CO1 like protein       180   3e-50   
dbj|BAN19216.1|  suppressor of overexpression of CO1 like protein       180   3e-50   
ref|XP_010919082.1|  PREDICTED: MADS-box protein SOC1-like isofor...    180   4e-50   
gb|AGN29205.1|  SOC1                                                    180   4e-50   
ref|NP_182090.1|  MADS-box protein SOC1                                 180   4e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AES80026.2|  MADS-box transcription factor                           180   4e-50   
gb|AGT96413.1|  AGL20                                                   180   4e-50   
dbj|BAN19211.1|  suppressor of overexpression of CO1 like protein       180   4e-50   
ref|XP_009617466.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   4e-50   
gb|AAC33475.1|  transcription activator                                 180   4e-50   Spuriopimpinella brachycarpa
emb|CBI34770.3|  unnamed protein product                                180   4e-50   
gb|ABG34340.1|  MADS box transcription factor 5                         180   5e-50   Populus tomentosa [Chinese white poplar]
gb|AFH41826.1|  MADS-box protein SOC1                                   180   5e-50   
dbj|BAN19212.1|  suppressor of overexpression of CO1 like protein       180   5e-50   
dbj|BAN19214.1|  suppressor of overexpression of CO1 like protein       180   6e-50   
dbj|BAH97195.1|  suppressor of overexpression of CO1                    180   6e-50   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFM77893.1|  MADS-box protein AGL20/SOC1                             179   6e-50   
ref|XP_010941167.1|  PREDICTED: MADS-box protein SOC1-like isofor...    181   6e-50   
ref|XP_010919081.1|  PREDICTED: MADS-box transcription factor 50-...    180   6e-50   
ref|XP_008794766.1|  PREDICTED: MADS-box transcription factor 50-...    180   7e-50   
gb|ADG27451.1|  suppressor of overexpression of constans 1-like c...    179   9e-50   
ref|NP_001240979.1|  uncharacterized protein LOC100805260               179   9e-50   
ref|XP_006579437.1|  PREDICTED: uncharacterized protein LOC100805...    179   1e-49   
gb|AGB50998.1|  MADS box transcription factor SOC1 variant 9            179   1e-49   
ref|XP_002882024.1|  hypothetical protein ARALYDRAFT_904011             179   1e-49   
gb|AGB51145.1|  MADS box transcription factor SOC1 variant 7            179   1e-49   
gb|AAQ54337.1|  MADS-box protein                                        179   1e-49   Brassica rapa
gb|AEF32135.1|  MADS-box protein                                        179   1e-49   
ref|XP_008437190.1|  PREDICTED: agamous-like MADS-box protein AGL19     179   1e-49   
emb|CAE46180.1|  AGL20-like MADS box transcription factor               178   1e-49   Elaeis guineensis
gb|AGB51008.1|  MADS box transcription factor SOC1 variant 14           179   1e-49   
gb|AGB51018.1|  MADS box transcription factor SOC1 variant 4            179   1e-49   
gb|ADX97324.1|  SOC1                                                    179   2e-49   
ref|XP_010919080.1|  PREDICTED: MADS-box protein SOC1-like isofor...    179   2e-49   
gb|ACV88635.1|  SUPRESSOR OF OVEREXPRESSION OF CONSTANS1                179   2e-49   Magnolia virginiana [sweetbay]
emb|CDY60689.1|  BnaCnng36880D                                          178   2e-49   
ref|XP_009375846.1|  PREDICTED: MADS-box protein SOC1 isoform X2        178   2e-49   
dbj|BAJ22387.1|  suppressor of overexpression of constans 1             178   2e-49   
ref|XP_006583366.1|  PREDICTED: MADS-box protein SOC1-like isofor...    179   2e-49   
gb|AGB51005.1|  MADS box transcription factor SOC1 variant 19           178   2e-49   
ref|XP_009617469.1|  PREDICTED: MADS-box protein SOC1-like isofor...    178   2e-49   
ref|XP_004143998.1|  PREDICTED: agamous-like MADS-box protein AGL...    178   3e-49   
gb|KDO85938.1|  hypothetical protein CISIN_1g027691mg                   176   3e-49   
ref|XP_006445195.1|  hypothetical protein CICLE_v10022568mg             176   3e-49   
emb|CDP08914.1|  unnamed protein product                                181   3e-49   
ref|XP_008342903.1|  PREDICTED: MADS-box protein SOC1-like isofor...    178   3e-49   
gb|AAX47171.2|  SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 a            178   3e-49   Pisum sativum [garden pea]
emb|CAL36577.1|  deficiens H68 homologue                                177   4e-49   Misopates orontium
ref|XP_003549870.1|  PREDICTED: agamous-like MADS-box protein AGL...    177   4e-49   
gb|KHN34444.1|  Agamous-like MADS-box protein AGL19                     177   5e-49   
gb|ADU17781.1|  forever young flower protein                            177   5e-49   
gb|AFH41827.1|  MADS-box protein SOC1                                   177   5e-49   
gb|AAP20424.1|  MADS-box protein                                        177   6e-49   Cardamine flexuosa
gb|AGB51015.1|  MADS box transcription factor SOC1 variant 10           177   7e-49   
ref|XP_004298725.1|  PREDICTED: agamous-like MADS-box protein AGL...    177   7e-49   
gb|AAP20423.1|  MADS-box protein                                        177   7e-49   Brassica rapa subsp. pekinensis [bai cai]
emb|CAA53782.1|  transcription factor                                   177   9e-49   Nicotiana tabacum [American tobacco]
gb|ADO61014.1|  suppressor of overexpression of CONSTANS 1              176   1e-48   
ref|XP_007051979.1|  AGAMOUS-like 20 isoform 2                          178   1e-48   
ref|XP_002867741.1|  hypothetical protein ARALYDRAFT_492570             176   1e-48   
ref|XP_002320747.2|  hypothetical protein POPTR_0014s07010g             181   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_007051978.1|  MIKC mads-box transcription factor SOC1 isof...    176   2e-48   
gb|AFX72886.1|  MADS-box protein SOC1.2                                 176   2e-48   
gb|ADO61007.1|  suppressor of overexpression of CONSTANS 1              176   2e-48   
ref|XP_006576386.1|  PREDICTED: MADS-box protein SOC1-like isofor...    175   2e-48   
ref|XP_010455601.1|  PREDICTED: agamous-like MADS-box protein AGL...    175   3e-48   
gb|ACJ86138.1|  unknown                                                 176   3e-48   Medicago truncatula
ref|XP_010433968.1|  PREDICTED: agamous-like MADS-box protein AGL19     175   3e-48   
gb|AHM92077.1|  MADS-box protein 1                                      175   3e-48   
ref|XP_009114655.1|  PREDICTED: agamous-like MADS-box protein AGL14     175   3e-48   
ref|XP_009796063.1|  PREDICTED: MADS-box protein SOC1-like              175   3e-48   
gb|AEO20230.1|  SOC1-like protein                                       175   3e-48   
gb|AHI85953.1|  SOC1-like protein                                       174   4e-48   
gb|AEO20234.1|  SOC1-like protein                                       174   6e-48   
ref|XP_006282713.1|  hypothetical protein CARUB_v10005697mg             174   6e-48   
emb|CAJ38368.1|  MADS-box transcription factor                          174   7e-48   Plantago major [cart-track plant]
gb|AGB51009.1|  MADS box transcription factor SOC1 variant 12           174   7e-48   
gb|KEH31691.1|  MADS-box transcription factor                           174   7e-48   
gb|AAO22989.1|  MADS-box transcription factor CDM36                     174   8e-48   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CDY55821.1|  BnaCnng29230D                                          174   8e-48   
ref|NP_194026.1|  agamous-like MADS-box protein AGL19                   174   9e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAK21257.1|AF335244_1  MADS-box transcription factor FBP28           174   1e-47   Petunia x hybrida [garden petunia]
ref|XP_009362848.1|  PREDICTED: agamous-like MADS-box protein AGL19     174   1e-47   
ref|XP_010448808.1|  PREDICTED: agamous-like MADS-box protein AGL19     174   1e-47   
ref|XP_009345824.1|  PREDICTED: agamous-like MADS-box protein AGL19     174   1e-47   
gb|AEO20233.1|  SOC1-like protein                                       173   1e-47   
ref|XP_007051982.1|  AGAMOUS-like 20 isoform 5                          174   1e-47   
emb|CDY13289.1|  BnaC09g23670D                                          173   2e-47   
gb|KEH19008.1|  MADS-box transcription factor                           173   2e-47   
gb|KEH19009.1|  MADS-box transcription factor                           173   2e-47   
emb|CCA61011.1|  GSOC2 protein                                          172   2e-47   
gb|KFK39263.1|  mads box agl protein                                    172   3e-47   
ref|XP_004983814.1|  PREDICTED: MADS-box transcription factor 56-...    173   3e-47   
ref|XP_009375845.1|  PREDICTED: MADS-box protein SOC1 isoform X1        172   3e-47   
ref|XP_003623808.1|  MADS-box transcription factor                      172   4e-47   
ref|XP_009108594.1|  PREDICTED: agamous-like MADS-box protein AGL19     172   4e-47   
ref|NP_001280778.1|  agamous-like MADS-box protein AGL19                172   5e-47   
gb|AAD16052.1|  putative MADS box transcription factor ETL              171   6e-47   Eucalyptus globulus subsp. globulus
dbj|BAK24000.1|  suppressor of overexpression of constans 1             172   7e-47   
ref|XP_007051981.1|  AGAMOUS-like 20 isoform 4                          171   8e-47   
ref|XP_002872630.1|  hypothetical protein ARALYDRAFT_490004             171   9e-47   
ref|XP_010439256.1|  PREDICTED: agamous-like MADS-box protein AGL...    171   9e-47   
ref|XP_006339502.1|  PREDICTED: MADS-box protein SOC1-like              171   1e-46   
ref|XP_010529519.1|  PREDICTED: agamous-like MADS-box protein AGL14     171   1e-46   
ref|XP_006288611.1|  hypothetical protein CARUB_v10001906mg             171   1e-46   
gb|ADO61008.1|  suppressor of overexpression of CONSTANS 1              171   2e-46   
emb|CAC86007.1|  putative MADS-box transcription factor DEFH68          171   2e-46   Antirrhinum majus [garden snapdragon]
gb|AFK35913.1|  unknown                                                 171   2e-46   
ref|XP_010455602.1|  PREDICTED: agamous-like MADS-box protein AGL...    169   2e-46   
gb|KCW90775.1|  hypothetical protein EUGRSUZ_A02846                     170   2e-46   
ref|XP_010439257.1|  PREDICTED: agamous-like MADS-box protein AGL...    170   2e-46   
emb|CAL36575.1|  deficiens H24 homologue                                171   3e-46   Misopates orontium
gb|KCW90778.1|  hypothetical protein EUGRSUZ_A02846                     170   3e-46   
ref|NP_001168784.1|  uncharacterized protein LOC100382583               170   3e-46   Zea mays [maize]
ref|XP_004510894.1|  PREDICTED: MADS-box protein SOC1-like              170   3e-46   
gb|AIU94286.1|  SOC1-like protein                                       170   3e-46   
gb|AEO20231.1|  SOC1-like protein                                       170   3e-46   
ref|XP_008658827.1|  PREDICTED: uncharacterized protein LOC100382...    170   3e-46   
ref|XP_008238753.1|  PREDICTED: agamous-like MADS-box protein AGL19     169   4e-46   
ref|XP_009617463.1|  PREDICTED: MADS-box protein SOC1-like isofor...    171   5e-46   
ref|XP_006396837.1|  hypothetical protein EUTSA_v10028949mg             169   7e-46   
ref|XP_010455600.1|  PREDICTED: agamous-like MADS-box protein AGL...    169   7e-46   
gb|EPS59775.1|  hypothetical protein M569_15030                         168   7e-46   
ref|XP_009782122.1|  PREDICTED: MADS-box protein SOC1-like              169   8e-46   
ref|XP_010434076.1|  PREDICTED: agamous-like MADS-box protein AGL14     169   8e-46   
ref|NP_192925.1|  agamous-like MADS-box protein AGL14                   169   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422139.1|  PREDICTED: agamous-like MADS-box protein AGL14     169   1e-45   
gb|AFR90178.1|  suppressor of overexpression of CO1                     168   1e-45   
gb|AGW23360.1|  MADS box protein MADS58                                 168   1e-45   
ref|XP_011091217.1|  PREDICTED: MADS-box protein SOC1                   168   1e-45   
ref|XP_008783455.1|  PREDICTED: MADS-box transcription factor 50-...    168   1e-45   
gb|KCW90779.1|  hypothetical protein EUGRSUZ_A02846                     166   2e-45   
ref|XP_009618745.1|  PREDICTED: MADS-box protein SOC1-like              168   2e-45   
gb|AAK21251.1|  MADS-box transcription factor FBP20                     167   2e-45   Petunia x hybrida [garden petunia]
gb|AAY84828.1|  transcription factor AGL20                              167   3e-45   Ipomoea batatas [batate]
ref|XP_007051980.1|  AGAMOUS-like 20 isoform 3                          165   3e-45   
ref|XP_007155575.1|  hypothetical protein PHAVU_003G213600g             165   3e-45   
ref|XP_008777520.1|  PREDICTED: MADS-box transcription factor 50-...    167   3e-45   
ref|XP_009136496.1|  PREDICTED: agamous-like MADS-box protein AGL19     167   3e-45   
ref|XP_006662002.1|  PREDICTED: MADS-box transcription factor 56-...    167   3e-45   
ref|XP_009137304.1|  PREDICTED: agamous-like MADS-box protein AGL...    167   4e-45   
gb|ACR25200.1|  SOC1-like floral activator                              166   4e-45   Brassica rapa var. purpuraria [purple stem mustard]
dbj|BAL70258.1|  suppressor of overexpression of CONSTANS 1             166   6e-45   
ref|XP_002263450.1|  PREDICTED: MADS-box protein SOC1-like              166   6e-45   Vitis vinifera
ref|XP_011101156.1|  PREDICTED: MADS-box protein SOC1-like isofor...    166   6e-45   
ref|XP_010061717.1|  PREDICTED: MADS-box protein SOC1-like              166   7e-45   
ref|XP_009137303.1|  PREDICTED: agamous-like MADS-box protein AGL...    166   8e-45   
ref|NP_001048801.1|  Os03g0122600                                       167   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649298.1|  PREDICTED: MADS-box transcription factor 50-...    167   8e-45   
gb|KHN15689.1|  MADS-box transcription factor 50                        166   8e-45   
emb|CAM59040.1|  MIKC-type MADS-box transcription factor WM1B           166   8e-45   Triticum aestivum [Canadian hard winter wheat]
gb|ACH53560.1|  MADS-box transcription factor PFSOC1                    166   9e-45   
gb|ABF57947.1|  MADS-box transcription factor TaAGL7                    166   9e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009792164.1|  PREDICTED: MADS-box protein SOC1-like isofor...    166   9e-45   
ref|XP_008788732.1|  PREDICTED: MADS-box protein SOC1-like isofor...    166   1e-44   
ref|NP_001288329.1|  MADS-box transcription factor 56-like              166   1e-44   
ref|XP_008234315.1|  PREDICTED: MADS-box protein SOC1-like              166   1e-44   
ref|XP_010692327.1|  PREDICTED: MADS-box protein SOC1                   166   1e-44   
ref|XP_010233636.1|  PREDICTED: MADS-box transcription factor 56-...    166   1e-44   
emb|CDP17588.1|  unnamed protein product                                166   1e-44   
ref|XP_006339503.1|  PREDICTED: MADS-box protein SOC1-like isofor...    166   1e-44   
ref|XP_004308127.1|  PREDICTED: MADS-box protein SOC1-like              166   1e-44   
ref|XP_009382800.1|  PREDICTED: MADS-box transcription factor 50-...    165   2e-44   
gb|AEA29618.1|  SOC1 protein                                            165   2e-44   
ref|NP_001266966.1|  MADS-box protein SOC1-like                         165   2e-44   
dbj|BAK00484.1|  predicted protein                                      166   2e-44   
ref|XP_009792165.1|  PREDICTED: MADS-box protein SOC1-like isofor...    164   2e-44   
ref|XP_010035073.1|  PREDICTED: MADS-box protein SOC1-like              165   2e-44   
ref|XP_002318261.1|  hypothetical protein POPTR_0012s13980g             164   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_003555365.1|  PREDICTED: MADS-box protein SOC1-like isofor...    164   3e-44   
ref|XP_007038540.1|  AGAMOUS-like 20                                    165   4e-44   
sp|A2Z9Q7.2|MAD56_ORYSI  RecName: Full=MADS-box transcription fac...    165   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008376862.1|  PREDICTED: MADS-box protein SOC1-like isofor...    165   5e-44   
ref|XP_010934005.1|  PREDICTED: MADS-box transcription factor 50-...    164   5e-44   
gb|AAQ23145.1|  transcription factor MADS56                             164   5e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010035067.1|  PREDICTED: MADS-box protein SOC1-like              164   6e-44   
ref|XP_009420441.1|  PREDICTED: agamous-like MADS-box protein AGL...    163   6e-44   
ref|XP_006341728.1|  PREDICTED: MADS-box protein SOC1-like              164   6e-44   
gb|AFW89766.1|  MADS1                                                   163   7e-44   
ref|XP_009384284.1|  PREDICTED: MADS-box transcription factor 50-...    164   7e-44   
ref|XP_010536502.1|  PREDICTED: MADS-box protein SOC1-like              163   8e-44   
ref|XP_009384292.1|  PREDICTED: MADS-box transcription factor 50-...    163   9e-44   
gb|AEJ76839.1|  MADS14                                                  163   9e-44   
gb|AAK21252.1|AF335239_1  MADS-box transcription factor FBP21           163   9e-44   
ref|XP_008467250.1|  PREDICTED: MADS-box protein SOC1-like              161   1e-43   
emb|CDX98780.1|  BnaA03g45650D                                          163   1e-43   
gb|EMS66203.1|  MADS-box transcription factor 56                        164   1e-43   
ref|NP_001105152.1|  MADS1                                              163   2e-43   
gb|AHJ60268.1|  SOC1                                                    163   2e-43   
gb|AAP40640.1|  SOC1-like floral activator                              162   2e-43   
ref|NP_001289659.1|  MADS-box protein SOC1-like                         162   2e-43   
ref|XP_009617465.1|  PREDICTED: MADS-box protein SOC1-like isofor...    164   2e-43   
ref|XP_010934009.1|  PREDICTED: MADS-box transcription factor 50-...    162   2e-43   
ref|XP_011030023.1|  PREDICTED: MADS-box protein SOC1-like              162   2e-43   
ref|XP_002465961.1|  hypothetical protein SORBIDRAFT_01g049020          163   2e-43   
ref|XP_010483927.1|  PREDICTED: MADS-box protein SOC1-like              162   2e-43   
ref|XP_008376871.1|  PREDICTED: MADS-box protein SOC1-like isofor...    163   2e-43   
ref|XP_004248574.1|  PREDICTED: MADS-box protein SOC1-like              162   2e-43   
gb|AAK21253.1|AF335240_1  MADS-box transcription factor FBP22           162   3e-43   
gb|AEP19345.1|  MADS box protein                                        162   3e-43   
ref|XP_010555321.1|  PREDICTED: MADS-box protein SOC1-like              162   3e-43   
ref|XP_008376847.1|  PREDICTED: MADS-box protein SOC1-like isofor...    163   3e-43   
ref|XP_009617464.1|  PREDICTED: MADS-box protein SOC1-like isofor...    162   4e-43   
ref|XP_008672806.1|  PREDICTED: uncharacterized protein LOC100279...    161   4e-43   
ref|XP_011076262.1|  PREDICTED: MADS-box protein SOC1-like              161   5e-43   
ref|XP_010458334.1|  PREDICTED: MADS-box protein SOC1-like              161   5e-43   
ref|XP_009371258.1|  PREDICTED: MADS-box protein SOC1-like              162   5e-43   
ref|XP_004143644.1|  PREDICTED: MADS-box protein SOC1-like              162   6e-43   
ref|NP_568952.1|  protein AGAMOUS-like 42                               160   7e-43   
gb|KCW46358.1|  hypothetical protein EUGRSUZ_K00207                     160   7e-43   
dbj|BAD93167.1|  MADS-box transcription factor GbMADS3                  161   7e-43   
ref|NP_001280901.1|  MADS-box protein SOC1-like                         162   7e-43   
gb|AHM92078.1|  MADS-box protein 2                                      161   9e-43   
ref|XP_004162764.1|  PREDICTED: MADS-box protein SOC1-like              160   9e-43   
ref|XP_008788734.1|  PREDICTED: MADS-box protein SOC1-like isofor...    160   9e-43   
ref|XP_002510866.1|  mads box protein, putative                         160   9e-43   
ref|XP_009420440.1|  PREDICTED: agamous-like MADS-box protein AGL...    160   1e-42   
emb|CAM59039.1|  MIKC-type MADS-box transcription factor WM1A           161   1e-42   
ref|XP_009347899.1|  PREDICTED: MADS-box protein SOC1-like isofor...    159   1e-42   
ref|XP_010035069.1|  PREDICTED: MADS-box protein SOC1-like              160   1e-42   
gb|ADK38585.1|  suppressor of overexpression of CO1                     160   1e-42   
ref|XP_009347895.1|  PREDICTED: MADS-box protein SOC1-like isofor...    161   1e-42   
ref|XP_010444066.1|  PREDICTED: MADS-box protein SOC1-like              160   1e-42   
ref|XP_009384267.1|  PREDICTED: MADS-box transcription factor 50-...    160   1e-42   
gb|AEJ76838.1|  MADS15                                                  162   1e-42   
ref|XP_004985919.1|  PREDICTED: MADS-box transcription factor 50-...    160   2e-42   
ref|XP_009347897.1|  PREDICTED: MADS-box protein SOC1-like isofor...    160   2e-42   
ref|XP_010055578.1|  PREDICTED: MADS-box protein SOC1-like isofor...    160   2e-42   
ref|XP_010035068.1|  PREDICTED: MADS-box protein SOC1-like              159   3e-42   
sp|P0C5B2.1|MAD56_ORYSJ  RecName: Full=MADS-box transcription fac...    160   3e-42   
ref|NP_001276829.1|  MADS-box protein SOC1-like                         159   4e-42   
ref|XP_009617468.1|  PREDICTED: MADS-box protein SOC1-like isofor...    160   4e-42   
ref|NP_001065168.1|  Os10g0536100                                       159   4e-42   
ref|XP_009384512.1|  PREDICTED: MADS-box transcription factor 50-...    159   4e-42   
ref|XP_003536488.1|  PREDICTED: MADS-box protein SOC1-like              159   5e-42   
ref|XP_008672808.1|  PREDICTED: uncharacterized protein LOC100279...    158   5e-42   
ref|XP_009341296.1|  PREDICTED: MADS-box protein SOC1-like              159   6e-42   
ref|XP_008460142.1|  PREDICTED: MADS-box protein SOC1-like              159   6e-42   
ref|XP_006606087.1|  PREDICTED: MADS-box protein SOC1-like isofor...    158   6e-42   
ref|XP_004145054.1|  PREDICTED: MADS-box protein SOC1-like              158   6e-42   
ref|NP_001146098.1|  uncharacterized protein LOC100279630               158   7e-42   
ref|XP_009400478.1|  PREDICTED: MADS-box transcription factor 50-...    158   7e-42   
ref|XP_009347898.1|  PREDICTED: MADS-box protein SOC1-like isofor...    158   8e-42   
emb|CDY68007.1|  BnaCnng57290D                                          156   8e-42   
ref|XP_009382240.1|  PREDICTED: MADS-box transcription factor 50-...    156   9e-42   
ref|XP_010035082.1|  PREDICTED: MADS-box protein SOC1-like isofor...    157   9e-42   
ref|XP_009347901.1|  PREDICTED: MADS-box protein SOC1-like              159   1e-41   
ref|XP_010538787.1|  PREDICTED: agamous-like MADS-box protein AGL14     157   1e-41   
ref|XP_004153376.1|  PREDICTED: MADS-box protein SOC1-like              158   1e-41   
emb|CAA43168.1|  TDR3                                                   155   1e-41   
ref|XP_010035070.1|  PREDICTED: MADS-box protein SOC1-like              157   1e-41   
ref|XP_009411422.1|  PREDICTED: MADS-box transcription factor 50-...    157   1e-41   
ref|XP_009130198.1|  PREDICTED: MADS-box protein SOC1-like              157   2e-41   
ref|XP_008672798.1|  PREDICTED: uncharacterized protein LOC100279...    157   2e-41   
ref|XP_010546076.1|  PREDICTED: MADS-box protein SOC1-like              157   2e-41   
ref|XP_009411419.1|  PREDICTED: MADS-box transcription factor 50-...    157   2e-41   
gb|KCW46341.1|  hypothetical protein EUGRSUZ_K00200                     155   3e-41   
gb|AAC49082.1|  MADS-box protein AGL14                                  156   4e-41   
ref|XP_006362696.1|  PREDICTED: MADS-box protein SOC1-like isofor...    156   4e-41   
ref|XP_008376826.1|  PREDICTED: MADS-box protein SOC1-like              157   4e-41   
ref|XP_006362694.1|  PREDICTED: MADS-box protein SOC1-like isofor...    157   5e-41   
emb|CDP05263.1|  unnamed protein product                                156   5e-41   
ref|XP_009382239.1|  PREDICTED: MADS-box transcription factor 50-...    156   5e-41   
ref|XP_006340581.1|  PREDICTED: MADS-box protein SOC1-like              154   5e-41   
gb|KCW46361.1|  hypothetical protein EUGRSUZ_K00207                     154   5e-41   
gb|KCW46362.1|  hypothetical protein EUGRSUZ_K00207                     154   6e-41   
ref|XP_010035066.1|  PREDICTED: MADS-box protein SOC1-like              155   6e-41   
ref|XP_009382237.1|  PREDICTED: MADS-box transcription factor 50-...    155   6e-41   
ref|XP_006340530.1|  PREDICTED: MADS-box protein SOC1-like              155   6e-41   
emb|CBI24464.3|  unnamed protein product                                155   6e-41   
gb|KCW46349.1|  hypothetical protein EUGRSUZ_K00202                     155   6e-41   
ref|XP_006394426.1|  hypothetical protein EUTSA_v10004954mg             155   7e-41   
gb|ACN36307.1|  unknown                                                 155   8e-41   
ref|XP_004240747.1|  PREDICTED: MADS-box protein SOC1-like              155   9e-41   
ref|XP_009766771.1|  PREDICTED: MADS-box protein SOC1 isoform X2        155   1e-40   
ref|XP_010035074.1|  PREDICTED: MADS-box protein SOC1-like              155   1e-40   
gb|AGR53805.1|  DAL19 protein                                           154   1e-40   
ref|XP_009766770.1|  PREDICTED: MADS-box protein SOC1 isoform X1        155   1e-40   
gb|ACN27495.1|  unknown                                                 154   1e-40   
ref|NP_001289658.1|  MADS-box protein SOC1-like                         154   1e-40   
gb|EYU19506.1|  hypothetical protein MIMGU_mgv1a013890mg                154   2e-40   
dbj|BAF00307.1|  hypothetical protein                                   152   2e-40   
ref|XP_010035071.1|  PREDICTED: MADS-box protein SOC1-like              154   2e-40   
gb|KCW46360.1|  hypothetical protein EUGRSUZ_K00207                     154   2e-40   
gb|ABG66221.1|  Agamous-like MADS box protein AGL19, putative, ex...    152   2e-40   
gb|ABX90014.1|  SOC1-like protein 1                                     154   2e-40   
ref|XP_010035064.1|  PREDICTED: MADS-box protein SOC1-like              154   3e-40   
ref|NP_001280844.1|  MADS-box protein SOC1-like                         154   3e-40   
ref|XP_009112008.1|  PREDICTED: MADS-box protein SOC1-like              153   4e-40   
ref|XP_009382235.1|  PREDICTED: MADS-box transcription factor 50-...    152   8e-40   
gb|AHW58045.1|  SOC1                                                    152   1e-39   
ref|NP_001190593.1|  protein AGAMOUS-like 42                            152   1e-39   
gb|ADU56828.1|  MADS-box protein TM3 subfamily                          150   3e-39   
gb|EYU25036.1|  hypothetical protein MIMGU_mgv1a018106mg                148   4e-39   
ref|XP_010035075.1|  PREDICTED: MADS-box protein SOC1-like isofor...    151   5e-39   
gb|ADE77195.1|  unknown                                                 150   5e-39   
ref|XP_006281113.1|  hypothetical protein CARUB_v10027142mg             150   7e-39   
gb|AAB80806.1|  putative MADS box transcription factor PrMADS9          150   8e-39   
ref|XP_008438118.1|  PREDICTED: MADS-box protein SOC1-like isofor...    150   1e-38   
emb|CBX45125.1|  GSOC1 protein                                          149   1e-38   
ref|XP_010555639.1|  PREDICTED: MADS-box protein SOC1-like              149   2e-38   
gb|AAB80808.1|  putative MADS box transcription factor PrMADS5          148   6e-38   
ref|XP_009415401.1|  PREDICTED: MADS-box transcription factor 50-...    147   6e-38   
gb|ABK21846.1|  unknown                                                 148   6e-38   
gb|AHH28299.1|  MADS-box transcription factor                           147   7e-38   
gb|KCW46352.1|  hypothetical protein EUGRSUZ_K00202                     148   7e-38   
dbj|BAF56968.1|  MADS-box transcription factor                          147   1e-37   
ref|XP_009389854.1|  PREDICTED: MADS-box protein SOC1-like              148   1e-37   
gb|KCW46332.1|  hypothetical protein EUGRSUZ_K00193                     146   1e-37   
dbj|BAJ99551.1|  predicted protein                                      146   2e-37   
gb|AAB80809.1|  putative MADS box transcription factor PrMADS6          146   2e-37   
emb|CAA55868.1|  DAL3 protein                                           145   2e-37   
gb|ADM73188.1|  MADS-domain transcription factor dal3 variant 2         146   2e-37   
ref|XP_008438119.1|  PREDICTED: MADS-box protein SOC1-like isofor...    145   3e-37   
ref|XP_008438120.1|  PREDICTED: MADS-box protein SOC1-like isofor...    144   6e-37   
gb|ABF57922.1|  MADS-box transcription factor TaAGL20                   145   6e-37   
emb|CAM59066.1|  MIKC-type MADS-box transcription factor WM21B          145   7e-37   
emb|CAB44447.2|  putative MADS domain transcription factor GGM1         145   9e-37   
gb|EEE56135.1|  hypothetical protein OsJ_05013                          146   1e-36   
gb|AHH28297.1|  MADS-box transcription factor                           144   1e-36   
gb|AHH28300.1|  MADS-box transcription factor                           143   1e-36   
ref|XP_010482530.1|  PREDICTED: MADS-box protein SOC1-like              144   1e-36   
gb|AAC27353.1|  putative MADS box transcription factor PrMADS8          143   2e-36   
ref|XP_004133895.1|  PREDICTED: MADS-box protein SOC1-like              144   2e-36   
gb|EPS70373.1|  hypothetical protein M569_04388                         141   2e-36   
gb|ABF57923.1|  MADS-box transcription factor TaAGL21                   144   2e-36   
ref|XP_006648207.1|  PREDICTED: MADS-box transcription factor 50-...    144   2e-36   
gb|AJA34534.1|  MADS                                                    144   2e-36   
gb|ABF57938.1|  MADS-box transcription factor TaAGL38                   144   2e-36   
gb|AHW58041.1|  AGL42                                                   141   2e-36   
gb|KCW46333.1|  hypothetical protein EUGRSUZ_K00193                     142   2e-36   
ref|XP_006281112.1|  hypothetical protein CARUB_v10027142mg             143   2e-36   
ref|NP_001275771.1|  SOC1-like protein 2                                142   6e-36   
ref|XP_006401902.1|  hypothetical protein EUTSA_v10014716mg             141   9e-36   
ref|XP_002865879.1|  predicted protein                                  141   9e-36   
ref|XP_004150307.1|  PREDICTED: MADS-box protein SOC1-like              141   1e-35   
ref|NP_200000.3|  MADS-box transcription factor AGL71                   140   2e-35   
ref|XP_009625300.1|  PREDICTED: MADS-box protein CMB1-like              141   5e-35   
ref|XP_009107040.1|  PREDICTED: MADS-box transcription factor 50 ...    139   7e-35   
ref|XP_010041409.1|  PREDICTED: MADS-box protein SOC1-like              137   7e-35   
emb|CDY00505.1|  BnaA10g07680D                                          139   8e-35   
gb|AAF77579.1|AF072534_1  pepper MADS-box protein                       138   9e-35   
gb|AAB80807.1|  putative MADS box transcription factor PrMADS4          139   1e-34   
ref|XP_008439150.1|  PREDICTED: MADS-box protein SOC1-like isofor...    138   1e-34   
ref|XP_008439148.1|  PREDICTED: MADS-box protein SOC1-like isofor...    138   1e-34   
ref|XP_009788435.1|  PREDICTED: MADS-box protein CMB1-like              139   1e-34   
gb|ADZ72838.1|  suppressor of overexpression of constans 1-like p...    138   1e-34   
ref|XP_008439149.1|  PREDICTED: MADS-box protein SOC1-like isofor...    138   2e-34   
ref|NP_001242365.1|  uncharacterized protein LOC100797819               139   2e-34   
gb|AAO45878.1|  MADS6                                                   138   2e-34   
ref|XP_009107038.1|  PREDICTED: MADS-box transcription factor 23 ...    139   2e-34   
gb|AFU61112.1|  MADS-box transcription factor MADS-RIN                  139   2e-34   
ref|XP_009107033.1|  PREDICTED: MADS-box protein SOC1 isoform X1        139   2e-34   
ref|NP_001288306.1|  MADS-box transcription factor 5-like               138   2e-34   
ref|NP_001078745.1|  MADS-box transcription factor AGL72                137   3e-34   
ref|XP_009384513.1|  PREDICTED: MADS-box transcription factor 50-...    138   3e-34   
ref|XP_010443990.1|  PREDICTED: MADS-box protein SOC1 isoform X1        137   3e-34   
gb|EEC72299.1|  hypothetical protein OsI_05477                          139   3e-34   
gb|ABK28751.1|  unknown                                                 137   3e-34   
ref|NP_974924.1|  MADS-box transcription factor AGL71                   136   3e-34   
ref|XP_006281070.1|  hypothetical protein CARUB_v10027093mg             137   3e-34   
ref|XP_006401901.1|  hypothetical protein EUTSA_v10015303mg             137   4e-34   
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                  138   4e-34   
ref|NP_001190517.1|  MADS-box transcription factor AGL71                137   4e-34   
ref|NP_001289808.1|  MADS-box transcription factor 50-like              138   4e-34   
gb|AHM92065.1|  MADS-box protein 5                                      137   4e-34   
ref|XP_010320555.1|  PREDICTED: MADS-box transcription factor iso...    137   5e-34   
gb|EPS68880.1|  hypothetical protein M569_05892                         136   6e-34   
dbj|BAG48497.1|  TM3-like MADS-box transcription factor                 137   8e-34   
gb|AAT37479.1|  MADS16 protein                                          137   8e-34   
ref|NP_001234670.1|  MADS-box transcription factor                      137   8e-34   
ref|NP_001056891.1|  Os06g0162800                                       137   8e-34   
ref|XP_010444025.1|  PREDICTED: MADS-box protein SOC1-like              136   8e-34   
dbj|BAD93165.1|  MADS-box transcription factor GbMADS1                  137   9e-34   
ref|XP_004490239.1|  PREDICTED: MADS-box protein CMB1-like isofor...    137   9e-34   
gb|AAT37478.1|  MADS15 protein                                          136   1e-33   
gb|AAK21254.1|AF335241_1  MADS-box transcription factor FBP23           137   1e-33   
ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like              137   1e-33   
ref|XP_010444014.1|  PREDICTED: MADS-box protein SOC1 isoform X2        135   1e-33   
ref|NP_199999.1|  MADS-box transcription factor AGL72                   135   1e-33   
ref|XP_004490237.1|  PREDICTED: MADS-box protein CMB1-like isofor...    136   1e-33   
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       136   2e-33   
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2        135   2e-33   
ref|NP_001234837.1|  MADS-box transcription factor                      136   2e-33   
ref|XP_006655819.1|  PREDICTED: MADS-box transcription factor 5-like    135   2e-33   
ref|XP_006363565.1|  PREDICTED: MADS-box protein CMB1-like              136   2e-33   
gb|ADA72021.1|  MADS2 protein                                           135   3e-33   
ref|XP_004237061.1|  PREDICTED: MADS-box protein CMB1 isoform X1        135   3e-33   
emb|CDY68754.1|  BnaAnng28250D                                          134   3e-33   
gb|KDP41334.1|  hypothetical protein JCGZ_15741                         135   3e-33   
gb|KHN15201.1|  MADS-box protein CMB1                                   135   3e-33   
gb|ADE75954.1|  unknown                                                 135   3e-33   
dbj|BAD77881.1|  MADS-box transcription factor                          134   3e-33   
gb|AFX72877.1|  MADS-box protein SEP2A                                  135   4e-33   
ref|XP_009415674.1|  PREDICTED: MADS-box protein CMB1-like              134   4e-33   
ref|XP_009132580.1|  PREDICTED: MADS-box protein SOC1-like isofor...    135   4e-33   
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g             135   4e-33   
ref|XP_009132581.1|  PREDICTED: MADS-box protein SOC1-like isofor...    134   4e-33   
ref|XP_004490238.1|  PREDICTED: MADS-box protein CMB1-like isofor...    135   4e-33   
emb|CAC81072.1|  MADS box transcription factor                          135   4e-33   
ref|XP_010442695.1|  PREDICTED: MADS-box protein SOC1-like              134   4e-33   



>ref|XP_006358849.1| PREDICTED: agamous-like MADS-box protein AGL19-like [Solanum 
tuberosum]
Length=224

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 162/211 (77%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQY--KKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+ KTI+RY  N K+LG+   K + + + +H+KE+ VA M++++E LE SKRKLLG GL
Sbjct  60    SSTTKTIERYQKNDKSLGRLNRKLTDQLTTEHLKEE-VATMTRKLEFLEDSKRKLLGHGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE-  546
             +S ++D+L Q++EQL  SL NIR RK+LL K+QI +L+E+EKIL ++NA+L+KR  V   
Sbjct  119   ESSTLDELQQVEEQLEKSLSNIRARKNLLFKEQIAQLKEEEKILLKKNADLRKRCEVLPL  178

Query  545   -----PQ------RLYTDVETRLFIGQPETR  486
                  PQ      R   +VET LFIG+PETR
Sbjct  179   TLTPFPQVEKDVERQIMEVETELFIGRPETR  209



>ref|XP_011071972.1| PREDICTED: agamous-like MADS-box protein AGL19 [Sesamum indicum]
Length=210

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 155/208 (75%), Gaps = 13/208 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKL+EFSS+
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPKGKLHEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S  N TI+RY  N K L   + S E +LQ +KE+  A + K++E+LE SKRKLLGE LDS
Sbjct  61    SMINNTIERYRKNTKTLAFGRNSVEENLQLLKEE-TATLYKKIELLEDSKRKLLGENLDS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CS D+L ++++QL  SL NIR RK+LL K+QID+L+E+EK L +EN EL+K+  +  P +
Sbjct  120   CSTDELEEVEKQLERSLSNIRARKNLLFKEQIDQLKEQEKNLTKENIELRKKSEML-PLK  178

Query  536   LYT-----------DVETRLFIGQPETR  486
             L T           +VET LFIG PE R
Sbjct  179   LSTLPKVQLLPQLMEVETALFIGLPEPR  206



>ref|XP_011081162.1| PREDICTED: MADS-box protein SOC1 [Sesamum indicum]
Length=212

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 12/212 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP G+LYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPKGRLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S  NKTI+RY+ N KNL   +K+ E + QH+K D  A + K +E+LE SKR+LLGE LDS
Sbjct  61    SVINKTIERYLANVKNLAIGRKTMEENTQHLK-DETAELRKTIELLEDSKRRLLGESLDS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR--------  561
             CS+++L Q+++ L  SL NIR RK+ L  +QID+L+E+EK L +EN  L+K+        
Sbjct  120   CSVEELEQVEQLLERSLNNIRARKNTLFHEQIDQLKEQEKKLMQENTRLRKKFEMLPLQL  179

Query  560   ---LAVSEPQRLYTDVETRLFIGQPETRPPAG  474
                L    P     +VET LFIG P T    G
Sbjct  180   SVNLPTVRPPAQAMEVETALFIGPPSTTTNGG  211



>ref|XP_009772098.1| PREDICTED: agamous-like MADS-box protein AGL19 [Nicotiana sylvestris]
Length=211

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 160/208 (77%), Gaps = 15/208 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR G+LKKAFELSVLCDAE+ LIVFSP G+LYEFSS 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRSGILKKAFELSVLCDAEVALIVFSPKGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSET-SLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS+NKTI+RY  N + LG  +K +E  + +H+KE+ VA M++++E+LE SKRKLLG+GLD
Sbjct  60    SSTNKTIERYQKNDRYLGPNRKIAEIQTTEHLKEE-VATMTRKLELLEDSKRKLLGQGLD  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV----  552
             S S D+L Q++EQL  SL  IR RK+LL ++QI  L+E+EKIL ++NA+L+KR+ V    
Sbjct  119   SSSFDELQQVEEQLERSLSCIRARKNLLLREQIAHLKEEEKILMKQNADLRKRIEVVPLP  178

Query  551   --------SEPQRLYTDVETRLFIGQPE  492
                      +PQR   ++ET LFIG P+
Sbjct  179   LKIDSREEEDPQRQTMELETELFIGLPQ  206



>ref|XP_004245665.1| PREDICTED: agamous-like MADS-box protein AGL19 [Solanum lycopersicum]
Length=224

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 160/211 (76%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQY--KKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+NKTI+RY  N K+LG+   K + + + +H+KE+ VA M++++E LE SKRKLLG GL
Sbjct  60    SSTNKTIERYQKNEKSLGRLNRKLTDQLTTEHLKEE-VATMTRKLEFLEDSKRKLLGHGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV---  552
             +S + D+L +++EQL  SL NIR RK+LL K+QI +L+E+EKIL +EN +LKK+  V   
Sbjct  119   ESSTFDELQKVEEQLEKSLSNIRARKNLLFKEQIAQLKEEEKILLKENVDLKKKCQVLPL  178

Query  551   ---------SEPQRLYTDVETRLFIGQPETR  486
                       + +R   +VET LFIG PETR
Sbjct  179   TLTPVPLVEKDVERQIMEVETELFIGLPETR  209



>ref|XP_009626499.1| PREDICTED: MADS-box protein SOC1-like [Nicotiana tomentosiformis]
Length=210

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 144/207 (70%), Gaps = 14/207 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++L+VFS  GKLYEFSS 
Sbjct  1     MVRGKTQIKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLMVFSQKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS+NKTI+RY  N KNL   K   E + +H+KED VA MS+++E+LE SKR++LGE LDS
Sbjct  60    SSTNKTIERYQKNDKNLRHDKILLEQTTEHLKED-VATMSRKLELLENSKRRILGEDLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI------------DRlrekekileeenae  573
             CSID+L +++EQL  SLRNIR RK+ L ++ I            +    +++        
Sbjct  119   CSIDELEKVEEQLDRSLRNIRARKNQLLREHIALLKDEEKVLMEENAELRKENEVRPLPL  178

Query  572   lkKRLAVSEPQRLYTDVETRLFIGQPE  492
                R      QR   DVET+LFIG PE
Sbjct  179   FTDRQQEEHLQRETVDVETQLFIGPPE  205



>gb|ABX90015.1| SOC1-like protein 2 [Sinningia speciosa]
Length=210

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 161/209 (77%), Gaps = 12/209 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSPTGKLYEFSS+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPTGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S  NKTI+RY +N+K L   +K+ E ++QH+K++ V  +SK++E+L++ +RKLLGEGLD+
Sbjct  61    SVINKTIERYQSNSKALVIGRKTKE-NVQHLKDETV-ELSKKIELLQELQRKLLGEGLDT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CS+D+L QI++QL  SL NIR +K+LL KQQID LR++EK L +EN EL+K+  +  P +
Sbjct  119   CSLDELGQIEQQLEQSLSNIRVKKNLLYKQQIDLLRDQEKALMKENTELRKKCEML-PAQ  177

Query  536   L---------YTDVETRLFIGQPETRPPA  477
             L           DVET LFIG      P+
Sbjct  178   LSILPKGKVQPVDVETALFIGLGPVYTPS  206



>ref|XP_010053874.1| PREDICTED: MADS-box protein SOC1 [Eucalyptus grandis]
Length=217

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 155/211 (73%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT ++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTLMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS N+TI+RY  + K+     KS E ++QH+K D  A M K++E+LE S+RKLLGEGL S
Sbjct  60    SSMNETIERYHRHTKDTRTGNKSVEENMQHLK-DEAANMMKKIELLEDSRRKLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S+ +IR RK+ + K+QID+L+EKEK+L  ENA L ++  +  PQR
Sbjct  119   CSIEELQQIEQQLERSVISIRARKTQVFKEQIDKLKEKEKMLTAENAILTEKCGIKPPQR  178

Query  536   LY--------------TDVETRLFIGQPETR  486
                             ++VET LFIG PETR
Sbjct  179   ANECRDSPLLRESSPSSEVETGLFIGPPETR  209



>ref|XP_009777755.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X2 [Nicotiana 
sylvestris]
Length=199

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLG--QYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+NKTI+RY  N K LG  + K +   + +H+KE+ +A M++++E LE SKRKLLGEGL
Sbjct  60    SSTNKTIERYKKNDKYLGLNRSKIADIQTTEHLKEE-IATMTRKLEFLEDSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
             DS S D+L Q++EQL  SL  IR RK+LL ++QI  L+E+EK L ++NA+LKKR    + 
Sbjct  119   DSSSYDELQQVEEQLERSLSCIRARKNLLFREQIAHLKEEEKFLMKQNADLKKR-EKEDT  177

Query  542   QRLYTDVETRLFIGQPE  492
             +R   +VET LFIG P+
Sbjct  178   ERQTMEVETELFIGLPQ  194



>ref|XP_002304455.1| hypothetical protein POPTR_0003s11960g [Populus trichocarpa]
 gb|EEE79434.1| hypothetical protein POPTR_0003s11960g [Populus trichocarpa]
Length=212

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 154/209 (74%), Gaps = 14/209 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFS  GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS N+TI+RY   AK++G   K  + ++Q VKED    ++K++E+LE SKRKLLGEGL++
Sbjct  60    SSINRTIERYQKRAKDVGISSKMVQDNIQPVKED-TFTLAKKIELLEVSKRKLLGEGLET  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP--  543
             CS DDL Q++ QL  SL  IR RK+ L +++I++L+ +EKIL EEN  L+++  + +P  
Sbjct  119   CSTDDLQQLENQLGRSLTRIRARKNQLFRERIEKLKGEEKILLEENTRLREKCGMQQPDL  178

Query  542   ----------QRLYTDVETRLFIGQPETR  486
                        R  T+VET LFIG PETR
Sbjct  179   SSTRKQQLLEDRQITEVETELFIGPPETR  207



>ref|XP_011029143.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
 ref|XP_011029144.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
 ref|XP_011029145.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
Length=217

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 157/216 (73%), Gaps = 14/216 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFS  GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS N+TI+RY   AK++G   K  + ++Q VKED    ++K++E+LE SKRKLLG+GL+ 
Sbjct  60    SSMNRTIERYQKRAKDVGTSGKMVKDNMQPVKEDAF-TLAKKIELLEVSKRKLLGDGLEP  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR--------  561
             CSID+L Q++ QL  SL  IR RK+ L ++QI++L+ +EKIL EEN +L+++        
Sbjct  119   CSIDELQQLENQLERSLTRIRARKNQLFREQIEKLKGEEKILMEENTKLREKCGMQPLDL  178

Query  560   LAVSEPQ----RLYTDVETRLFIGQPETRPPAGDHN  465
             LA   PQ    R   +VET LFIG P++R  A   N
Sbjct  179   LATKTPQILQDRQIIEVETELFIGPPDSRDTACPQN  214



>ref|XP_009777750.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X1 [Nicotiana 
sylvestris]
Length=212

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 156/209 (75%), Gaps = 16/209 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLG--QYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+NKTI+RY  N K LG  + K +   + +H+KE+ +A M++++E LE SKRKLLGEGL
Sbjct  60    SSTNKTIERYKKNDKYLGLNRSKIADIQTTEHLKEE-IATMTRKLEFLEDSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR------  561
             DS S D+L Q++EQL  SL  IR RK+LL ++QI  L+E+EK L ++NA+LKKR      
Sbjct  119   DSSSYDELQQVEEQLERSLSCIRARKNLLFREQIAHLKEEEKFLMKQNADLKKRCEVLPQ  178

Query  560   LAVSEPQ------RLYTDVETRLFIGQPE  492
             L  + PQ      R   +VET LFIG P+
Sbjct  179   LMTTVPQEKEDTERQTMEVETELFIGLPQ  207



>ref|XP_009802625.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Nicotiana sylvestris]
Length=194

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++L+VFS  GKLYEFSS 
Sbjct  1     MVRGKTQIKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLMVFSQKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS+NKTI+RY  N KNL   K   E + +H+KE+ VA MS+++E+LE SKR++LGE LDS
Sbjct  60    SSTNKTIERYQKNDKNLRHEKILLEQTTEHLKEE-VATMSRKLELLENSKRRILGEDLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CSID+L +++EQL  SLRNIR RK+ L ++QI
Sbjct  119   CSIDELEKVEEQLERSLRNIRARKNQLFREQI  150



>ref|XP_009802617.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802618.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802619.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802620.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802621.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802622.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802623.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009802624.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana sylvestris]
Length=202

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++L+VFS  GKLYEFSS 
Sbjct  1     MVRGKTQIKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLMVFSQKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS+NKTI+RY  N KNL   K   E + +H+KE+ VA MS+++E+LE SKR++LGE LDS
Sbjct  60    SSTNKTIERYQKNDKNLRHEKILLEQTTEHLKEE-VATMSRKLELLENSKRRILGEDLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CSID+L +++EQL  SLRNIR RK+ L ++QI
Sbjct  119   CSIDELEKVEEQLERSLRNIRARKNQLFREQI  150



>ref|XP_009607136.1| PREDICTED: agamous-like MADS-box protein AGL19 [Nicotiana tomentosiformis]
Length=212

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 155/209 (74%), Gaps = 16/209 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQ--YKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+NKTI+RY  N K LG    K +   + +H+KE+ VA M++++E LE SKRKLLG+GL
Sbjct  60    SSTNKTIERYQKNDKYLGLNISKIADIQTTEHLKEE-VATMTRKLEFLEDSKRKLLGQGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV---  552
             DS S D+L Q++EQL  SL  IR RK+LL ++QI  L+E+EKIL ++NA+L+KR+ V   
Sbjct  119   DSSSFDELQQVEEQLERSLSCIRARKNLLLREQIAHLKEEEKILMKQNADLRKRIEVLPL  178

Query  551   ---------SEPQRLYTDVETRLFIGQPE  492
                       + QR   +VET L IG P+
Sbjct  179   SLTIVPREEEDSQRQTMEVETELSIGLPQ  207



>ref|XP_006477355.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X5 
[Citrus sinensis]
 ref|XP_006477356.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X6 
[Citrus sinensis]
Length=202

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 7/202 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S NKTI+RY    K++G   K  E   QH KE     M+K +E LE +KRKLLG+GL+ 
Sbjct  61    -SINKTIERYQKKTKDIGINSKIVEDHSQHAKEQTSNMMTK-LEFLEVAKRKLLGDGLEP  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             C+ID+L Q++ QL  SL  IR RK+ L ++QI++L+EKEKIL EEN +L+++  +     
Sbjct  119   CTIDELQQLENQLERSLSRIRARKNQLFREQIEKLKEKEKILIEENTKLREQCGMQPRQA  178

Query  551   SEPQRLYTDVETRLFIGQPETR  486
             SE Q +Y DVET+L IG PE R
Sbjct  179   SEEQEVYMDVETQLSIGPPERR  200



>gb|ABF51526.1| MADS box transcription factor [Populus tomentosa]
Length=217

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 156/216 (72%), Gaps = 14/216 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELS+LCDAE+ LIVFS  GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSILCDAEVALIVFSTRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS N+TI+RY   AK++G   +  + ++Q VKED    ++K++++LE SKRKLLG+GL+ 
Sbjct  60    SSMNRTIERYQKRAKDVGISSRMVKDNMQPVKEDAF-TLAKKIDILEVSKRKLLGDGLEQ  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSIDDL Q++ QL  SL  IR RK+ L ++QI++L+ +EKIL EEN +L+++        
Sbjct  119   CSIDDLQQLENQLERSLTRIRARKNQLFREQIEKLKGEEKILMEENTKLREKCGMQPLDL  178

Query  557   -AVSEPQ----RLYTDVETRLFIGQPETRPPAGDHN  465
              A   PQ    R   +VET LFIG P++R  A   N
Sbjct  179   QATKTPQILQDRQIIEVETELFIGPPDSRDTACPQN  214



>emb|CDP17592.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 160/212 (75%), Gaps = 20/212 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRRRGLLKKAFELSVLCDAE+ LI+FSP+GKLYEFSS+
Sbjct  1     MVRGKTQIKRIENAASRQVTFSKRRRGLLKKAFELSVLCDAEVALIIFSPSGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVK--EDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S+++ TI+RY  N +NL     S + +LQH +  E+ VA + K++E+LE++KRKLLG+GL
Sbjct  61    SATS-TIERYQKNIRNLC---PSEKMALQHSQNFEEEVAILRKKLEILEETKRKLLGDGL  116

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS-E  546
             D+ S D+L QI+ QL  SL  IR RKSLL  +QID L+E+EKIL +ENAEL++++ +  E
Sbjct  117   DTSSFDELQQIEGQLERSLNIIRSRKSLLFWEQIDHLKEEEKILRKENAELREKVHLQYE  176

Query  545   PQRL-------------YTDVETRLFIGQPET  489
              QRL               ++ETRLFIG PE+
Sbjct  177   QQRLGQSISRQPLSLRQVKEIETRLFIGLPES  208



>ref|XP_002275695.2| PREDICTED: agamous-like MADS-box protein AGL19 [Vitis vinifera]
Length=214

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 11/207 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GK++EFSS 
Sbjct  1     MVRGKTQMKRIENAASRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKVFEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKTI+RY + AK LG  K+ +  + QH  E     ++K++E+LE SKR+LLGE LDS
Sbjct  60    SSINKTIERYQSKAKGLGISKRGAPENEQHHLEGETVDLAKKIELLEVSKRRLLGECLDS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CSI++L QI+ +L  SL NIR +K+ LCK  I+RL+E+E+IL EENA+L+ +  +     
Sbjct  120   CSIEELQQIENELEQSLSNIRIQKNHLCKGHIERLKEQERILGEENAKLRGKCGLQPLQP  179

Query  551   -----SEPQRLYTDVETRLFIGQPETR  486
                  S P    ++VET LFIG PE R
Sbjct  180   STKHQSVPYVEISEVETELFIGPPERR  206



>gb|AHW58028.1| TM3-2 [Coffea arabica]
Length=212

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 160/212 (75%), Gaps = 20/212 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRRRGLLKKAFELSVLCDAE+ LI+FSP+GKLYEFSS+
Sbjct  1     MVRGKTQIKRIENAASRQVTFSKRRRGLLKKAFELSVLCDAEVALIIFSPSGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVK--EDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S+++ TI+RY  N +NL     S + +LQH +  E+ VA + K++E+LE++KRKLLG+GL
Sbjct  61    SATS-TIERYQKNIRNLC---PSEKMALQHSQNFEEEVAILRKKLEILEETKRKLLGDGL  116

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS-E  546
             D+ S D+L QI+ QL  SL  IR RKSLL  +QID L+E+EKIL +ENAEL++++ +  E
Sbjct  117   DTSSFDELQQIEGQLERSLNIIRSRKSLLFWEQIDHLKEEEKILRKENAELREKMNLQYE  176

Query  545   PQRL-------------YTDVETRLFIGQPET  489
              QRL               ++ETRLFIG PE+
Sbjct  177   QQRLGPSISRQPLSLRQVKEIETRLFIGLPES  208



>gb|ADU56825.1| MADS-box protein TM3 subfamily [Coffea arabica]
Length=206

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 147/210 (70%), Gaps = 20/210 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRRRGLLKKAFELSVLCDAE+ LI+FSP+GKLYEFSS+
Sbjct  1     MVRGKTQIKRIENAASRQVTFSKRRRGLLKKAFELSVLCDAEVALIIFSPSGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVK--EDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S+++ TI+RY  N +NL     S + +LQH +  E+ VA + K++E+LE++KRKLLG+GL
Sbjct  61    SATS-TIERYQKNIRNLC---PSEKMALQHSQNFEEEVAILRKKLEILEETKRKLLGDGL  116

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQID---------Rlrekekileeenael  570
             D+ S D+L QI+ QL  SL  IR RKSLL  +QID         R    E   +      
Sbjct  117   DTSSFDELQQIEGQLERSLNIIRSRKSLLFWEQIDHLKEEEKILRKENAELREKMNLQYE  176

Query  569   kKRLAVS---EPQRLYT--DVETRLFIGQP  495
             ++RL  S   +P  L T  ++ETRLFIG P
Sbjct  177   QQRLGPSISRQPLSLETVKEIETRLFIGLP  206



>ref|XP_010272601.1| PREDICTED: MADS-box protein SOC1-like [Nelumbo nucifera]
Length=217

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 161/220 (73%), Gaps = 20/220 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKTI+RY   +K++ Q  ++ E S+QH+K +  A M+K++E+LE SKRKLLGE L S
Sbjct  60    SSMNKTIERYQRYSKDV-QVDRTIEQSMQHLKYEA-ANMAKKIELLEVSKRKLLGENLGS  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA---VSE  546
             CS+++L QI+ QL  SL  IR RK+ L ++QI+ L+EKE++L+EENA L+K+     +  
Sbjct  118   CSLEELQQIENQLERSLTTIRARKTQLFREQIEDLKEKERLLDEENAVLRKKCGGQKMEH  177

Query  545   PQR-----LY------TDVETRLFIGQPE---TRPPAGDH  468
             P       L+       DVET LFIG+PE   TR P  D+
Sbjct  178   PNHHRQTELFGQSNQNADVETELFIGRPERANTRYPLQDY  217



>gb|ACZ36915.1| MADS-box transcription factor 2 [Hevea brasiliensis]
Length=217

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 155/217 (71%), Gaps = 20/217 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF++ 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K+    +K S+ +++ +K +  A M K++E+LE SKRKLLGEGLDS
Sbjct  60    SSMQETIERYRRHVKDNQIDEKKSDENMELLKTEA-ANMVKKIELLEISKRKLLGEGLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS----  549
             C++++L QI++QL  S+ +IR RK+ + K+QI+RL+EKE  L  ENA L ++  V     
Sbjct  119   CTVEELQQIEQQLERSVSSIRARKNQVFKEQIERLKEKESQLAAENARLSEKCGVQPWEG  178

Query  548   ----------EPQRLYTDVETRLFIGQPETR----PP  480
                       E   L +DVET LFIG PETR    PP
Sbjct  179   LKVVGETRYCEESSLVSDVETELFIGLPETRTKGHPP  215



>gb|AEF32132.1| MADS-box protein, partial [Betula platyphylla]
Length=175

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTQIKRIENAASRQVAFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KTI+RY    K+LG   KS ET +QHVKED  ++++K++E+L+ SKRKLLG+GL+ 
Sbjct  61    SIS-KTIERYQKRGKDLGLGSKSQET-MQHVKED-ASSLAKKIELLDASKRKLLGDGLEV  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSID+L Q++ QL  SL  IRE+KS L  + I++
Sbjct  118   CSIDELQQVENQLERSLIKIREKKSQLYGEHIEQ  151



>ref|XP_006829116.1| hypothetical protein AMTR_s00001p00266470 [Amborella trichopoda]
 gb|ERM96532.1| hypothetical protein AMTR_s00001p00266470 [Amborella trichopoda]
Length=223

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 152/210 (72%), Gaps = 16/210 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKL+EFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLHEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI+RY   +K +G   K  E S+QH K +  A M+K++E+LE SKRKLLGE LDS
Sbjct  60    SNMQKTIERYQRYSKEVGMNGKILEQSMQHWKYEA-ATMAKKIELLEFSKRKLLGESLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE-PQ  540
             CS+++L  I+ QL  SL +IR RK+ +  +QI++L+EKEK+L  ENA L ++  + + P 
Sbjct  119   CSVEELQHIESQLERSLSSIRGRKTAMLMEQIEKLKEKEKVLSAENAMLSEKCGIPQTPL  178

Query  539   R-------------LYTDVETRLFIGQPET  489
             R              + DVET L+IG+PE+
Sbjct  179   RDNRKSTVSYITSSEHVDVETDLYIGRPES  208



>dbj|BAK18785.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=215

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 156/214 (73%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKL+EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLFEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK      K  SSE ++QH+K+   + M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQGTIERYQKHAKGNQTSNKSSSSEQNMQHLKQKATSMM-KQLELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
             +SC++ +L +I+ QL  S+ N+R RKS + K+QI++LREKEK+L+ E A L ++    +P
Sbjct  119   ESCTLAELQEIEHQLEKSVNNVRARKSQVFKEQIEQLREKEKLLKAETARLVEKCGSFQP  178

Query  542   Q---------RLYT------DVETRLFIGQPETR  486
             +         R YT      DVET LFIG PE+R
Sbjct  179   RKTLDERRENRTYTDSSTSSDVETELFIGPPESR  212



>gb|EYU32030.1| hypothetical protein MIMGU_mgv1a013555mg [Erythranthe guttata]
Length=217

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 145/212 (68%), Gaps = 17/212 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS + TI RY    K +  +K   E ++Q +K +  A M K++E LE SKRKLLGEGL +
Sbjct  60    SSMHDTIDRYQKYTKEIQAHKPPEEHNMQQLKHEA-ACMMKKIEQLEASKRKLLGEGLGA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C+ ++L QI++QL  S+  IR RK  + KQQI++L+EK K L  ENA L  +  + + QR
Sbjct  119   CTFEELQQIEQQLERSVGTIRARKMQVYKQQIEQLKEKGKALAAENAMLCDKFGLQKQQR  178

Query  536   ---------------LYTDVETRLFIGQPETR  486
                              +DVET LFIG PETR
Sbjct  179   GSNEERAIVPSTEISEVSDVETELFIGPPETR  210



>dbj|BAJ53133.1| JHL05D22.4 [Jatropha curcas]
 gb|KDP28711.1| hypothetical protein JCGZ_14482 [Jatropha curcas]
Length=218

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 153/212 (72%), Gaps = 17/212 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+R+  + K+    KK ++ ++QH+K +  A+M K++E LE +KRKLLGEGL  
Sbjct  60    SSMQGTIERFRKHVKDTQVTKKITDENMQHLKTEA-ASMVKKIEHLETAKRKLLGEGLGL  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             C++++L QI++QL  S+ +IR RK+ + K+QI+RL+EKE++L  ENA L ++  +     
Sbjct  119   CTLEELQQIEQQLGRSVSSIRARKNQVFKEQIERLQEKERLLAAENARLSEKCGIQPLQG  178

Query  551   ----------SEPQRLYTDVETRLFIGQPETR  486
                       SE     +DVET LFIG PETR
Sbjct  179   FKQLGEQNMPSEESSPVSDVETELFIGLPETR  210



>gb|AHI85950.1| SOC1 [Carya cathayensis]
Length=217

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 150/219 (68%), Gaps = 20/219 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP  KLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRSKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI RY  + K+     KS E ++QH++ +  A M K++E+LE SKRKLLGE L +
Sbjct  60    SSMQETIDRYRRHTKDAQPINKSVEQNMQHLRHES-ANMVKKIELLEVSKRKLLGESLGA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS----  549
             CS+D+LH+I++QL  S+  IR RK+ + K+QID+L++KEK L  ENA L ++  +     
Sbjct  119   CSLDELHKIEQQLESSVIKIRARKTQVFKEQIDKLKDKEKALVAENARLCEKCGIQLQQG  178

Query  548   ----------EPQRLYTDVETRLFIGQPETR----PPAG  474
                       E     +DVET LFIG PE R    PP  
Sbjct  179   ANEHREISPYEESNPSSDVETELFIGPPERRTKRLPPPN  217



>ref|XP_010255589.1| PREDICTED: MADS-box protein SOC1 [Nelumbo nucifera]
 ref|XP_010255590.1| PREDICTED: MADS-box protein SOC1 [Nelumbo nucifera]
Length=224

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 155/209 (74%), Gaps = 17/209 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKTI+RY   AK+  Q  K+ E ++QH+K +  A M+K++E+LE SKRKLLGE L S
Sbjct  60    SSMNKTIERYQRYAKD-AQSNKTIEQNMQHLKHEA-ANMAKKIELLEASKRKLLGENLGS  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA---VSE  546
              S ++L QI+ QL  SL +IR RK+ L ++QI  L+EKEKIL EENA L+++ A   +  
Sbjct  118   SSPEELQQIENQLERSLVSIRARKTQLFREQIANLKEKEKILTEENAILREKCAPQHMEH  177

Query  545   PQR-----LY------TDVETRLFIGQPE  492
             P +     LY      +DVET LFIG+PE
Sbjct  178   PTQNREIDLYGQSSQNSDVETELFIGRPE  206



>ref|XP_011033831.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
 ref|XP_011033832.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
 ref|XP_011033833.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
 ref|XP_011033834.1| PREDICTED: agamous-like MADS-box protein AGL19 [Populus euphratica]
Length=212

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 152/209 (73%), Gaps = 14/209 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFS  GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS N+TI+RY   AK++G   K  + +++ VKED    ++K++E+LE SKRK+LGEGL++
Sbjct  60    SSINRTIERYQKRAKDVGISSKMVQDNIEPVKEDTF-TLAKKIELLEVSKRKILGEGLET  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE---  546
             CS D+L Q++ QL   L  IR RK+ L ++++++L+ +EKI+ EEN  L+++  + +   
Sbjct  119   CSTDELQQLENQLERGLTRIRARKNQLFRERVEKLKAEEKIMLEENRRLREKCGMQQLDL  178

Query  545   ---------PQRLYTDVETRLFIGQPETR  486
                        R  T+VET LFIG PETR
Sbjct  179   SSTRKQQLLEDRQITEVETELFIGPPETR  207



>ref|XP_010523711.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
 ref|XP_010523712.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
Length=213

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 150/210 (71%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             ++  +TIQRY+ + K+    K  SE ++QH+K +  A M +++E LE +KRKLLGEG+ S
Sbjct  60    ANMQETIQRYLRHTKDRISNKPPSEENMQHLKHEA-ANMMRKIEQLETAKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE---  546
              SI++L QI++QL  S++ IR RK+ + K+QI++LR+KEK L  EN  L K+  V E   
Sbjct  119   SSIEELQQIEQQLEKSVKTIRARKTQVFKEQIEQLRQKEKALAAENERLSKKWEVEEGQA  178

Query  545   -----PQ--------RLYTDVETRLFIGQP  495
                  PQ           +DVET LFIG P
Sbjct  179   GLDKQPQITARAEESSPNSDVETELFIGLP  208



>ref|XP_010934920.1| PREDICTED: MADS-box transcription factor 50-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010934921.1| PREDICTED: MADS-box transcription factor 50-like isoform X1 [Elaeis 
guineensis]
Length=207

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY+ +AK++   KKS E + Q +K D  A++ K++E LE SKRKLLGE L+S
Sbjct  60    SSMEKTIDRYIMHAKDVNINKKSREHNAQQLKSDA-ASLMKKIERLEASKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlreke---kileeenaelkKRLAVSE  546
             C+I++LH ++ QL  SL +IR RK  + ++QI RL+EKE       +E    + RL +  
Sbjct  119   CAIEELHDLELQLEQSLSSIRNRKYQMLEEQICRLKEKEKILTASIQEKLNAEPRLQLCA  178

Query  545   P------QRLYTDVETRLFIGQPET  489
             P          TDVET L IG+P T
Sbjct  179   PAVSDDYDSQNTDVETELVIGRPGT  203



>gb|KDP25539.1| hypothetical protein JCGZ_20695 [Jatropha curcas]
Length=212

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 153/210 (73%), Gaps = 16/210 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP G+LYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGRLYEFSSC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S NKTI+RY     +LG   K+ + ++Q++KED + ++ K++E LE SKRK+LG+GL+ 
Sbjct  61    -SMNKTIERYQKKVIDLGISIKAVQENMQNIKEDTL-SLGKKIEHLEVSKRKMLGDGLEP  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C ID+L Q++ QL  SL  IR RK  L +++I++LRE+EKIL EEN  L+++  + +P  
Sbjct  119   CPIDELQQLENQLERSLTRIRARKGQLFRERIEKLREEEKILLEENTSLREKCGM-QPME  177

Query  536   LYT-------------DVETRLFIGQPETR  486
             L T             +VET LFIG PETR
Sbjct  178   LSTKKQQIQVADRESMEVETALFIGPPETR  207



>ref|XP_010053361.1| PREDICTED: agamous-like MADS-box protein AGL19 [Eucalyptus grandis]
 gb|KCW77636.1| hypothetical protein EUGRSUZ_D01939 [Eucalyptus grandis]
Length=205

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 146/207 (71%), Gaps = 17/207 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTQMKRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KTI++Y   AK++G   K++E S+QH K D +  M K++E  E S+R+LLGEGLDS
Sbjct  61    SLS-KTIEKYQKRAKDMGA--KTAEISMQHSKGDTL-DMEKKIEHFEISRRRLLGEGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CS+++L Q + QL  SL  IR RK+ L ++ I+RL+ +E+ L EE  +L + +       
Sbjct  117   CSVEELQQTENQLERSLTKIRARKNHLIREHIERLKAEERKLLEEKRKLLQEIECGKGLT  176

Query  551   ---SEPQR-----LYTDVETRLFIGQP  495
                SEP R        DVET LFIG P
Sbjct  177   PVSSEPPREEIRAESMDVETELFIGPP  203



>ref|XP_008232833.1| PREDICTED: MADS-box protein SOC1 [Prunus mume]
 ref|XP_008232835.1| PREDICTED: MADS-box protein SOC1 [Prunus mume]
Length=214

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 156/214 (73%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKK-SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  + K NL   K  S++ ++QH+K++  ++M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHTKDNLTNNKSVSTDQNMQHLKQES-SSMMKQIELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SCSI++L +I++QL  S+ N+R RK+ + K+QI++LREK K L  EN +L ++    +P
Sbjct  119   GSCSIEELQEIEQQLERSVSNVRARKTQVFKEQIEQLREKGKALAAENEKLIEKCGRIQP  178

Query  542   QR---------LYT------DVETRLFIGQPETR  486
             ++          YT      DVET LFIG PE R
Sbjct  179   RQASNEQRENLAYTESSPSSDVETELFIGLPERR  212



>ref|XP_006477351.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X1 
[Citrus sinensis]
 ref|XP_006477352.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X2 
[Citrus sinensis]
 ref|XP_006477353.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X3 
[Citrus sinensis]
 ref|XP_006477354.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X4 
[Citrus sinensis]
Length=210

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 150/210 (71%), Gaps = 15/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S NKTI+RY    K++G   K  E   QH KE     M+K +E LE +KRKLLG+GL+ 
Sbjct  61    -SINKTIERYQKKTKDIGINSKIVEDHSQHAKEQTSNMMTK-LEFLEVAKRKLLGDGLEP  118

Query  716   CSIDDLHQIQEQLVISLRNIRERK--------SLLCKQQIDRlrekekileeenaelkKR  561
             C+ID+L Q++ QL  SL  IR RK        + L ++QI++L+EKEKIL EEN +L+++
Sbjct  119   CTIDELQQLENQLERSLSRIRARKFRNLVFSQNQLFREQIEKLKEKEKILIEENTKLREQ  178

Query  560   LAV-----SEPQRLYTDVETRLFIGQPETR  486
               +     SE Q +Y DVET+L IG PE R
Sbjct  179   CGMQPRQASEEQEVYMDVETQLSIGPPERR  208



>gb|AEO20232.1| SOC1-like protein [Photinia serratifolia]
Length=213

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 146/224 (65%), Gaps = 41/224 (18%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKL+EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLFEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK+     K  SSE S+QH+K++  + M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQGTIERYQKHAKDNQTNNKSASSEQSMQHLKQEATSMM-KQIEILEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++ +L +I+ QL  S+ N+R RKS + K+QI++               K++L  +E 
Sbjct  119   GSCTLAELQEIEHQLEKSVYNVRARKSQVFKEQIEQ------------LREKEKLLTAEN  166

Query  542   QRLY-------------------------TDVETRLFIGQPETR  486
              RL                          +DVET LFIG PE+R
Sbjct  167   TRLVEKYGSFKKTLNERREKTPYNESSTSSDVETELFIGLPESR  210



>ref|XP_004252597.1| PREDICTED: MADS-box protein SOC1-like [Solanum lycopersicum]
 ref|XP_010314481.1| PREDICTED: MADS-box protein SOC1-like [Solanum lycopersicum]
 ref|XP_010314482.1| PREDICTED: MADS-box protein SOC1-like [Solanum lycopersicum]
Length=206

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 151/207 (73%), Gaps = 14/207 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRG TE+KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FS  GKL+EFSS 
Sbjct  1     MVRGITEMKRIENTTSRQVTFSKRRGGLLKKAFELSVLCDAEVSLIIFSQKGKLFEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS+NKTI+RY  N KNLG      E + +H+K + V +M++ +EVLE SKR+LLGE L+S
Sbjct  60    SSTNKTIERYQKNDKNLGHENILLEQTTEHLKGE-VMSMTRNLEVLEISKRRLLGEDLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CSID+L +++ QL  SLRNIR +K+ L K+QI  L+++EK+L  +NAEL+++        
Sbjct  119   CSIDELEKVEGQLDQSLRNIRAKKNQLFKEQISLLKDEEKVLMNKNAELREKYEARSLPL  178

Query  551   -------SEPQRLYTDVETRLFIGQPE  492
                      PQ    +V+T+LFIG PE
Sbjct  179   FIDRREDESPQTQNMEVDTQLFIGLPE  205



>ref|NP_001236377.1| SOC1 [Glycine max]
 ref|XP_006601712.1| PREDICTED: SOC1 isoform X1 [Glycine max]
 ref|XP_006601713.1| PREDICTED: SOC1 isoform X2 [Glycine max]
 gb|ABC75835.1| SOC1 [Glycine max]
 gb|KHN03168.1| MADS-box protein SOC1 [Glycine soja]
Length=209

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 144/208 (69%), Gaps = 16/208 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY  + ++     +S E ++QH+K++  A + K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQDTIERYRRHNRSAQTVNRSDEQNMQHLKQE-TANLMKKIELLEASKRKLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID------RlrekekileeenaelkKRLA  555
             CS+++L QI++QL  S+ N+R RK+ + K+QID      R    E     E   ++ + A
Sbjct  119   CSLEELQQIEQQLERSVSNVRARKNQVYKEQIDQLKEKERALYAENARLCEQYGIQPQPA  178

Query  554   VSEPQRLY--------TDVETRLFIGQP  495
               +P+ +         ++VET LFIG P
Sbjct  179   TKDPKEIQPYAESSPSSEVETELFIGLP  206



>ref|XP_010661478.1| PREDICTED: MADS-box protein isoform X1 [Vitis vinifera]
 gb|ABF56527.1| MADS-box protein [Vitis vinifera]
 emb|CBI38825.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 154/213 (72%), Gaps = 19/213 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GL KKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLFKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNL--GQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY  + K++    Y K++E ++QH+K +  A M+K++E+LE SKRKLLGEGL
Sbjct  60    SSMQETIERYQRHTKDVHTNNY-KTTEHNMQHLKHEA-ANMAKKIELLEISKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV---  552
              SCSI++L QI++QL  S+ +IR RK+ + K+QI++L+EKEK L  ENA L ++  V   
Sbjct  118   GSCSIEELQQIEQQLERSVSSIRARKNQVFKEQIEQLKEKEKALAAENAMLCEKCGVQPY  177

Query  551   -----------SEPQRLYTDVETRLFIGQPETR  486
                        S  +   +DV T LFIG PE R
Sbjct  178   QAPNQENETLPSAERSQNSDVSTDLFIGLPEGR  210



>gb|AHW58027.1| TM3-1 [Coffea arabica]
Length=203

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 156/207 (75%), Gaps = 15/207 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGKT+LKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MARGKTQLKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+++ TIQRY  N KNL   ++  +   QH +E+ VA + K++E+LE+++R+ LG+GLDS
Sbjct  61    SATS-TIQRYQKNIKNLCPSRRMEQA--QHFEEE-VAILRKKIEILEETRRRFLGDGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR--------  561
              S D+L QI+ +L  SL  IR RKSLL ++++D L+E+EKIL +ENAEL+ +        
Sbjct  117   SSGDELQQIENRLEKSLSIIRSRKSLLFRERMDHLKEEEKILRKENAELRGKYEEATNWN  176

Query  560   LAVSE---PQRLYTDVETRLFIGQPET  489
             L++S    P R   +VET+LFIG P++
Sbjct  177   LSISPQPLPLRQVKEVETQLFIGPPKS  203



>gb|AEO20229.1| SOC1-like protein [Prunus mume]
Length=214

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 155/214 (72%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKK-SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  + K NL   K  S++ ++QH+K++  ++M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHTKDNLTNNKSVSTDQNMQHLKQES-SSMMKQIELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SCSI++L +I++QL  S+ N+R RK+ + K+QI++LREK K L  EN +L ++    +P
Sbjct  119   GSCSIEELQEIEQQLERSVSNVRARKTQVFKEQIEQLREKGKALAAENEKLIEKCGRIQP  178

Query  542   QRL---------------YTDVETRLFIGQPETR  486
             ++                 +DVET LFIG PE R
Sbjct  179   RQASNEQRENLAFTESSPSSDVETELFIGLPERR  212



>emb|CDP09831.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 157/206 (76%), Gaps = 14/206 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MARGKTQMKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPKGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+++ TI+RY  N KNL   ++  +   QH +E+ VA + K++E+LE+++R+ LG+GLDS
Sbjct  61    SATS-TIERYQKNIKNLCPSRRMEQA--QHFEEE-VAILRKKIEILEETRRRFLGDGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR-------L  558
              S+D+L QI+ QL  SL  IR RKS L ++++D+L+E+EKIL +ENAEL+ +       L
Sbjct  117   SSVDELQQIENQLEKSLSIIRSRKSSLFRERMDQLKEEEKILRKENAELRGKYEEQQLEL  176

Query  557   AVSE---PQRLYTDVETRLFIGQPET  489
             ++S    P R   +VET+LFIG P++
Sbjct  177   SISPQPLPLRQVKEVETQLFIGPPKS  202



>ref|XP_003623807.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES80025.1| MADS-box transcription factor [Medicago truncatula]
 gb|AFK43010.1| unknown [Medicago truncatula]
Length=213

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S   TI+RY  N ++    ++S E ++Q++K +  A++ K++E+LE SKRKL+GEGL S
Sbjct  61    CSMQDTIERYRRNTRSAQPMQRSDEQNMQNLKHE-TASLMKKIELLEASKRKLMGEGLGS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+D+L QI++QL  S+  +R RK+   K QID+
Sbjct  120   CSLDELQQIEQQLEKSVSVVRARKNQAYKHQIDQ  153



>gb|ACO40488.1| SOC1 [Prunus armeniaca]
 gb|AGD88524.1| SOC1 [Prunus armeniaca]
Length=214

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 154/214 (72%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKK-SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  + K NL   K  S++ ++QH+K++  ++M K++E LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHTKDNLTNNKSVSTDQNMQHLKQES-SSMMKQIEFLEISKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SCSI++L +I++QL  S+ N+R RK+ + K+QI++LREK K L  EN  L ++    +P
Sbjct  119   GSCSIEELQEIEQQLERSVSNVRARKTQVFKEQIEQLREKGKALAAENERLIEKCGRIQP  178

Query  542   QR---------LYT------DVETRLFIGQPETR  486
             ++          YT      DVET LFIG PE R
Sbjct  179   RQASNEQRENLAYTESSPSSDVETELFIGLPERR  212



>gb|AGD88523.1| SOC1 [Prunus salicina]
Length=215

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 154/214 (72%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK+     K  S++ ++QH+K++  ++M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHAKDNHTNNKPVSTDQNMQHLKQES-SSMMKQIELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC+I++L +I++QL  S+ N+R RK+ + K+QI++L+EK K L  EN  L ++    +P
Sbjct  119   GSCTIEELQEIEQQLERSVSNVRARKTQVFKEQIEQLKEKGKALAAENERLIEKCGRIQP  178

Query  542   QRL---------------YTDVETRLFIGQPETR  486
             ++                 +DVET LFIG PE R
Sbjct  179   RQASNEQRENLAYIESSPSSDVETELFIGLPERR  212



>gb|KDO85931.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
Length=206

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ +I+FSP GKL EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY+ + K+    ++ +E ++QH+K +  A M K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQETIERYLKHTKDTRNKQQPTEQNMQHLKHEA-ANMVKKIELLEVSKRKLLGEGLAS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C++++L QI+ QL  S+ NIR RK+ +  +QI +L+EK  +   + ++ +     ++   
Sbjct  119   CTLEELQQIERQLEKSVSNIRARKNQVFNEQIAQLKEKCGMENWQGSKEQPENLTNDDGA  178

Query  536   LYTDVETRLFIGQPETR  486
               +DVET LFIG P  R
Sbjct  179   STSDVETELFIGPPPER  195



>ref|XP_007040082.1| AGAMOUS-like 14 [Theobroma cacao]
 gb|EOY24583.1| AGAMOUS-like 14 [Theobroma cacao]
Length=215

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 153/210 (73%), Gaps = 16/210 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSS-ETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS NKTI+RY    K+ G   K++ E ++ +VKED   +M+K++E+LE SKRKLLG GL+
Sbjct  60    SSMNKTIERYQKREKDYGICSKAALEENMPNVKEDA-HSMAKKIELLEDSKRKLLGNGLE  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
              CS +DL  ++ QL  SL  IR RK+ L  +QI++L+ +E+ L EENA+L+++  + +P+
Sbjct  119   PCSFNDLQLLESQLERSLSRIRARKNQLFWEQIEKLKGEERRLGEENAKLREQCGM-QPR  177

Query  539   RLYT------------DVETRLFIGQPETR  486
             +  T            +VET LFIG PE R
Sbjct  178   QSPTSQTDELHHVQSMEVETELFIGPPERR  207



>ref|XP_009133734.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Brassica rapa]
Length=222

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 152/216 (70%), Gaps = 18/216 (8%)
 Frame = -1

Query  1094  LVR*SEMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKL  915
             L++  EMVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKL
Sbjct  4     LIKEKEMVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKL  63

Query  914   YEFSSTSSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLL  735
             YEF+S++  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLL
Sbjct  64    YEFASSNMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLL  121

Query  734   GEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA  555
             GEG+ SCSI++L QI++QL  S++ +R RK+ + K+QI +L++KEK L  EN +L ++  
Sbjct  122   GEGIGSCSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQKEKALAAENEKLAEKWG  181

Query  554   VSEPQRL----------------YTDVETRLFIGQP  495
               E +                   ++VET+LFIG P
Sbjct  182   SHEIEVWSNKNQESGRGDEDSSPSSEVETQLFIGLP  217



>gb|AFO68796.1| suppressor of overexpression of constans 1, partial [Pachysandra 
terminalis]
Length=165

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFS++
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFSNS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S  N TI+RY   +K++    KS E ++QH+K + V  MSK++E LE SKRKLLGEGL S
Sbjct  61    SMQN-TIERYQRYSKDVLINNKSIEQNMQHLKHEAV-NMSKKIEHLEISKRKLLGEGLRS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
             C++D+L +++ QL  SL N+R RK+ L K+Q +
Sbjct  119   CTVDELQRVENQLERSLINVRARKTQLFKEQTE  151



>ref|NP_001280855.1| MADS-box protein SOC1-like [Malus domestica]
 ref|XP_008342912.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Malus domestica]
 dbj|BAI49494.1| SOC1 like protein [Malus domestica]
Length=213

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 146/224 (65%), Gaps = 41/224 (18%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENTTSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK+     K  SSE ++QH+K++  + M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQGTIERYQKHAKDNQTNDKSSSSEQNMQHLKQEATSMM-KQIELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++ +L +I++QL  S+ N+R RKS + K+QI++               K++L  +E 
Sbjct  119   GSCTLAELQEIEDQLEKSVYNVRARKSQVFKEQIEQ------------LREKEKLLTAEN  166

Query  542   QRLY-------------------------TDVETRLFIGQPETR  486
              RL                          +DVET LFIG PE+R
Sbjct  167   TRLVEKYGSFKKTLHERREKTPYNESSTSSDVETELFIGLPESR  210



>ref|XP_010941169.1| PREDICTED: MADS-box transcription factor 50-like isoform X2 [Elaeis 
guineensis]
Length=211

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 3/196 (2%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTEVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT+ RY+ + K++    +++E ++Q  + +   AM+K++E LE  KRKLLGEGL S
Sbjct  61    SSIQKTVDRYLMHTKDVNINIRATEQNMQQWRAEA-EAMTKKIEHLEAYKRKLLGEGLGS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CS+++LH ++ QL  SL  I+ERK  +  +QI RL+EK K         +        Q 
Sbjct  120   CSLEELHGVEMQLEQSLIKIKERKYHMLMEQIARLKEKCKTEPPVQLITQASSNGDACQN  179

Query  536   LYTDVETRLFIGQPET  489
             +  +VET L IG+P T
Sbjct  180   M--EVETELIIGRPGT  193



>ref|XP_010934923.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Elaeis guineensis]
Length=167

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY+ +AK++   KKS E + Q +K D  A++ K++E LE SKRKLLGE L+S
Sbjct  60    SSMEKTIDRYIMHAKDVNINKKSREHNAQQLKSDA-ASLMKKIERLEASKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             C+I++LH ++ QL  SL +IR RK  + ++QI R
Sbjct  119   CAIEELHDLELQLEQSLSSIRNRKYQMLEEQICR  152



>emb|CDY27368.1| BnaC04g50370D [Brassica napus]
Length=213

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFTSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ ++K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLTHSKDRISNKPVSEENMQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI+ QL  S++ IR RK+ L K+QI++
Sbjct  119   CSIEELQQIETQLEKSVKCIRARKTQLFKEQIEQ  152



>gb|ADU56826.1| MADS-box protein TM3 subfamily [Coffea arabica]
Length=151

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGKT+LKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MARGKTQLKRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+++ TIQRY  N KNL   ++  +   QH +E+ VA + K++E+LE+++R  LG+GLDS
Sbjct  61    SATS-TIQRYQKNIKNLCPSRRMEQA--QHFEEE-VAILRKKIEILEETRRSFLGDGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
              S+D+L QI+ +L  SL  IR RKSLL ++++D
Sbjct  117   SSVDELQQIENRLEKSLSIIRSRKSLLFRKRMD  149



>gb|KCW77637.1| hypothetical protein EUGRSUZ_D01939 [Eucalyptus grandis]
Length=175

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTQMKRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KTI++Y   AK++G   K++E S+QH K D +  M K++E  E S+R+LLGEGLDS
Sbjct  61    SLS-KTIEKYQKRAKDMGA--KTAEISMQHSKGDTL-DMEKKIEHFEISRRRLLGEGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+++L Q + QL  SL  IR RK+ L ++ I+R
Sbjct  117   CSVEELQQTENQLERSLTKIRARKNHLIREHIER  150



>gb|AGS32267.1| SOC1-1 [Litchi chinensis]
Length=230

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 148/218 (68%), Gaps = 23/218 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TIQRY+ + K+     K +E S+Q +K +  A M K++E+LE +KR+LLGEGL S
Sbjct  60    SSMQETIQRYLKHTKDTRTIDKPTEQSMQQMKNEA-ANMMKKIELLEVAKRRLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CSI++L QI++QL  S+  IR RKS + K+QI+ L+EKEK L  ENA L  +  V     
Sbjct  119   CSIEELQQIEQQLERSVTCIRARKSQVFKEQIELLKEKEKNLIAENARLSAKCGVQPWLG  178

Query  551   ----------------SEPQRLYTDVETRLFIGQPETR  486
                             +E     +DVET LFIG P  R
Sbjct  179   SKEKEKEKEQPENSPSNEDSTPTSDVETELFIGLPPAR  216



>ref|XP_010934925.1| PREDICTED: MADS-box protein SOC1-like isoform X4 [Elaeis guineensis]
Length=167

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY+ +AK++   KKS E + Q +K D  A++ K++E LE SKRKLLGE L+S
Sbjct  60    SSMEKTIDRYIMHAKDVNINKKSREHNAQQLKSDA-ASLMKKIERLEASKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             C+I++LH ++ QL  SL +IR RK  + ++QI R
Sbjct  119   CAIEELHDLELQLEQSLSSIRNRKYQMLEEQICR  152



>gb|AAP20425.1| MADS-box protein [Draba nemorosa var. hebecarpa]
Length=175

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TIDRYLRHTKDRISSKPVSEENMQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLGKSVKCIRARKTQVFKEQIEQ  152



>ref|XP_003534598.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Glycine max]
 ref|XP_006587878.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Glycine max]
 ref|XP_006587879.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Glycine max]
Length=211

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 148/207 (71%), Gaps = 17/207 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+L+RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQLRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY  + ++     +S E ++QH+K++  A + K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQDTIERYRRHNRSAQTVNRSDEQNMQHLKQE-TANLMKKIELLEASKRKLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CS+++L QI++QL  S+ ++R RK+ + K+QID+L+EKE+ L  ENA L ++    +PQ 
Sbjct  119   CSLEELQQIEQQLERSVSSVRARKNQVYKEQIDQLKEKERALYAENARLCEQYGGIQPQP  178

Query  536   LYTD---------------VETRLFIG  501
                D               VET LFIG
Sbjct  179   ATKDPKEIQPYAESSPSSEVETELFIG  205



>ref|XP_009142352.1| PREDICTED: MADS-box protein SOC1-like [Brassica rapa]
 ref|XP_009142353.1| PREDICTED: MADS-box protein SOC1-like [Brassica rapa]
 emb|CDY37054.1| BnaA04g26320D [Brassica napus]
Length=213

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLTHTKDRISNKPVSEENMQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI+ QL  S++ IR RK+ L K+QI++
Sbjct  119   CSIEELQQIETQLEKSVKCIRARKTQLFKEQIEQ  152



>ref|XP_011002079.1| PREDICTED: MADS-box protein SOC1 [Populus euphratica]
Length=209

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 151/207 (73%), Gaps = 13/207 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ +IVFSP GKLYEF S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIVFSPRGKLYEFGS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K      ++ E +++ +K +  A+M K++E+LE SKRKLLGE L S
Sbjct  60    SSVQETIERYQRHVKESNTNNQTMELTVEQLKGEA-ASMIKKIELLEVSKRKLLGECLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C+I++L QI++QL  S+  IR RK+ + ++QI++L++KEK+L  ENA L  +  V +P R
Sbjct  119   CTIEELQQIEQQLERSVSTIRARKNQVFREQIEQLKQKEKLLTAENARLSNKCGV-QPWR  177

Query  536   LY----------TDVETRLFIGQPETR  486
             +           +DVET LFIG PETR
Sbjct  178   VLSREQRESSSISDVETELFIGLPETR  204



>gb|AGB51002.1| MADS box transcription factor SOC1 variant 5 [Brassica juncea]
Length=213

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>ref|XP_006294978.1| hypothetical protein CARUB_v10024046mg [Capsella rubella]
 gb|EOA27876.1| hypothetical protein CARUB_v10024046mg [Capsella rubella]
Length=213

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI+RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIERYLRHTKDRVSTKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>ref|XP_010941170.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Elaeis guineensis]
Length=209

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 145/208 (70%), Gaps = 16/208 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTEVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT+ RY+ +A +    K++ E + Q   E   A++ K++E LE  KRKLLGE L+S
Sbjct  61    SSMEKTLDRYLLHAMDANVNKQTKEHNAQLKSE--TASLMKKIEQLEACKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C++++LH+++ QL  SL NIRERK  +   QIDRL+EKEK L + N+ L + L      +
Sbjct  119   CTVEELHELEFQLEKSLSNIRERKYHMLAGQIDRLKEKEKNLLKRNSSLHEMLNPETQLQ  178

Query  536   LY--------------TDVETRLFIGQP  495
             L+              T+VET L IG+P
Sbjct  179   LFAPGNAVSDDHDGQNTEVETELVIGRP  206



>ref|XP_010518187.1| PREDICTED: MADS-box protein SOC1 [Camelina sativa]
 ref|XP_010518188.1| PREDICTED: MADS-box protein SOC1 [Camelina sativa]
Length=213

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI+RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIERYLRHTKDRVSSKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AFM77891.1| MADS-box protein AGL20/SOC1 [Brassica napus]
Length=213

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 148/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ IR RK+ + K+QI++L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENKKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETELFIGLP  208



>ref|XP_004492667.1| PREDICTED: MADS-box protein SOC1-like [Cicer arietinum]
Length=207

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+LKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQLKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY  N+++    +KS E ++Q+++++  A++ K++E+LE SKRKL+GEGL S
Sbjct  60    SSMQDTIERYRRNSRSAQPMQKSDEQNMQNLRQE-TASLMKKIELLEASKRKLMGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CS+++L QI++QL  S+  +R RK+ + K QI
Sbjct  119   CSMEELQQIEQQLEKSVSTVRARKNQVYKNQI  150



>ref|XP_010508131.1| PREDICTED: MADS-box protein SOC1-like [Camelina sativa]
Length=213

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI+RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIERYLRHTKDRVSSKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
             CSI++L QI++QL  S++ IR RK+ + K+QI+
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIE  151



>gb|AFM77896.1| MADS-box protein AGL20/SOC1 [Brassica juncea]
Length=213

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 149/210 (71%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ IR RK+ + K+QI++L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENKKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>ref|NP_001275772.1| SOC1-like protein 1 [Citrus sinensis]
 ref|XP_006445196.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 ref|XP_006445197.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 ref|XP_006445198.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 ref|XP_006490969.1| PREDICTED: MADS-box protein SOC1 [Citrus sinensis]
 gb|ABS84659.1| SOC1-like protein 1 [Citrus sinensis]
 gb|ESR58436.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 gb|ESR58437.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 gb|ESR58438.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 gb|KDO85932.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
 gb|KDO85933.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
 gb|KDO85934.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
 gb|KDO85935.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
 gb|KDO85936.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
Length=220

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 152/211 (72%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ +I+FSP GKL EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY+ + K+    ++ +E ++QH+K +  A M K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQETIERYLKHTKDTRNKQQPTEQNMQHLKHEA-ANMVKKIELLEVSKRKLLGEGLAS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             C++++L QI+ QL  S+ NIR RK+ +  +QI +L+EK K+LE EN  L+++  +     
Sbjct  119   CTLEELQQIERQLEKSVSNIRARKNQVFNEQIAQLKEKGKVLEAENTRLEEKCGMENWQG  178

Query  551   --SEPQRL-------YTDVETRLFIGQPETR  486
                +P+ L        +DVET LFIG P  R
Sbjct  179   SKEQPENLTNDDGASTSDVETELFIGPPPER  209



>ref|NP_001267909.1| MADS-box protein [Vitis vinifera]
 gb|ACZ26527.1| suppressor of overexpression of CO 1 [Vitis vinifera]
Length=218

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 19/213 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GL KKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLFKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNL--GQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY  + K++    Y K++E ++Q +K +  A M+K++E+LE SKRKLLGEGL
Sbjct  60    SSMQETIERYQRHTKDVHTNNY-KTTEHNMQQLKHEA-ANMAKKIELLEISKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV---  552
              SCSI++L QI++QL  S+ +IR RK+ + K+QI++L+EKEK L  ENA L ++  V   
Sbjct  118   GSCSIEELQQIEQQLERSVSSIRARKNQVFKEQIEQLKEKEKALAAENAMLCEKCGVQPY  177

Query  551   -----------SEPQRLYTDVETRLFIGQPETR  486
                        S  +   +DV T LFIG PE R
Sbjct  178   QAPNQENETLPSAERSQNSDVSTDLFIGLPEGR  210



>ref|XP_010506539.1| PREDICTED: MADS-box protein SOC1-like [Camelina sativa]
 ref|XP_010506540.1| PREDICTED: MADS-box protein SOC1-like [Camelina sativa]
Length=214

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI+RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIERYLRHTKDRVSSKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
             CSI++L QI++QL  S++ IR RK+ + K+QI+
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIE  151



>ref|XP_006397744.1| hypothetical protein EUTSA_v10001632mg [Eutrema salsugineum]
 ref|XP_006397745.1| hypothetical protein EUTSA_v10001632mg [Eutrema salsugineum]
 gb|ESQ39197.1| hypothetical protein EUTSA_v10001632mg [Eutrema salsugineum]
 gb|ESQ39198.1| hypothetical protein EUTSA_v10001632mg [Eutrema salsugineum]
Length=213

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRISSKPVSEENMQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>ref|XP_010934922.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Elaeis guineensis]
Length=181

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY+ +AK++   KKS E + Q +K D  A++ K++E LE SKRKLLGE L+S
Sbjct  60    SSMEKTIDRYIMHAKDVNINKKSREHNAQQLKSDA-ASLMKKIERLEASKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             C+I++LH ++ QL  SL +IR RK  + ++QI R
Sbjct  119   CAIEELHDLELQLEQSLSSIRNRKYQMLEEQICR  152



>ref|XP_008356915.1| PREDICTED: MADS-box protein SOC1-like [Malus domestica]
 dbj|BAI49495.1| SOC1 like protein [Malus domestica]
Length=215

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 152/215 (71%), Gaps = 19/215 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKL+EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLFEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSS--ETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK      KSS  E ++QH+K+     M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQGTIERYQKHAKGNQTSNKSSSNEQNMQHLKQKATIMM-KQLELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++ +L +I+ QL  S+ N+R RKS + K+QI++LREKEK+L+ E A L ++    +P
Sbjct  119   GSCTLAELQEIEHQLEKSVNNVRARKSQVFKEQIEQLREKEKLLKAETARLVEKCGSFQP  178

Query  542   QRLYTD---------------VETRLFIGQPETRP  483
             ++   +               VET LFIG PE+R 
Sbjct  179   RKTLDERRQNTTYTDSSTSSDVETELFIGLPESRA  213



>ref|XP_006583359.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Glycine max]
 ref|XP_006583360.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Glycine max]
 ref|XP_006583361.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Glycine max]
 ref|XP_006583362.1| PREDICTED: MADS-box protein SOC1-like isoform X4 [Glycine max]
 ref|XP_006583363.1| PREDICTED: MADS-box protein SOC1-like isoform X5 [Glycine max]
 ref|XP_006583364.1| PREDICTED: MADS-box protein SOC1-like isoform X6 [Glycine max]
 ref|XP_006583365.1| PREDICTED: MADS-box protein SOC1-like isoform X7 [Glycine max]
 gb|KHN04595.1| MADS-box protein SOC1 [Glycine soja]
Length=226

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 157/227 (69%), Gaps = 25/227 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYK-KSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  ++I+RY  + K++     +S E ++QH+K++    M K++++LE +KRK LGEGL 
Sbjct  60    SSMQESIERYRRHTKHVNPTTFRSVEQNMQHLKQEA-ENMMKKIDLLEAAKRKFLGEGLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             +CSI++L +I++QL  SL N+R RK  + K+QI++L+EKEK L +ENA+L +   +SE  
Sbjct  119   ACSIEELQRIEQQLERSLSNVRARKVQVFKEQIEQLKEKEKALLDENAKLTENARLSEKH  178

Query  539   RLY----------------------TDVETRLFIGQPETRPPAGDHN  465
              ++                      +DVET LFIG P+TR     H+
Sbjct  179   DIHLQPATKNQNVNQPQCNAESSSSSDVETELFIGLPDTRARHISHH  225



>dbj|BAK18558.1| suppressor of overexpression of constans 1-like protein [Eustoma 
exaltatum subsp. russellianum]
Length=217

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 148/211 (70%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDA++ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K++   K   E ++QH+K++    MSK +E LE SKRKLLGE L S
Sbjct  60    SSMQETIERYHKHTKDVQTDKPLVEENMQHLKQETARMMSK-IEQLETSKRKLLGESLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             CS++DL Q+++QL  S+++IR RK  + ++QI +LREKEK+L  EN +L ++  +  P  
Sbjct  119   CSLEDLQQLEQQLEKSVKSIRARKVQVFQEQIHQLREKEKVLAAENLKLCEKCGIKAPST  178

Query  539   -------------RLYTDVETRLFIGQPETR  486
                              DVET LFIG PE R
Sbjct  179   QKESKATEVHAEGNNAHDVETDLFIGPPERR  209



>ref|XP_010941171.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Elaeis guineensis]
Length=193

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTEVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT+ RY+ +A +    K++ E + Q   E   A++ K++E LE  KRKLLGE L+S
Sbjct  61    SSMEKTLDRYLLHAMDANVNKQTKEHNAQLKSE--TASLMKKIEQLEACKRKLLGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             C++++LH+++ QL  SL NIRERK  +   QIDR
Sbjct  119   CTVEELHELEFQLEKSLSNIRERKYHMLAGQIDR  152



>ref|XP_010544676.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
 ref|XP_010544677.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
 ref|XP_010544678.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
 ref|XP_010544679.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
 ref|XP_010544680.1| PREDICTED: MADS-box protein SOC1-like [Tarenaya hassleriana]
Length=217

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 150/214 (70%), Gaps = 22/214 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR G+LKKAFELSVLCDAE++LI+FSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGILKKAFELSVLCDAEVSLIIFSPKGRLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKN-LGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             ++  +TI+RY+ + K+ +   K +SE ++QH+K +  A M +++E LE +KRKL+GEG+ 
Sbjct  60    ANMQETIERYLRHTKDRVSSNKPTSEENMQHLKHEA-ANMMRKIEQLENAKRKLMGEGIG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             SCSI++L QI++QL  S++ IR RK+ + K+QI++LR+KEK L  EN  L K+    E  
Sbjct  119   SCSIEELQQIEQQLERSVKTIRARKTQVFKEQIEQLRQKEKALAAENERLSKKWETEECS  178

Query  539   RLYTD-------------------VETRLFIGQP  495
             R   D                   VET LFIG P
Sbjct  179   RTGMDKEQQNIIARAVEESSPISEVETELFIGLP  212



>dbj|BAK18559.1| suppressor of overexpression of constans 1-like protein [Eustoma 
exaltatum subsp. russellianum]
Length=217

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 148/211 (70%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDA++ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K++   K   E ++QH+K++    MSK +E LE SKRKLLGE L S
Sbjct  60    SSMQETIERYHKHTKDVQTDKPLVEENMQHLKQETARMMSK-IEQLETSKRKLLGESLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             CS++DL Q+++QL  S+++IR RK  + ++QI +LREKEK+L  EN +L ++  +  P  
Sbjct  119   CSLEDLQQLEQQLEKSVKSIRARKVQVFQEQIHQLREKEKVLAAENLKLCEKCGIKAPST  178

Query  539   -------------RLYTDVETRLFIGQPETR  486
                              DVET LFIG PE R
Sbjct  179   QKESKATEVHAEGNNTHDVETDLFIGPPERR  209



>ref|XP_004515788.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X1 
[Cicer arietinum]
 ref|XP_004515789.1| PREDICTED: agamous-like MADS-box protein AGL19-like isoform X2 
[Cicer arietinum]
Length=203

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 147/203 (72%), Gaps = 8/203 (4%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN ++RQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  GKLYEF ST
Sbjct  1     MVRGKTQMKRIENESNRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGKLYEF-ST  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKT++RY    K+     K  + + QH+KE   +A +K++E LE SKRKLLG  LD+
Sbjct  60    SSINKTVERYQRKIKDFTLNTKGIQENTQHLKECDNSA-TKKIEHLELSKRKLLGNELDT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C+ID+L QI+EQ+  SL  IR RK+ L ++QI++LRE+E+ L EEN  L+ +  + +   
Sbjct  119   CAIDELQQIEEQIERSLSKIRARKNQLFREQIEKLREQERYLLEENRHLRDKCRIEQDNE  178

Query  536   LYT------DVETRLFIGQPETR  486
             L T      +VET LFIG+PE R
Sbjct  179   LITESLQGGEVETELFIGRPERR  201



>gb|AGB50999.1| MADS box transcription factor SOC1 variant 15 [Brassica juncea]
Length=213

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 148/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ +R RK+ + K+QI +L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQKEKALAAENEKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>ref|XP_010676581.1| PREDICTED: agamous-like MADS-box protein AGL19 [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN +SRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP+GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENDSSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPSGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS+ KTI RY  + K+L   K     + +L   K+D +  + K+++ LE SKRKLLG+GL
Sbjct  60    SSTTKTIDRYQKHMKDLRGVKSKVLDQKNLLQFKDDTI-ELEKKLKSLELSKRKLLGDGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
             ++CSID+L ++++QL  SL +IR RK+ L K+QI++L E+EK L +EN  LK ++  S P
Sbjct  119   EACSIDELQELEKQLDKSLSSIRARKNALYKEQINKLYEEEKHLIKENVRLKDKVLNSSP  178

Query  542   QRL------------YTDVETRLFIGQPETR  486
               L              DVET LFIG PE+R
Sbjct  179   DLLRRQQRADDQEISMQDVETELFIGPPESR  209



>gb|AGK07583.1| SOC1 [Dendrobium hybrid cultivar]
Length=223

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 139/214 (65%), Gaps = 22/214 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAEI LIVFSP GKLYEFSS 
Sbjct  1     MVRGKTEMRRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEIGLIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI+RY  N K +    KSSE ++Q  K+D    MSK+++VLE SKRKL+GE L+S
Sbjct  60    SSMLKTIERYKMNNKEMISNNKSSEQNIQQWKQDK-DLMSKKIDVLEDSKRKLMGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI------DRlrekekileeenaelkKRLA  555
             CS ++LH+++ QL  S+  +R RK+ L ++Q+      +R+  +E  L  +       L 
Sbjct  119   CSAEELHELESQLEESISKVRGRKNHLLEEQVVQLKERERVLLEENALLHKQESHTTSLL  178

Query  554   VSEP--------------QRLYTDVETRLFIGQP  495
               EP                 + DVET L++G P
Sbjct  179   WKEPLLGSNTSKEVVPQCDNKHMDVETELYVGWP  212



>gb|AAB41526.1| transcription factor SaMADS A [Sinapis alba]
Length=213

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ +R RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQ  152



>gb|AGB51012.1| MADS box transcription factor SOC1 variant 8 [Brassica nigra]
Length=213

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+  + K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVRSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ +R RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQ  152



>gb|AAP46287.1|AF377868_1 MADS-box protein PTM5 [Populus tremuloides]
Length=220

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 141/220 (64%), Gaps = 23/220 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K     K+  E ++  +KE+  A+M K++E LE SKRKLLGE L S
Sbjct  60    SSMQETIERYRRHVKENNTNKQPVEQNMLQLKEEA-ASMIKKIEHLEVSKRKLLGECLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID-----RlrekekileeenaelkKRLAV  552
             C+I++L QI++QL  S+  IR RK+ + K+QI+           +     +    +   V
Sbjct  119   CTIEELQQIEQQLERSVSTIRARKNQVFKEQIELLKQKEKLLAAENARLSDECGAQSWPV  178

Query  551   SEPQR------------LYTDVETRLFIGQPETR----PP  480
             S  QR              +DVET LFIG PETR    PP
Sbjct  179   SWEQRDDLPREEQRESSSISDVETELFIGPPETRTKRIPP  218



>gb|AGB51146.1| MADS box transcription factor SOC1 variant 8 [Brassica carinata]
Length=212

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AEH43352.1| SOC1 [Arabis alpina]
 gb|AEH43355.1| SOC1 [Arabis alpina]
 gb|KFK37355.1| mads-box protein agl20 soc1 [Arabis alpina]
Length=216

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  +TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  60    SNMQETIDRYVRHTKDRIINKPVSEENMQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>ref|XP_009143158.1| PREDICTED: MADS-box protein SOC1 [Brassica rapa]
 gb|AGB51006.1| MADS box transcription factor SOC1 variant 6 [Brassica juncea]
 gb|AGB51019.1| MADS box transcription factor SOC1 [Brassica napus]
 gb|AGB51020.1| MADS box transcription factor SOC1 [Brassica rapa]
 emb|CDX74755.1| BnaA05g05010D [Brassica napus]
Length=213

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AFM77895.1| MADS-box protein AGL20/SOC1 [Brassica juncea]
Length=213

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 149/210 (71%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLG+G+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGDGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ +R RK+ + K+QI++L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQLKQKEKALAVENEKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>gb|AGB51017.1| MADS box transcription factor SOC1 variant 7 [Brassica carinata]
Length=213

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ +R RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQ  152



>emb|CDY69077.1| BnaC04g53290D [Brassica napus]
Length=213

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>emb|CDY53886.1| BnaA03g56880D [Brassica napus]
Length=213

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ +R RK+ + K+QI +L++ EK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQTEKALAAENEKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>ref|NP_001288813.1| MADS-box protein SOC1-like [Brassica rapa]
 ref|XP_009133735.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Brassica rapa]
 ref|XP_009133736.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Brassica rapa]
 ref|XP_009133737.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Brassica rapa]
 gb|ABP88100.1| MADS-box protein AGL20 [Brassica rapa subsp. chinensis]
 gb|AFM77892.1| MADS-box protein AGL20/SOC1 [Brassica napus]
 gb|AFM77894.1| MADS-box protein AGL20/SOC1 [Brassica juncea]
 gb|AGB50996.1| MADS box transcription factor SOC1 variant 16 [Brassica rapa]
 gb|AGB50997.1| MADS box transcription factor SOC1 variant 17 [Brassica rapa]
 gb|AGB51000.1| MADS box transcription factor SOC1 variant 17 [Brassica juncea]
 gb|AGB51001.1| MADS box transcription factor SOC1 variant 17 [Brassica juncea]
 gb|AGB51003.1| MADS box transcription factor SOC1 variant 17 [Brassica juncea]
 gb|AGB51004.1| MADS box transcription factor SOC1 variant 17 [Brassica rapa]
 gb|AGB51007.1| MADS box transcription factor SOC1 variant 17 [Brassica juncea]
 gb|AGB51010.1| MADS box transcription factor SOC1 variant 18 [Brassica napus]
 gb|AGB51011.1| MADS box transcription factor SOC1 variant 17 [Brassica napus]
 gb|AGB51143.1| MADS box transcription factor SOC1 variant 4 [Brassica rapa]
Length=213

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 148/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ +R RK+ + K+QI +L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQKEKALAAENEKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>dbj|BAN19217.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=216

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMQVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>ref|XP_011034922.1| PREDICTED: MADS-box protein SOC1-like [Populus euphratica]
 ref|XP_011034930.1| PREDICTED: MADS-box protein SOC1-like [Populus euphratica]
 ref|XP_011034937.1| PREDICTED: MADS-box protein SOC1-like [Populus euphratica]
Length=219

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 143/233 (61%), Gaps = 46/233 (20%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K     K+  E ++  +KE+  A+M K++E+LE SKRKLLGE L S
Sbjct  60    SSMQETIERYRRHVKENNTNKQPVEQNMLQLKEEA-ASMIKKIEILEVSKRKLLGECLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C++++L QI++QL  S+  IR RK+ + K+QI+                K++L  +E  R
Sbjct  119   CTVEELQQIEQQLERSVSTIRARKNQVFKEQIE------------LLRQKEKLLTAENAR  166

Query  536   L----------------------------YTDVETRLFIGQPETR----PPAG  474
             L                             +DVET LFIG PETR    PP  
Sbjct  167   LSDECGAQSWPVSRELRDLRREDLRESSSISDVETELFIGPPETRTKRIPPGN  219



>dbj|BAL14663.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
seticuspe f. boreale]
 dbj|BAN19213.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=216

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMKVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>dbj|BAN19216.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=215

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 18/211 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+  
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFA--  58

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +SS +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  59    NSSKETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  117   STIDELVQIEQQLERSVRIIRARKMKVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  176

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  177   TEEMGVDLNVLESGENSDVETELFIGPPETR  207



>ref|XP_010919082.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Elaeis guineensis]
Length=206

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSST
Sbjct  29    MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSST  88

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S  KTI RY  +AK+     + +E ++Q  K +  A+MS+++E LE SKRKLL E L+S
Sbjct  89    -SMQKTINRYRMHAKSGINNNEVTEQNIQQCKFEA-ASMSRKIESLEASKRKLLAESLES  146

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CS+++LH+I+ +L  SLRNIR RK+ L  +QI
Sbjct  147   CSVEELHEIEGKLEQSLRNIRGRKNQLLGEQI  178



>gb|AGN29205.1| SOC1 [Cardamine flexuosa]
Length=215

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TIDRYLRHTKDRVSSKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>ref|NP_182090.1| MADS-box protein SOC1 [Arabidopsis thaliana]
 sp|O64645.1|SOC1_ARATH RecName: Full=MADS-box protein SOC1; AltName: Full=Agamous-like 
MADS-box protein AGL20; AltName: Full=Protein SUPPRESSOR 
OF CONSTANS OVEREXPRESSION 1 [Arabidopsis thaliana]
 gb|AAK60321.1|AF385731_1 At2g45660/F17K2.19 [Arabidopsis thaliana]
 gb|AAC06175.1| MADS-box protein (AGL20) [Arabidopsis thaliana]
 gb|AAG16297.1| MADS box protein AGL20 [Arabidopsis thaliana]
 gb|AAM16228.1| At2g45660/F17K2.19 [Arabidopsis thaliana]
 gb|AEC10583.1| MADS-box protein SOC1 [Arabidopsis thaliana]
Length=214

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++QH+K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENMQHLKYEA-ANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AES80026.2| MADS-box transcription factor [Medicago truncatula]
Length=212

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S    TI+RY  N ++    ++S E ++Q++K +  A++ K++E+LE SKRKL+GEGL S
Sbjct  60    SCMQDTIERYRRNTRSAQPMQRSDEQNMQNLKHE-TASLMKKIELLEASKRKLMGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+D+L QI++QL  S+  +R RK+   K QID+
Sbjct  119   CSLDELQQIEQQLEKSVSVVRARKNQAYKHQIDQ  152



>gb|AGT96413.1| AGL20 [Brassica oleracea var. viridis]
Length=213

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 146/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             CSI++L QI++QL  S++ IR RK+ + K+Q ++ ++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQTEQPKQKEKALAAENKKLAEKWGSHEIEV  178

Query  539   ---------------RLYTDVETRLFIGQP  495
                               ++VET LFIG P
Sbjct  179   RSNKNQESGRGDDESSPSSEVETELFIGLP  208



>dbj|BAN19211.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
 dbj|BAN19215.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=216

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMKVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>ref|XP_009617466.1| PREDICTED: MADS-box protein SOC1-like isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009617467.1| PREDICTED: MADS-box protein SOC1-like isoform X4 [Nicotiana tomentosiformis]
Length=249

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 157/220 (71%), Gaps = 19/220 (9%)
 Frame = -1

Query  1094  LVR*SEMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKL  915
             +VR  EMVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKL
Sbjct  25    VVRRGEMVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKL  84

Query  914   YEFSSTSSSNKTIQRYMNNAKNLGQYKKS-SETSLQHVKEDGVAAMSKRVEVLEQSKRKL  738
             YEF+S SS+ + I+RY  + K+  Q +    E +LQH++ +  A++ K++E+LE+SKRKL
Sbjct  85    YEFAS-SSTQEIIERYKRHNKDKVQPENQVGEQNLQHMQHEA-ASLMKKIELLEESKRKL  142

Query  737   LGEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL  558
             LGEGL SC++ +L QI++QL  S+  IR RK  + K+QI+RL+EKEKIL  ENA L+++ 
Sbjct  143   LGEGLQSCTLGELQQIEKQLERSVSTIRARKIQVFKEQIERLKEKEKILASENAILREKF  202

Query  557   AV----------SEPQRLYT------DVETRLFIGQPETR  486
                          E + L T      DVET LFIG PE R
Sbjct  203   GGLQRRQGSTGEKEGEALCTESSEKSDVETELFIGPPECR  242



>gb|AAC33475.1| transcription activator [Spuriopimpinella brachycarpa]
Length=217

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 149/212 (70%), Gaps = 17/212 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKL+EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLHEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS ++TI+RY  + K++         ++QH+K +  A+++K++E+LE SKRKLLGEGL +
Sbjct  60    SSMHETIERYRKHTKDVQSNNTPVVQNMQHLKHE-TASLAKKIELLEVSKRKLLGEGLGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S+  +R RK  + K+QI++L+EKEK L  +NA L  +  V   Q 
Sbjct  119   CSINELQQIEQQLEKSVCTVRARKMQVFKEQIEQLKEKEKTLAADNAILLAKYDVQPRQE  178

Query  536   L---------------YTDVETRLFIGQPETR  486
                              +DVET LFIG PE R
Sbjct  179   SPEDGGNLTSTTENSENSDVETELFIGPPEKR  210



>emb|CBI34770.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 145/200 (73%), Gaps = 11/200 (6%)
 Frame = -1

Query  1055  LKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSSTSSSNKTI  876
             +KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GK++EFSS SS NKTI
Sbjct  1     MKRIENAASRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKVFEFSS-SSINKTI  59

Query  875   QRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDSCSIDDLH  696
             +RY + AK LG  K+ +  + QH  E     ++K++E+LE SKR+LLGE LDSCSI++L 
Sbjct  60    ERYQSKAKGLGISKRGAPENEQHHLEGETVDLAKKIELLEVSKRRLLGECLDSCSIEELQ  119

Query  695   QIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV----------SE  546
             QI+ +L  SL NIR +K+ LCK  I+RL+E+E+IL EENA+L+ +  +          S 
Sbjct  120   QIENELEQSLSNIRIQKNHLCKGHIERLKEQERILGEENAKLRGKCGLQPLQPSTKHQSV  179

Query  545   PQRLYTDVETRLFIGQPETR  486
             P    ++VET LFIG PE R
Sbjct  180   PYVEISEVETELFIGPPERR  199



>gb|ABG34340.1| MADS box transcription factor 5 [Populus tomentosa]
Length=220

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 140/220 (64%), Gaps = 23/220 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K     K+  E ++  +KE+  A+M K++E LE SKRKLLGE L S
Sbjct  60    SSMQETIERYRRHVKENNTNKQPVEQNMLQLKEEA-ASMIKKIEHLEVSKRKLLGECLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID-----RlrekekileeenaelkKRLAV  552
             C+I++L QI+ QL  S+  IR RK+ + K+QI+           +     +    +   V
Sbjct  119   CTIEELQQIEHQLERSVSTIRARKNQVFKEQIELLKQKEKLLAAENTRLSDECGAQSWPV  178

Query  551   SEPQR------------LYTDVETRLFIGQPETR----PP  480
             S  QR              +DVET LFIG PETR    PP
Sbjct  179   SWEQRDDLPREEQRESSSISDVETELFIGPPETRTKRIPP  218



>gb|AFH41826.1| MADS-box protein SOC1 [Brassica napus]
Length=213

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CSI++L QI++QL  S++ +R RK+ + K+QI
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQI  150



>dbj|BAN19212.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=216

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMQVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>dbj|BAN19214.1| suppressor of overexpression of CO1 like protein [Chrysanthemum 
x morifolium]
Length=216

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMKVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>dbj|BAH97195.1| suppressor of overexpression of CO1 [Chrysanthemum x morifolium]
Length=216

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMQVYNEQIEQLHAKEKMLAAENAILTEKCIIQTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGPPETR  208



>gb|AFM77893.1| MADS-box protein AGL20/SOC1 [Brassica juncea]
Length=213

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CSI++L QI++QL  S++ +R RK+ + K+QI
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQI  150



>ref|XP_010941167.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Elaeis guineensis]
 ref|XP_010941168.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Elaeis guineensis]
Length=239

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTEVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT+ RY+ + K++    +++E ++Q  + +   AM+K++E LE  KRKLLGEGL S
Sbjct  61    SSIQKTVDRYLMHTKDVNINIRATEQNMQQWRAEA-EAMTKKIEHLEAYKRKLLGEGLGS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+++LH ++ QL  SL  I+ERK  +  +QI R
Sbjct  120   CSLEELHGVEMQLEQSLIKIKERKYHMLMEQIAR  153



>ref|XP_010919081.1| PREDICTED: MADS-box transcription factor 50-like isoform X2 [Elaeis 
guineensis]
Length=217

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 150/208 (72%), Gaps = 16/208 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSST
Sbjct  1     MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSST  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S  KTI RY  +AK+     + +E ++Q  K +  A+MS+++E LE SKRKLL E L+S
Sbjct  61    -SMQKTINRYRMHAKSGINNNEVTEQNIQQCKFE-AASMSRKIESLEASKRKLLAESLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR--------  561
             CS+++LH+I+ +L  SLRNIR RK+ L  +QI +L+EKE+ LE+EN  L+++        
Sbjct  119   CSVEELHEIEGKLEQSLRNIRGRKNQLLGEQIAQLKEKEQTLEKENTLLQEKCKLQSQPP  178

Query  560   ---LAVSEPQR---LYTDVETRLFIGQP  495
                L  ++P      + +VET L+IG P
Sbjct  179   LADLEEADPDEQDGQHNEVETELYIGCP  206



>ref|XP_008794766.1| PREDICTED: MADS-box transcription factor 50-like [Phoenix dactylifera]
Length=225

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 147/206 (71%), Gaps = 13/206 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTEVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY+ + K++    +++E  +Q  K + V +M+K +E LE SKRKLLGEGL S
Sbjct  61    SSMQKTIDRYLMHTKDVDINIRATERIMQQRKSE-VESMTKEIEHLEASKRKLLGEGLGS  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C +D++H ++ QL  SL  I+ERK  +  +QI +L+E E+IL EEN+ L+ +     P +
Sbjct  120   CLLDEVHGLEMQLEQSLIKIKERKYRMQMEQIAQLKEDERILLEENSSLRGKCKTERPVQ  179

Query  536   LYT------------DVETRLFIGQP  495
             L T            +VET+L IG+P
Sbjct  180   LITQASANDQARQNMEVETQLIIGRP  205



>gb|ADG27451.1| suppressor of overexpression of constans 1-like c protein [Malus 
domestica]
Length=215

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 152/214 (71%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MV+GKT+++RIEN TSRQV+FSKR+ GLLKKAFELSVLCDAE++LI+FSP GKL+EF+S 
Sbjct  1     MVKGKTQMRRIENTTSRQVTFSKRKSGLLKKAFELSVLCDAEVSLIIFSPRGKLFEFAS-  59

Query  896   SSSNKTIQRYMNNAKN--LGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK    G    S+E ++QH+K+   + M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQGTIERYQKHAKGNQTGNKSSSNEQNMQHLKQKATSMM-KQLELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++ +L +I+ QL  S+ N+R RKS + K+QI++LREKEK+L+ E A L ++    +P
Sbjct  119   GSCTLAELQEIEHQLEKSVNNVRARKSQVFKEQIEQLREKEKLLKAETARLVEKCGSFQP  178

Query  542   QRLYTD---------------VETRLFIGQPETR  486
             ++   +               VET LFIG PE+R
Sbjct  179   RKTLDERRQNTTYTDSSTSSDVETELFIGLPESR  212



>ref|NP_001240979.1| uncharacterized protein LOC100805260 [Glycine max]
 ref|XP_006579439.1| PREDICTED: uncharacterized protein LOC100805260 isoform X3 [Glycine 
max]
 gb|ACU24392.1| unknown [Glycine max]
Length=224

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 149/212 (70%), Gaps = 16/212 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  G+LYEFSS 
Sbjct  1     MVRGKTQMKRIENETSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKT++RY    ++LG   K    + QH+KE  + +M+K++E LE S+RKLLG+ LD 
Sbjct  60    SSINKTVERYQRKIEDLGVSNKGIHENTQHLKEVDM-SMAKKIEHLEDSRRKLLGDELDK  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSID+L Q++ QL  SL  IR  K+ L +++I++L+E+EK L E N  L+++  + E QR
Sbjct  119   CSIDELQQLENQLERSLDKIRATKNQLFRKRIEKLKEEEKCLLEVNKRLREQYRI-ERQR  177

Query  536   LYTD-------------VETRLFIGQPETRPP  480
               +D             VET LFIG+PE R P
Sbjct  178   CLSDQDVEFATKKEGEEVETELFIGRPERRMP  209



>ref|XP_006579437.1| PREDICTED: uncharacterized protein LOC100805260 isoform X1 [Glycine 
max]
 ref|XP_006579438.1| PREDICTED: uncharacterized protein LOC100805260 isoform X2 [Glycine 
max]
Length=227

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 17/214 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  G+LYEFSS+
Sbjct  1     MVRGKTQMKRIENETSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGRLYEFSSS  60

Query  896   --SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
               SS NKT++RY    ++LG   K    + QH+KE  + +M+K++E LE S+RKLLG+ L
Sbjct  61    RCSSINKTVERYQRKIEDLGVSNKGIHENTQHLKEVDM-SMAKKIEHLEDSRRKLLGDEL  119

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
             D CSID+L Q++ QL  SL  IR  K+ L +++I++L+E+EK L E N  L+++  + E 
Sbjct  120   DKCSIDELQQLENQLERSLDKIRATKNQLFRKRIEKLKEEEKCLLEVNKRLREQYRI-ER  178

Query  542   QRLYTD-------------VETRLFIGQPETRPP  480
             QR  +D             VET LFIG+PE R P
Sbjct  179   QRCLSDQDVEFATKKEGEEVETELFIGRPERRMP  212



>gb|AGB50998.1| MADS box transcription factor SOC1 variant 9 [Brassica juncea]
 gb|AGB51013.1| MADS box transcription factor SOC1 variant 11 [Brassica nigra]
 gb|AGB51014.1| MADS box transcription factor SOC1 variant 9 [Brassica nigra]
 gb|AGB51144.1| MADS box transcription factor SOC1 variant 5 [Brassica juncea]
Length=213

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLG+G+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGDGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ +R RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQ  152



>ref|XP_002882024.1| hypothetical protein ARALYDRAFT_904011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58283.1| hypothetical protein ARALYDRAFT_904011 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+   TI RY+ + K+    K  SE ++QH+K +  A M K++E LE +KRKLLGEG+ +
Sbjct  60    SNMQDTIDRYLRHTKDRVSTKPVSEENMQHLKYEA-ANMMKKIEQLEAAKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI+ QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEHQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AGB51145.1| MADS box transcription factor SOC1 variant 7 [Brassica carinata]
Length=212

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSSKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI+ QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIELQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AAQ54337.1| MADS-box protein [Brassica rapa subsp. oleifera]
Length=213

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKVQIEQ  152



>gb|AEF32135.1| MADS-box protein [Betula platyphylla]
Length=219

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 140/219 (64%), Gaps = 22/219 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+ST
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAST  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S  + I+RY  + K     K+  E ++  +KE+  A+M K++E LE SKRKLLGE L S
Sbjct  61    -SMQEAIERYRRHVKENNTNKQPVEQNMLQLKEEA-ASMIKKIEHLEVSKRKLLGECLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID-----RlrekekileeenaelkKRLAV  552
             C++++L QI++QL  S+  IR RK+ + K+QI+           +     +    +   V
Sbjct  119   CTVEELQQIEQQLERSVSTIRARKNQVFKEQIELLRQKEKLLAAENARLSDECGAQSWPV  178

Query  551   SEPQR-----------LYTDVETRLFIGQPETR----PP  480
             S  QR             +DVET LFIG PETR    PP
Sbjct  179   SREQRDLPREDLRESSSISDVETELFIGPPETRTKRIPP  217



>ref|XP_008437190.1| PREDICTED: agamous-like MADS-box protein AGL19 [Cucumis melo]
 ref|XP_008437191.1| PREDICTED: agamous-like MADS-box protein AGL19 [Cucumis melo]
Length=223

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFS+ 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSNC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S NKTI RY N  K+L     ++   +Q  KE    +M+K++E LE  KRKLLG+GLD 
Sbjct  61    -SMNKTIDRYQNRTKDLMSSNSTATEDVQLEKEYDSFSMTKKLEHLEVCKRKLLGDGLDL  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSID+L Q++ QL  SL  IR RK  + K +I +L+E+EK L EENA L+ ++       
Sbjct  120   CSIDELQQLERQLERSLSKIRSRKYQMLKDEITKLKEEEKKLLEENAALQIKVRSESSKK  179

Query  557   ------AVSEPQRLYTDVETRLFIGQPETR  486
                   + S       DVET LFIG PE R
Sbjct  180   QDSNQRSESSNHEEIMDVETELFIGPPERR  209



>emb|CAE46180.1| AGL20-like MADS box transcription factor [Elaeis guineensis]
Length=209

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 146/206 (71%), Gaps = 11/206 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS+
Sbjct  1     MVRGKTQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSSS  60

Query  896   SSS-NKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SSS  KTI RY+ +AK++   KKS E + Q +K D  A++ K++E LE SKRKLLGE L+
Sbjct  61    SSSMEKTIDRYIMHAKDVNINKKSREHNAQQLKSDA-ASLMKKIERLEASKRKLLGENLE  119

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlreke---kileeenaelkKRLAVS  549
             SC+I++LH ++ QL   L +IR RK  + ++QI RL+EKE       +E    + RL + 
Sbjct  120   SCAIEELHDLELQLEQXLSSIRNRKYQMLEEQICRLKEKEKILTASIQEKLNAEPRLQLC  179

Query  548   EP------QRLYTDVETRLFIGQPET  489
              P          TDVET L IG+P T
Sbjct  180   APAVSDDYDSXNTDVETELVIGRPGT  205



>gb|AGB51008.1| MADS box transcription factor SOC1 variant 14 [Brassica napus]
 gb|AGB51016.1| MADS box transcription factor SOC1 variant 13 [Brassica carinata]
Length=213

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHE-AANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSID+L QI++QL  S++ +R RK+ + K+Q ++L++KEK L  EN +L ++    E + 
Sbjct  119   CSIDELQQIEQQLEKSVKCVRARKNQVFKEQSEQLKQKEKALAAENEKLAEKWGSLEIEF  178

Query  536   LYT----------------DVETRLFIGQP  495
                                +VET+LFIG P
Sbjct  179   WSNKNQESGRGGEDSSPSFEVETQLFIGLP  208



>gb|AGB51018.1| MADS box transcription factor SOC1 variant 4 [Brassica carinata]
Length=213

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSSKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI+ QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIELQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|ADX97324.1| SOC1 [Mangifera indica]
Length=223

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 147/212 (69%), Gaps = 20/212 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQ++FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENNTSRQITFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI R++ + K+    K+ +E ++Q++K +  A M K++E LE  KRKLLGEGL+S
Sbjct  60    SSMQETIGRFLRHTKDSRASKRPTEETMQNMKNE-AANMMKKIEHLEDWKRKLLGEGLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA------  555
             CSI++L +I++QL  S+ NIR RK++L K+QI +L+EKE +L  EN  L ++        
Sbjct  119   CSIEELQEIEQQLENSVSNIRARKTVLFKEQIQQLKEKEIVLAAENLRLAEKCGGMQVET  178

Query  554   ------------VSEPQRLYTDVETRLFIGQP  495
                         + +     +DVET LFIG P
Sbjct  179   LNGSKELGESENIGDDSNPISDVETELFIGLP  210



>ref|XP_010919080.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Elaeis guineensis]
Length=245

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSST
Sbjct  29    MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSST  88

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S  KTI RY  +AK+     + +E ++Q  K +  A+MS+++E LE SKRKLL E L+S
Sbjct  89    -SMQKTINRYRMHAKSGINNNEVTEQNIQQCKFEA-ASMSRKIESLEASKRKLLAESLES  146

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CS+++LH+I+ +L  SLRNIR RK+ L  +QI
Sbjct  147   CSVEELHEIEGKLEQSLRNIRGRKNQLLGEQI  178



>gb|ACV88635.1| SUPRESSOR OF OVEREXPRESSION OF CONSTANS1 [Magnolia virginiana]
Length=221

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 153/220 (70%), Gaps = 23/220 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GL KKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLFKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS +KTI RY  +AK++    K+ E ++Q  K +  A  +K++E LE SKRKLLGEGL S
Sbjct  60    SSMHKTIDRYGRHAKDVSITNKTVEQNVQQWKFEA-AHTAKKIENLEVSKRKLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR---LAVSE  546
             C I++L QI+ QL  SL +IR RK+ L  +QI +L+EKE+ L EENA L K+   L+V  
Sbjct  119   CPIEELQQIESQLERSLSSIRARKTRLFTEQIQQLKEKERFLTEENAILSKKAIDLSVQP  178

Query  545   PQRL---------YTD------VETRLFIGQPE---TRPP  480
              Q+L         Y D      VET LFIG+PE   TR P
Sbjct  179   LQQLSPTQKEIVPYDDETQDPEVETELFIGRPERGKTRYP  218



>emb|CDY60689.1| BnaCnng36880D [Brassica napus]
Length=213

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHE-AANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSID+L QI++QL  S++ +R RK+ + K+Q ++L++KEK L  EN +L ++    E + 
Sbjct  119   CSIDELQQIEQQLEKSVKCVRARKNQVFKEQSEQLKQKEKALAAENEKLAEKWGSLEIEF  178

Query  536   LYT----------------DVETRLFIGQP  495
                                +VET+LFIG P
Sbjct  179   WSNKNQESGRGGEDSSPSFEVETQLFIGLP  208



>ref|XP_009375846.1| PREDICTED: MADS-box protein SOC1 isoform X2 [Pyrus x bretschneideri]
Length=213

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 146/224 (65%), Gaps = 41/224 (18%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENTTSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY+ +AK+     K  SSE ++QH+K++  ++M K++E+LE SKR+LLGE L
Sbjct  60    SSMQGTIERYLKHAKDNQTNNKSSSSEQNMQHLKQEA-SSMLKQIELLEVSKRQLLGESL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++ +L +I+ QL  S+ N+R RK+ + K+QI++               K++L  +E 
Sbjct  119   GSCTLAELQEIEHQLEKSVYNVRARKNQVFKEQIEQ------------LREKEKLLTAEN  166

Query  542   QRLY-------------------------TDVETRLFIGQPETR  486
              RL                          +DVET LFIG PE+R
Sbjct  167   TRLVEKYGSFKKTLDERREKTPYNESSTSSDVETELFIGLPESR  210



>dbj|BAJ22387.1| suppressor of overexpression of constans 1 [Vigna unguiculata]
Length=211

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + ++     +S E ++QH+K++  A + K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQETIERYRRHNRSAQTVNRSDEQNMQHLKQE-TANLMKKIELLEASKRKLLGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
             CS+++L QI++QL  S+ ++R RK+ + K QI+
Sbjct  119   CSLEELQQIEQQLERSVSSVRARKNQVYKDQIE  151



>ref|XP_006583366.1| PREDICTED: MADS-box protein SOC1-like isoform X8 [Glycine max]
Length=224

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 157/227 (69%), Gaps = 27/227 (12%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYK-KSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  ++I+RY  + K++     +S E ++QH+K++    M K++++LE +KRK LGEGL 
Sbjct  60    SSMQESIERYRRHTKHVNPTTFRSVEQNMQHLKQEA-ENMMKKIDLLEAAKRKFLGEGLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             +CSI++L +I++QL  SL N+R RK  + K+QI++L+EKEK L +ENA+L +   +SE  
Sbjct  119   ACSIEELQRIEQQLERSLSNVRARK--VFKEQIEQLKEKEKALLDENAKLTENARLSEKH  176

Query  539   RLY----------------------TDVETRLFIGQPETRPPAGDHN  465
              ++                      +DVET LFIG P+TR     H+
Sbjct  177   DIHLQPATKNQNVNQPQCNAESSSSSDVETELFIGLPDTRARHISHH  223



>gb|AGB51005.1| MADS box transcription factor SOC1 variant 19 [Brassica juncea]
Length=213

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L QI++QL  S++ +R RK+ + K+QI +L++KEK L  EN +L ++    E + 
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQKEKALAAENEKLAEKWGSHEIEV  178

Query  536   L----------------YTDVETRLFIGQP  495
                               ++VET+LFIG P
Sbjct  179   WSNKNQESGRGDEDSSPSSEVETQLFIGLP  208



>ref|XP_009617469.1| PREDICTED: MADS-box protein SOC1-like isoform X6 [Nicotiana tomentosiformis]
Length=219

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 153/214 (71%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS-SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS+ + I+RY  + K+  Q +    E +LQH++ +  A++ K++E+LE+SKRKLLGEGL 
Sbjct  60    SSTQEIIERYKRHNKDKVQPENQVGEQNLQHMQHE-AASLMKKIELLEESKRKLLGEGLQ  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV----  552
             SC++ +L QI++QL  S+  IR RK  + K+QI+RL+EKEKIL  ENA L+++       
Sbjct  119   SCTLGELQQIEKQLERSVSTIRARKIQVFKEQIERLKEKEKILASENAILREKFGGLQRR  178

Query  551   ------SEPQRLYT------DVETRLFIGQPETR  486
                    E + L T      DVET LFIG PE R
Sbjct  179   QGSTGEKEGEALCTESSEKSDVETELFIGPPECR  212



>ref|XP_004143998.1| PREDICTED: agamous-like MADS-box protein AGL19-like [Cucumis 
sativus]
 ref|XP_004166995.1| PREDICTED: agamous-like MADS-box protein AGL19-like [Cucumis 
sativus]
Length=222

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 143/210 (68%), Gaps = 14/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFS+ 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSNC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S NKTI RY N  K+L     ++   +Q  KE    +M+K++E LE  KRKLLG+GLD 
Sbjct  61    -SMNKTIDRYQNRTKDLMSSNSTAIEDVQLEKEYDSFSMTKKLEHLEVCKRKLLGDGLDL  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSID+L Q++ QL  SL  IR RK  + K +I +L+E+EK+L EENA L+ ++       
Sbjct  120   CSIDELQQLERQLERSLSKIRSRKYQMLKDEIMKLKEEEKMLLEENAALQIKVISESSKK  179

Query  557   ------AVSEPQRLYTDVETRLFIGQPETR  486
                   + S       DVET LFIG PE R
Sbjct  180   QESNQRSESSNHEEIMDVETELFIGPPERR  209



>gb|KDO85938.1| hypothetical protein CISIN_1g027691mg [Citrus sinensis]
Length=167

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ +I+FSP GKL EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY+ + K+    ++ +E ++QH+K +  A M K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQETIERYLKHTKDTRNKQQPTEQNMQHLKHEA-ANMVKKIELLEVSKRKLLGEGLAS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             C++++L QI+ QL  S+ NIR RK+ +  +QI
Sbjct  119   CTLEELQQIERQLEKSVSNIRARKNQVFNEQI  150



>ref|XP_006445195.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
 gb|ESR58435.1| hypothetical protein CICLE_v10022568mg [Citrus clementina]
Length=170

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ +I+FSP GKL EF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY+ + K+    ++ +E ++QH+K +  A M K++E+LE SKRKLLGEGL S
Sbjct  60    SSMQETIERYLKHTKDTRNKQQPTEQNMQHLKHEA-ANMVKKIELLEVSKRKLLGEGLAS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             C++++L QI+ QL  S+ NIR RK+ +  +QI
Sbjct  119   CTLEELQQIERQLEKSVSNIRARKNQVFNEQI  150



>emb|CDP08914.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 151/211 (72%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF S 
Sbjct  114   MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFGS-  172

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  + I+RY  +AK++     S+E ++Q +K++  A+M K++E+LE SKRKLLGEGL S
Sbjct  173   SSMKEIIERYQKHAKDVRANNPSAEQNMQQLKQE-TASMVKKIELLEASKRKLLGEGLVS  231

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C++++L Q++ QL  S+  IR RK  + ++QI++L+EKEK+LE EN +L ++     PQ 
Sbjct  232   CTVEELQQLERQLERSVNCIRARKMQVFQEQIEKLKEKEKVLEAENDKLLEKCGAEPPQT  291

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PE R
Sbjct  292   SKENTEIVPCTESSEVSDVETGLFIGPPERR  322



>ref|XP_008342903.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Malus domestica]
Length=217

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 146/228 (64%), Gaps = 45/228 (20%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENTTSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKR----KLL  735
             SS   TI+RY  +AK+     K  SSE ++QH+K++  + M K++E+LE SKR    KLL
Sbjct  60    SSMQGTIERYQKHAKDNQTNDKSSSSEQNMQHLKQEATSMM-KQIELLEVSKRFMALKLL  118

Query  734   GEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA  555
             GEGL SC++ +L +I++QL  S+ N+R RKS + K+QI++               K++L 
Sbjct  119   GEGLGSCTLAELQEIEDQLEKSVYNVRARKSQVFKEQIEQ------------LREKEKLL  166

Query  554   VSEPQRLY-------------------------TDVETRLFIGQPETR  486
              +E  RL                          +DVET LFIG PE+R
Sbjct  167   TAENTRLVEKYGSFKKTLHERREKTPYNESSTSSDVETELFIGLPESR  214



>gb|AAX47171.2| SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 a [Pisum sativum]
Length=216

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S    TI+RY  N ++    ++S E ++Q++K++  A++ K++E+LE SKRKL+GEGL S
Sbjct  60    SCMQDTIERYRRNTRSAQPLQRSDEQNMQNLKQE-TASLMKKIELLEASKRKLMGEGLGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+++L QI++QL  S+  +R RK+ + K QI++
Sbjct  119   CSLEELQQIEQQLEKSVSTVRARKNQVYKNQIEQ  152



>emb|CAL36577.1| deficiens H68 homologue [Misopates orontium]
Length=217

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 154/217 (71%), Gaps = 20/217 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY  + K L      +E ++QHV+ +  A++ K++E LE SKRKLLGEGL +
Sbjct  60    SSMQDTIERYQGHTKELQANNPPAEHNIQHVRHEA-ASLMKKIEQLETSKRKLLGEGLGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE--P  543
             C+ ++L Q+++QL  S+  IR RK+ + KQQI++L+EK K L  ENA L +++ V +  P
Sbjct  119   CTFEELQQLEQQLERSVATIRARKTQMFKQQIEQLKEKGKSLAAENAMLHQKIGVEQQVP  178

Query  542   ----QRL---------YTDVETRLFIGQPET---RPP  480
                 Q+           +DVET LFIG PET   RPP
Sbjct  179   ALNLQKPVMGSSEISEVSDVETELFIGLPETRAKRPP  215



>ref|XP_003549870.1| PREDICTED: agamous-like MADS-box protein AGL19-like [Glycine 
max]
Length=220

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 149/208 (72%), Gaps = 12/208 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLC+AE+ LI+FS  G+LYEFSS 
Sbjct  1     MVRGKTQMKRIENETSRQVTFSKRRNGLLKKAFELSVLCEAEVALIIFSTRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS NKT++RY    K+LG   K  +   +H+KE G  +M+K++E LE S+RKLLG+ LD 
Sbjct  60    SSVNKTVERYQRKIKDLGVSNKGIQKKTRHLKE-GDMSMAKKIEHLEDSRRKLLGDELDK  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSID+L Q++ QL  SL  IR RK+ L +++I+ L+++EK L E N  L+++  + + QR
Sbjct  119   CSIDELQQLENQLERSLDKIRARKNQLFRERIENLKQEEKCLLEVNKRLREQYRI-DRQR  177

Query  536   LYTD---------VETRLFIGQPETRPP  480
               TD         VET LFIG+PE R P
Sbjct  178   CLTDNVTEKEAEEVETELFIGRPERRMP  205



>gb|KHN34444.1| Agamous-like MADS-box protein AGL19 [Glycine soja]
Length=227

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 17/214 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLC+AE+ LI+FS  G+LYEFSS+
Sbjct  1     MVRGKTQMKRIENETSRQVTFSKRRNGLLKKAFELSVLCEAEVALIIFSTRGRLYEFSSS  60

Query  896   --SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
               SS NKT++RY    ++LG   K    + QH+KE  + +M+K++E LE S+RKLLG+ L
Sbjct  61    RCSSINKTVERYQRKIEDLGVSNKGIHENTQHLKEVDM-SMAKKIEHLEDSRRKLLGDEL  119

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
             D CSID+L Q++ QL  SL  IR  K+ L +++I++L+E+EK L E N  L+++  + E 
Sbjct  120   DKCSIDELQQLENQLERSLDKIRATKNQLFRKRIEKLKEEEKCLLEVNKRLREQYRI-ER  178

Query  542   QRLYTD-------------VETRLFIGQPETRPP  480
             QR  +D             VET LFIG+PE R P
Sbjct  179   QRCLSDQDVEFATKKEGEEVETELFIGRPERRMP  212



>gb|ADU17781.1| forever young flower protein [Oncidium hybrid cultivar]
Length=225

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRG+TE++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGRTEMRRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI+RY  N+K +    K++E  +Q  K+D    +SKR++VL+ SKRKL+GE L+S
Sbjct  60    SSMPKTIERYRMNSKEVISNNKATEHDIQQWKQD-TDLISKRIDVLQDSKRKLMGENLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CS+D+LH+++ QL  S+  +R RK+ L ++Q+
Sbjct  119   CSVDELHELESQLEQSISKVRGRKNHLLEEQV  150



>gb|AFH41827.1| MADS-box protein SOC1 [Brassica juncea]
Length=213

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++ RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMMRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CSI++L QI++QL  S++ +R RK+ + K+QI
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQI  150



>gb|AAP20424.1| MADS-box protein [Cardamine flexuosa]
Length=213

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE ++Q++K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TIDRYLRHTKDRVSSKPVSEENMQYLKFE-AANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>gb|AGB51015.1| MADS box transcription factor SOC1 variant 10 [Brassica nigra]
Length=213

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLG+G+ S
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGDGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ +R RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCVRARKTQVFKEQIEQ  152



>ref|XP_004298725.1| PREDICTED: agamous-like MADS-box protein AGL19-like [Fragaria 
vesca subsp. vesca]
Length=225

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 121/154 (79%), Gaps = 3/154 (2%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  GKL+EFSS 
Sbjct  1     MVRGKTQMKRIENAASRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSNRGKLFEFSSC  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSS--ETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS NKTI R+   AK+ G   K++     ++   ED  ++M+ R+E++E SKRKLLG+GL
Sbjct  61    SSLNKTIDRFQKRAKDQGLSGKAARDHDHMELANED-TSSMAMRIELIESSKRKLLGDGL  119

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             +SCSID+LHQ+++ L  SL  IR++K+L+ ++QI
Sbjct  120   ESCSIDELHQLEKDLERSLAKIRDQKNLMLREQI  153



>gb|AAP20423.1| MADS-box protein [Brassica rapa subsp. pekinensis]
Length=213

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKA ELSVLCDAE++LI+FSP  KLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKASELSVLCDAEVSLIIFSPKAKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + TI RY+ + K+    K  SE +LQH+K +  A M K++E LE SKRKLLGEG+ S
Sbjct  61    NMQD-TIDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMKKIEQLEASKRKLLGEGIGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++L QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   CSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQ  152



>emb|CAA53782.1| transcription factor [Nicotiana tabacum]
 gb|AFY06683.1| suppressor of overexpression of CO 1 [Nicotiana tabacum]
Length=219

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 151/214 (71%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS-SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + I+RY  + K+  Q +    E +LQH+ +   A++ K++E+LE+SKRKLLGEGL 
Sbjct  60    SSMQEIIERYKRHTKDKVQPENQVGEQNLQHM-QHAAASLMKKIELLEESKRKLLGEGLQ  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL------  558
             SCS+ +L QI++QL  S+  IR RK  + K+QI+RL+EKEKIL  ENA L+++       
Sbjct  119   SCSLVELQQIEKQLERSVSTIRARKIQVFKEQIERLKEKEKILASENAILREKFGGLQQR  178

Query  557   ----AVSEPQRLYT------DVETRLFIGQPETR  486
                    E + L T      DVET LFIG PE R
Sbjct  179   QGSSGEKEGEALCTESSEKSDVETELFIGPPECR  212



>gb|ADO61014.1| suppressor of overexpression of CONSTANS 1 [Helianthus annuus]
Length=212

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 153/209 (73%), Gaps = 15/209 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKK FELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKGFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY +  K++ Q   SS   +QH+K +  A M+K+VE+LE +KR+LLGEGL +
Sbjct  60    SSMQETIERYRSQVKDV-QTDISSVEDVQHLKHE-TAIMAKKVELLEVAKRRLLGEGLGA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR---LAVSE  546
              +ID+L +I++QL   +R +R RK  + ++QI++L+ KEK+L  ENA L ++   + V+E
Sbjct  118   TTIDELVRIEQQLERGVRLVRARKMQVYQEQIEQLQAKEKLLAAENAVLTEKCQAVQVTE  177

Query  545   PQRL---------YTDVETRLFIGQPETR  486
              ++           +DVET LFIG PETR
Sbjct  178   ERQADFRVLENGENSDVETELFIGPPETR  206



>ref|XP_007051979.1| AGAMOUS-like 20 isoform 2 [Theobroma cacao]
 gb|EOX96136.1| AGAMOUS-like 20 isoform 2 [Theobroma cacao]
Length=262

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 152/213 (71%), Gaps = 18/213 (8%)
 Frame = -1

Query  1082  SEMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFS  903
             +EMVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+
Sbjct  48    AEMVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFA  107

Query  902   STSSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S SS  +TI+RY  + K+     K SE ++Q +K +  A M K++E+LE S+RKLLGEGL
Sbjct  108   S-SSMQETIERYNRHTKD--TRTKPSEQNMQLLKTEA-ANMVKKIELLEVSRRKLLGEGL  163

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC++++L QI++QL  S+ +IR RK+ + K+QI++L+EKEK+L  ENA L ++  +   
Sbjct  164   GSCTLEELLQIEQQLERSVSSIRARKAQVFKEQIEQLKEKEKVLAAENARLCEKCGMQPW  223

Query  542   Q--------------RLYTDVETRLFIGQPETR  486
             Q                  DVET LFIG PE R
Sbjct  224   QGSKEQKENVPCDESSPSIDVETELFIGPPERR  256



>ref|XP_002867741.1| hypothetical protein ARALYDRAFT_492570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44000.1| hypothetical protein ARALYDRAFT_492570 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 19/213 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   K ++ S Q    D  + ++K++E LE SKRKLLGEG+D+
Sbjct  61    SIA-KTIERYQRRIKEIGINHKRNDNSQQA--RDETSGLTKKIEQLETSKRKLLGEGIDA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR-LAVSEPQ  540
             CSI++L Q++ QL  SL  IR +K  L +++I++L+E+E+ L +EN ELK++ L +  P 
Sbjct  118   CSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKEQERNLVKENKELKEKWLGMGAPT  177

Query  539   RLYT---------------DVETRLFIGQPETR  486
                +               +VET LFIG P+TR
Sbjct  178   IASSQSTLSSSEVNIDDNMEVETGLFIGPPDTR  210



>ref|XP_002320747.2| hypothetical protein POPTR_0014s07010g, partial [Populus trichocarpa]
 gb|EEE99062.2| hypothetical protein POPTR_0014s07010g, partial [Populus trichocarpa]
Length=371

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 142/220 (65%), Gaps = 22/220 (10%)
 Frame = -1

Query  1079  EMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSS  900
             EMVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S
Sbjct  152   EMVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS  211

Query  899   TSSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             T S  +TI+RY  + K     K+  E ++  +KE+  A+M K++E LE SKRKLLGE L 
Sbjct  212   T-SMQETIERYRRHVKENNTNKQPVEQNMLQLKEEA-ASMIKKIEHLEVSKRKLLGECLG  269

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQID-----RlrekekileeenaelkKRLA  555
             SC++++L QI++QL  S+  IR RK+ + K+QI+           +     +    +   
Sbjct  270   SCTVEELQQIEQQLERSVSTIRARKNQVFKEQIELLRQKEKLLAAENARLSDECGAQSWP  329

Query  554   VSEPQR-----------LYTDVETRLFIGQPETR----PP  480
             VS  QR             +DVET LFIG PETR    PP
Sbjct  330   VSREQRDLPREDLRESSSISDVETELFIGPPETRTKRIPP  369



>ref|XP_007051978.1| MIKC mads-box transcription factor SOC1 isoform 1 [Theobroma 
cacao]
 gb|EOX96135.1| MIKC mads-box transcription factor SOC1 isoform 1 [Theobroma 
cacao]
Length=213

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 150/211 (71%), Gaps = 18/211 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K+     K SE ++Q +K +  A M K++E+LE S+RKLLGEGL S
Sbjct  60    SSMQETIERYNRHTKDT--RTKPSEQNMQLLKTEA-ANMVKKIELLEVSRRKLLGEGLGS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             C++++L QI++QL  S+ +IR RK+ + K+QI++L+EKEK+L  ENA L ++  +   Q 
Sbjct  117   CTLEELLQIEQQLERSVSSIRARKAQVFKEQIEQLKEKEKVLAAENARLCEKCGMQPWQG  176

Query  539   -------------RLYTDVETRLFIGQPETR  486
                              DVET LFIG PE R
Sbjct  177   SKEQKENVPCDESSPSIDVETELFIGPPERR  207



>gb|AFX72886.1| MADS-box protein SOC1.2 [Aquilegia coerulea]
Length=221

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 146/211 (69%), Gaps = 16/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN  SRQV+FSKRR+GLLKKA ELSVLCDAE++LIVFSPTGKLYEFS+ 
Sbjct  1     MVRGKTQVKRIENVASRQVTFSKRRKGLLKKAHELSVLCDAEVSLIVFSPTGKLYEFSN-  59

Query  896   SSSNKTIQRYM-NNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  ++I+RY  + AK+L  Y    E ++Q +K +  A   K++E+LE SKRKLLGEGL 
Sbjct  60    SSMQRSIERYQRHQAKDLELYNNEIEHNMQQLKYEA-AECEKKIEILEVSKRKLLGEGLS  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             SCS ++L  ++ QL  S+ NIR RKS L  +Q+D+L+E+E+ L EE   L+++ A    Q
Sbjct  119   SCSTEELQHLENQLQRSIINIRHRKSQLLAEQVDQLKEQERTLMEEQVMLREQCAQQVHQ  178

Query  539   RL-------------YTDVETRLFIGQPETR  486
              +               D+E  LFIG+PE R
Sbjct  179   SIEQREIVPSCESSDNCDLELELFIGRPEGR  209



>gb|ADO61007.1| suppressor of overexpression of CONSTANS 1 [Helianthus annuus]
Length=212

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 154/209 (74%), Gaps = 15/209 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKK FELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKGFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY +  K++ Q   SS   +QH+K +  A M+K+VE+LE +KR+LLGEGL +
Sbjct  60    SSMQETIERYRSQVKDV-QTDISSVEDVQHLKHE-TAIMAKKVELLEVAKRRLLGEGLGA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR---LAVSE  546
              +ID+L +I++QL   +R +R RK  + ++QI++L+ KEK+L +ENA L ++   + V+E
Sbjct  118   TTIDELVRIEQQLERGVRLVRARKMQVYQEQIEQLQAKEKLLADENAILTEKCQAVQVTE  177

Query  545   PQRL---------YTDVETRLFIGQPETR  486
              ++           +DVET LFIG PETR
Sbjct  178   ERQADFRVLENGENSDVETELFIGPPETR  206



>ref|XP_006576386.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Glycine max]
 ref|XP_006576387.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Glycine max]
 ref|XP_006576388.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Glycine max]
 ref|XP_006576389.1| PREDICTED: MADS-box protein SOC1-like isoform X4 [Glycine max]
Length=205

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 144/202 (71%), Gaps = 10/202 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS +GKLYEF+S 
Sbjct  1     MVRGKTQIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSSSGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYK-KSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS   +I+RY  + K+      +S E ++QH+K++  A M K++ +LE +KRK LGEGL 
Sbjct  60    SSIQCSIERYRRHTKHDNPTTFRSVEQNMQHLKQEA-ANMMKKIGLLEAAKRKFLGEGLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             +CSI++L  I++QL  SL N+R RK  + K+QI++L+ K  I  +   + +    V++PQ
Sbjct  119   ACSIEELQWIEQQLERSLSNVRTRKIQVFKEQIEQLKGKHGINLQTETKNQN---VNQPQ  175

Query  539   ----RLYTDVETRLFIGQPETR  486
                    +DVET L IG P+TR
Sbjct  176   YNAGSPSSDVETELIIGLPDTR  197



>ref|XP_010455601.1| PREDICTED: agamous-like MADS-box protein AGL14 isoform X2 [Camelina 
sativa]
Length=207

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGPNHKRNDNSQQ--SKDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              SI++L Q++ QL  SL  IR +K  L +++I+ L+EK  +              +E   
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLREEIEILKEKCDMGGRGIVARTSSSITTEEVD  178

Query  536   L---YTDVETRLFIGQPETR-----PPA  477
             +     +V T LFIG PETR     PP 
Sbjct  179   IDDNEMEVVTDLFIGPPETRHSKKFPPP  206



>gb|ACJ86138.1| unknown [Medicago truncatula]
Length=227

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 25/219 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSET--SLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY ++ + +     +SE+  + Q +KE+    M K++++LE SKRKLLGEGL
Sbjct  60    SSILETIERYRSHTR-INNTPTTSESVENTQQLKEEA-ENMMKKIDLLETSKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR------  561
              SCSID+L +I++QL  S+  IR +K+ + ++QID+L+EKEK L  EN  L ++      
Sbjct  118   GSCSIDELQKIEQQLEKSINKIRVKKTKVFREQIDQLKEKEKALVAENVRLSEKYGNYST  177

Query  560   ----------LAVSEP----QRLYTDVETRLFIGQPETR  486
                       +A  EP        +DVET LFIG PETR
Sbjct  178   QESTKDQRENIAEVEPYADQSSPSSDVETELFIGLPETR  216



>ref|XP_010433968.1| PREDICTED: agamous-like MADS-box protein AGL19 [Camelina sativa]
 ref|XP_010433969.1| PREDICTED: agamous-like MADS-box protein AGL19 [Camelina sativa]
 ref|XP_010433970.1| PREDICTED: agamous-like MADS-box protein AGL19 [Camelina sativa]
 ref|XP_010433971.1| PREDICTED: agamous-like MADS-box protein AGL19 [Camelina sativa]
Length=220

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 25/221 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   K    S Q    D    ++K++E LE SKRKLLGEG+D 
Sbjct  61    SIA-KTIERYQRRIKEIGINHKGDANSQQA--RDETQGLTKKIEQLEISKRKLLGEGIDK  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSI++L Q++ QL  SL  IR +K  L ++QI++L+E+E+ L +EN ELK++        
Sbjct  118   CSIEELQQLENQLERSLTRIRAKKYQLLREQIEKLKEEERKLVKENKELKEKWLGMGATV  177

Query  557   ----------AVSEPQRLYTDVETRLFIGQPETR-----PP  480
                        V+       +VET LFIG PETR     PP
Sbjct  178   ASSQSTLSSSEVNIDDNDNMEVETGLFIGPPETRQSKKTPP  218



>gb|AHM92077.1| MADS-box protein 1 [Erycina pusilla]
Length=221

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 152/216 (70%), Gaps = 22/216 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRG+TE++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEFSS 
Sbjct  1     MVRGRTEMRRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI+RY  N+K++    KS+E  +Q  K+D    +SKR++VL+ SK KL+GE L+S
Sbjct  60    SSMPKTIERYRMNSKDISN-NKSTEQDIQQWKQD-TDLISKRIDVLQDSKLKLMGENLES  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR-----LAV  552
             CS+D+L +++ +L  S+  +RERK+ L ++QI +L+E+E++L EENA L+K+       +
Sbjct  118   CSVDELQELESKLEQSISKVRERKNHLLEEQIVQLKERERMLLEENALLQKQGKHTSFLL  177

Query  551   SEPQRL--------------YTDVETRLFIGQPETR  486
              EPQ                Y DVET L++G P  R
Sbjct  178   KEPQICLNTSKEVVVPKCDEYRDVETELYMGWPAGR  213



>ref|XP_009114655.1| PREDICTED: agamous-like MADS-box protein AGL14 [Brassica rapa]
 ref|XP_009114656.1| PREDICTED: agamous-like MADS-box protein AGL14 [Brassica rapa]
 emb|CDX86738.1| BnaA09g21280D [Brassica napus]
Length=220

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY     +LG   K  + S Q   E     +++++E LE SKRK LGEGLD+
Sbjct  61    SSITKTVERYQKRVHDLGSNHKREDNSQQAKGE--TYGLARKIEQLEISKRKFLGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
              SI++L Q++ QL  SL  IR +K  L ++++D+
Sbjct  119   SSIEELQQLENQLERSLTKIRAKKYQLLREELDK  152



>ref|XP_009796063.1| PREDICTED: MADS-box protein SOC1-like [Nicotiana sylvestris]
 ref|XP_009796069.1| PREDICTED: MADS-box protein SOC1-like [Nicotiana sylvestris]
Length=219

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 151/214 (71%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS-SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + I+RY  + K+  Q +    E +LQH+ +   A++ +++E+LE+SKRKLLGEGL 
Sbjct  60    SSMQEIIERYKRHTKDKVQPENQVGEQNLQHM-QHAAASLMEKIELLEESKRKLLGEGLQ  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL------  558
             SCS+ +L QI++QL  S+  IR RK  + K+QI+RL+EKEKIL  ENA L+++       
Sbjct  119   SCSLVELQQIEKQLERSVSTIRARKIQVFKEQIERLKEKEKILASENAILREKFGGLQQR  178

Query  557   ----AVSEPQRLYT------DVETRLFIGQPETR  486
                    E + L T      DVET LFIG PE R
Sbjct  179   QGSSGEKEGEALCTESSEKSDVETELFIGPPECR  212



>gb|AEO20230.1| SOC1-like protein [Rosa hybrid cultivar]
Length=215

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 148/214 (69%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELS+LCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSILCDAEVALIIFSPRGKLYEFASN  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S    TI+RY  + K+     KS  SE ++Q +K +  + M K++E LE SKRKLLGE L
Sbjct  61    SMQT-TIERYEKHTKDNQANNKSVASEQNVQQLKHEATSMM-KQIEHLEVSKRKLLGESL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
               CSID+L +I++QL  S+ +IR RK+ + K+QI++LREKE++L  EN  L ++    +P
Sbjct  119   GLCSIDELQEIEQQLERSVNSIRARKAQVYKEQIEQLREKERVLTAENQRLNEKCEAMQP  178

Query  542   QRLY---------------TDVETRLFIGQPETR  486
             ++                 +DVET LFIG PE R
Sbjct  179   RQPVSEQRENLACPESSPSSDVETELFIGLPERR  212



>gb|AHI85953.1| SOC1-like protein, partial [Carya cathayensis]
Length=204

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK +++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP  KLYEF+S 
Sbjct  1     MVRGKIQVRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRSKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI RY  + K+     KS E ++QH++ +  A M K++E+LE SKRKLLGE L +
Sbjct  60    SSMQETIDRYRRHTKDAQPINKSVEQNMQHLRHES-ANMVKKIELLEVSKRKLLGESLGA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+D+LH+I++QL  S+  IR RK+ + ++QID+
Sbjct  119   CSLDELHKIEQQLESSVIKIRARKTQVFEEQIDK  152



>gb|AEO20234.1| SOC1-like protein [Spiraea cantoniensis]
Length=221

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 24/219 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  +AK+     KS  SE + QH++++  + M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHAKDNQTNNKSVASEQNTQHLRQEA-SRMMKQIEILEGSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA----  555
              SCS+++L +++ QL  S+ ++R RK  + K+ I++L+EKEK+L  EN  L ++      
Sbjct  119   ASCSLEELQELEHQLEKSVTSVRARKDQVFKELIEQLKEKEKMLAAENVRLMEKCGSIQQ  178

Query  554   -------VSEPQRLY---------TDVETRLFIGQPETR  486
                     S  QR +         +DVET LFIG P  R
Sbjct  179   MQAGAPQTSNEQREHLPYADSSPSSDVETELFIGMPPER  217



>ref|XP_006282713.1| hypothetical protein CARUB_v10005697mg [Capsella rubella]
 gb|EOA15611.1| hypothetical protein CARUB_v10005697mg [Capsella rubella]
Length=220

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 25/221 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI+RY    K +G   K    S Q   +D    ++K++E LE SKRKLLGEG+D+
Sbjct  60    SSITKTIERYQRRVKEIGINHKGDANSQQA--KDETRILTKKIEQLEISKRKLLGEGIDT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSI++L Q++ QL   L  IR +K  L +Q+I++L+E+E+ L +EN ELK++        
Sbjct  118   CSIEELQQLENQLERGLTRIRAKKYQLLRQEIEKLKEEERKLAKENKELKEKWLGMGATV  177

Query  557   ----------AVSEPQRLYTDVETRLFIGQPETR-----PP  480
                        V+       +VET LFIG PETR     PP
Sbjct  178   ASSQSTLSSSEVNIDDDDNMEVETGLFIGPPETRQSKKVPP  218



>emb|CAJ38368.1| MADS-box transcription factor [Plantago major]
Length=221

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 151/223 (68%), Gaps = 24/223 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY ++ K L       E + Q ++ +  A + +++E LE +KRKLLGEG+ +
Sbjct  60    SSLQDTIERYQSHIKELQAENPPLEQNTQQLQYE-TAGLLRKIEQLEAAKRKLLGEGIGA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CS+++L Q++ QL  S+ +IR RK+ L KQQI++L+EK K L  ENA + ++  + +PQ+
Sbjct  119   CSLEELQQLETQLERSVTSIRTRKTQLYKQQIEQLKEKTKALAAENASICQKYGL-QPQK  177

Query  536   -------------------LYTDVETRLFIGQPETRPPAGDHN  465
                                  +DVET LFIG PE+R  A  H+
Sbjct  178   GGGAKLSEERGNAASAEISEVSDVETDLFIGLPESR--ANKHS  218



>gb|AGB51009.1| MADS box transcription factor SOC1 variant 12 [Brassica napus]
Length=213

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++K IENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S+
Sbjct  1     MVRGKTQMKSIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +  + T+ RY+ + K+    K  SE ++QH K +  A M K++E LE SKRKLLGEG+ +
Sbjct  61    NMQD-TVDRYLRHTKDRVSSKPVSEENMQHFKHEA-ANMMKKIEQLEASKRKLLGEGIGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQ  624
             CSID+L QI++QL  S++ +R RK+ + K+Q
Sbjct  119   CSIDELLQIEQQLEKSVKCVRARKNQVFKEQ  149



>gb|KEH31691.1| MADS-box transcription factor [Medicago truncatula]
Length=205

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 145/205 (71%), Gaps = 10/205 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN ++RQV+FSKRR GLLKKAFELSVLCDAE+ LIVFS TGKLYEFSS+
Sbjct  1     MVRGKTQMKRIENESNRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTTGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KT++RY    K L    K  + + QH+KE  +   +K++E LE SKRKLLGE L S
Sbjct  61    SIS-KTVERYQGKVKELVLSTKGIQENTQHLKECDIDT-TKKLEHLELSKRKLLGEELGS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C+ D+L QI+ QL  SL  IR RK+ L K+QI++L++KE++L EEN  L K+  + +   
Sbjct  119   CAFDELQQIENQLERSLSKIRARKNQLLKEQIEKLKDKERLLLEENKRLCKQCGIGQNDC  178

Query  536   LYT--------DVETRLFIGQPETR  486
             L          +VET LFIG+P+ R
Sbjct  179   LNKQQESVHDEEVETELFIGRPKKR  203



>gb|AAO22989.1| MADS-box transcription factor CDM36 [Chrysanthemum x morifolium]
Length=216

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 149/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GL+KKAFELSVL DAE+ LI+FSP GKLYEF++ 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLMKKAFELSVLRDAEVALIIFSPRGKLYEFAN-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY ++ K++ Q   SS   +Q++K +  AAM+K+VE LE +KRKLLGEGL +
Sbjct  60    SSMQETIERYRSHVKDI-QTDTSSVEDVQNLKHE-TAAMAKKVEALEVAKRKLLGEGLGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +ID+L QI++QL  S+R IR RK  +  +QI++L  KEK+L  ENA L ++  +   + 
Sbjct  118   STIDELVQIEQQLERSVRIIRARKMQVYNEQIEQLHAKEKMLAAENAILTEKCIIKTDKA  177

Query  536   L--------------YTDVETRLFIGQPETR  486
                             +DVET LFIG PETR
Sbjct  178   TEEMGVDLNVLESGENSDVETELFIGLPETR  208



>emb|CDY55821.1| BnaCnng29230D [Brassica napus]
Length=221

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 143/215 (67%), Gaps = 21/215 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSPT KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPTSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KTI+RY      +G   K    S Q   E     ++K++E LE +KRK+LGEG+D 
Sbjct  61    SIS-KTIERYQRRVTEIGINHKRDADSQQARGE--TYGLTKKIEQLEITKRKMLGEGIDV  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA------  555
             CSI++LHQ++ QL   L  IR +K  L +++ID+L+E+E+ L +EN EL ++L+      
Sbjct  118   CSIEELHQLENQLERGLTRIRAKKYQLLREEIDKLKEEERNLIKENKELNEKLSGMGAIV  177

Query  554   ------------VSEPQRLYTDVETRLFIGQPETR  486
                         V+       +VET LFIG PE R
Sbjct  178   VASSSSTLTSSEVNTDGNDSMEVETGLFIGPPEPR  212



>ref|NP_194026.1| agamous-like MADS-box protein AGL19 [Arabidopsis thaliana]
 sp|O82743.1|AGL19_ARATH RecName: Full=Agamous-like MADS-box protein AGL19 [Arabidopsis 
thaliana]
 gb|AAG37901.1|AF312664_1 MADS-box protein AGL19 [Arabidopsis thaliana]
 emb|CAA19810.1| putative MADS Box / AGL protein [Arabidopsis thaliana]
 emb|CAB79250.1| putative MADS Box / AGL protein [Arabidopsis thaliana]
 gb|AAN13066.1| putative MADS box AGL protein [Arabidopsis thaliana]
 gb|AEE84684.1| agamous-like MADS-box protein AGL19 [Arabidopsis thaliana]
Length=219

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 147/220 (67%), Gaps = 24/220 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S +  TI+RY    K +G   K ++ S Q    D  + ++K++E LE SKRKLLGEG+D+
Sbjct  61    SIA-ATIERYQRRIKEIGNNHKRNDNSQQA--RDETSGLTKKIEQLEISKRKLLGEGIDA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             CSI++L Q++ QL  SL  IR +K  L +++I++L+ +E+ L +EN +LK++        
Sbjct  118   CSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEKWLGMGTAT  177

Query  536   LYT----------------DVETRLFIGQPETR-----PP  480
             + +                +VET LFIG PETR     PP
Sbjct  178   IASSQSTLSSSEVNIDDNMEVETGLFIGPPETRQSKKFPP  217



>gb|AAK21257.1|AF335244_1 MADS-box transcription factor FBP28 [Petunia x hybrida]
Length=215

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 149/210 (71%), Gaps = 15/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FS  GKLYEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSTRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNL-GQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + I+RY  +++++ G+     + ++Q++K D  A++ K++E+LE SKRKLLGE L 
Sbjct  60    SSMQEIIERYRRHSEDVQGEKPAVEQNNMQNLKLDA-ASLMKKIEILETSKRKLLGEDLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             SCS+++L QI++QL  S+  IR RK  + ++QI+RL+   K+L  ENA L ++    E Q
Sbjct  119   SCSLEELQQIEKQLERSISTIRARKMEVFREQIERLKGNVKVLATENAMLWEKCGDLEMQ  178

Query  539   RLY------------TDVETRLFIGQPETR  486
             +              +DVET LFIG PE R
Sbjct  179   QTSGGEDLSIEGSEKSDVETELFIGLPECR  208



>ref|XP_009362848.1| PREDICTED: agamous-like MADS-box protein AGL19 [Pyrus x bretschneideri]
Length=219

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 143/215 (67%), Gaps = 20/215 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIE+A SRQV+FSKRR GL+KKAFELSVLCDAE+ L+VFS  GKLYEFSS 
Sbjct  1     MVRGKTQMKRIEDAASRQVTFSKRRNGLMKKAFELSVLCDAEVALVVFSARGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQY-KKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS N T+ RY    K+ G    K+ E  ++H K+D    ++K++E +E SKRKLLG  L+
Sbjct  60    SSINNTLDRYQMRVKDAGHLTTKAFEEDMEHEKDD-TQTLAKKIECIEASKRKLLGNDLE  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSE--  546
             SCS+++LHQI+ QL  SL  IR ++S L  +QID+L+E+EK L ++N  L +  ++    
Sbjct  119   SCSMEELHQIENQLERSLTKIRAKRSQLLTEQIDKLKEEEKKLLQQNTRLWEMCSMQPLR  178

Query  545   ---------------PQRLYTDVETRLFIGQPETR  486
                            PQ    DVET LFIG P+ R
Sbjct  179   ASRTSKHGDDHGVFLPQTPNMDVETDLFIGPPKRR  213



>ref|XP_010448808.1| PREDICTED: agamous-like MADS-box protein AGL19 [Camelina sativa]
Length=220

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 144/221 (65%), Gaps = 25/221 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   K    S Q    D    ++K++E LE SKRKLLGEG+D 
Sbjct  61    SIA-KTIERYQRRIKEIGINHKGDANSQQA--RDETHGLTKKIEQLEISKRKLLGEGIDK  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSI++L Q++ QL  SL  IR +K  L ++QI++L+E+E+ L +EN ELK+         
Sbjct  118   CSIEELQQLENQLERSLTRIRAKKYQLLREQIEKLKEEERKLVKENKELKETWLGMGATV  177

Query  557   ----------AVSEPQRLYTDVETRLFIGQPETR-----PP  480
                        V+       +VET LFIG PETR     PP
Sbjct  178   ASSQSTLSSSEVNIDDNDNMEVETGLFIGPPETRQSKKTPP  218



>ref|XP_009345824.1| PREDICTED: agamous-like MADS-box protein AGL19 [Pyrus x bretschneideri]
 ref|XP_009345827.1| PREDICTED: agamous-like MADS-box protein AGL19 [Pyrus x bretschneideri]
 dbj|BAK18786.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=219

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 145/212 (68%), Gaps = 20/212 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ L++FS  GKLYEFSST
Sbjct  1     MVRGKTQMKRIENAASRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSARGKLYEFSST  60

Query  896   SSSNKTIQRYMNNAKNLGQY-KKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             S  + TI+RY    K+ GQ   K+ +  ++H   D    ++K++E +E SKRKLLG  L+
Sbjct  61    SIRS-TIERYQMRVKDQGQLTTKAFQEDMEHETND-TQTLAKKIESIEASKRKLLGNDLE  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA-----  555
             SCS+++LHQ + QL  SL+ IR +K+ L ++QID+L+E+EK L E+NA+L++        
Sbjct  119   SCSMEELHQTENQLERSLKKIRAKKNQLLREQIDKLKEEEKNLLEQNAKLREMCGMQSLG  178

Query  554   ------------VSEPQRLYTDVETRLFIGQP  495
                         V +PQ    DVET LFIG P
Sbjct  179   PSGKSKHGDDREVFQPQTPNVDVETDLFIGPP  210



>gb|AEO20233.1| SOC1-like protein [Prunus yedoensis]
Length=216

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 156/214 (73%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKK-SSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS   TI+RY  + K N   YK  S++ ++QH+K++  ++M K++E+LE SKRKLLGEGL
Sbjct  60    SSMQTTIERYQKHTKDNHTNYKSVSTDQNMQHLKQES-SSMMKQIELLEVSKRKLLGEGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              SC+I++L ++++QL  S+ N+R RK+ + K+QI++LREKEK L  EN  L ++    +P
Sbjct  119   GSCTIEELQELEQQLERSVSNVRARKTQVFKEQIEQLREKEKALTAENERLIEKCGSIQP  178

Query  542   QR---------LYT------DVETRLFIGQPETR  486
             ++          YT      DVET LFIG PE R
Sbjct  179   RQASNEQRENLAYTESSPSSDVETELFIGLPEER  212



>ref|XP_007051982.1| AGAMOUS-like 20 isoform 5, partial [Theobroma cacao]
 gb|EOX96139.1| AGAMOUS-like 20 isoform 5, partial [Theobroma cacao]
Length=221

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  1088  R*SEMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYE  909
             R +EMVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYE
Sbjct  10    RNAEMVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYE  69

Query  908   FSSTSSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGE  729
             F+S SS  +TI+RY  + K+     K SE ++Q +K +  A M K++E+LE S+RKLLGE
Sbjct  70    FAS-SSMQETIERYNRHTKD--TRTKPSEQNMQLLKTEA-ANMVKKIELLEVSRRKLLGE  125

Query  728   GLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQID  618
             GL SC++++L QI++QL  S+ +IR RK+ + K+QI+
Sbjct  126   GLGSCTLEELLQIEQQLERSVSSIRARKAQVFKEQIE  162



>emb|CDY13289.1| BnaC09g23670D [Brassica napus]
Length=217

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY     +LG   K  + + Q   E     +++++E LE SKRK LGEGLD+
Sbjct  61    SSITKTVERYQKRIHDLGSSHKREDNTQQAKGE--TYGLARKIEQLEISKRKFLGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
              SI++L Q++ QL  SL  IR +K  L ++++D+
Sbjct  119   SSIEELQQLENQLERSLTKIRAKKYQLLREELDK  152



>gb|KEH19008.1| MADS-box transcription factor [Medicago truncatula]
Length=230

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 153/219 (70%), Gaps = 25/219 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFTS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSET--SLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY ++ + +     +SE+  + Q +KE+    M K++++LE SKRKLLGEGL
Sbjct  60    SSILETIERYRSHTR-INNTPTTSESVENTQQLKEEA-ENMMKKIDLLETSKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA----  555
              SCSID+L +I++QL  S+  IR +K+ + ++QI++L+EKEK L  ENA L ++      
Sbjct  118   GSCSIDELQKIEQQLERSISKIRAKKTQVFREQIEQLKEKEKTLVAENAMLAEKYGNYSS  177

Query  554   --VSEPQR--------------LYTDVETRLFIGQPETR  486
                ++ QR                +DVET LFIG PETR
Sbjct  178   QEATKDQRENIVEAETYADQSSPSSDVETELFIGLPETR  216



>gb|KEH19009.1| MADS-box transcription factor [Medicago truncatula]
Length=224

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 153/219 (70%), Gaps = 25/219 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFTS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSET--SLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY ++ + +     +SE+  + Q +KE+    M K++++LE SKRKLLGEGL
Sbjct  60    SSILETIERYRSHTR-INNTPTTSESVENTQQLKEEA-ENMMKKIDLLETSKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA----  555
              SCSID+L +I++QL  S+  IR +K+ + ++QI++L+EKEK L  ENA L ++      
Sbjct  118   GSCSIDELQKIEQQLERSISKIRAKKTQVFREQIEQLKEKEKTLVAENAMLAEKYGNYSS  177

Query  554   --VSEPQR--------------LYTDVETRLFIGQPETR  486
                ++ QR                +DVET LFIG PETR
Sbjct  178   QEATKDQRENIVEAETYADQSSPSSDVETELFIGLPETR  216



>emb|CCA61011.1| GSOC2 protein [Gerbera hybrid cultivar]
Length=209

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 148/211 (70%), Gaps = 12/211 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP  KLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRSKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K +     SS   +QH+K+   A M+K++E+LE +KR+LLGEGL +
Sbjct  60    SSMQETIKRYRGHVKEIRTQNASSTEDVQHLKQLA-AGMAKKIELLEVAKRRLLGEGLGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
              +I++L QI++QL  S+  IR RK  +  +Q+++L+ KEK+LE ENA L ++  V   +R
Sbjct  119   SNIEELQQIEQQLEKSVCIIRARKMQVYNEQVEQLQAKEKMLEAENAILNEKCQVLTEER  178

Query  536   ----------LYTDVETRLFIGQPETRPPAG  474
                         +DVET LFIGQ + R   G
Sbjct  179   GEDFEVAENGEKSDVETELFIGQAKWRITKG  209



>gb|KFK39263.1| mads box agl protein [Arabis alpina]
Length=220

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 145/214 (68%), Gaps = 20/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L+VFSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   K    S Q    D    ++K++E LE SKRKL GEG+D+
Sbjct  61    SIA-KTIERYQKRIKEIGSSHKRDNNSQQA--RDETQGLTKKIEQLEISKRKLHGEGIDA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR------LA  555
             CSI++L Q++ QL  SL  IR +K  L ++QI++L+E+E+ L +EN ELK++      + 
Sbjct  118   CSIEELQQLENQLDRSLTRIRAKKYQLLREQIEKLKEEERKLIKENKELKEKCRGMGAMV  177

Query  554   VSEPQRLYT-----------DVETRLFIGQPETR  486
             V+      +           +VET LFIG PETR
Sbjct  178   VASSSSTPSSSEMNIDDNDMEVETGLFIGPPETR  211



>ref|XP_004983814.1| PREDICTED: MADS-box transcription factor 56-like [Setaria italica]
Length=225

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 11/208 (5%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFASA  60

Query  896   SSSNKTIQRYM----NNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGE  729
             SS  KTI RY      N  N     KS +  +Q VK D + +++ R+E LE+SKRK LGE
Sbjct  61    SSLQKTIDRYKAYTRENVNN-----KSVQQDIQQVKADAL-SLANRLEALEKSKRKFLGE  114

Query  728   GLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS  549
              L+ CS+++LH ++ +L  SL  IR +K+ L +QQI +L+EKE+ L ++N EL+++    
Sbjct  115   NLEGCSVEELHSLEVKLEKSLHVIRGKKTQLLEQQIAKLKEKERTLLKDNKELREKQRNV  174

Query  548   EPQRLYTDVETRLFIGQPETRP-PAGDH  468
             +PQ +   +  R     P   P P  D+
Sbjct  175   QPQPVAPALNPRCLPPWPRNLPAPCNDN  202



>ref|XP_009375845.1| PREDICTED: MADS-box protein SOC1 isoform X1 [Pyrus x bretschneideri]
Length=217

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 146/228 (64%), Gaps = 45/228 (20%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENTTSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKK--SSETSLQHVKEDGVAAMSKRVEVLEQSKR----KLL  735
             SS   TI+RY+ +AK+     K  SSE ++QH+K++  ++M K++E+LE SKR    +LL
Sbjct  60    SSMQGTIERYLKHAKDNQTNNKSSSSEQNMQHLKQEA-SSMLKQIELLEVSKRFMALQLL  118

Query  734   GEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA  555
             GE L SC++ +L +I+ QL  S+ N+R RK+ + K+QI++               K++L 
Sbjct  119   GESLGSCTLAELQEIEHQLEKSVYNVRARKNQVFKEQIEQ------------LREKEKLL  166

Query  554   VSEPQRLY-------------------------TDVETRLFIGQPETR  486
              +E  RL                          +DVET LFIG PE+R
Sbjct  167   TAENTRLVEKYGSFKKTLDERREKTPYNESSTSSDVETELFIGLPESR  214



>ref|XP_003623808.1| MADS-box transcription factor [Medicago truncatula]
Length=206

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = -1

Query  1055  LKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSSTSSSNKTI  876
             +KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+ S   TI
Sbjct  1     MKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSCSMQDTI  60

Query  875   QRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDSCSIDDLH  696
             +RY  N ++    ++S E ++Q++K +  A++ K++E+LE SKRKL+GEGL SCS+D+L 
Sbjct  61    ERYRRNTRSAQPMQRSDEQNMQNLKHE-TASLMKKIELLEASKRKLMGEGLGSCSLDELQ  119

Query  695   QIQEQLVISLRNIRERKSLLCKQQIDR  615
             QI++QL  S+  +R RK+   K QID+
Sbjct  120   QIEQQLEKSVSVVRARKNQAYKHQIDQ  146



>ref|XP_009108594.1| PREDICTED: agamous-like MADS-box protein AGL19 [Brassica rapa]
 ref|XP_009108595.1| PREDICTED: agamous-like MADS-box protein AGL19 [Brassica rapa]
 emb|CDX76346.1| BnaA08g10540D [Brassica napus]
Length=221

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 142/215 (66%), Gaps = 21/215 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSPT KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPTSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S S KTI+RY      +G   K    S Q   E     ++K++E LE  KRK+LGEG+D 
Sbjct  61    SIS-KTIERYQRRVTEIGINHKRDADSQQARGE--TYGLTKKIEQLEIIKRKMLGEGIDV  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA------  555
             CSI++LHQ++ QL   L  IR +K  L +++ID+L+E+E+ L +EN EL ++L+      
Sbjct  118   CSIEELHQLENQLERGLTRIRAKKYQLLREEIDKLKEEERNLIKENKELNEKLSGMGAIV  177

Query  554   ------------VSEPQRLYTDVETRLFIGQPETR  486
                         V+       +VET LFIG PE R
Sbjct  178   VASSSSTLTSSEVNTDGNDSMEVETGLFIGPPEPR  212



>ref|NP_001280778.1| agamous-like MADS-box protein AGL19 [Malus domestica]
 dbj|BAG48169.1| MADS-box transcription factor [Malus domestica]
 gb|ADL36739.1| MADS domain class transcription factor [Malus domestica]
Length=219

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 143/212 (67%), Gaps = 20/212 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ L++FS  GKLYEFSST
Sbjct  1     MVRGKTQMKRIENAASRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSARGKLYEFSST  60

Query  896   SSSNKTIQRYMNNAKNLGQY-KKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             S  + TI RY    K+ GQ   K+ +  ++H   D    ++K++E +E SKRKLLG  L+
Sbjct  61    SIRS-TIDRYQMRVKDQGQLTTKAFQEDMEHETND-TQTLAKKIESIEASKRKLLGNDLE  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA-----  555
             SCS+++LHQ + QL  SL+ IR +K  L ++QID+L+E+EK L E+NA+L++        
Sbjct  119   SCSMEELHQTENQLERSLKKIRAKKHQLLREQIDKLKEEEKNLLEQNAKLREMCGMQQLG  178

Query  554   ------------VSEPQRLYTDVETRLFIGQP  495
                         V +PQ    DVET LFIG P
Sbjct  179   PSRKSKHGDDREVFQPQTPNVDVETDLFIGPP  210



>gb|AAD16052.1| putative MADS box transcription factor ETL [Eucalyptus globulus 
subsp. globulus]
Length=205

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 141/207 (68%), Gaps = 17/207 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTQMKRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI++Y   AK++    K++E S+Q  K + +  M K++E  E S+R+LLGEGLDS
Sbjct  60    SSLCKTIEKYQTRAKDM--EAKTAEISMQPSKGNTL-DMEKKIEHFEISRRRLLGEGLDS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS----  549
             CS+++L Q + QL  SL  IR RK+ L ++ I+RL+ +E+ L EE  +L + +       
Sbjct  117   CSVEELQQTENQLERSLTKIRARKNHLIREHIERLKAEERKLLEEKRKLLQEIECGKGLT  176

Query  548   ---------EPQRLYTDVETRLFIGQP  495
                      E +    DVET LFIG P
Sbjct  177   PVSSERPREEIRAESMDVETELFIGPP  203



>dbj|BAK24000.1| suppressor of overexpression of constans 1 [Gypsophila paniculata]
Length=221

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 21/216 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSS-ETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  +TI RY  + ++    + SS E  +Q +KE+  A++ K+VE +E +KR+LLGE L 
Sbjct  60    SSMQETIGRYQRHVRDAQPARDSSAEQDIQSLKEE-TASLVKKVEAIEAAKRRLLGENLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV--SE  546
             +CS+++L QI+ QL  S+  IR +K+ +  +QI +L+EKEK L  EN  L ++  V   E
Sbjct  119   ACSLEELQQIENQLEKSVSKIRAKKNQVFNEQIKQLKEKEKHLAAENQRLTEKYGVMPKE  178

Query  545   PQRL----------------YTDVETRLFIGQPETR  486
             P  +                 +DVET LFIG PE R
Sbjct  179   PSSVDKPTDDTSPSEDTASQISDVETDLFIGLPERR  214



>ref|XP_007051981.1| AGAMOUS-like 20 isoform 4, partial [Theobroma cacao]
 gb|EOX96138.1| AGAMOUS-like 20 isoform 4, partial [Theobroma cacao]
Length=208

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K+     K SE ++Q +K +  A M K++E+LE S+RKLLGEGL S
Sbjct  60    SSMQETIERYNRHTKD--TRTKPSEQNMQLLKTEA-ANMVKKIELLEVSRRKLLGEGLGS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             C++++L QI++QL  S+ +IR RK+ + K+QI++
Sbjct  117   CTLEELLQIEQQLERSVSSIRARKAQVFKEQIEQ  150



>ref|XP_002872630.1| hypothetical protein ARALYDRAFT_490004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48889.1| hypothetical protein ARALYDRAFT_490004 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K  + S Q   +D   A+++++E LE S RK+LGEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGSNHKRDDNSQQ--SKDETYALARKIEHLEISTRKMLGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLR  147



>ref|XP_010439256.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X1 [Camelina 
sativa]
Length=220

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 143/214 (67%), Gaps = 20/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   +    S Q   E     ++K++E LE SKRKLLGEG+D 
Sbjct  61    SIA-KTIERYQRRIKEIGINHRGDANSQQARYE--TQGLTKKIEQLEISKRKLLGEGIDK  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSI++L Q++ QL  SL  IR +K  L ++QI++L+E+E+ L +EN ELK++        
Sbjct  118   CSIEELQQLENQLERSLTRIRAKKYQLLREQIEKLKEEERKLVKENKELKEKWLGMGATV  177

Query  557   ----------AVSEPQRLYTDVETRLFIGQPETR  486
                        V+       +VET LFIG PETR
Sbjct  178   ASSQSTLSSSEVNIDDNDNMEVETGLFIGPPETR  211



>ref|XP_006339502.1| PREDICTED: MADS-box protein SOC1-like [Solanum tuberosum]
Length=216

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYK-KSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS+ + I+RY  + K+  Q + ++    LQH++ +  A + K++E LE SKRK LGEGL 
Sbjct  60    SSTQEIIERYKRHTKDRVQPENQAGGQHLQHMQHE-AANLMKKIEFLETSKRKFLGEGLQ  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV----  552
             SC++ ++ QI++QL  S+  IR RK  + K+Q++RL+EKEKIL  ENA+L+++       
Sbjct  119   SCTLQEVQQIEKQLERSVSTIRARKLQVFKEQVERLKEKEKILAAENAKLREKFGGLQQR  178

Query  551   ------SEPQRLYT------DVETRLFIGQPETR  486
                    E + L T      DVET LFIG PE R
Sbjct  179   ETPSVEKEGEALCTDGSEKSDVETELFIGPPECR  212



>ref|XP_010529519.1| PREDICTED: agamous-like MADS-box protein AGL14 [Tarenaya hassleriana]
 ref|XP_010529520.1| PREDICTED: agamous-like MADS-box protein AGL14 [Tarenaya hassleriana]
 ref|XP_010529521.1| PREDICTED: agamous-like MADS-box protein AGL14 [Tarenaya hassleriana]
Length=215

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 144/210 (69%), Gaps = 14/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS 
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KTI RY    K+L         + Q  K D    +++++E LE SKRK+LGEGL++
Sbjct  60    SSITKTIDRYQKRTKDLAITNSKGNVNSQPAK-DETYGLARKIEQLEISKRKMLGEGLEA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenae------lkKRLA  555
             CSI++L Q++ QL   L  IR +K  L +++I++L+E+E+ L EEN +         R A
Sbjct  119   CSIEELQQLENQLERGLTKIRAKKYQLFREEIEKLKEEERNLLEENKKLKEECETGARGA  178

Query  554   VSEPQRLY------TDVETRLFIGQPETRP  483
             + + +++        +VET LFIG PETRP
Sbjct  179   LLQAKQVEEVKIDDMEVETDLFIGPPETRP  208



>ref|XP_006288611.1| hypothetical protein CARUB_v10001906mg [Capsella rubella]
 gb|EOA21509.1| hypothetical protein CARUB_v10001906mg [Capsella rubella]
Length=223

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG  +K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGSNQKRNDNSQQS--KDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR RK  L +
Sbjct  119   SSIEELQQLENQLDRSLLKIRARKYQLLR  147



>gb|ADO61008.1| suppressor of overexpression of CONSTANS 1 [Helianthus annuus]
Length=215

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 149/212 (70%), Gaps = 18/212 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKK FELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKGFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY +  K++ Q   SS   +QH+K +  A M+K+VE+LE +KR+LLGEGL +
Sbjct  60    SSMQETIERYRSQVKDV-QTDISSVEDVQHLKHE-TAIMAKKVELLEVAKRRLLGEGLGA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
              +ID+L +I++QL   +R +R RK  +  +QI++L+ KEK+L +ENA L ++        
Sbjct  118   TTIDELVRIEQQLERGVRLVRARKMQVYHEQIEQLQAKEKLLADENAILTEKCQAVHNDQ  177

Query  557   AVSEPQRLY--------TDVETRLFIGQPETR  486
                E Q  +        +DVET LFIG P TR
Sbjct  178   VTEEXQADFRVLENGENSDVETELFIGPPXTR  209



>emb|CAC86007.1| putative MADS-box transcription factor DEFH68 [Antirrhinum majus]
Length=218

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 18/213 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+F+P GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFAPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS   TI+RY  + K L      +E ++QHV+ +  A++ K++E LE SKRKLLGEGL +
Sbjct  60    SSMQDTIERYQCHTKELQANNPPAEHNIQHVRHEA-ASLMKKIEQLETSKRKLLGEGLGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             C+ ++L Q+++QL  S+  IR RK+ + KQQI++L+EK K L  ENA L +++ V + Q 
Sbjct  119   CTFEELQQLEQQLERSVATIRARKTQMFKQQIEQLKEKGKSLAAENAMLHQKIGVEQQQV  178

Query  539   ---------------RLYTDVETRLFIGQPETR  486
                               +DVET LFIG  ETR
Sbjct  179   PALNLQKAVMGSSEISEVSDVETELFIGLRETR  211



>gb|AFK35913.1| unknown [Medicago truncatula]
Length=224

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 152/219 (69%), Gaps = 25/219 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR G LKKAFELSVLCDAE+ LIVFSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGSLKKAFELSVLCDAEVALIVFSPRGRLYEFTS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSET--SLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY ++ + +     +SE+  + Q +KE+    M K++++LE SKRKLLGEGL
Sbjct  60    SSILETIERYRSHTR-INNTPTTSESVENTQQLKEEA-ENMMKKIDLLETSKRKLLGEGL  117

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA----  555
              SCSID+L +I++QL  S+  IR +K+ + ++QI++L+EKEK L  ENA L ++      
Sbjct  118   GSCSIDELQKIEQQLERSISKIRAKKTQVFREQIEQLKEKEKTLVAENAMLAEKYGNYSS  177

Query  554   --VSEPQR--------------LYTDVETRLFIGQPETR  486
                ++ QR                +DVET LFIG PETR
Sbjct  178   QEATKDQRENIVEAETYADQSSPSSDVETELFIGLPETR  216



>ref|XP_010455602.1| PREDICTED: agamous-like MADS-box protein AGL14 isoform X3 [Camelina 
sativa]
Length=177

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGPNHKRNDNSQQS--KDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLR  147



>gb|KCW90775.1| hypothetical protein EUGRSUZ_A02846 [Eucalyptus grandis]
 gb|KCW90776.1| hypothetical protein EUGRSUZ_A02846 [Eucalyptus grandis]
 gb|KCW90777.1| hypothetical protein EUGRSUZ_A02846 [Eucalyptus grandis]
Length=214

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 144/215 (67%), Gaps = 20/215 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGK ++KRIENATSRQ +FSKRR GL+KKAFELSVLCDAE+ +I+FS  G+LYEFSS 
Sbjct  1     MARGKIQMKRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI+RY   AK     K S E  + H+K +  A MS+++E+LE SKRK LG+GL+S
Sbjct  60    SNMQKTIERYHQYAKEDTGKKASMEQYMLHLKHEA-ADMSRKIELLEASKRKFLGQGLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVS----  549
             CS+D+L +I  QL  SL  IR +K  L K+QI++L+ KE  L EEN+ L ++        
Sbjct  119   CSVDELQEISVQLERSLSTIRVKKDQLFKEQIEQLKAKEVFLIEENSRLCEKYGEKGMPW  178

Query  548   ------EPQ--RLY------TDVETRLFIGQPETR  486
                   +P+  R++      TDVET LFIG PE R
Sbjct  179   QSTSSVQPKEARIHSLSSGSTDVETELFIGLPEMR  213



>ref|XP_010439257.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X2 [Camelina 
sativa]
Length=206

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 127/200 (64%), Gaps = 6/200 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP  KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S + KTI+RY    K +G   +    S Q   E     ++K++E LE SKRKLLGEG+D 
Sbjct  61    SIA-KTIERYQRRIKEIGINHRGDANSQQARYE--TQGLTKKIEQLEISKRKLLGEGIDK  117

Query  716   CSIDDLHQIQEQLVISLRNIR---ERKSLLCKQQIDRlrekekileeenaelkKRLAVSE  546
             CSI++L Q++ QL  SL  IR   ERK +   +++             +        V+ 
Sbjct  118   CSIEELQQLENQLERSLTRIRAKKERKLVKENKELKEKWLGMGATVASSQSTLSSSEVNI  177

Query  545   PQRLYTDVETRLFIGQPETR  486
                   +VET LFIG PETR
Sbjct  178   DDNDNMEVETGLFIGPPETR  197



>emb|CAL36575.1| deficiens H24 homologue [Misopates orontium]
Length=228

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 153/229 (67%), Gaps = 33/229 (14%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  +AK +      +E + QH+K + V+ M K++E LE SKRKLLGEGL +
Sbjct  60    SSMQETIERYQKHAKEVQANNPPTEHNFQHLKHETVSMM-KKIEQLETSKRKLLGEGLGT  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             C++++L Q+++QL  S+ +IR RK  +  QQI++L+EK K L  ENA L +++ + +PQ 
Sbjct  119   CNMEELQQLEQQLERSVTSIRARKMQVYMQQIEQLKEKGKALAAENAMLSQKVGL-QPQG  177

Query  539   --------------------------RLYTDVETRLFIGQPET---RPP  480
                                          +DVET LFIG PET   RPP
Sbjct  178   QTSNSDKATCSFEKTEKATLGTSTEISEVSDVETELFIGLPETRAKRPP  226



>gb|KCW90778.1| hypothetical protein EUGRSUZ_A02846 [Eucalyptus grandis]
Length=213

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 140/214 (65%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGK ++KRIENATSRQ +FSKRR GL+KKAFELSVLCDAE+ +I+FS  G+LYEFSS 
Sbjct  1     MARGKIQMKRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI+RY   AK     K S E  + H+K +  A MS+++E+LE SKRK LG+GL+S
Sbjct  60    SNMQKTIERYHQYAKEDTGKKASMEQYMLHLKHEA-ADMSRKIELLEASKRKFLGQGLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ-  540
             CS+D+L +I  QL  SL  IR +K  L K+QI++L+ K  ++EE +   +K      P  
Sbjct  119   CSVDELQEISVQLERSLSTIRVKKDQLFKEQIEQLKAKVFLIEENSRLCEKYGEKGMPWQ  178

Query  539   ----------RLY------TDVETRLFIGQPETR  486
                       R++      TDVET LFIG PE R
Sbjct  179   STSSVQPKEARIHSLSSGSTDVETELFIGLPEMR  212



>ref|NP_001168784.1| uncharacterized protein LOC100382583 [Zea mays]
 gb|ACN30699.1| unknown [Zea mays]
 gb|AFW88192.1| putative MADS-box transcription factor family protein [Zea mays]
 gb|AIB04419.1| MADS transcription factor, partial [Zea mays]
Length=224

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 131/215 (61%), Gaps = 23/215 (11%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L+VFSP GKLYEF+S 
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVVFSPRGKLYEFASA  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +S  KTI RY    +      K+ +  +Q VK D V +++ R+E LE++KR  LGE L+ 
Sbjct  61    ASLQKTIDRYRTYTRE-NVNNKTVQQDIQQVKADAV-SLASRLEALEKTKRMFLGENLEE  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQID----------------Rlrekekilee  585
             CSI++LH ++ +L  SL  IR +K+ L +QQI                 R +++      
Sbjct  119   CSIEELHNLEVKLAKSLHVIRGKKTQLLEQQISKLKEKERTLLQDNKELRDKQRNLQSPP  178

Query  584   enaelkKRLAVSEPQRLYT-----DVETRLFIGQP  495
             E      R     P+ L       DVET L+IG P
Sbjct  179   EAPPDLNRCVPPWPRSLPAPSNDMDVETELYIGLP  213



>ref|XP_004510894.1| PREDICTED: MADS-box protein SOC1-like [Cicer arietinum]
Length=221

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 149/218 (68%), Gaps = 26/218 (12%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S+
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFASS  60

Query  896   SSSNKTIQRYMNNAK--NLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             S +  +I+RY ++ +  N        + +   +KE+    M K++++LE SKRKLLG+GL
Sbjct  61    SITG-SIERYRSHTRTNNTSTPASVDQNTQAQLKEES-QHMMKKIDLLEASKRKLLGQGL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR------  561
              SCS+D+L +I++QL  S+ +IR +K+ + ++QI++L+EKEK L  EN  L ++      
Sbjct  119   GSCSLDELQKIEQQLERSISSIRTKKNQIFREQIEQLKEKEKTLIAENIRLSEKYDKFSQ  178

Query  560   -------------LAVSEPQRLYTDVETRLFIGQPETR  486
                           A S P+   +DVET LFIG PETR
Sbjct  179   PAKKDERENLHEPFAESSPR---SDVETELFIGLPETR  213



>gb|AIU94286.1| SOC1-like protein [Prunus pseudocerasus]
Length=213

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 137/214 (64%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK E+KRIENATSRQV+FSKRR GLLKKAFELSVLCDA++++I+FS  G+LYEFSS 
Sbjct  1     MVRGKIEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVSVIIFSQKGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S    TI+RY  +AK     K   E  ++ +K +  A M+K++E LE S+RKLLG GLDS
Sbjct  60    SDMQDTIKRYHKHAKAGQTNKIEVEEYVEQLKHESTA-MAKKIENLEASQRKLLGHGLDS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR---------lrekekileeenaelkK  564
             CS+++L +I  QL  S+RNIRERK+ L  +Q+++             +   E       +
Sbjct  119   CSVEELQEITGQLERSVRNIRERKAHLFAEQMEQLRAKERLLLEENAKLSEEFGAQPRLQ  178

Query  563   RLAVSEPQRLYT--------DVETRLFIGQPETR  486
             +L+V E   +          +VET LFIG P TR
Sbjct  179   QLSVEEKGAVSYWSQSSLSSEVETELFIGPPVTR  212



>gb|AEO20231.1| SOC1-like protein [Fragaria vesca]
Length=215

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 150/214 (70%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+L+RIENATSRQV+FSKRR GLLKKAFELS+LCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQLRRIENATSRQVTFSKRRSGLLKKAFELSILCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY  + ++     K   SE ++Q +K +  + M K++E LE SKRKLLGE L
Sbjct  60    SSMQETIERYEKHTRDNQANNKVAISEQNVQQLKHEATSMM-KQIEHLEVSKRKLLGESL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR---LAV  552
               C+I++L ++++QL  S+  IR RK+ + K+QI++L EKE+IL  EN  L ++   L +
Sbjct  119   GLCTIEELQEVEQQLERSVNTIRARKAQVFKEQIEQLEEKERILTAENERLTEKCDALQL  178

Query  551   SEP---QRLY---------TDVETRLFIGQPETR  486
              +P   QR +         +DVET LFIG PE R
Sbjct  179   RQPVIEQREHLAYNESSTSSDVETELFIGLPERR  212



>ref|XP_008658827.1| PREDICTED: uncharacterized protein LOC100382583 isoform X1 [Zea 
mays]
 gb|AFW88193.1| putative MADS-box transcription factor family protein [Zea mays]
Length=223

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTELKRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L+VFSP GKLYEF+S 
Sbjct  1     MVRGKTELKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVVFSPRGKLYEFASA  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +S  KTI RY    +      K+ +  +Q VK D V +++ R+E LE++KR  LGE L+ 
Sbjct  61    ASLQKTIDRYRTYTRE-NVNNKTVQQDIQQVKADAV-SLASRLEALEKTKRMFLGENLEE  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CSI++LH ++ +L  SL  IR +K+ L +QQI +
Sbjct  119   CSIEELHNLEVKLAKSLHVIRGKKTQLLEQQISK  152



>ref|XP_008238753.1| PREDICTED: agamous-like MADS-box protein AGL19 [Prunus mume]
Length=219

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 147/215 (68%), Gaps = 20/215 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENA SRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  GKLYEFSS+
Sbjct  1     MVRGKTQMKRIENAASRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S  N T+ RY    K+ G   K+ +  ++H K+D  ++M+K+++ +E SK+KLLG  L+S
Sbjct  61    SIGN-TLDRYQKRVKDQGLGSKAVQVDMEHGKDD-TSSMAKKIDFIEASKQKLLGNCLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR--------  561
             CSI++L Q + QL  SL  IR RK+ L ++QI+ L+E+EK L E+NA+L+++        
Sbjct  119   CSIEELQQTENQLERSLSKIRARKTQLLREQIENLKEEEKNLFEQNAKLREKCGMQPLGP  178

Query  560   ---------LAVSEPQRL-YTDVETRLFIGQPETR  486
                       AV +P+     DVET L IG PE R
Sbjct  179   PSARKDEENCAVRQPRTPDMEDVETDLVIGPPERR  213



>ref|XP_009617463.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Nicotiana tomentosiformis]
Length=251

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 153/219 (70%), Gaps = 20/219 (9%)
 Frame = -1

Query  1094  LVR*SEMVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKL  915
             +VR  EMVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L++FSP GKL
Sbjct  25    VVRRGEMVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKL  84

Query  914   YEFSSTSSSNKTIQRYMNNAKNLGQYKKSS-ETSLQHVKEDGVAAMSKRVEVLEQSKRKL  738
             YEF+S SS  + ++RY  ++K+  Q +  +   ++QH+K +  A++ K++E+L+ SKRKL
Sbjct  85    YEFAS-SSMQEIVERYKRHSKDKVQPENQAVGQNMQHLKLE-TASLMKKIELLDTSKRKL  142

Query  737   LGEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL  558
             LGEGL SC++++L QI++QL  S+  IR RK  + ++Q+DRL+EKEK L  ENA L+++ 
Sbjct  143   LGEGLGSCTLEELQQIEKQLERSVSAIRARKMQVFREQMDRLKEKEKALAVENAMLREKF  202

Query  557   A-----------------VSEPQRLYTDVETRLFIGQPE  492
                                 E     +DVET LFIG P+
Sbjct  203   GGLQQRQTSSGEKEGEVICIEGGSDKSDVETELFIGPPD  241



>ref|XP_006396837.1| hypothetical protein EUTSA_v10028949mg [Eutrema salsugineum]
 gb|ESQ38290.1| hypothetical protein EUTSA_v10028949mg [Eutrema salsugineum]
Length=222

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 135/227 (59%), Gaps = 34/227 (15%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K    S +   E     +++++E LE SKRKLLGEGLD+
Sbjct  61    SSITKTVERYQKRIQDLGSDHKRDGNSQEGKGE--TYGLARKIEQLEISKRKLLGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIR-----------------------ERKSLLCKQQIDRlre  606
              SI++L Q++ QL  SL  IR                       E K L  K +++R   
Sbjct  119   SSIEELQQLENQLDRSLTKIRAKKYQLLREEIEKLKEKERNLIAENKMLKEKYEMERGGT  178

Query  605   kekileeenaelkKRLAVSEPQRLYTDVETRLFIGQPETR-----PP  480
               +     +   +  +  +E + + TD    LFIG PETR     PP
Sbjct  179   VARTSPSSSTSEEVDIYDNEIEEVVTD----LFIGPPETRHSKKFPP  221



>ref|XP_010455600.1| PREDICTED: agamous-like MADS-box protein AGL14 isoform X1 [Camelina 
sativa]
Length=221

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGPNHKRNDNSQQ--SKDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLR  147



>gb|EPS59775.1| hypothetical protein M569_15030 [Genlisea aurea]
Length=194

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAEI LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEIALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNL-GQYKKSS----ETSLQHVKEDGVAAMSKRVEVLEQSKRKLLG  732
             SS  +TI+RY  + K +   Y   +    E +L H+ E   A+M K++E LE SKRKLLG
Sbjct  60    SSMPETIERYQKHTKEIQPTYPNPNPNPIEQNLLHL-EVEAASMMKKIEQLEASKRKLLG  118

Query  731   EGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             EGL S +I++L QI++QL  SL  IR RK  L KQQI
Sbjct  119   EGLASSTIEELQQIEKQLERSLTAIRGRKIQLYKQQI  155



>ref|XP_009782122.1| PREDICTED: MADS-box protein SOC1-like [Nicotiana sylvestris]
Length=221

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 146/216 (68%), Gaps = 21/216 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNL-GQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + ++RY  + +++ G+     + ++Q++K +    M K++E+LE SKRKLLGEGL 
Sbjct  60    SSMQEIMERYRKHNEDVRGEIPPVEQNNMQNLKHETTTLM-KKIELLETSKRKLLGEGLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR-------  561
             SCS++++ QI+ QL  SL  IR RK  + ++QI RL+E  K L  ENA L ++       
Sbjct  119   SCSLEEIQQIERQLERSLNVIRARKMEVFREQIGRLKENVKDLSSENAMLLEKCGDLEQP  178

Query  560   -----------LAVSEPQRLYTDVETRLFIGQPETR  486
                        L++S      +DVET LFIG PE R
Sbjct  179   KASSGEDQGEDLSLSVEGSEKSDVETELFIGLPECR  214



>ref|XP_010434076.1| PREDICTED: agamous-like MADS-box protein AGL14 [Camelina sativa]
Length=221

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGSNHKRNDNSQQ--SKDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLR  147



>ref|NP_192925.1| agamous-like MADS-box protein AGL14 [Arabidopsis thaliana]
 sp|Q38838.2|AGL14_ARATH RecName: Full=Agamous-like MADS-box protein AGL14 [Arabidopsis 
thaliana]
 emb|CAB44326.1| MADS-box protein AGL14 [Arabidopsis thaliana]
 emb|CAB78231.1| MADS-box protein AGL14 [Arabidopsis thaliana]
 dbj|BAF02258.1| MADS-box protein AGL14 [Arabidopsis thaliana]
 gb|AEE83062.1| agamous-like MADS-box protein AGL14 [Arabidopsis thaliana]
Length=221

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGSNHKRNDNSQQ--SKDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRAKKYQLLR  147



>ref|XP_010422139.1| PREDICTED: agamous-like MADS-box protein AGL14 [Camelina sativa]
Length=221

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  KT++RY    ++LG   K ++ S Q   +D    +++++E LE S RK++GEGLD+
Sbjct  61    SSIPKTVERYQKRIQDLGPNHKRNDNSQQ--SKDETYGLARKIEHLEISTRKMMGEGLDA  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCK  630
              SI++L Q++ QL  SL  IR +K  L +
Sbjct  119   SSIEELQQLENQLDRSLMKIRGKKYQLLR  147



>gb|AFR90178.1| suppressor of overexpression of CO1 [Fragaria x ananassa]
Length=215

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 150/214 (70%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELS+LCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRSGLLKKAFELSILCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  +TI+RY  + ++     K   SE ++Q +K +  + M K++E LE SKRKLLGE L
Sbjct  60    SSMQETIERYEKHTRDNQANNKVAISEQNVQQLKHEATSMM-KQIEHLEVSKRKLLGESL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKR---LAV  552
               C+I++L ++++QL  S+  IR RK+ + K+QI++L+EKE+IL  EN  L ++   L  
Sbjct  119   GLCTIEELQEVEQQLERSVNTIRARKAQVFKEQIEQLKEKERILTAENERLTEKCDALQQ  178

Query  551   SEP---QRLY---------TDVETRLFIGQPETR  486
              +P   QR +         +DVET LFIG PE R
Sbjct  179   RQPVIEQREHLAYNESSTSSDVETELFIGLPERR  212



>gb|AGW23360.1| MADS box protein MADS58 [Gossypium hirsutum]
Length=216

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 145/211 (69%), Gaps = 17/211 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKL+EF+S 
Sbjct  1     MVRGKTQMRRIENNTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLFEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY    K+  +  K  E +LQH+K +  A M K +E LE S+RKLLGE L S
Sbjct  60    SSMQQTIERYRRRTKD-NETNKPIEQNLQHLKTES-ANMLKTLEDLEISRRKLLGENLGS  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQR  537
             C++++L +I++QL  S+  IR RK+ + + QI++L+EKEK L  EN +L ++      +R
Sbjct  118   CTLEELQEIEQQLQKSVSIIRARKTQIFRDQIEQLKEKEKALAAENEKLCEKCGTKSWKR  177

Query  536   L--------------YTDVETRLFIGQPETR  486
             L               +DVET LFIG PE R
Sbjct  178   LSEQEDNVPYDESSPSSDVETELFIGLPEGR  208



>ref|XP_011091217.1| PREDICTED: MADS-box protein SOC1 [Sesamum indicum]
Length=223

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 146/215 (68%), Gaps = 20/215 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE++RIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTEMRRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS ++TI+RY    K +       E ++QH+K +  A M K++E LE +KRKLLGE L +
Sbjct  60    SSMHQTIERYQQYTKEIQANNPPVEHNMQHLKHE-AATMMKKIEQLEATKRKLLGENLGN  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CSI++L Q+++QL  S+  IR RK  + KQQI++L++K + L  ENA L ++  V     
Sbjct  119   CSIEELQQLEQQLERSVSIIRARKMQVYKQQIEQLKQKGRALAAENAMLSEKFGVHGQVQ  178

Query  551   ---SEPQRL----------YTDVETRLFIGQPETR  486
                S  +R            +DVET LFIG PETR
Sbjct  179   GAGSNEERGGMVGSAEISEISDVETELFIGPPETR  213



>ref|XP_008783455.1| PREDICTED: MADS-box transcription factor 50-like [Phoenix dactylifera]
Length=219

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 5/153 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFS  GKLYEFSST
Sbjct  1     MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSRGKLYEFSST  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEG--L  723
              S  KTI RY  +AKN     + +E ++Q  K +  A MS+++E LE SKRKLLGE   L
Sbjct  61    -SMQKTIDRYRMHAKNGINNNEVTEQNIQQWKFEA-AGMSRKIEFLESSKRKLLGESIEL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKS-LLCKQ  627
             +S S+++LH+I+ +L  SLR IR RK+ LLC+Q
Sbjct  119   ESSSVEELHEIEYKLEQSLRVIRGRKNQLLCEQ  151



>gb|KCW90779.1| hypothetical protein EUGRSUZ_A02846 [Eucalyptus grandis]
Length=165

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGK ++KRIENATSRQ +FSKRR GL+KKAFELSVLCDAE+ +I+FS  G+LYEFSS 
Sbjct  1     MARGKIQMKRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI+RY   AK     K S E  + H+K +  A MS+++E+LE SKRK LG+GL+S
Sbjct  60    SNMQKTIERYHQYAKEDTGKKASMEQYMLHLKHEA-ADMSRKIELLEASKRKFLGQGLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+D+L +I  QL  SL  IR +K  L K+QI++
Sbjct  119   CSVDELQEISVQLERSLSTIRVKKDQLFKEQIEQ  152



>ref|XP_009618745.1| PREDICTED: MADS-box protein SOC1-like [Nicotiana tomentosiformis]
Length=219

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 143/214 (67%), Gaps = 19/214 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNL-GQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + ++RY  + +++ G+ +   + ++Q++K +    M K++E+LE SKRKLLGEGL 
Sbjct  60    SSMQEIMERYRKHNEDVQGEKQPVEQKNMQNLKHETTTLM-KKIELLETSKRKLLGEGLG  118

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEPQ  540
             SCS  +L QI+ QL  SL  IR RK  + ++QI RL+E  K L  ENA L ++    E  
Sbjct  119   SCSFAELQQIEHQLERSLNVIRARKMEVFREQIGRLKENVKDLSSENAMLLEKFDDLEQP  178

Query  539   RLY----------------TDVETRLFIGQPETR  486
             +                  +DVET LFIG PE R
Sbjct  179   KASSAEDQGEDLSIEGSEKSDVETELFIGLPECR  212



>gb|AAK21251.1| MADS-box transcription factor FBP20 [Petunia x hybrida]
Length=216

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 144/214 (67%), Gaps = 22/214 (10%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDA++ L++FSP GK YEFSS 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVGLVIFSPRGKQYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYK-KSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             SS  + I+RY  + K+  Q + ++ E +LQH      A + K++E LE SKRKLLGEGL 
Sbjct  60    SSMQEIIERYKGHTKDKVQTENQAGEQNLQHE----TAGLMKKIEFLETSKRKLLGEGLG  115

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLA-----  555
             SC++++L +I++QL  S+  IR RK  + K+QI++L EKEK L  ENA L+++       
Sbjct  116   SCTLEELQKIEKQLERSVSIIRARKMQVFKEQIEKLNEKEKALAAENAMLREKFGGLQQR  175

Query  554   -----------VSEPQRLYTDVETRLFIGQPETR  486
                        V       +DVET LFIG PE R
Sbjct  176   QASSGEKEGEVVCTEGSDKSDVETELFIGPPECR  209



>gb|AAY84828.1| transcription factor AGL20 [Ipomoea batatas]
Length=220

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 146/213 (69%), Gaps = 18/213 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKS--SETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGL  723
             SS  + I+RY  +  ++     S   E  +QH++ +    ++K+++ LE SKR+LLGE L
Sbjct  60    SSMREIIERYRRHTADVQSENPSVEQEQDMQHLQHE-TECLAKKIDYLEASKRRLLGEDL  118

Query  722   DSCSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAVSEP  543
              +C++++L QI++QL  S+  IR RK  +  +QI RLR+KE+ L+ ENA L  +    +P
Sbjct  119   GACAMEELQQIEQQLERSVNIIRARKMEVYAEQIKRLRDKEESLKAENAVLWDKYNGLQP  178

Query  542   QRLY--------------TDVETRLFIGQPETR  486
             Q++               +DVET LFIG PE+R
Sbjct  179   QQVSNEGNEKESAEGSEKSDVETELFIGLPESR  211



>ref|XP_007051980.1| AGAMOUS-like 20 isoform 3 [Theobroma cacao]
 gb|EOX96137.1| AGAMOUS-like 20 isoform 3 [Theobroma cacao]
Length=160

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT+++RIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP GKLYEF+S 
Sbjct  1     MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             SS  +TI+RY  + K+     K SE ++Q +K +  A M K++E+LE S+RKLLGEGL S
Sbjct  60    SSMQETIERYNRHTKD--TRTKPSEQNMQLLKTE-AANMVKKIELLEVSRRKLLGEGLGS  116

Query  716   CSIDDLHQIQEQLVISLRNIRERK  645
             C++++L QI++QL  S+ +IR RK
Sbjct  117   CTLEELLQIEQQLERSVSSIRARK  140



>ref|XP_007155575.1| hypothetical protein PHAVU_003G213600g, partial [Phaseolus vulgaris]
 gb|ESW27569.1| hypothetical protein PHAVU_003G213600g, partial [Phaseolus vulgaris]
Length=144

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FS  G+LYEFSS+
Sbjct  1     MVRGKTQMKRIENETSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGRLYEFSSS  60

Query  896   SSS-NKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             +SS NKT++RY    K++         + Q +K DG  +M+KR+E L+ S+RKLLG+ LD
Sbjct  61    TSSINKTVERYQRKIKDVCVNNNGIHENTQILK-DGDMSMTKRIEQLDNSRRKLLGDELD  119

Query  719   SCSIDDLHQIQEQLVISLRNIRERK  645
              CSID+L Q++ QL  SL  IR RK
Sbjct  120   PCSIDELRQVENQLERSLEKIRARK  144



>ref|XP_008777520.1| PREDICTED: MADS-box transcription factor 50-like [Phoenix dactylifera]
Length=208

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 146/211 (69%), Gaps = 20/211 (9%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+K IEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ +IVFSP G+LYEFSST
Sbjct  1     MVRGKTEMKLIENVTSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIVFSPRGRLYEFSST  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S   KTI RY  +AKN      +SE + Q   E    +MS+++E LE SKRKLLGE L+S
Sbjct  61    SME-KTIDRYRTHAKN---GINNSEVTQQWKFE--ATSMSRKIEFLEVSKRKLLGESLES  114

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-SEPQ  540
             CS+++LH+I+ ++  SL NIR RK+ L  +QI +L+E+E++L +ENA L ++  + S+P 
Sbjct  115   CSVEELHEIEGKIEQSLCNIRGRKNQLLGEQIAQLKEQEQMLMKENALLLEKCKLRSQPP  174

Query  539   RLYT-------------DVETRLFIGQPETR  486
             +                +VET L+IG P  R
Sbjct  175   QAAPEETVPCDHDSQNMEVETELYIGWPGRR  205



>ref|XP_009136496.1| PREDICTED: agamous-like MADS-box protein AGL19 [Brassica rapa]
Length=221

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 146/222 (66%), Gaps = 26/222 (12%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP+ KLYEFSS+
Sbjct  1     MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPSSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
               + KTI+RY    K  G   K  + S Q   E     ++K++E LE SKRKLLGEG+D+
Sbjct  61    GIA-KTIERYQRRVKETGVNHKRDDNSQQAKGE--TYGLTKKIEQLEISKRKLLGEGIDA  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL-------  558
             CSI++L Q++ QL   L  IR +K  L +++I++L+E+E+ L +EN ELK++L       
Sbjct  118   CSIEELQQLENQLERGLTRIRAKKYQLLREEIEKLKEEERNLIKENKELKEKLHGMGAIV  177

Query  557   -----------AVSEPQRLYTDVETRLFIGQPETR-----PP  480
                         V+       +VET LFIG PETR     PP
Sbjct  178   VASSSSTLSSAEVNMDDNGNMEVETGLFIGPPETRQSKKIPP  219



>ref|XP_006662002.1| PREDICTED: MADS-box transcription factor 56-like [Oryza brachyantha]
Length=231

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRG+TELKRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP G+LYEF+S 
Sbjct  1     MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFASA  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
              S  KTI+RY    K+     K+ +  +Q VK+D +  ++K++E L+ ++RK++GE L+ 
Sbjct  61    PSLQKTIERYKAYTKDHVINNKTIQQDIQQVKDDTL-GLAKKLEALDDARRKIMGENLEG  119

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
             CS+++L  ++ +L  SL NIR RK+ L +QQI
Sbjct  120   CSVEELRGLEIKLEKSLHNIRLRKTQLLEQQI  151



>ref|XP_009137304.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X2 [Brassica 
rapa]
Length=219

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 136/222 (61%), Gaps = 35/222 (16%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP  KLYEFSS+
Sbjct  1     MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKE-------DGVAAMSKRVEVLEQSKRKL  738
             S S KTI+RY          K+  ET + H +E       D    ++K++E LE SKRKL
Sbjct  61    SIS-KTIERYQ---------KRVKETGINHTRENNSQQARDETYGLTKKIEQLEISKRKL  110

Query  737   LGEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCK------QQIDRlrekekileeena  576
             LGEG+D+CSI++L Q++ QL   L  IR +K  L +      ++ +R   KE    +E  
Sbjct  111   LGEGIDACSIEELQQLENQLERGLSRIRAKKYQLLREEIEKLKEEERNLIKENKELKEKW  170

Query  575   elkKRLAVSEPQ------RLYTD------VETRLFIGQPETR  486
                  + V+ P        + TD      VET LFIG PE R
Sbjct  171   RGMGAIVVASPSSTLSSAEVNTDSVDNMEVETGLFIGPPEPR  212



>gb|ACR25200.1| SOC1-like floral activator [Brassica rapa var. purpuraria]
Length=204

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = -1

Query  1058  ELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSSTSSSNKT  879
             ++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE++LI+FSP  KLYEF+S++  + T
Sbjct  1     QMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKAKLYEFASSNMQD-T  59

Query  878   IQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDSCSIDDL  699
             I RY+ + K+    K  SE +LQH+K +  A M +++E LE SKRKLLGEG+ SCSI++L
Sbjct  60    IDRYLRHTKDRVSTKPVSEENLQHLKHEA-ANMMEKIEQLEASKRKLLGEGIGSCSIEEL  118

Query  698   HQIQEQLVISLRNIRERKSLLCKQQIDR  615
              QI++QL  S++ IR RK+ + K+QI++
Sbjct  119   QQIEQQLEKSVKCIRARKTQVFKEQIEQ  146



>dbj|BAL70258.1| suppressor of overexpression of CONSTANS 1 [Rhododendron x pulchrum]
Length=203

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK E+KRIEN TSRQV+FS+RR GLLKKA+ELSVLCDA++ LI+FSPTG+L+EFSS 
Sbjct  1     MVRGKIEMKRIENGTSRQVTFSRRRNGLLKKAYELSVLCDAQVALIIFSPTGRLHEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+ +K I+RY  +AK         E  +Q +K++  A M+K++E+LE S+RK+LG  + S
Sbjct  60    SNMHKIIERYCEHAKQAQTKNPEVEHYIQQLKQEA-ANMAKKMEILEASQRKILGHNVAS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+++L ++  QL  SLRNIR RK  L ++QI++
Sbjct  119   CSVEELRELDNQLERSLRNIRARKEYLFREQIEQ  152



>ref|XP_002263450.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662337.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662338.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662339.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662341.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662342.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
 ref|XP_010662343.1| PREDICTED: MADS-box protein SOC1-like [Vitis vinifera]
Length=210

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK +++RIENATSRQV+FSKRR GLLKKA+ELSVLCDAE+ +I+FS  G+LYEFSS 
Sbjct  1     MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+    I+RY  +AK +       E  +Q++K+D   +M+K++E+LE S+RKLLG+GL S
Sbjct  60    SNMQSAIERYREHAKQVETNNPELEQYMQNLKQDA-ESMAKKIELLEVSQRKLLGQGLSS  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI----DRlrekekileeenaelkKRLAVS  549
             CS+D++ +I  QL  SL++IR RK+ + ++QI    +R ++  +     + +  ++  +S
Sbjct  119   CSLDEILEIDSQLEKSLKSIRARKAQIFQEQIEELKEREKQLLEENARLSQKDTRQWQLS  178

Query  548   -EPQRLYT--------DVETRLFIGQPETR  486
              +P    T        +VET LFIG PE R
Sbjct  179   AQPSEGVTYSQSSPSSEVETELFIGLPEMR  208



>ref|XP_011101156.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Sesamum indicum]
 ref|XP_011101157.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Sesamum indicum]
 ref|XP_011101158.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Sesamum indicum]
 ref|XP_011101160.1| PREDICTED: MADS-box protein SOC1-like isoform X1 [Sesamum indicum]
Length=210

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK ++KRIENATSRQV+FSKRR GLLKKA+ELSVLCDAE+ LI+FS  G+L+EFSS 
Sbjct  1     MVRGKVQMKRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSQKGRLFEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI RY+ +AK+ G      E  +QH+K +  A M+K++E+LE ++RKLLG  + +
Sbjct  60    SNMQKTIGRYLEHAKDRG-TSIEVEQHMQHLKHEA-AFMAKKIELLENAQRKLLGHNIGT  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRLAV-----  552
             CS+++L QI  QL  SL+NIR RK  L K++I++L+ KEK L EENA L  +  +     
Sbjct  118   CSMEELQQIDNQLERSLKNIRARKLQLFKEEIEKLQAKEKFLLEENARLSDKCGMRGRHA  177

Query  551   SEPQR--------LYTDVETRLFIGQPETR  486
             +E Q+          ++V T LFIG P  R
Sbjct  178   AEKQKEIGRNNQSTRSEVVTELFIGPPTIR  207



>ref|XP_010061717.1| PREDICTED: MADS-box protein SOC1-like [Eucalyptus grandis]
 ref|XP_010061724.1| PREDICTED: MADS-box protein SOC1-like [Eucalyptus grandis]
 ref|XP_010061731.1| PREDICTED: MADS-box protein SOC1-like [Eucalyptus grandis]
Length=194

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             M RGK ++KRIENATSRQ +FSKRR GL+KKAFELSVLCDAE+ +I+FS  G+LYEFSS 
Sbjct  1     MARGKIQMKRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S+  KTI+RY   AK     K S E  + H+K +  A MS+++E+LE SKRK LG+GL+S
Sbjct  60    SNMQKTIERYHQYAKEDTGKKASMEQYMLHLKHEA-ADMSRKIELLEASKRKFLGQGLES  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDR  615
             CS+D+L +I  QL  SL  IR +K  L K+QI++
Sbjct  119   CSVDELQEISVQLERSLSTIRVKKDQLFKEQIEQ  152



>ref|XP_009137303.1| PREDICTED: agamous-like MADS-box protein AGL19 isoform X1 [Brassica 
rapa]
Length=219

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 136/222 (61%), Gaps = 35/222 (16%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKTE+KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ LI+FSP  KLYEFSS+
Sbjct  1     MVRGKTEIKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRSKLYEFSSS  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKE-------DGVAAMSKRVEVLEQSKRKL  738
             S + KTI+RY          K+  ET + H +E       D    ++K++E LE SKRKL
Sbjct  61    SIA-KTIERYQ---------KRVKETGINHTRENNSQQARDETYGLTKKIEQLEISKRKL  110

Query  737   LGEGLDSCSIDDLHQIQEQLVISLRNIRERKSLLCK------QQIDRlrekekileeena  576
             LGEG+D+CSI++L Q++ QL   L  IR +K  L +      ++ +R   KE    +E  
Sbjct  111   LGEGIDACSIEELQQLENQLERGLSRIRAKKYQLLREEIEKLKEEERNLIKENKELKEKW  170

Query  575   elkKRLAVSEPQ------RLYTD------VETRLFIGQPETR  486
                  + V+ P        + TD      VET LFIG PE R
Sbjct  171   RGMGAIVVASPSSTLSSAEVNTDSVDNMEVETGLFIGPPEPR  212



>ref|NP_001048801.1| Os03g0122600 [Oryza sativa Japonica Group]
 sp|Q9XJ60.1|MAD50_ORYSJ RecName: Full=MADS-box transcription factor 50; AltName: Full=OsMADS50; 
AltName: Full=Protein AGAMOUS-like 20; AltName: Full=Protein 
SUPPRESSOR OF CONSTANS OVEREXPRESSION 1-like; Short=OsSOC1; 
AltName: Full=RMADS208 [Oryza sativa Japonica Group]
 dbj|BAA81886.1| MADS box-like protein [Oryza sativa Japonica Group]
 gb|AAQ01162.1| MADS box protein [Oryza sativa]
 dbj|BAF10715.1| Os03g0122600 [Oryza sativa Japonica Group]
Length=230

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             +S+ KTI+RY    K N+G   K+ +  ++ VK D    ++K++E LE  KRKLLGE LD
Sbjct  60    ASTQKTIERYRTYTKENIGN--KTVQQDIEQVKADA-DGLAKKLEALETYKRKLLGEKLD  116

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
              CSI++LH ++ +L  SL +IR RK+ L ++Q+
Sbjct  117   ECSIEELHSLEVKLERSLISIRGRKTKLLEEQV  149



>ref|XP_006649298.1| PREDICTED: MADS-box transcription factor 50-like [Oryza brachyantha]
Length=229

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIEN TSRQV+FSKRR GLLKKAFELSVLCDAE+ LIVFSP GKLYEF+S 
Sbjct  1     MVRGKTQMKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS-  59

Query  896   SSSNKTIQRYMNNAK-NLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLD  720
             +S+ KTI+RY    K N+G   KS +  ++ VK D    ++K++E LE  KRKLLGE L+
Sbjct  60    ASTQKTIERYRTYTKDNIGN--KSVQQDIEQVKADA-EGLAKKLEALEAYKRKLLGEKLE  116

Query  719   SCSIDDLHQIQEQLVISLRNIRERKSLLCKQQI  621
              CSI++LH ++ +L  SL +IR RK+ L ++Q+
Sbjct  117   ECSIEELHSLEVKLERSLISIRGRKTRLMEEQV  149



>gb|KHN15689.1| MADS-box transcription factor 50 [Glycine soja]
Length=200

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 138/201 (69%), Gaps = 12/201 (6%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGK +LK+IE+ TSRQV+FSKRR GLLKKA+ELSVLCDAE+ +IVFS  G+LYEFSS 
Sbjct  1     MVRGKVQLKKIEDTTSRQVAFSKRRSGLLKKAYELSVLCDAEVAVIVFSQNGRLYEFSS-  59

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             S   K ++RY    K++    K  +  +Q +K D V +M+K++E+LE SKRKLLG+ + S
Sbjct  60    SDMTKILERYREYTKDVPG-SKFGDDYIQQLKLDSV-SMTKKIELLEHSKRKLLGQSVSS  117

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQIDRlrekekileeenaelkKRL--AVSEP  543
             CS D+L  I+EQL  SL+ +R+RK+ L  +QIDRLR + +  E  + +   R   A +EP
Sbjct  118   CSFDELKGIEEQLRTSLQRVRQRKTQLYTEQIDRLRSQYQRAERSSQQQWPRHTQAEAEP  177

Query  542   -----QRLYTDVETRLFIGQP  495
                  Q L  DV+T LFIG P
Sbjct  178   HCSSSQSL--DVDTELFIGLP  196



>emb|CAM59040.1| MIKC-type MADS-box transcription factor WM1B [Triticum aestivum]
Length=229

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 136/221 (62%), Gaps = 26/221 (12%)
 Frame = -1

Query  1076  MVRGKTELKRIENATSRQVSFSKRRRGLLKKAFELSVLCDAEITLIVFSPTGKLYEFSST  897
             MVRGKT++KRIENATSRQV+FSKRR GLLKKAFELSVLCDAE+ L+VFSP G+LYEF+S 
Sbjct  1     MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGRLYEFASA  60

Query  896   SSSNKTIQRYMNNAKNLGQYKKSSETSLQHVKEDGVAAMSKRVEVLEQSKRKLLGEGLDS  717
             +S  K+I RY    K+     K+ +  +Q VK D + +++K++E LE SKRK+LGE L  
Sbjct  61    TSLQKSIDRYKAYTKDTVN-NKTVQPDIQQVKADAL-SLAKKLEALEDSKRKILGENLGG  118

Query  716   CSIDDLHQIQEQLVISLRNIRERKSLLCKQQI------DRlrekekileeenaelkKRLA  555
             CS ++LH ++ ++  SLR IR +K+ L +QQI      +R   K+         L+ RL 
Sbjct  119   CSTEELHFLEGKIEKSLRVIRGKKTQLLEQQIAKLKEKERTLLKDNEDLRGKRNLEARLL  178

Query  554   VSEPQRLYT------------------DVETRLFIGQPETR  486
             +  P  +                    DVET L+IG P  R
Sbjct  179   LPAPNSVAPLQPRGEPAPEQEPVQRDEDVETELYIGLPGVR  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3423712266800