BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14956_g2_i1 len=316 path=[821:0-177 144:178-315]

Length=316
                                                                      Score     E

ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...    115   4e-27   
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2     113   2e-26   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1     113   2e-26   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3         111   5e-26   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3         111   6e-26   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3         110   1e-25   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease                110   1e-25   
emb|CBI19918.3|  unnamed protein product                                110   1e-25   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...    110   1e-25   Vitis vinifera
gb|KHG24601.1|  Cucumisin                                               110   1e-25   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    109   4e-25   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1     109   5e-25   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease        108   5e-25   
gb|AES74057.2|  subtilisin-like serine protease                         108   6e-25   
ref|XP_003603806.1|  Subtilisin-like serine protease                    107   1e-24   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease                107   1e-24   
emb|CDP07365.1|  unnamed protein product                                107   2e-24   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g             107   2e-24   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg             107   2e-24   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...    107   2e-24   
ref|XP_002307740.1|  putative subtilisin precursor family protein       107   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like           106   5e-24   
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like           106   5e-24   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like           106   6e-24   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...    105   8e-24   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...    105   9e-24   
gb|KHN09070.1|  Subtilisin-like protease                                103   6e-23   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g             102   2e-22   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like           101   2e-22   
gb|KEH34337.1|  subtilisin-like serine protease                         101   2e-22   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease        100   4e-22   
ref|NP_001238252.1|  subtilisin-type protease precursor                 100   4e-22   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                       100   6e-22   Glycine max [soybeans]
ref|NP_001236511.1|  subtilisin-type protease precursor                 100   7e-22   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         99.8    1e-21   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  99.8    1e-21   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  99.4    1e-21   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  99.8    1e-21   
ref|XP_003603807.1|  Subtilisin-type protease                         99.4    1e-21   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...  99.0    2e-21   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        98.2    3e-21   
gb|EPS70387.1|  hypothetical protein M569_04373                       93.6    3e-21   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 98.2    4e-21   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           97.8    4e-21   
gb|KDP36888.1|  hypothetical protein JCGZ_08179                       97.4    5e-21   
dbj|BAJ53097.1|  JHL20J20.3                                           97.4    6e-21   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         97.4    6e-21   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      96.3    1e-20   
ref|XP_003603196.1|  Subtilisin-type protease                         96.3    1e-20   
gb|KFK44142.1|  hypothetical protein AALP_AA1G220500                  95.5    3e-20   
gb|KHN09069.1|  Cucumisin                                             90.5    4e-20   
ref|XP_002300693.2|  putative subtilisin precursor family protein     94.4    7e-20   Populus trichocarpa [western balsam poplar]
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  93.2    2e-19   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        92.8    3e-19   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        92.8    3e-19   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         92.8    3e-19   
ref|XP_006416427.1|  hypothetical protein EUTSA_v10006858mg           92.8    3e-19   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           92.0    5e-19   
ref|XP_002893091.1|  subtilase                                        92.0    5e-19   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           91.7    6e-19   
ref|XP_010477248.1|  PREDICTED: CO(2)-response secreted protease      91.3    8e-19   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 90.5    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893090.1|  predicted protein                                90.5    2e-18   
gb|AAM65424.1|  subtilisin-like serine protease                       90.1    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    90.1    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg           90.1    2e-18   
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...  90.1    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...  90.1    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         89.7    3e-18   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       89.7    3e-18   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  89.4    3e-18   
emb|CDY67543.1|  BnaCnng55400D                                        89.7    3e-18   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  89.7    3e-18   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  89.0    6e-18   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  89.0    6e-18   
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  87.0    3e-17   
emb|CDY01388.1|  BnaA07g11610D                                        87.0    3e-17   
emb|CDY44210.1|  BnaC05g15670D                                        87.0    3e-17   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              86.7    3e-17   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  86.3    6e-17   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              85.9    8e-17   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       84.3    3e-16   
gb|EMT05539.1|  Subtilisin-like protease                              82.8    7e-16   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       82.8    9e-16   
dbj|BAJ93850.1|  predicted protein                                    81.3    3e-15   
ref|XP_002461867.1|  hypothetical protein SORBIDRAFT_02g009600        81.3    3e-15   Sorghum bicolor [broomcorn]
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  80.9    3e-15   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  80.9    4e-15   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  80.5    5e-15   
ref|XP_002980086.1|  hypothetical protein SELMODRAFT_419592           80.1    7e-15   
ref|XP_010229480.1|  PREDICTED: CO(2)-response secreted protease-...  76.6    9e-15   
ref|XP_002987481.1|  hypothetical protein SELMODRAFT_426260           79.7    9e-15   
gb|AES74037.2|  subtilisin-like serine protease                       77.4    2e-14   
ref|XP_004165291.1|  PREDICTED: subtilisin-like protease-like         79.0    2e-14   
ref|XP_003603786.1|  Subtilisin-like protease                         77.4    2e-14   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease              78.6    2e-14   
ref|XP_002980084.1|  hypothetical protein SELMODRAFT_419590           78.2    3e-14   
ref|XP_002987482.1|  hypothetical protein SELMODRAFT_426261           78.2    4e-14   
ref|XP_002994537.1|  hypothetical protein SELMODRAFT_432452           77.8    4e-14   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like         77.8    4e-14   
ref|XP_010451309.1|  PREDICTED: subtilisin-like protease SBT3.3       74.7    4e-14   
gb|KDO48659.1|  hypothetical protein CISIN_1g028958mg                 74.3    5e-14   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        77.4    5e-14   
gb|KGN47766.1|  hypothetical protein Csa_6G401370                     75.9    2e-13   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like         75.5    2e-13   
gb|KDP25528.1|  hypothetical protein JCGZ_20684                       75.1    4e-13   
ref|XP_002987483.1|  hypothetical protein SELMODRAFT_126179           74.7    4e-13   
ref|XP_004146802.1|  PREDICTED: subtilisin-like protease-like         74.3    7e-13   
gb|KEH19206.1|  subtilisin-like serine protease                       73.9    8e-13   
ref|XP_010445227.1|  PREDICTED: subtilisin-like protease SBT3.3       71.2    8e-13   
gb|KDO48658.1|  hypothetical protein CISIN_1g028958mg                 70.9    8e-13   
gb|KEH19205.1|  subtilisin-like serine protease                       73.9    8e-13   
ref|XP_002987480.1|  hypothetical protein SELMODRAFT_126065           73.9    9e-13   
ref|XP_002980085.1|  hypothetical protein SELMODRAFT_111799           73.6    1e-12   
ref|XP_002980088.1|  hypothetical protein SELMODRAFT_111859           73.2    2e-12   
gb|KHN45945.1|  Subtilisin-like protease                              72.8    2e-12   
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g           72.8    2e-12   
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g           72.4    2e-12   
gb|KHN45943.1|  Subtilisin-like protease                              72.0    2e-12   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g           72.4    3e-12   
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg           72.0    4e-12   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like         72.0    4e-12   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like         72.0    4e-12   
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg           72.0    5e-12   
emb|CBI34614.3|  unnamed protein product                              72.4    5e-12   
ref|XP_010087079.1|  hypothetical protein L484_010451                 68.2    5e-12   
ref|XP_002867837.1|  subtilase family protein                         71.6    6e-12   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...  71.6    6e-12   
gb|KHN10324.1|  Subtilisin-like protease                              71.2    7e-12   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...  71.2    8e-12   
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg           71.2    8e-12   
emb|CDY36894.1|  BnaC07g01060D                                        70.9    8e-12   
ref|XP_010046680.1|  PREDICTED: subtilisin-like protease              71.2    8e-12   
gb|KEH19202.1|  subtilisin-like serine protease                       70.9    1e-11   
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5       70.9    1e-11   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5       70.9    1e-11   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...  70.9    1e-11   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like    70.5    1e-11   
emb|CDX77071.1|  BnaC04g38660D                                        70.5    1e-11   
emb|CDY57477.1|  BnaAnng14590D                                        70.5    1e-11   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4       70.5    2e-11   
gb|EMT32761.1|  Subtilisin-like protease                              70.1    2e-11   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g           70.1    2e-11   
gb|KGN50585.1|  hypothetical protein Csa_5G187340                     67.0    2e-11   
emb|CDY67954.1|  BnaAnng25710D                                        70.1    2e-11   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  70.1    2e-11   
ref|XP_002980373.1|  hypothetical protein SELMODRAFT_112475           69.7    2e-11   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...  69.7    2e-11   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5       69.7    3e-11   
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg           69.7    3e-11   
ref|XP_010092449.1|  Subtilisin-like protease SDD1                    68.9    3e-11   
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3       69.7    3e-11   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                       69.3    3e-11   
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  69.3    4e-11   
ref|XP_007210133.1|  hypothetical protein PRUPE_ppa022964mg           68.9    4e-11   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like    68.9    4e-11   
emb|CDP18817.1|  unnamed protein product                              68.9    5e-11   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg           68.9    5e-11   
emb|CDP18580.1|  unnamed protein product                              68.9    5e-11   
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                 68.9    5e-11   
ref|XP_002992980.1|  hypothetical protein SELMODRAFT_187138           68.9    5e-11   
ref|XP_008351708.1|  PREDICTED: cucumisin-like                        66.2    5e-11   
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  68.6    6e-11   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg           68.6    7e-11   
gb|ABE66081.1|  subtilase family protein                              66.6    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  68.9    7e-11   
ref|XP_010104913.1|  Subtilisin-like protease                         68.6    7e-11   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg           68.6    7e-11   
gb|AET04097.2|  subtilisin-like serine protease                       68.2    8e-11   
ref|XP_003629621.1|  Subtilisin-like protease                         68.2    8e-11   
emb|CDX93810.1|  BnaA09g24100D                                        68.2    8e-11   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...  68.2    9e-11   
emb|CDP21113.1|  unnamed protein product                              67.0    9e-11   
ref|XP_007039330.1|  Subtilase family protein, putative               68.2    1e-10   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3       68.2    1e-10   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         68.2    1e-10   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3       67.8    1e-10   
ref|XP_008375386.1|  PREDICTED: subtilisin-like protease              67.8    1e-10   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                    67.8    1e-10   
ref|XP_002891022.1|  subtilase family protein                         67.8    1e-10   
tpg|DAA41966.1|  TPA: putative subtilase family protein               67.4    1e-10   
ref|XP_002518939.1|  Cucumisin precursor, putative                    67.8    1e-10   Ricinus communis
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease              67.8    1e-10   
emb|CDX94251.1|  BnaC02g29110D                                        67.8    1e-10   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg           67.8    1e-10   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  67.4    1e-10   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  67.4    1e-10   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like         67.4    1e-10   
gb|EPS69827.1|  hypothetical protein M569_04935                       67.4    2e-10   
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2   67.4    2e-10   
ref|XP_008667162.1|  PREDICTED: putative subtilase family protein...  67.4    2e-10   
tpg|DAA41968.1|  TPA: putative subtilase family protein               67.4    2e-10   
gb|ACF86497.1|  unknown                                               67.4    2e-10   Zea mays [maize]
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                  67.4    2e-10   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.4    2e-10   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3       67.4    2e-10   
ref|XP_007016589.1|  Subtilase family protein, putative               67.4    2e-10   
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3       67.0    2e-10   
emb|CDY54842.1|  BnaC05g51310D                                        67.4    2e-10   
ref|XP_009420549.1|  PREDICTED: subtilisin-like protease SBT5.3       67.0    2e-10   
gb|KDO48661.1|  hypothetical protein CISIN_1g0368302mg                66.2    2e-10   
ref|XP_002867838.1|  subtilase family protein                         67.0    2e-10   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.0    2e-10   
ref|XP_002962719.1|  hypothetical protein SELMODRAFT_61337            67.0    2e-10   
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...  66.6    2e-10   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.0    2e-10   
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                   67.0    3e-10   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...  66.6    3e-10   
ref|XP_010675509.1|  PREDICTED: subtilisin-like protease SBT5.4       67.0    3e-10   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like         66.6    3e-10   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5       66.6    3e-10   
gb|KDP25529.1|  hypothetical protein JCGZ_20685                       66.6    3e-10   
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5       66.6    3e-10   
ref|XP_008794760.1|  PREDICTED: subtilisin-like protease SBT5.3       66.6    3e-10   
ref|XP_002963482.1|  hypothetical protein SELMODRAFT_405382           66.2    3e-10   
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg           66.6    3e-10   
ref|XP_002867836.1|  subtilase family protein                         66.6    3e-10   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3       66.6    3e-10   
ref|XP_002988191.1|  hypothetical protein SELMODRAFT_426943           66.6    3e-10   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg              66.6    3e-10   
ref|XP_002317030.2|  hypothetical protein POPTR_0011s14930g           66.6    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008667736.1|  PREDICTED: uncharacterized protein LOC100278...  66.2    3e-10   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3       66.6    3e-10   
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3       66.2    4e-10   
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  66.2    4e-10   
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  66.2    4e-10   
ref|XP_008667735.1|  PREDICTED: uncharacterized protein LOC100278...  66.2    4e-10   
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                  66.2    4e-10   
gb|KHN03124.1|  Cucumisin                                             62.8    4e-10   
ref|NP_564414.2|  Subtilase family protein SBT3.3                     66.2    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667730.1|  PREDICTED: uncharacterized protein LOC100278...  66.2    4e-10   
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  66.2    4e-10   
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  66.2    4e-10   
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3       66.2    4e-10   Vitis vinifera
ref|XP_004149954.1|  PREDICTED: cucumisin-like                        66.2    4e-10   
ref|XP_008461717.1|  PREDICTED: cucumisin-like                        66.2    4e-10   
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5       66.2    4e-10   
ref|XP_004164258.1|  PREDICTED: cucumisin-like                        66.2    4e-10   
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like         66.2    4e-10   
ref|XP_002317663.1|  subtilase family protein                         66.2    4e-10   Populus trichocarpa [western balsam poplar]
emb|CBI34615.3|  unnamed protein product                              66.2    4e-10   
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...  66.2    4e-10   
gb|KHN38839.1|  Subtilisin-like protease                              66.2    4e-10   
ref|XP_002518937.1|  Cucumisin precursor, putative                    66.2    4e-10   Ricinus communis
gb|KCW65828.1|  hypothetical protein EUGRSUZ_G03177                   65.5    5e-10   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like         66.2    5e-10   
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...  66.2    5e-10   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3       66.2    5e-10   
ref|XP_002461614.1|  hypothetical protein SORBIDRAFT_02g005460        66.2    5e-10   Sorghum bicolor [broomcorn]
ref|NP_193895.2|  Subtilase family protein                            65.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891021.1|  predicted protein                                65.9    5e-10   
gb|KHN39834.1|  Cucumisin                                             65.9    5e-10   
ref|NP_567633.2|  Subtilase family protein                            65.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464909.1|  PREDICTED: cucumisin-like                        65.9    5e-10   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                        65.9    5e-10   
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3       65.9    6e-10   
emb|CDX93811.1|  BnaA09g24110D                                        65.9    6e-10   
ref|XP_004965849.1|  PREDICTED: cucumisin-like                        65.9    6e-10   
ref|XP_002971639.1|  hypothetical protein SELMODRAFT_412127           65.9    6e-10   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                  65.9    6e-10   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5       66.2    6e-10   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease              65.9    6e-10   
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3       65.9    6e-10   
ref|XP_007016588.1|  Subtilisin-like serine endopeptidase family ...  65.5    6e-10   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574           65.5    7e-10   
ref|XP_002965691.1|  hypothetical protein SELMODRAFT_407291           65.5    7e-10   
ref|XP_002990396.1|  hypothetical protein SELMODRAFT_131663           65.5    7e-10   
gb|AEM42989.1|  cucumisin                                             65.5    7e-10   
gb|EYU32830.1|  hypothetical protein MIMGU_mgv1a020631mg              65.5    7e-10   
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650           65.5    7e-10   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g           65.5    7e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease              65.5    7e-10   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease              65.5    8e-10   
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3       65.5    8e-10   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5       65.5    8e-10   
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease      65.5    8e-10   Vitis vinifera
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...  65.1    9e-10   
emb|CBI38006.3|  unnamed protein product                              65.1    9e-10   
ref|XP_010919429.1|  PREDICTED: cucumisin-like                        65.1    9e-10   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg           65.1    1e-09   
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative    65.1    1e-09   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                 65.1    1e-09   
emb|CDX99526.1|  BnaC09g24660D                                        65.1    1e-09   
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    1e-09   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg           65.1    1e-09   
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    1e-09   
ref|XP_010935422.1|  PREDICTED: cucumisin-like                        65.5    1e-09   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g           65.1    1e-09   
emb|CDX86874.1|  BnaA09g22640D                                        65.1    1e-09   
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    1e-09   
ref|XP_007016587.1|  Subtilase family protein, putative isoform 1     64.7    1e-09   
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873           65.1    1e-09   
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    1e-09   
ref|XP_007016591.1|  Subtilase family protein, putative isoform 1     64.7    1e-09   
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3       64.7    1e-09   
emb|CDX94043.1|  BnaC07g36770D                                        64.7    1e-09   
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5       64.7    1e-09   
emb|CDX82843.1|  BnaC01g12930D                                        64.7    1e-09   
ref|XP_002986919.1|  hypothetical protein SELMODRAFT_125066           64.7    1e-09   
ref|XP_007016592.1|  Subtilase 4.13, putative isoform 2               64.7    1e-09   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  64.7    1e-09   
ref|XP_010109770.1|  hypothetical protein L484_008446                 64.7    1e-09   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1         64.7    1e-09   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5       64.7    1e-09   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1         64.7    1e-09   
ref|NP_001046518.1|  Os02g0270200                                     64.3    1e-09   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    1e-09   
dbj|BAD35681.1|  putative subtilisin-like serine proteinase           64.3    1e-09   
ref|XP_002869615.1|  predicted protein                                64.7    2e-09   
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                  64.7    2e-09   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5       64.3    2e-09   
ref|XP_010436456.1|  PREDICTED: subtilisin-like protease SBT3.5       64.3    2e-09   
gb|KDP44852.1|  hypothetical protein JCGZ_01352                       64.3    2e-09   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  64.3    2e-09   
gb|EAY91723.1|  hypothetical protein OsI_13365                        61.2    2e-09   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  64.3    2e-09   
ref|XP_004490922.1|  PREDICTED: cucumisin-like                        64.3    2e-09   
ref|XP_002887016.1|  subtilase family protein                         64.3    2e-09   
dbj|BAA13135.1|  subtilisin-like protein                              64.3    2e-09   
ref|XP_006370742.1|  hypothetical protein POPTR_0001s460001g          63.2    2e-09   
gb|EAZ01729.1|  hypothetical protein OsI_23755                        64.3    2e-09   
ref|NP_564413.2|  subtilase family protein                            64.3    2e-09   
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...  64.3    2e-09   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2     64.3    2e-09   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg           64.3    2e-09   
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842            64.3    2e-09   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    2e-09   
ref|XP_009120430.1|  PREDICTED: cucumisin-like                        63.9    2e-09   
ref|XP_008797388.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    2e-09   
gb|EEE66042.1|  hypothetical protein OsJ_22024                        63.9    2e-09   
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3       63.5    2e-09   
ref|XP_004309572.1|  PREDICTED: subtilisin-like protease-like         64.3    2e-09   
ref|XP_002451012.1|  hypothetical protein SORBIDRAFT_05g022600        63.9    2e-09   
ref|NP_001174909.1|  Os06g0624100                                     64.3    2e-09   
ref|XP_010928976.1|  PREDICTED: subtilisin-like protease SBT3.5       63.9    2e-09   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease              63.9    2e-09   
gb|KHG07231.1|  Cucumisin                                             63.9    2e-09   
ref|XP_011081159.1|  PREDICTED: cucumisin-like                        63.9    2e-09   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1     63.9    2e-09   
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4       63.9    3e-09   
gb|EEE56708.1|  hypothetical protein OsJ_06199                        63.9    3e-09   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5       63.9    3e-09   
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    3e-09   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg           63.9    3e-09   
emb|CDP09825.1|  unnamed protein product                              63.5    3e-09   
gb|KHN41792.1|  Subtilisin-like protease                              63.5    3e-09   
gb|EEC72887.1|  hypothetical protein OsI_06697                        63.9    3e-09   
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                   63.9    3e-09   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    3e-09   
emb|CDX79081.1|  BnaA01g11480D                                        63.5    3e-09   
ref|XP_004951230.1|  PREDICTED: subtilisin-like protease-like         63.5    3e-09   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg           63.5    3e-09   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like         63.5    3e-09   
ref|NP_567632.1|  Subtilase family protein                            63.5    3e-09   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  63.9    3e-09   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5       63.5    3e-09   
gb|KEH27645.1|  subtilisin-like serine protease                       63.5    3e-09   
ref|XP_003612438.1|  Subtilisin-like protease                         63.5    3e-09   
ref|XP_002972044.1|  hypothetical protein SELMODRAFT_96495            63.5    3e-09   
gb|KDP30627.1|  hypothetical protein JCGZ_16192                       63.5    3e-09   
ref|XP_006370729.1|  hypothetical protein POPTR_0001s45480g           63.2    4e-09   
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5       63.5    4e-09   
gb|AAL24366.1|  subtilisin proteinase-like                            63.5    4e-09   
emb|CAB36809.1|  subtilisin proteinase-like                           63.5    4e-09   
ref|XP_004309570.1|  PREDICTED: subtilisin-like protease-like         63.5    4e-09   
ref|XP_008461724.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like   63.2    4e-09   
ref|XP_004149951.1|  PREDICTED: cucumisin-like                        63.5    4e-09   
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg           63.2    4e-09   
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  63.2    4e-09   
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3       63.2    4e-09   
ref|XP_002891020.1|  subtilase family protein                         63.2    4e-09   
ref|XP_003607044.1|  Subtilisin-like protease                         63.2    4e-09   
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like         63.2    4e-09   
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  63.2    4e-09   
gb|KDP25228.1|  hypothetical protein JCGZ_20384                       62.0    4e-09   
emb|CBI23085.3|  unnamed protein product                              63.5    4e-09   
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3       63.2    4e-09   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  63.2    4e-09   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...  63.2    5e-09   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...  63.2    5e-09   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...  63.2    5e-09   
ref|XP_006351094.1|  PREDICTED: cucumisin-like                        63.2    5e-09   
ref|XP_008461745.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like   63.2    5e-09   
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.2    5e-09   
gb|KHG23166.1|  Cucumisin                                             62.8    5e-09   
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3       63.2    5e-09   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3       63.2    5e-09   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.2    5e-09   
emb|CAN80173.1|  hypothetical protein VITISV_018392                   63.2    5e-09   
ref|XP_010691741.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  62.8    5e-09   
ref|XP_002972591.1|  hypothetical protein SELMODRAFT_97292            62.8    5e-09   
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.2    5e-09   
emb|CAN68992.1|  hypothetical protein VITISV_039721                   62.8    5e-09   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg           63.2    5e-09   
ref|XP_004165285.1|  PREDICTED: cucumisin-like                        63.2    5e-09   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg           62.8    5e-09   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg           62.8    6e-09   
ref|XP_009409658.1|  PREDICTED: cucumisin-like                        62.8    6e-09   
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5       62.8    6e-09   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                       62.8    6e-09   
ref|XP_004153386.1|  PREDICTED: cucumisin-like                        62.0    6e-09   
ref|XP_006857966.1|  hypothetical protein AMTR_s00069p00176100        62.8    6e-09   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3       62.8    6e-09   
ref|XP_004165286.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like   62.8    6e-09   
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5       62.8    6e-09   
emb|CBI37484.3|  unnamed protein product                              62.8    6e-09   
ref|XP_004490923.1|  PREDICTED: cucumisin-like                        62.8    6e-09   
emb|CDX98690.1|  BnaA03g44750D                                        62.8    7e-09   
ref|XP_002263237.2|  PREDICTED: subtilisin-like protease SBT3.5 i...  62.8    7e-09   
emb|CDX94044.1|  BnaC07g36780D                                        62.8    7e-09   
ref|XP_003629039.1|  Serine protease-like protein                     62.8    7e-09   
ref|XP_011033825.1|  PREDICTED: cucumisin-like                        62.8    7e-09   
ref|XP_010649319.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  62.4    7e-09   
ref|XP_010649320.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  62.4    7e-09   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like         62.4    7e-09   
ref|XP_011048160.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  62.4    7e-09   
ref|XP_010919430.1|  PREDICTED: cucumisin-like                        62.4    7e-09   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...  62.4    7e-09   
gb|EMS53237.1|  Subtilisin-like protease                              62.4    7e-09   
gb|KHG08490.1|  Cucumisin                                             62.4    7e-09   
ref|NP_564869.1|  Subtilase-like protein                              62.4    7e-09   
gb|AES89241.2|  subtilisin-like serine protease                       62.4    8e-09   
gb|KHN28302.1|  Subtilisin-like protease                              62.4    8e-09   
emb|CBI31873.3|  unnamed protein product                              62.4    8e-09   
ref|XP_009611073.1|  PREDICTED: subtilisin-like protease SBT5.3       62.4    8e-09   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3       62.4    8e-09   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like         62.4    8e-09   
ref|XP_002528535.1|  Cucumisin precursor, putative                    62.4    8e-09   
gb|EMS63596.1|  Cucumisin                                             62.4    8e-09   
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...  62.4    8e-09   
ref|NP_001169603.1|  putative subtilase family protein precursor      62.4    8e-09   
ref|XP_007015871.1|  Cucumisin protein                                62.4    8e-09   
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319           62.4    8e-09   
ref|XP_011085840.1|  PREDICTED: CO(2)-response secreted protease-...  62.4    9e-09   
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460           62.4    9e-09   
emb|CDX80297.1|  BnaC09g34450D                                        62.4    9e-09   
ref|NP_564412.1|  Subtilase 3.5                                       62.4    9e-09   
dbj|BAC53929.1|  serine protease-like protein                         62.0    9e-09   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  62.4    9e-09   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4     62.0    9e-09   
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...  62.4    9e-09   
ref|XP_010106565.1|  hypothetical protein L484_025325                 62.4    9e-09   
emb|CAB36808.1|  subtilisin-like protease                             62.0    1e-08   
ref|XP_011032225.1|  PREDICTED: cucumisin-like                        62.0    1e-08   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease              62.0    1e-08   
ref|XP_002991821.1|  hypothetical protein SELMODRAFT_134229           62.0    1e-08   
ref|XP_002864619.1|  hypothetical protein ARALYDRAFT_919147           58.5    1e-08   
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4       62.0    1e-08   
emb|CDX98438.1|  BnaC05g39370D                                        62.0    1e-08   
ref|XP_008461722.1|  PREDICTED: cucumisin-like                        62.0    1e-08   
ref|XP_002451941.1|  hypothetical protein SORBIDRAFT_04g010330        60.1    1e-08   
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351           62.0    1e-08   
emb|CDY33016.1|  BnaA10g12220D                                        62.0    1e-08   
ref|XP_009351463.1|  PREDICTED: cucumisin-like                        58.9    1e-08   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g           62.0    1e-08   
ref|XP_002437302.1|  hypothetical protein SORBIDRAFT_10g024550        62.0    1e-08   
ref|XP_007016590.1|  Subtilisin serine endopeptidase family prote...  62.0    1e-08   
ref|XP_006647148.1|  PREDICTED: subtilisin-like protease-like         62.0    1e-08   
ref|XP_010106817.1|  Xylem serine proteinase 1                        58.5    1e-08   
emb|CDX98693.1|  BnaA03g44780D                                        62.0    1e-08   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3       62.0    1e-08   
emb|CDP15047.1|  unnamed protein product                              62.0    1e-08   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3       62.0    1e-08   
ref|XP_002874634.1|  subtilase family protein                         62.0    1e-08   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...  62.0    1e-08   
gb|EYU28708.1|  hypothetical protein MIMGU_mgv1a0019261mg             58.9    1e-08   
ref|XP_010667129.1|  PREDICTED: cucumisin-like                        61.6    1e-08   
ref|XP_007009168.1|  Subtilisin-like serine endopeptidase family ...  61.6    1e-08   
ref|XP_008363061.1|  PREDICTED: cucumisin-like                        58.9    1e-08   
ref|XP_009420612.1|  PREDICTED: subtilisin-like protease SBT5.4       61.6    1e-08   
emb|CAB40021.1|  subtilisin-like protease-like protein                62.0    1e-08   
ref|XP_010101169.1|  Subtilisin-like protease                         61.6    1e-08   
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like        62.0    1e-08   
ref|XP_002872522.1|  subtilase family protein                         61.6    1e-08   
ref|NP_567362.1|  subtilisin-like protease                            61.6    1e-08   
ref|XP_009391454.1|  PREDICTED: subtilisin-like protease SBT5.3       61.6    1e-08   
emb|CDP01740.1|  unnamed protein product                              61.6    1e-08   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1     61.6    1e-08   
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                   62.0    1e-08   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3     61.6    1e-08   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  61.6    1e-08   
ref|NP_001190697.1|  subtilisin-like protease                         61.6    1e-08   
ref|XP_007009166.1|  Subtilisin-like serine endopeptidase family ...  61.2    1e-08   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4       61.6    1e-08   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4       61.6    1e-08   
ref|XP_010091320.1|  Subtilisin-like protease                         61.6    1e-08   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4       61.6    1e-08   
emb|CDM82077.1|  unnamed protein product                              61.6    1e-08   
emb|CDX97560.1|  BnaA05g25190D                                        61.6    2e-08   
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3       61.6    2e-08   
ref|XP_010694663.1|  PREDICTED: CO(2)-response secreted protease-...  61.6    2e-08   
gb|KDO66671.1|  hypothetical protein CISIN_1g0384741mg                58.9    2e-08   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg           61.6    2e-08   
ref|XP_006301478.1|  hypothetical protein CARUB_v10021900mg           61.6    2e-08   
ref|XP_008779567.1|  PREDICTED: cucumisin-like                        61.6    2e-08   
emb|CBI24460.3|  unnamed protein product                              61.6    2e-08   
gb|EMT05336.1|  Subtilisin-like protease                              61.6    2e-08   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease              61.6    2e-08   
ref|XP_010113170.1|  Subtilisin-like protease SDD1                    60.5    2e-08   



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D  QL++SL+KRN  ++V  Y  GF GF+ARL+ EEA+SIAQ PGVVSVFPDP+L L 
Sbjct  12   RTDHTQLLSSLMKRNKNSVVQNYNKGFSGFAARLSEEEAKSIAQRPGVVSVFPDPVLQLH  71

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  KI  T      S       SS+GADTIIGIL
Sbjct  72   TTRSWDFLKYQTAVKIDSTPTSPFDS-------SSAGADTIIGIL  109



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQAQLI+SL+KRN  A+++ Y NGF GF+ARL+  EA+SIAQ PGVVSVFPDP+L L 
Sbjct  49   RNDQAQLISSLIKRNKNAVIHRYENGFSGFAARLSESEAQSIAQRPGVVSVFPDPVLQLH  108

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL    Y     TN   S+ + ++  +    ADTIIGIL
Sbjct  109  TTRSWDFL---KYQTGDETNSSPSSRSDSSPNV----ADTIIGIL  146



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQAQLI+SL+KRN  A+++ Y NGF GF+ARL+  EA+SIAQ PGVVSVFPDP+L L 
Sbjct  49   RNDQAQLISSLIKRNKNAVIHRYENGFSGFAARLSESEAQSIAQRPGVVSVFPDPVLQLH  108

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL    Y     TN   S+ + ++  +    ADTIIGIL
Sbjct  109  TTRSWDFL---KYQTGDETNSSPSSRSDSSPNV----ADTIIGIL  146



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQAQLI+SL++RN  A+V++Y NGF GF+ARL+  EA+S+AQ PGVVSVFPDP+L L 
Sbjct  48   RHDQAQLISSLIRRNKNAVVHSYKNGFSGFAARLSEAEAKSMAQRPGVVSVFPDPVLQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL   +  KI+ +    S S+         GADTIIGIL
Sbjct  108  TTHSWDFLKYQTDEKINSSPSSGSDSSLI-------GADTIIGIL  145



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQAQLI+SL++RN  A+V++Y NGF GF+ARL+  EA+S+AQ PGV+SVFPDP+L L 
Sbjct  48   RHDQAQLISSLIRRNKNAVVHSYNNGFSGFAARLSEAEAKSMAQRPGVISVFPDPVLQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL   +  KI+ +    S S+         GADTIIGIL
Sbjct  108  TTHSWDFLKYQTDEKINSSPSSGSDSSLI-------GADTIIGIL  145



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + +QA L++SL++R   A+V++Y NGF GF+ARL+  EA SIAQ PGV+SVFPDPIL+L 
Sbjct  48   KNNQADLMSSLIRRKKDAIVHSYKNGFSGFAARLSEAEANSIAQKPGVISVFPDPILNLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  +IS   +  S S       S +GADTIIGIL
Sbjct  108  TTRSWDFLQYQTDVEISSGPIYGSGS-------SPNGADTIIGIL  145



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + +QA+L++SL++R   A+V++Y NGF GF+A L+  EA SIAQ PGV+SVFPDPIL+L 
Sbjct  48   KNNQAELMSSLIRRKKDAIVHSYKNGFSGFAAHLSEAEANSIAQKPGVISVFPDPILNLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  +IS   L  S S       S  GADTIIGIL
Sbjct  108  TTRSWDFLQYQTDVEISSGPLSGSDS-------SPKGADTIIGIL  145



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ+++SLLKR   ALV++Y +GF GF+A LT EEARSIAQ PGVVSVF DP+L L 
Sbjct  22   RYDHAQILSSLLKRKANALVHSYRHGFSGFAAHLTEEEARSIAQKPGVVSVFEDPVLQLH  81

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSG-ADTIIGIL  315
            TTRSWDFL          T+L   +   +     SSG ADTIIGIL
Sbjct  82   TTRSWDFLH-------YQTDLETDSKPGSDGDSQSSGQADTIIGIL  120



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ+++SLLKR   ALV++Y +GF GF+A LT EEARSIAQ PGVVSVF DP+L L 
Sbjct  47   RYDHAQILSSLLKRKANALVHSYRHGFSGFAAHLTEEEARSIAQKPGVVSVFEDPVLQLH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSG-ADTIIGIL  315
            TTRSWDFL          T+L   +   +     SSG ADTIIGIL
Sbjct  107  TTRSWDFLH-------YQTDLETDSKPGSDGDSQSSGQADTIIGIL  145



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL++SLLKRN  ALV +Y NGF GF+ARL+AEEA SIAQ  GVVSVFPDP+L L 
Sbjct  47   RHDHAQLLSSLLKRNKNALVRSYKNGFSGFAARLSAEEAHSIAQRAGVVSVFPDPVLELH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL+  +   I       S ST+     + SGA  IIGIL
Sbjct  107  TTRSWDFLNYQTSVVIDSNPNPNSNSTS-----NDSGA--IIGIL  144



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQ QL++SL+KRN   +V++Y NGF GF+ARL+  EA+SIAQ PGVVSVFPDP+L L 
Sbjct  50   RNDQMQLVSSLIKRNKNTVVHSYKNGFSGFAARLSEAEAQSIAQRPGVVSVFPDPVLQLH  109

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL    Y  +  TN   S+ + ++     +GADTIIGIL
Sbjct  110  TTRSWDFL---KYQTVDETNSSPSSGSDSS----PNGADTIIGIL  147



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQ QL++SL+KRN   +V++Y NGF GF+ARL+  EA+SIAQ PGVVSVFPDP+L L 
Sbjct  50   RNDQMQLVSSLIKRNKNTVVHSYKNGFSGFAARLSEAEAQSIAQRPGVVSVFPDPVLQLH  109

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL    Y  +  TN   S+ + ++     +GADTIIGIL
Sbjct  110  TTRSWDFL---KYQTVDETNSSPSSGSDSS----PNGADTIIGIL  147



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 6/105 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            +  QA+L++SL+KR   A+V++Y NGF GF+ARL+  EA+SIAQ PGV+SVFPDPIL L 
Sbjct  48   KNQQAELMSSLIKRKKDAVVHSYNNGFSGFAARLSEAEAKSIAQKPGVISVFPDPILQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  + S      S   + +   S  G DTIIGIL
Sbjct  108  TTRSWDFLQYQTEVESS------SGPISGSDNASPKGVDTIIGIL  146



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R+D A ++ ++LKRN KALV+ Y +GF GF+ARL+  EA SIAQ PGVVSVFPDPIL L 
Sbjct  52   REDHAHILNTVLKRNEKALVHNYKHGFSGFAARLSKSEANSIAQQPGVVSVFPDPILKLH  111

Query  181  TTRSWDFLDSISYTKI  228
            TTRSWDFL+  +Y K+
Sbjct  112  TTRSWDFLEMQTYAKL  127



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R+D A ++ ++LKRN KALV+ Y +GF GF+ARL+  EA SIAQ PGVVSVFPDPIL L 
Sbjct  52   REDHAHILNTVLKRNEKALVHNYKHGFSGFAARLSKSEANSIAQQPGVVSVFPDPILKLH  111

Query  181  TTRSWDFLDSISYTKI  228
            TTRSWDFL+  +Y K+
Sbjct  112  TTRSWDFLEMQTYAKL  127



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL++S++ R   A+V+TY +GF GF+ARLT EEARSIA  PGVVSVF DPIL L 
Sbjct  69   RDDHAQLLSSVVTRKPNAVVHTYKHGFSGFAARLTDEEARSIASKPGVVSVFLDPILKLH  128

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAA--AQPLSSSGADTIIGIL  315
            TT SWDFL   +  KI  +NL  +   AA     +++ G+DTIIGIL
Sbjct  129  TTHSWDFLKYQTALKID-SNLNSNNYDAADGVSLVTADGSDTIIGIL  174



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D  QL+ S+LKR  K +VY+Y NGF GF+ARL+ EEARSIAQ PGVVSVFPDP+L L 
Sbjct  47   RNDHDQLLNSMLKRK-KDVVYSYNNGFSGFAARLSEEEARSIAQRPGVVSVFPDPLLQLH  105

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  +I   NLR ++ + ++    S+G DTIIGI+
Sbjct  106  TTRSWDFLKYQTDVEI---NLRPTSGSNSS----SNGEDTIIGIM  143



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D A L+ S+L+R   A+V+TY +GF GF+ARL+ EEARSIA  PGVVSVFPDP+L L 
Sbjct  54   RNDHALLLKSVLRRKANAVVHTYRHGFSGFAARLSEEEARSIAHKPGVVSVFPDPLLKLH  113

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT+SW+FL   +  +I       S +      +S++G+DTIIGIL
Sbjct  114  TTQSWEFLKYQTALEIYSNPNSISGAANGFSSVSANGSDTIIGIL  158



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL+ ++L+RN KALV  Y +GF GF+ARL+ EEA SIAQ PGVVSVFPDP+L L 
Sbjct  53   RNDHAQLLNAVLRRNDKALVRNYKHGFSGFAARLSKEEANSIAQKPGVVSVFPDPVLKLH  112

Query  181  TTRSWDFLDSISYTKI  228
            TTRSWDFL   ++ KI
Sbjct  113  TTRSWDFLKYQTHVKI  128



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D A L+ S+L+R   A+V+TY +GF GF+ARL+ EEARSIA  PGVVSVFPDP+L L 
Sbjct  16   RNDHALLLKSVLRRKANAVVHTYRHGFSGFAARLSEEEARSIAHKPGVVSVFPDPLLKLH  75

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT+SW+FL   +  +I       S +      +S++G+DTIIGIL
Sbjct  76   TTQSWEFLKYQTALEIYSNPNSISGAANGFSSVSANGSDTIIGIL  120



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + + AQL++S+LKR   ALV++Y +G  GF+ARL+A EA+SIA+NPGVVSVFPDP+  L 
Sbjct  47   KNEHAQLLSSVLKRRKNALVHSYEHGISGFTARLSAAEAQSIAKNPGVVSVFPDPVYQLH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL          T+++   S  +   LSS G D IIGIL
Sbjct  107  TTRSWDFLK-------YGTDVKIDLSPNSDSNLSSRGYDVIIGIL  144



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + + AQL++S+LKR   ALV++Y +G  GF+ARL+A EA+SIA+NPGVVSVFPDP+  L 
Sbjct  47   KNEHAQLLSSVLKRRKNALVHSYEHGISGFTARLSAAEAQSIAKNPGVVSVFPDPVYQLH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL          T+++   S  +   LSS G D IIGIL
Sbjct  107  TTRSWDFLK-------YGTDVKIDLSPNSDSNLSSRGYDVIIGIL  144



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D A L+  +L+RN KALV  Y +GF GF+A L+ EEA SIAQ PGVVSVFPDPIL+L 
Sbjct  57   RNDHAHLLNRVLRRNEKALVRNYKHGFSGFAAHLSKEEANSIAQQPGVVSVFPDPILNLH  116

Query  181  TTRSWDFLDSISYTKI  228
            TTRSWDFLD  ++ KI
Sbjct  117  TTRSWDFLDLQTHVKI  132



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            +  +A+L++SL++R   A+V++Y+NGF GF+ARL+  EA+SIAQ PGV+SVFPDPIL L 
Sbjct  48   KNQRAELMSSLIRRKKDAVVHSYSNGFSGFAARLSEAEAKSIAQKPGVISVFPDPILQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  + S      S   + +   S  G DTIIGIL
Sbjct  108  TTRSWDFLQYQTEVESS------SGPISGSDNASPKGVDTIIGIL  146



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D A L+  +L+RN KALV  Y +GF GF+A L+ EEA SIAQ PGVVSVFPDPIL+L 
Sbjct  58   RNDHAHLLNRVLRRNEKALVRNYKHGFSGFAAHLSKEEANSIAQQPGVVSVFPDPILNLH  117

Query  181  TTRSWDFLDSISYTKIS  231
            TTRSWDFLD  ++ KI+
Sbjct  118  TTRSWDFLDLQTHVKIN  134



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL+ SL+ R   A+++TY++GF GF+ARL+ +EA+ IA+ PGVVSVFPDP+L L 
Sbjct  47   RNDHAQLLRSLMNRKKNAVLHTYSHGFLGFAARLSDKEAKLIAKRPGVVSVFPDPVLQLH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL  +  T   PT+             SSSG DTIIG L
Sbjct  107  TTHSWDFLKYLDSTPKVPTD------------SSSSGEDTIIGFL  139



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL+ SL+ R   A+++TY++GF GF+ARL+ +EA+ IA+ PGVVSVFPDP+L L 
Sbjct  47   RNDHAQLLRSLMNRKKNAVLHTYSHGFLGFAARLSDKEAKLIAKRPGVVSVFPDPVLQLH  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL  +  T   PT+             SSSG DTIIG L
Sbjct  107  TTHSWDFLKYLDSTPKVPTD------------SSSSGEDTIIGFL  139



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++ S+L+RN  ALV  Y +GF GF+ARL+ +EA SIAQ PGVVSVFPDP+L L 
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPDPVLKLH  115

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  KI              +P + S + ++IGIL
Sbjct  116  TTRSWDFLKYQTQVKID------------TKPNAVSKSSSVIGIL  148



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 12/107 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++ S+LKR+ KALV  Y +GF GF+ARL+ EEA SIAQ PGVVSVFPDPIL L 
Sbjct  57   RNDHAQILNSVLKRDKKALVRNYKHGFSGFAARLSKEEADSIAQKPGVVSVFPDPILKLH  116

Query  181  TTRSWDFLDSISYTKIS--PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSW FL+  +  ++   P  L             SS +D I+GI+
Sbjct  117  TTRSWYFLEQQTRVEVDTKPNTLSN----------FSSSSDIILGII  153



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D  Q++ S+LKRN  A+V  Y +GF GF+ARL+ EEA SI+Q PGVVSVFPDPIL L 
Sbjct  52   RNDHVQILNSVLKRNENAIVRNYKHGFSGFAARLSKEEANSISQKPGVVSVFPDPILKLH  111

Query  181  TTRSWDFLDS  210
            TTRSWDFL S
Sbjct  112  TTRSWDFLKS  121



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            RKD   ++  +L+RN KALV+ Y  GF GF+ARL+  EA SIAQ PGVVSVF DPIL L 
Sbjct  51   RKDHDHVLNMVLRRNEKALVHNYKYGFSGFAARLSKNEANSIAQQPGVVSVFLDPILKLH  110

Query  181  TTRSWDFLDSISYTKISPT  237
            TTRSWDFL+S +Y +I  T
Sbjct  111  TTRSWDFLNSQTYVEIDNT  129



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + D AQL++S+LKR   ALV +Y +G  GF+ARL+A EA+SIA+NPGVVSVFPDP+  L 
Sbjct  46   KNDHAQLLSSVLKRRKNALVQSYEHGISGFAARLSAAEAQSIARNPGVVSVFPDPVYQLH  105

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL          T++   +S  +    SS G D+IIGIL
Sbjct  106  TTRSWDFLK-------YGTDVVIDSSPNSNSSSSSGGYDSIIGIL  143



>ref|NP_001238252.1| subtilisin-type protease precursor [Glycine max]
 gb|AAG38994.1|AF160513_1 subtilisin-type protease precursor [Glycine max]
 emb|CAB87246.1| putative pre-pro-subtilisin [Glycine max]
 emb|CAB87247.1| putative subtilisin precursor [Glycine max]
Length=770

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + + AQ++ S+L+RN  ALV  Y +GF GF+ARL+ EEA SIAQ PGVVSVFPDPIL L 
Sbjct  57   KNEHAQILNSVLRRNENALVRNYKHGFSGFAARLSKEEANSIAQKPGVVSVFPDPILKLH  116

Query  181  TTRSWDFLDS  210
            TTRSWDFL S
Sbjct  117  TTRSWDFLKS  126



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++ S+L+RN  ALV  Y +GF GF+ARL+ +EA SIAQ PGVVSVFP P+L L 
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPGPVLKLH  115

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  KI              +P + S + ++IGIL
Sbjct  116  TTRSWDFLKYQTQVKID------------TKPNAVSKSSSVIGIL  148



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++ S+L+RN  ALV  Y +GF GF+ARL+ +EA SIAQ PGVVSVFP P+L L 
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPGPVLKLH  115

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  KI              +P + S + ++IGIL
Sbjct  116  TTRSWDFLKYQTQVKID------------TKPNAVSKSSSVIGIL  148



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++  +L+RN  ALV  Y +GF GF+ARL+ EEA SIA  PGVVSVFPDPIL+L 
Sbjct  52   RNDHAQVLNLVLRRNENALVRNYKHGFSGFAARLSKEEAASIAHKPGVVSVFPDPILNLH  111

Query  181  TTRSWDFLDSISYTKI  228
            TTRSW+FL   ++ KI
Sbjct  112  TTRSWEFLKYQTHVKI  127



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 10/107 (9%)
 Frame = +1

Query  4    KDQAQLIASLLKRNG---KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +D  QL++S+L+R     + LVY+Y NGF GF+A LT EEA ++ Q PGVVSVF DP+L 
Sbjct  55   EDHIQLLSSVLERTEAMQERLVYSYRNGFSGFAAHLTEEEAGAMVQKPGVVSVFEDPVLQ  114

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTRSWDFL          T+L+R ++ ++     + G+DTIIGIL
Sbjct  115  LHTTRSWDFLQ-------YQTDLKRDSNPSSDSDTLTQGSDTIIGIL  154



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + D AQL++SLLKR   ALV+ Y +GF GF+A L+AEEA SIA+ PGVVSVFPD +L L 
Sbjct  12   KDDHAQLLSSLLKRKTNALVHNYKHGFSGFAAVLSAEEAHSIAERPGVVSVFPDSVLELH  71

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +   I       S ST+       SGA  IIG+L
Sbjct  72   TTRSWDFLKYQTSVVIDSNPNSDSNSTSDPD----SGA--IIGVL  110



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + D AQL++SLLKR   ALV+ Y +GF GF+A L+AEEA SIA+ PGVVSVFPD +L L 
Sbjct  12   KDDHAQLLSSLLKRKTNALVHNYKHGFSGFAAVLSAEEAHSIAERPGVVSVFPDSVLELH  71

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +   I       S ST+       SGA  IIG+L
Sbjct  72   TTRSWDFLKYQTSVVIDSNPNSDSNSTSDPD----SGA--IIGVL  110



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            RKD A +++++L+RN KALV+ Y  GF GF+ARL+  E   +AQ PGVVSVFPDPIL L 
Sbjct  52   RKDHAYVLSTVLRRNEKALVHNYKYGFSGFAARLSKNEVNLVAQQPGVVSVFPDPILKLY  111

Query  181  TTRSWDFLD  207
            TTRSWDFLD
Sbjct  112  TTRSWDFLD  120



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +1

Query  7    DQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            D  QL++SL  R   A+V++Y + F GF+ARL+ +EA+SIAQ+PGVVSVFPDP+  L TT
Sbjct  42   DHIQLMSSLTTRRKNAVVHSYKHSFSGFAARLSDDEAQSIAQHPGVVSVFPDPVFQLHTT  101

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFL           NL  +   ++    +S GADTIIGI 
Sbjct  102  RSWDFLR-------DQYNLLHNFPDSSHSNSTSKGADTIIGIF  137



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQ QL++SL  R   A+V++Y N F GF+A L+  EA+SIAQ PGV+SVFPDP+  L 
Sbjct  48   RDDQIQLMSSLTTRRKNAVVHSYRNSFSGFAALLSDAEAQSIAQQPGVISVFPDPVFQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL           +L  S   ++    +S+G DTIIGI 
Sbjct  108  TTRSWDFL-------TDQYDLVHSFPNSSGPNSTSNGVDTIIGIF  145



>gb|EPS70387.1| hypothetical protein M569_04373 [Genlisea aurea]
Length=185

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 68/105 (65%), Gaps = 12/105 (11%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R +   L++S++KR   A+++TY+NGF GF+ARL+ EE  SIAQ P V+SVF DPIL+L 
Sbjct  53   RNEHGPLLSSVMKRKRNAVLHTYSNGFSGFAARLSKEEVNSIAQMPEVLSVFKDPILNLH  112

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSW+FL      KI           +A +  S +GAD I+GIL
Sbjct  113  TTRSWEFLRYQDALKID----------SATE--SYTGADVILGIL  145



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL+AS+LK    +++ +Y +GF GF+ARL+AEEA ++++ PGVVS+FPDP+L L 
Sbjct  48   RDDHAQLLASMLKWKKNSIIRSYKHGFSGFAARLSAEEAHALSKKPGVVSIFPDPVLQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL      KI    L  S  + +        +DTIIGIL
Sbjct  108  TTRSWDFL------KIQTDVLIDSVPSPSLNSQDQE-SDTIIGIL  145



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQL+AS+LK    +++ +Y +GF GF+ARL+AEEA ++++ PGVVS+FPDP+L L 
Sbjct  48   RDDHAQLLASMLKWKKNSIIRSYKHGFSGFAARLSAEEAHALSKKPGVVSIFPDPVLQLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL      KI    L  S  + +        +DTIIGIL
Sbjct  108  TTRSWDFL------KIQTDVLIDSVPSPSLNSQDQE-SDTIIGIL  145



>gb|KDP36888.1| hypothetical protein JCGZ_08179 [Jatropha curcas]
Length=705

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 13/105 (12%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              D  QL++S+L R   +LV +Y NGF GF+ARL+  E +SIA+ PGVVSVFPDP+L L 
Sbjct  9    ENDYVQLLSSILTRKKNSLVRSYRNGFSGFAARLSEAEVQSIAKRPGVVSVFPDPVLQLH  68

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  +I  +++             S G+DTI+GI+
Sbjct  69   TTRSWDFLKYQTDIEIDSSSM-------------SHGSDTIVGII  100



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 13/105 (12%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              D  QL++S+L R   +LV +Y NGF GF+ARL+  E +SIA+ PGVVSVFPDP+L L 
Sbjct  42   ENDYVQLLSSILTRKKNSLVRSYRNGFSGFAARLSEAEVQSIAKRPGVVSVFPDPVLQLH  101

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   +  +I  +++             S G+DTI+GI+
Sbjct  102  TTRSWDFLKYQTDIEIDSSSM-------------SHGSDTIVGII  133



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +1

Query  7    DQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            D   L++SL  R   A+V++Y N F GF+ARL+ +EA+SIAQ+PGVVSVFPDP+  L TT
Sbjct  42   DHIHLMSSLTTRRKNAVVHSYKNSFSGFAARLSDDEAQSIAQHPGVVSVFPDPVFQLHTT  101

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSW+FL           NL  +   ++    +S+GADTIIGI 
Sbjct  102  RSWEFLR-------DQYNLVHNFPYSSHSNSTSNGADTIIGIF  137



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 8/100 (8%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            +++SLL+RN  ALV++Y +GF GF+A L+  EA  +   PGVVSVFPDP+  L TTRSWD
Sbjct  46   ILSSLLRRNKNALVHSYKHGFSGFAAHLSDSEAHQLTNEPGVVSVFPDPVYQLHTTRSWD  105

Query  199  FLD-SISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   IS        L  S   + A  LSS G+DTIIGIL
Sbjct  106  FLQREISL-------LTDSQPRSNAPVLSSQGSDTIIGIL  138



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
             A ++ ++L+RN KALV+ Y +GF GF+ARL+  EA SIAQ PGVVSVFPDPIL L TT 
Sbjct  49   NAHVLNTVLRRNEKALVHNYKHGFSGFAARLSKNEAASIAQQPGVVSVFPDPILKLHTTH  108

Query  190  SWDFLDSISYTKI  228
            SWDFL   ++ KI
Sbjct  109  SWDFLKLQTHVKI  121



>gb|KFK44142.1| hypothetical protein AALP_AA1G220500 [Arabis alpina]
Length=706

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++S+LKRNGK  ++ Y +GF GF+A L+ +EA  +A+ PGVVSVFPD +L L T
Sbjct  49   NDHVELLSSMLKRNGKTPMHHYKHGFSGFAAHLSEDEAEMMAKQPGVVSVFPDQMLPLHT  108

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY + +       T T     L  +  DTIIG L
Sbjct  109  TRSWDFLVQESYQRDT-----YYTETNTGPKLDVAVGDTIIGFL  147



>gb|KHN09069.1| Cucumisin [Glycine soja]
Length=181

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ++  +L R+  A+V  Y +GF  F+ARL+ EEA SIAQ  GVVSVFPDPIL L 
Sbjct  58   RNDHAQVLNLVLSRDENAIVRNYKHGFSWFAARLSKEEAASIAQKAGVVSVFPDPILQLH  117

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             TR W+FL   ++ KI         +   A   SSS +D I+G+L
Sbjct  118  ATRFWEFLKYQTHVKID--------TKPNAVFNSSSSSDIILGVL  154



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            + D AQL++S+LKR   ALV +Y +G  GF+ARL+A EA+SIA+ PGVVSVF DP+  L 
Sbjct  46   KNDHAQLLSSVLKRRKNALVQSYVHGISGFAARLSATEAQSIAKTPGVVSVFRDPVYQLH  105

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL          T++   +S  +    SS G D+IIGIL
Sbjct  106  TTRSWDFLK-------YGTDVVIDSSPNSDSNSSSGGYDSIIGIL  143



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 7/99 (7%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR G  LV+TY +GF GF+ARLTAEEA+ IA+  GVVSVFPDP   L TT SWD
Sbjct  57   LINTMFKRRGNDLVHTYKHGFTGFAARLTAEEAKLIAKKQGVVSVFPDPNYQLHTTHSWD  116

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         S+AAA   S    DTIIGIL
Sbjct  117  FLKYQTSVKID----SGPPSSAAA---SDGSYDTIIGIL  148



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D  +L+ S+ +RN  A+V+TY +GF GF+A L+  EA+++ Q+PGVVSVFPDP+L L 
Sbjct  55   RTDFLRLLNSVNRRN--AVVHTYKHGFTGFAAHLSEHEAQAMRQSPGVVSVFPDPLLKLH  112

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL S +  KI   N +     +++QP      DTIIGIL
Sbjct  113  TTHSWDFLVSQTSVKID-ANPKSDPPASSSQPY-----DTIIGIL  151



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQ QL+ +   R   A+V++Y N F GF+ARL+  EA+SIAQ PGV+SVFPDP+  L 
Sbjct  48   RDDQIQLMTT---RRKNAVVHSYRNSFSGFAARLSDAEAQSIAQQPGVISVFPDPVFQLH  104

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSW+FL           +L  S   ++    +S GADTIIGI 
Sbjct  105  TTRSWEFL-------TDQYDLVHSFPYSSGSNSTSKGADTIIGIF  142



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D  +L+ S+ +RN  A+V+TY +GF GF+A L+  EA+++ Q+PGVVSVFPDP+L L 
Sbjct  50   RTDFLRLLNSVNRRN--AVVHTYKHGFTGFAAHLSEHEAQAMRQSPGVVSVFPDPLLKLH  107

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TT SWDFL S +  KI   N +     +++QP      DTIIGIL
Sbjct  108  TTHSWDFLVSQTSVKID-ANPKSDPPASSSQPY-----DTIIGIL  146



>ref|XP_006416427.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
 gb|ESQ34780.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
Length=779

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 11/107 (10%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++SL KR+GK+  + Y +GF GF+A L+ EEAR +A  PGVVSVFPD IL L T
Sbjct  48   NDHVELLSSLFKRSGKSPTHRYKHGFSGFAAHLSEEEARIMANQPGVVSVFPDQILPLHT  107

Query  184  TRSWDFLDSISYTKISPTNLRRST--STAAAQP-LSSSGADTIIGIL  315
            TRSWDFL   SY        +R T  +   +QP L  +  DTIIG +
Sbjct  108  TRSWDFLVQESY--------QRETYFTDMNSQPELDVAVGDTIIGFI  146



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR G  +V+TY +GF GF+ARLTAEEA  IA+ PGVVSVFPDP   L TT SWD
Sbjct  51   LINTMFKRRGNDIVHTYKHGFTGFAARLTAEEATVIAKKPGVVSVFPDPNYQLHTTHSWD  110

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL      KI         S   +   S    D+IIGIL
Sbjct  111  FLKYQEAVKID--------SGPPSSAASGGSYDSIIGIL  141



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 13/101 (13%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    LV+TY +GF GF+ARLTAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  16   LINTMFKRRANDLVHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  75

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGA--DTIIGIL  315
            FL   +  KI            +  P S+S    D+I+GIL
Sbjct  76   FLKYQTSVKID-----------SGPPSSASDGSYDSIVGIL  105



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    LV+TY +GF GF+ARLTAEEA++IA+ PGV+SVFPDP   L TT SWD
Sbjct  56   LINTMFKRRANDLVHTYKHGFTGFAARLTAEEAKAIAKKPGVISVFPDPNFQLHTTHSWD  115

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         STA     S    D+I+GIL
Sbjct  116  FLKYQTSVKID----SGPPSTA-----SDGSYDSIVGIL  145



>ref|XP_010477248.1| PREDICTED: CO(2)-response secreted protease [Camelina sativa]
Length=776

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++S+LKR+GK  ++ Y +GF GF+A L+  EA  +A+ PGVVSVFPD +L L T
Sbjct  48   NDHVELLSSMLKRSGKTPMHRYKHGFSGFAAHLSEGEAHLMAKQPGVVSVFPDQMLQLHT  107

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY + +       T     Q L     DTIIG +
Sbjct  108  TRSWDFLVQESYQRET-----YFTEMNYQQELDVHAGDTIIGFV  146



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 13/101 (13%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    L++TY +GF GF+ARLTAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  16   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  75

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGA--DTIIGIL  315
            FL             + S    +  P S+S    D+I+GIL
Sbjct  76   FL-----------KYQTSVKVDSGPPSSASDGSYDSIVGIL  105



>ref|XP_002893090.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69349.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++S+LKR+GK  ++ Y +GF GF+A L+ +EA  +A+ PGVVSVFPD +L L T
Sbjct  46   NDHVELLSSMLKRSGKTPMHRYKHGFSGFAAHLSEDEAHLMAKQPGVVSVFPDQMLQLHT  105

Query  184  TRSWDFLDSISY---TKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY   T  S  N  + +             DTIIG L
Sbjct  106  TRSWDFLVQESYQRDTYFSEINYGQESEVHE--------GDTIIGFL  144



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 13/101 (13%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    L++TY +GF GF+ARLTAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  55   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  114

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGA--DTIIGIL  315
            FL             + S    +  P S+S    D+I+GIL
Sbjct  115  FL-----------KYQTSVKVDSGPPSSASDGXYDSIVGIL  144



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 13/101 (13%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    L++TY +GF GF+ARLTAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  55   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  114

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGA--DTIIGIL  315
            FL             + S    +  P S+S    D+I+GIL
Sbjct  115  FL-----------KYQTSVKVDSGPPSSASDGSYDSIVGIL  144



>ref|XP_006304500.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
 gb|EOA37398.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
Length=781

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++S+ KR+GK  ++ Y +GF GF+A L+ +EA  +A+ PGVVSVFPD +L L T
Sbjct  48   NDHVELLSSMFKRSGKTPMHIYKHGFSGFAAHLSEDEAHLMAKQPGVVSVFPDQMLELHT  107

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY + +       T     Q       DTIIG +
Sbjct  108  TRSWDFLVQESYQRET-----YFTEMNNQQEFDVHEGDTIIGFI  146



>gb|AAF79898.1|AC022472_7 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082 [Arabidopsis 
thaliana]
Length=779

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++SLL+R+GK  ++ Y +GF GF+A L+ +EA  IA+ PGV+SVFPD +L L T
Sbjct  47   NDHVELLSSLLQRSGKTPMHRYKHGFSGFAAHLSEDEAHLIAKQPGVLSVFPDQMLQLHT  106

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY + +       T     Q       DTIIG L
Sbjct  107  TRSWDFLVQESYQRDT-----YFTEMNYEQESEMHEGDTIIGFL  145



>ref|NP_564106.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AEE29944.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=780

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             D  +L++SLL+R+GK  ++ Y +GF GF+A L+ +EA  IA+ PGV+SVFPD +L L T
Sbjct  48   NDHVELLSSLLQRSGKTPMHRYKHGFSGFAAHLSEDEAHLIAKQPGVLSVFPDQMLQLHT  107

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL   SY + +       T     Q       DTIIG L
Sbjct  108  TRSWDFLVQESYQRDT-----YFTEMNYEQESEMHEGDTIIGFL  146



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D A+L+  L +R G ALV+ Y +GF GF+ARL+ EEA  +AQ PGVVSVFPD +L L 
Sbjct  52   RTDHARLLTLLTRRKGNALVHVYRHGFSGFAARLSEEEALLMAQKPGVVSVFPDHLLKLH  111

Query  181  TTRSWDFL  204
            TT SWDFL
Sbjct  112  TTHSWDFL  119



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R + AQL++SL KR G  +V++Y+    GF+ARL+ EEARSIAQ PGV+SVF DP+L L 
Sbjct  48   RYEHAQLLSSL-KRKGTTVVHSYSRSLSGFAARLSEEEARSIAQKPGVISVFKDPLLPLH  106

Query  181  TTRSWDFL  204
            TTRSWDFL
Sbjct  107  TTRSWDFL  114



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R DQ QL++SL  R   A+V++Y N F GF+ARL+  EA+SIA+ PGVVSVF +P+  L 
Sbjct  54   RDDQIQLMSSLTTRRKNAVVHSYKNSFSGFAARLSDAEAQSIAEQPGVVSVFLNPVFQLH  113

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL           +L    S ++    +S+ ADTIIGI 
Sbjct  114  TTRSWDFLR-------DQYDLVHDFSYSSGSNSTSNEADTIIGIF  151



>emb|CDY67543.1| BnaCnng55400D [Brassica napus]
Length=898

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +1

Query  16   QLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSW  195
            +L++++LK++GK  ++ Y +GF GF+A L+ +EAR +A+ PGVVSVFPD +L L TTRSW
Sbjct  173  ELMSTMLKQSGKTPMHRYKHGFSGFAAHLSEDEARLMAEQPGVVSVFPDQMLPLHTTRSW  232

Query  196  DFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            DFL   SY + +       T   + Q L  +  DTIIG +
Sbjct  233  DFLVQESYQRET-----HFTEMNSQQELDVAVGDTIIGFI  267



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    LVYTY +GF GF+A +TAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  55   LINTMFKRRANDLVYTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  114

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI          +      +    D+I+GIL
Sbjct  115  FLKYQTSVKI---------DSGPPSTTADGSYDSIVGIL  144



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    LV+TY +GF GF+A +TAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  70   LINTMFKRRANDLVHTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  129

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         STA     S    D+I+GIL
Sbjct  130  FLKYQTSVKID----SGPPSTA-----SDGSYDSIVGIL  159



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    LV+TY +GF GF+A +TAEEA+ IA+ PGVVSVFPDP   L TT SWD
Sbjct  70   LINTMFKRRANDLVHTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  129

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         STA     S    D+I+GIL
Sbjct  130  FLKYQTSVKID----SGPPSTA-----SDGSYDSIVGIL  159



>ref|XP_009103352.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
 ref|XP_009103353.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=784

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = +1

Query  16   QLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSW  195
             L++++LKR+GK  ++ Y +GF GF+  L+ +EAR +A+ PGVVSVFPD +L L TTRSW
Sbjct  58   DLMSTMLKRSGKTPMHRYKHGFSGFATHLSEDEARLMAEQPGVVSVFPDQMLPLHTTRSW  117

Query  196  DFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            DFL   SY K S       T   +   L  +  DTIIG +
Sbjct  118  DFLVQESYQKES----TYFTEMNSQPELDVAVGDTIIGFI  153



>emb|CDY01388.1| BnaA07g11610D [Brassica napus]
Length=777

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = +1

Query  16   QLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSW  195
             L++++LKR+GK  ++ Y +GF GF+  L+ +EAR +A+ PGVVSVFPD +L L TTRSW
Sbjct  51   DLMSTMLKRSGKTPMHRYKHGFSGFATHLSEDEARLMAEQPGVVSVFPDQMLPLHTTRSW  110

Query  196  DFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            DFL   SY K S       T   +   L  +  DTIIG +
Sbjct  111  DFLVQESYQKES----TYFTEMNSQPELDVAVGDTIIGFI  146



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    +V+TY +GF GF+ARL+AEEA+ IA+  GVVSVFPDP   L TT SWD
Sbjct  57   LINTMFKRRANDIVHTYKHGFTGFAARLSAEEAKVIAKKTGVVSVFPDPNYQLHTTHSWD  116

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         S+  + P + S  D+IIGIL
Sbjct  117  FLKYQTAVKID--------SSPPSSPEAGS-YDSIIGIL  146



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = +1

Query  19   LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWD  198
            LI ++ KR    +V+TY +GF GF+ARL+AEEA+ IA+  GVVSVFPDP   L TT SWD
Sbjct  57   LINTMFKRRANDIVHTYKHGFTGFAARLSAEEAKVIAKKTGVVSVFPDPNYQLHTTHSWD  116

Query  199  FLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            FL   +  KI         S+  + P + S  D+IIGIL
Sbjct  117  FLKYQTAVKID--------SSPPSSPEAGS-YDSIIGIL  146



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    RKDQAQ-LIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHL  177
              ++AQ LI ++ KR   A+++ Y +GF GF+ARLTAEEA ++A+  GVVSVFPDP   L
Sbjct  39   ESNKAQILINTMFKRRENAVLHVYKHGFSGFAARLTAEEAETLAKKQGVVSVFPDPTFQL  98

Query  178  KTTRSWDFLDSISYTKI  228
             TTRSWDFL   +  KI
Sbjct  99   HTTRSWDFLKYQTAVKI  115



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 11/108 (10%)
 Frame = +1

Query  1    RKDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R++  QL++S+L+R     K L+++Y +GF GF+ARL+ EEA +I++  GVVSVF DPI 
Sbjct  49   RENHLQLLSSVLRRGQSPEKTLLWSYRHGFSGFAARLSKEEAVAISEKAGVVSVFLDPIY  108

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL   S    S     +    AA+ P +S   DTIIG L
Sbjct  109  QLHTTRSWDFLRQTSLETDS-----KPDEEAASSPQTS---DTIIGFL  148



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 15/109 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +++  QL+AS+L+R     K L+ +Y +GF GF+ARL+ EEA +I++  GVVSVF DPI 
Sbjct  81   KENHLQLLASVLQRGQHAEKTLIRSYRHGFSGFAARLSEEEALAISRKEGVVSVFVDPIY  140

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGA-DTIIGIL  315
             L TTRSWDFL  +  T  +P           + P SS+ A DTIIGIL
Sbjct  141  QLHTTRSWDFLQQME-TDPNPD----------SDPASSTQASDTIIGIL  178



>gb|EMT05539.1| Subtilisin-like protease [Aegilops tauschii]
Length=604

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R+   +L+ ++LKR   A   +V  Y +GF GF+ARL+ +EA ++   PGVVSVF DP+ 
Sbjct  46   RQSHLRLVGTILKRGKLAQSVVVQQYKHGFSGFAARLSKDEAAALRHKPGVVSVFADPVY  105

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL      KI     R    TAA+   S+   DTIIG+L
Sbjct  106  QLHTTRSWDFLQQTD-VKIDSAKRRSPRPTAAST--SAPTTDTIIGLL  150



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 65/109 (60%), Gaps = 13/109 (12%)
 Frame = +1

Query  1    RKDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            ++   QL+AS+L+R     K L+ +Y +GF GF+ARL+ EEA +I +  GVVSVF DPI 
Sbjct  51   KESHLQLLASVLQRGQHAEKTLIRSYRHGFSGFAARLSKEEALAIGRKAGVVSVFVDPIY  110

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGA-DTIIGIL  315
             L TTRSWDFL            +  +     + P SS+ A DTIIGIL
Sbjct  111  QLHTTRSWDFLQQ---------TMVETDPNPDSDPASSTQASDTIIGIL  150



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R+   +L+ ++LKR   A   +V  Y + F GF+ARL+ +EA ++   PGVVSVF DP+ 
Sbjct  54   RQSHIRLVGTILKRGKVAQSVVVQQYKHAFSGFAARLSKDEAAALRHKPGVVSVFADPVY  113

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL      KI     R S +TAA+   S+   +TIIG+L
Sbjct  114  QLHTTRSWDFLQQTD-VKIDSARHRSSKTTAAST--SAPTTETIIGLL  158



>ref|XP_002461867.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
 gb|EER98388.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
Length=826

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 18/111 (16%)
 Frame = +1

Query  37   KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSIS  216
            +R    +V+ Y +GF GF+ARL+ +EA ++ + PGVVSVF DP+  + TTRSWDFL   +
Sbjct  73   RRADSVVVHQYKHGFSGFAARLSKDEAAALRRKPGVVSVFADPVYQMHTTRSWDFLQQTT  132

Query  217  YTKI-------SPTNLRR----------STSTAAAQPLSSSGA-DTIIGIL  315
             T +        P   RR          +T+ AAA P SSS A DT++G+L
Sbjct  133  TTAVKIDDSAAGPAARRRGSSNKKGSSKATTPAAADPSSSSPATDTVVGLL  183



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 70/115 (61%), Gaps = 15/115 (13%)
 Frame = +1

Query  16   QLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            +L++++LKR  +A   +V+ Y +GF GF+ARL+ +EA ++ + PGVVSVF DP+  L TT
Sbjct  64   RLVSTVLKRGRRADSLVVHQYKHGFSGFAARLSKDEAAALRRKPGVVSVFADPVYQLHTT  123

Query  187  RSWDFL-DSISYTKISPT----------NLRRSTSTAAAQPLSSS-GADTIIGIL  315
            RSWDFL  + +  KI             N +   +  A  P SSS  ADTIIG+L
Sbjct  124  RSWDFLQQTTTAVKIDDAAGAGPARRSGNKKGKAAAPANDPSSSSPAADTIIGLL  178



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 70/115 (61%), Gaps = 15/115 (13%)
 Frame = +1

Query  16   QLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            +L++++LKR  +A   +V+ Y +GF GF+ARL+ +EA ++ + PGVVSVF DP+  L TT
Sbjct  64   RLVSTVLKRGRRADSLVVHQYKHGFSGFAARLSKDEAAALRRKPGVVSVFADPVYQLHTT  123

Query  187  RSWDFL-DSISYTKISPT----------NLRRSTSTAAAQPLSSS-GADTIIGIL  315
            RSWDFL  + +  KI             N +   +  A  P SSS  ADTIIG+L
Sbjct  124  RSWDFLQQTTTAVKIDDAAGAGPARRSGNKKGKAAAPANDPSSSSPAADTIIGLL  178



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 11/108 (10%)
 Frame = +1

Query  1    RKDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +++  QL+AS+L+R     K L+  Y +GF GF+ARL+ EEA +I++  GVVSVF DPI 
Sbjct  50   KENHLQLLASVLQRGQHVEKTLIRRYRHGFSGFAARLSKEEALAISRKAGVVSVFVDPIY  109

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL          T +  +++  +    S+  +DTIIG+L
Sbjct  110  QLHTTRSWDFLQQ--------TMVETNSNPDSDPSSSTQASDTIIGLL  149



>ref|XP_002980086.1| hypothetical protein SELMODRAFT_419592 [Selaginella moellendorffii]
 gb|EFJ18956.1| hypothetical protein SELMODRAFT_419592 [Selaginella moellendorffii]
Length=699

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (58%), Gaps = 13/102 (13%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
              Q++AS+      +LV++Y +GF GFSA LTA EA SIA+ PGVV VF    L L TTR
Sbjct  48   HHQILASVKGSKESSLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSKKLSLHTTR  107

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SWDFLDS S                  Q  SSSG+D I+G+L
Sbjct  108  SWDFLDSFS-------------GGPHIQLNSSSGSDVIVGVL  136



>ref|XP_010229480.1| PREDICTED: CO(2)-response secreted protease-like, partial [Brachypodium 
distachyon]
Length=228

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 14/117 (12%)
 Frame = +1

Query  1    RKDQAQLIASLLK----RNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPI  168
            ++   +L+ S+LK    RN   +V  Y +GF GF+ARL+ EEA ++ + PGVVSVFPDP+
Sbjct  49   QETHLRLVGSVLKGQVARN--VVVQQYNHGFSGFAARLSKEEAAALRRKPGVVSVFPDPV  106

Query  169  LHLKTTRSWDFLDSISYTKI-----SPTNLRRSTS---TAAAQPLSSSGADTIIGIL  315
              L TTRSWDFL     T +     S    R S +    A++   +++  DTIIG+L
Sbjct  107  YQLHTTRSWDFLQQQQQTDVVVKIGSSAKSRHSPNKPSAASSSSSATTAGDTIIGLL  163



>ref|XP_002987481.1| hypothetical protein SELMODRAFT_426260 [Selaginella moellendorffii]
 gb|EFJ11568.1| hypothetical protein SELMODRAFT_426260 [Selaginella moellendorffii]
Length=753

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (58%), Gaps = 13/102 (13%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
              Q++AS+      +LV++Y +GF GFSA LTA EA SIA+ PGVV VF    L L TTR
Sbjct  48   HHQILASVKGSKESSLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSKKLSLHTTR  107

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SWDFLDS S                  Q  SSSG+D I+G+L
Sbjct  108  SWDFLDSFS-------------GGPHIQLNSSSGSDVIVGVL  136



>gb|AES74037.2| subtilisin-like serine protease [Medicago truncatula]
Length=373

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  43   NGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            N +AL++ Y +GF GF+A L+  EA SIAQ PGVVSVFP+ IL L TTRSWDFL
Sbjct  3    NERALIHNYKHGFSGFAALLSKHEANSIAQQPGVVSVFPNSILKLHTTRSWDFL  56



>ref|XP_004165291.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=738

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +1

Query  7    DQAQLIASLLKRNGK--ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            D  QL++S++  +G    +++ Y + F GFSA LT EEA S++   G+VSVFPDP L L 
Sbjct  15   DYFQLLSSVIPSSGSRAVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDPTLQLH  74

Query  181  TTRSWDFLDSIS  216
            TTRSWDFLDSIS
Sbjct  75   TTRSWDFLDSIS  86



>ref|XP_003603786.1| Subtilisin-like protease [Medicago truncatula]
Length=402

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  43   NGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            N +AL++ Y +GF GF+A L+  EA SIAQ PGVVSVFP+ IL L TTRSWDFL
Sbjct  3    NERALIHNYKHGFSGFAALLSKHEANSIAQQPGVVSVFPNSILKLHTTRSWDFL  56



>ref|XP_008445401.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 17/112 (15%)
 Frame = +1

Query  7    DQAQLIASLL-------KRNG--KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFP  159
            D  QL++S++       K NG    +++ Y + F GFSA LT EEA S++   G+VSVFP
Sbjct  15   DYLQLLSSVIPSRKEKEKENGSRDVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFP  74

Query  160  DPILHLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            DP L L TTRSWDFLDSIS        LR  T         SS +D I+G++
Sbjct  75   DPTLQLHTTRSWDFLDSIS-------GLRPPTPLPPPHFYPSS-SDVIVGVI  118



>ref|XP_002980084.1| hypothetical protein SELMODRAFT_419590 [Selaginella moellendorffii]
 gb|EFJ18954.1| hypothetical protein SELMODRAFT_419590 [Selaginella moellendorffii]
Length=752

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
              Q++AS+      +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTR
Sbjct  48   HHQILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTR  107

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SWDFLDS S                  Q  SSSG+D I+G+L
Sbjct  108  SWDFLDSFS-------------GGPHIQLNSSSGSDVIVGVL  136



>ref|XP_002987482.1| hypothetical protein SELMODRAFT_426261 [Selaginella moellendorffii]
 gb|EFJ11569.1| hypothetical protein SELMODRAFT_426261 [Selaginella moellendorffii]
Length=749

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
              Q++AS+      +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTR
Sbjct  48   HHQILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTR  107

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SWDFLDS S                  Q  SSSG+D I+G+L
Sbjct  108  SWDFLDSFS-------------GGPHIQINSSSGSDVIVGVL  136



>ref|XP_002994537.1| hypothetical protein SELMODRAFT_432452 [Selaginella moellendorffii]
 gb|EFJ04398.1| hypothetical protein SELMODRAFT_432452 [Selaginella moellendorffii]
Length=749

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
              Q++AS+      +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTR
Sbjct  48   HHQILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTR  107

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SWDFLDS S                  Q  SSSG+D I+G+L
Sbjct  108  SWDFLDSFS-------------GGPHIQINSSSGSDVIVGVL  136



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +1

Query  1    RKDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            ++   +L++++LKR    G  +V  Y +GF GF+ARL+  EA ++ + PGVVSVF DP+ 
Sbjct  45   QESHLRLVSTVLKRGRRAGSVVVRQYKHGFSGFAARLSEVEAAALRRKPGVVSVFADPVY  104

Query  172  HLKTTRSWDFLDSISYTKISPTNLRR  249
            HL TTRSWDFL   +  KI     RR
Sbjct  105  HLHTTRSWDFLQQAA-VKIDAAARRR  129



>ref|XP_010451309.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=230

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (61%), Gaps = 11/107 (10%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P VV V P+ IL LK
Sbjct  66   HHQMLESLLQSKEDARNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVVHVIPNRILKLK  125

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSS--GADTIIGIL  315
            TTR+WD L       ISP     S+S+A    L  +  G++ IIG+L
Sbjct  126  TTRTWDHLG------ISPIPTPFSSSSAVKGLLHDTNLGSEAIIGVL  166



>gb|KDO48659.1| hypothetical protein CISIN_1g028958mg [Citrus sinensis]
Length=200

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 64/103 (62%), Gaps = 10/103 (10%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++   + +  +L++ Y + F GFSA LT +EA  ++ +  +VSVFPDP+L L TT
Sbjct  65   QLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSGHEKIVSVFPDPVLKLHTT  124

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFL+       +    + +TST ++    +  +D IIGI+
Sbjct  125  RSWDFLE-------AEAEAKATTSTWSSHKYHNISSDVIIGII  160



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 12/107 (11%)
 Frame = +1

Query  7    DQAQLIASLLK----RNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            D  +LI+S+       +   LV +Y NGF GF+ARLTA+ A ++A+ P VVSVF DP L 
Sbjct  58   DHLELISSITASKKPHSQGLLVRSYMNGFSGFAARLTAQHAAAMAKQPQVVSVFVDPFLQ  117

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTRSWDFL    +T++ P +   S S       S +  +TIIG+L
Sbjct  118  LHTTRSWDFLQ--EHTELEPYSDMDSDSG------SRNNTNTIIGLL  156



>gb|KGN47766.1| hypothetical protein Csa_6G401370 [Cucumis sativus]
Length=789

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +1

Query  7    DQAQLIASLL-----KRNGK--ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDP  165
            D  QL++S++     K +G    +++ Y + F GFSA LT EEA S++   G+VSVFPDP
Sbjct  61   DYFQLLSSVIPSRKEKESGSRAVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDP  120

Query  166  ILHLKTTRSWDFLDSIS  216
             L L TTRSWDFLDSIS
Sbjct  121  TLQLHTTRSWDFLDSIS  137



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS  210
            AL++ Y++ F GFSA LT  EA +++ + GVVSVFPDPIL L TTRSWDFLDS
Sbjct  68   ALIHHYSHAFSGFSAMLTHTEASALSGHDGVVSVFPDPILQLHTTRSWDFLDS  120



>gb|KDP25528.1| hypothetical protein JCGZ_20684 [Jatropha curcas]
Length=771

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 17/89 (19%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            ++++Y+Y   F GF+A+LT EEAR+I++  GV+SV P+PIL L TTRSWDF+   S +KI
Sbjct  64   ESIIYSYGRSFNGFAAKLTDEEARTISEMEGVISVIPNPILKLHTTRSWDFM-GFSSSKI  122

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             P                S  AD IIG+L
Sbjct  123  GP----------------SQEADVIIGLL  135



>ref|XP_002987483.1| hypothetical protein SELMODRAFT_126179 [Selaginella moellendorffii]
 gb|EFJ11570.1| hypothetical protein SELMODRAFT_126179 [Selaginella moellendorffii]
Length=704

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 53/88 (60%), Gaps = 13/88 (15%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +LV++Y +GF GFSA LTA EA SIA+ PGVV VF    L L TTRSWDFLDS S     
Sbjct  7    SLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSRKLSLHTTRSWDFLDSFS-----  61

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                         Q  SSSG+D I+G+L
Sbjct  62   --------GGPHIQLNSSSGSDVIVGVL  81



>ref|XP_004146802.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=733

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSIS  216
            +++ Y + F GFSA LT EEA S++   G+VSVFPDP L L TTRSWDFLDSIS
Sbjct  28   VIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDPTLQLHTTRSWDFLDSIS  81



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS  210
            L++ Y + F GFSA LT  EA +++ + GVVSVFPDPIL L TTRSWDFLDS
Sbjct  64   LIHHYNHAFSGFSAMLTQSEASALSGHDGVVSVFPDPILELHTTRSWDFLDS  115



>ref|XP_010445227.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=259

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  65   HHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVIHVIPNRILKLK  124

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPL---SSSGADTIIGIL  315
            TTR+WD L       +SP     ++S+ + + L   ++ G++ IIG++
Sbjct  125  TTRTWDHLG------LSPIPTSFTSSSLSVKGLLHDTNLGSEAIIGVI  166



>gb|KDO48658.1| hypothetical protein CISIN_1g028958mg [Citrus sinensis]
Length=201

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 11/104 (11%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSI-AQNPGVVSVFPDPILHLKT  183
            QL++S++   + +  +L++ Y + F GFSA LT +EA  + A +  +VSVFPDP+L L T
Sbjct  65   QLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSAGHEKIVSVFPDPVLKLHT  124

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL+       +    + +TST ++    +  +D IIGI+
Sbjct  125  TRSWDFLE-------AEAEAKATTSTWSSHKYHNISSDVIIGII  161



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS  210
            L++ Y + F GFSA LT  EA +++ + GVVSVFPDPIL L TTRSWDFLDS
Sbjct  64   LIHHYNHAFSGFSAMLTQSEASALSGHDGVVSVFPDPILELHTTRSWDFLDS  115



>ref|XP_002987480.1| hypothetical protein SELMODRAFT_126065 [Selaginella moellendorffii]
 gb|EFJ11567.1| hypothetical protein SELMODRAFT_126065 [Selaginella moellendorffii]
Length=698

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 52/88 (59%), Gaps = 13/88 (15%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTRSWDFLDS S     
Sbjct  7    SLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTRSWDFLDSFS-----  61

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                         Q  SSSG+D I+G+L
Sbjct  62   --------GGPHIQLNSSSGSDVIVGVL  81



>ref|XP_002980085.1| hypothetical protein SELMODRAFT_111799 [Selaginella moellendorffii]
 gb|EFJ18955.1| hypothetical protein SELMODRAFT_111799 [Selaginella moellendorffii]
Length=694

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 52/88 (59%), Gaps = 13/88 (15%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTRSWDFLDS S     
Sbjct  7    SLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTRSWDFLDSFS-----  61

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                         Q  SSSG+D I+G+L
Sbjct  62   --------GGPHIQLNSSSGSDVIVGVL  81



>ref|XP_002980088.1| hypothetical protein SELMODRAFT_111859 [Selaginella moellendorffii]
 gb|EFJ18958.1| hypothetical protein SELMODRAFT_111859 [Selaginella moellendorffii]
Length=704

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 52/88 (59%), Gaps = 13/88 (15%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +LV++Y +GF GFSA LT  EA SIA+ PGVV VF    L L TTRSWDFLDS S     
Sbjct  7    SLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSRKLSLHTTRSWDFLDSFS-----  61

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                         Q  SSSG+D I+G+L
Sbjct  62   --------GGPHIQLNSSSGSDVIVGVL  81



>gb|KHN45945.1| Subtilisin-like protease [Glycine soja]
Length=510

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +1

Query  43   NGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH-LKTTRSWDFL  204
            N KA V  + +GF GF+ARLT EEA SIAQ P VVSVFPDPIL  L TTRS DFL
Sbjct  43   NEKAPVRNFKHGFSGFAARLTKEEANSIAQKPRVVSVFPDPILKLLHTTRSCDFL  97



>ref|XP_007131420.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03414.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=510

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL     A   ++Y+Y +GF GF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDF+            +  STS +A    S+ G   IIG++
Sbjct  115  KLHTTRSWDFI-----------GIHHSTSKSALSN-SNLGEGAIIGVI  150



>ref|XP_007131422.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03416.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=563

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL     A   ++Y+Y +GF GF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDF+            +  STS +A    S+ G   IIG++
Sbjct  115  KLHTTRSWDFI-----------GIHHSTSKSALSN-SNLGEGAIIGVI  150



>gb|KHN45943.1| Subtilisin-like protease [Glycine soja]
Length=482

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 55/105 (52%), Gaps = 30/105 (29%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R D AQ+I S+L                   ARL+ EEA SIA  PGVVSVFPDP+L L 
Sbjct  13   RNDHAQVINSVLL------------------ARLSKEEATSIAHKPGVVSVFPDPVLKLH  54

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDFL   ++ KI              +P + S + ++IGIL
Sbjct  55   TTRSWDFLKYQTHVKID------------TKPNTVSKSSSVIGIL  87



>ref|XP_007131421.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03415.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=775

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL     A   ++Y+Y +GF GF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSS--GADTIIGIL  315
             L TTRSWDF+            +  STS +A   LS+S  G   IIG++
Sbjct  115  KLHTTRSWDFI-----------GIHHSTSKSA---LSNSNLGEGAIIGVI  150



>ref|XP_006413752.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
 gb|ESQ55205.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
Length=714

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = +1

Query  10   QAQLIASLLKRNG---KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+      K+++Y+Y +GF GF+A LT+ +A+ I+++P VV V P+ IL LK
Sbjct  53   HHQMLESLLESKEDAQKSMIYSYKHGFSGFAALLTSSQAKKISEHPEVVHVIPNRILKLK  112

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSS-GADTIIGIL  315
            TTR+WD+L       +SP     S+S+A     +++ G++ IIG++
Sbjct  113  TTRTWDYLG------LSPIPTSFSSSSAKGLLHNTNMGSEAIIGVI  152



>ref|XP_006471277.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=806

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 10/103 (10%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++   + +  +L++ Y + F GFSA LT +EA  ++ +  +VSVFPDPIL L TT
Sbjct  83   QLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSGHEKIVSVFPDPILKLHTT  142

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFL++ +  K         TST ++    +  +D IIGI+
Sbjct  143  RSWDFLEAEAEAK-------APTSTWSSHKYHNISSDVIIGII  178



>ref|XP_003541562.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=778

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 17/93 (18%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS-----IS  216
            AL + +++ F GFSA LT  EA +++ + GVVSVFPDP+L L TTRSWDFL+S       
Sbjct  71   ALTHHFSHAFSGFSAMLTESEASALSGHDGVVSVFPDPVLELHTTRSWDFLESELGMKPY  130

Query  217  YTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            Y+  +PT L +  ST           D IIG++
Sbjct  131  YSHGTPT-LHKHPST-----------DIIIGVI  151



>ref|XP_006432515.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45755.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=779

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 10/103 (10%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++   + +  +L++ Y + F GFSA LT +EA  ++ +  +VSVFPDPIL L TT
Sbjct  56   QLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSGHEKIVSVFPDPILKLHTT  115

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFL++ +  K         TST ++    +  +D IIGI+
Sbjct  116  RSWDFLEAEAEAK-------APTSTWSSHKYHNISSDVIIGII  151



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 61/103 (59%), Gaps = 16/103 (16%)
 Frame = +1

Query  19    LIASLLKRNGKA----LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
             ++AS+L R  K+    +VY+Y +GF GF+A+LT  +A+ +A  PGVV V P+ +  L+TT
Sbjct  1547  ILASVLGRKSKSAFDSMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTT  1606

Query  187   RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             RSWD+L     +  SP+NL   T+          G   IIG+L
Sbjct  1607  RSWDYL---GLSSQSPSNLLHETNM---------GGGIIIGLL  1637


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R     ++AS++     A   +VY+Y +GF GF+A+LT  +A+ IA+ PGV+ V P+ + 
Sbjct  785  RDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSLH  844

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L+TTRSWD+L  +S+   SP N+  S         S+ G   IIG+L
Sbjct  845  QLQTTRSWDYL-GLSFQ--SPKNILHS---------SNMGDGVIIGVL  880



>ref|XP_010087079.1| hypothetical protein L484_010451 [Morus notabilis]
 gb|EXB26134.1| hypothetical protein L484_010451 [Morus notabilis]
Length=157

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 14/90 (16%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++ Y+Y +GF G +ARLT  EA++IA+ PGVV V PD I+   TTRSWDFL      K 
Sbjct  78   QSIFYSYRHGFSGIAARLTDAEAKAIAKIPGVVKVIPDYIVKAHTTRSWDFLGVPH--KY  135

Query  229  SPTNLRRSTSTAAAQPLSSS-GADTIIGIL  315
            SP +           PLS + G  TIIG++
Sbjct  136  SPQS-----------PLSKNLGQGTIIGVV  154



>ref|XP_002867837.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44096.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = +1

Query  10   QAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+      K+LVY+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  61   HHQMLESLLQSKEDAHKSLVYSYQHGFSGFAALLTSSQAKKISEHPSVIHVIPNRILKLK  120

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSS--GADTIIGIL  315
            TTR+WD L       +SP     S+S++A   L  +  G++TIIG++
Sbjct  121  TTRTWDHLG------LSPIPTSFSSSSSAKGLLHDTNMGSETIIGVV  161



>ref|XP_010543788.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Tarenaya 
hassleriana]
Length=766

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  16   QLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL+AS++ R       +V+ Y + F GFSA LT +EA   +++  VVS+FPDP L L TT
Sbjct  61   QLLASVIPREENDRVKVVHHYKHAFKGFSAMLTDDEAAFFSEHDEVVSIFPDPTLQLHTT  120

Query  187  RSWDFLDSIS  216
            RSWDFL+SIS
Sbjct  121  RSWDFLESIS  130



>gb|KHN10324.1| Subtilisin-like protease [Glycine soja]
Length=778

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 17/93 (18%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS-----IS  216
            AL + +++ F GFSA LT  EA +++ + GVVSVFPDP+L L TTRSWDFL+S       
Sbjct  71   ALTHHFSHAFSGFSAMLTESEASALSGHDGVVSVFPDPVLELHTTRSWDFLESDLGMKPY  130

Query  217  YTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            Y+  +PT L +  ST           D IIG++
Sbjct  131  YSHGTPT-LHKHPST-----------DIIIGLI  151



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 61/103 (59%), Gaps = 16/103 (16%)
 Frame = +1

Query  16   QLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++        +L+++Y +   GFSA LT +EA S++ +  VVSVFPDP+L L TT
Sbjct  56   QLLSSIIPSEESQRLSLIHSYNHAIKGFSAMLTEKEASSLSGHEKVVSVFPDPVLQLHTT  115

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFLDS S  +           +    P +SS  D IIGI+
Sbjct  116  RSWDFLDSESGIR-----------SGIKYPQASS--DVIIGII  145



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL     A   LVY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  53   ESHHQMLWSLLGSKEDAHESLVYSYRHGFSGFAAKLTKSQAKKIADVPEVVHVIPDSFYK  112

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            LKTTR+WD+L     +  +P NL   T+          GA +IIG++
Sbjct  113  LKTTRTWDYL---GLSAANPKNLLNETNM---------GAQSIIGVI  147



>emb|CDY36894.1| BnaC07g01060D [Brassica napus]
Length=539

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL     A   +VY+Y +GF GFSA+LT  +A+ IA  P VV V PD    
Sbjct  29   ESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFSAKLTKSQAKKIANLPEVVHVIPDSFYK  88

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +KTTR+WD+L     +  SP NL   T+          G   IIGI+
Sbjct  89   MKTTRTWDYL---GLSASSPKNLLNETNM---------GEQIIIGII  123



>ref|XP_010046680.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW87048.1| hypothetical protein EUGRSUZ_B03592 [Eucalyptus grandis]
Length=796

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 60/106 (57%), Gaps = 11/106 (10%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              QL+ ++ K   +A   ++Y+YT GF GF+A+LT+++A +IA+  GVVSVF   IL L 
Sbjct  54   HQQLLLNVFKSEEEAAQSMIYSYTYGFSGFAAKLTSDQATTIARKEGVVSVFRSKILELH  113

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSS-GADTIIGIL  315
            TTRSWDF+         P         A   P SS+ G D I+GI 
Sbjct  114  TTRSWDFMG-------LPLRETPDYDEAPQSPSSSTFGDDVIVGIF  152



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS  210
            AL++ Y++ F GFSA LT  EA ++A N GVVSVF DPIL L TTRSWDFL+S
Sbjct  72   ALIHHYSHAFNGFSAMLTQSEASALAGNDGVVSVFEDPILELHTTRSWDFLES  124



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++++LL     A   ++Y+Y +GF GF+AR+TA +A  IA+ PGVV V P+ I 
Sbjct  59   KKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIH  118

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSW+F   I     SP NL            S+ G  TIIG++
Sbjct  119  KLHTTRSWEF---IGLEHHSPQNLLTQ---------SNMGQGTIIGVI  154



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++++LL     A   ++Y+Y +GF GF+AR+TA +A  IA+ PGVV V P+ I 
Sbjct  59   KKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIH  118

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSW+F   I     SP NL            S+ G  TIIG++
Sbjct  119  KLHTTRSWEF---IGLEHHSPQNLLTQ---------SNMGQGTIIGVI  154



>ref|XP_003524182.2| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Glycine 
max]
Length=793

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              ++++SLL     A   ++Y+Y +GF GF+ARLT  +A +IA+ PGVVSV P+ I  L 
Sbjct  77   HHKMLSSLLGSKEAAKNSILYSYKHGFSGFAARLTKYQAEAIAKFPGVVSVIPNGIHKLH  136

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWDF+            +  STS  A    S+ G  TIIG++
Sbjct  137  TTRSWDFM-----------GVHHSTSKIAFSD-SNLGEGTIIGVI  169



>ref|XP_004309569.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (57%), Gaps = 18/109 (17%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++ +LL     A   ++Y+Y +GF GF+ARLT  +A +IA+ PGV+ V P+ + 
Sbjct  105  KKFHHKMLTNLLGSKEAAYNSILYSYKHGFSGFAARLTESQAETIAEFPGVLQVIPNRVH  164

Query  172  HLKTTRSWDFLDSISYTKISPTN-LRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDF   I   + SP N LRRS            G  TIIG++
Sbjct  165  KLHTTRSWDF---IGIHQHSPENHLRRSM-----------GKGTIIGVI  199



>emb|CDX77071.1| BnaC04g38660D [Brassica napus]
Length=760

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  16   QLIASLLKRNG---KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            Q++ +LL R     +  V+ Y + F GFSA LT EEA +++ +  VVSVF DP+L L TT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  187  RSWDFLDSIS  216
            RSWDFLDS+S
Sbjct  115  RSWDFLDSLS  124



>emb|CDY57477.1| BnaAnng14590D [Brassica napus]
Length=781

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  16   QLIASLLKRNG---KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            Q++ +LL R     +  V+ Y + F GFSA LT EEA +++ +  VVSVF DP+L L TT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  187  RSWDFLDSIS  216
            RSWDFLDS+S
Sbjct  115  RSWDFLDSLS  124



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  16   QLIASLLKRNG---KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            Q++ +LL R     +  V+ Y + F GFSA LT EEA +++ +  VVSVF DP+L L TT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  187  RSWDFLDSIS  216
            RSWDFLDS+S
Sbjct  115  RSWDFLDSLS  124



>gb|EMT32761.1| Subtilisin-like protease [Aegilops tauschii]
Length=779

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
            R    +++AS++ +  + L ++Y + F GF+A LT EEA +++ +  VVSVF DP+L L 
Sbjct  54   RAAHLEMLASIVPQEQRWLTHSYHHAFEGFAAELTEEEALALSAHERVVSVFRDPVLLLH  113

Query  181  TTRSWDFLD  207
            TTRSWDFLD
Sbjct  114  TTRSWDFLD  122



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            K+++Y+Y +GF GF+A L+  +AR IA  PGVV V P+ IL L TTRSWDFL        
Sbjct  34   KSILYSYKHGFSGFAAVLSQPQARLIADFPGVVRVIPNKILSLHTTRSWDFL--------  85

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               N+++   T+A      SG  TIIGI+
Sbjct  86   ---NVKQEMITSALS-RGQSGRGTIIGIM  110



>gb|KGN50585.1| hypothetical protein Csa_5G187340 [Cucumis sativus]
Length=180

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL---DSISY  219
            K L+Y+Y   F GF+ RLT EEA+ IA   GVVSVFP+   H+ TTRSWDF+    S+  
Sbjct  71   KHLLYSYKRSFNGFAVRLTEEEAQKIALKEGVVSVFPNGKKHVHTTRSWDFMGFTQSVPR  130

Query  220  TKISPTNLRRSTSTAAAQPLSSSGADTIIG  309
                 +N+          P S S  DT +G
Sbjct  131  VNQVESNIVVGVLDTGIWPESPSFNDTDLG  160



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL     A   +VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  52   ESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYK  111

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            LKTTR+WD+L     +  SP NL   T+          G   IIGI+
Sbjct  112  LKTTRTWDYL---GLSASSPKNLLNETNM---------GEQIIIGII  146



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL     A   +VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  52   ESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYK  111

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            LKTTR+WD+L     +  SP NL   T+          G   IIGI+
Sbjct  112  LKTTRTWDYL---GLSASSPKNLLNETNM---------GEQIIIGII  146



>ref|XP_002980373.1| hypothetical protein SELMODRAFT_112475, partial [Selaginella 
moellendorffii]
 gb|EFJ18633.1| hypothetical protein SELMODRAFT_112475, partial [Selaginella 
moellendorffii]
Length=678

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+AR+T ++A++IA    VVSVFP   L L TTRSWDFL++ S T +S 
Sbjct  2    IVYSYKHGFDGFAARMTPKQAKAIAGMRDVVSVFPSKTLQLHTTRSWDFLETFS-TGLSY  60

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +  R             +GAD I+G++
Sbjct  61   SRRRL-----------GAGADVIVGVM  76



>ref|XP_007028364.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08866.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=762

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 14/106 (13%)
 Frame = +1

Query  7    DQAQLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHL  177
            D  QL+++++ R      +L++ Y +   GFSA LT  EA  +A + GVVS+FPD +L L
Sbjct  47   DHLQLLSTVIPRQDSGRISLIHHYNHALRGFSAMLTENEASELAGHDGVVSLFPDSVLQL  106

Query  178  KTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             TTRSWDFL+  S  + S  + +  +S            D IIG++
Sbjct  107  HTTRSWDFLEGQSRPRFSHGSYQHKSSY-----------DVIIGMI  141



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++ +LL     A   ++Y+Y +GF GF+A+LT  +A  IA+ PGVV V P+ I 
Sbjct  59   KKIHYEMLLTLLGSKEAARSSILYSYRHGFSGFAAKLTESQAEDIAEFPGVVQVIPNGIH  118

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSW+F   I     SP NL +          S+ G  TIIG++
Sbjct  119  KLHTTRSWEF---IGLNHHSPQNLLKQ---------SNMGQGTIIGVI  154



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++++LL   K    ++VY+Y +GF GF+A+LT  +AR+IA+ P VV V PD +  
Sbjct  47   ESHHQMLSTLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQARTIAELPEVVHVIPDGVYE  106

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTR+WD+L     +  +P NL   T+          G   IIG++
Sbjct  107  LATTRTWDYL---GLSGANPNNLLTDTNM---------GDQVIIGVI  141



>ref|XP_010092449.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB51215.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=403

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 14/90 (16%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            ++++Y+Y +GF G +ARLT  EA++IA+ PGVV V PD I+   TTRSWDFL      K 
Sbjct  78   QSILYSYRHGFSGIAARLTDAEAKAIAKIPGVVKVIPDYIVKAHTTRSWDFLGVPH--KY  135

Query  229  SPTNLRRSTSTAAAQPLSSS-GADTIIGIL  315
            SP +           PLS++ G  TIIG++
Sbjct  136  SPQS-----------PLSNNLGQGTIIGVI  154



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  61   HHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVIHVIPNRILKLK  120

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPL---SSSGADTIIGIL  315
            TTR+WD L       +SP     ++S+ + + L   ++ G++ IIG++
Sbjct  121  TTRTWDHL------GLSPIPTSFTSSSLSVKGLLHDTNLGSEAIIGVI  162



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +L++ Y + F GFSA LT  EA  +++N  V+SVF DPIL L TTRSWDFL++ S  +IS
Sbjct  73   SLIHHYNHAFNGFSAMLTESEASELSENEEVISVFKDPILKLHTTRSWDFLEAKSGMQIS  132



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL  N    K++VY+Y +GF GF+A+LTA +A+ +A+ P V+ V PD    
Sbjct  83   ESHHQILCSLLGSNETAHKSMVYSYRHGFSGFAAKLTASQAKELAELPEVIHVTPDSFYQ  142

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            + TTR+WD+L     +  +P NL   T           G   IIG++
Sbjct  143  VATTRTWDYL---GLSAANPKNLLNETDM---------GEQVIIGVI  177



>ref|XP_007210133.1| hypothetical protein PRUPE_ppa022964mg, partial [Prunus persica]
 gb|EMJ11332.1| hypothetical protein PRUPE_ppa022964mg, partial [Prunus persica]
Length=635

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +1

Query  10   QAQLIASLLKRNGKAL---VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              +++AS++     A+   VY+Y +GF GF+A+LT  EA+ IA+ PGV  V P+    L+
Sbjct  21   HHEMLASVVGSKEAAIDSIVYSYKHGFSGFAAKLTESEAKEIAELPGVAHVMPNSFHTLQ  80

Query  181  TTRSWDFLDSISYTKISPTNLRRST  255
             TRSWD+L   S+   SPTNL   T
Sbjct  81   NTRSWDYLGLSSH---SPTNLMHDT  102



>ref|XP_006476262.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=777

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 11/89 (12%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
             +++Y+Y +GF GF+ARLT  +A  IA+ PGVV V P+ IL L TTRSW+F+        
Sbjct  70   HSILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGILKLHTTRSWEFM--------  121

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                L    S+      S+ G  TIIGI+
Sbjct  122  ---GLHYYQSSKNLSTESNMGEGTIIGII  147



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  16   QLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++ R  +   ++ ++Y + F GFSA LT +EA  ++ +  VVSVFPDP+L L TT
Sbjct  55   QLLSSIIPREERDRLSIQHSYQHSFSGFSAMLTEDEASILSAHSKVVSVFPDPVLKLHTT  114

Query  187  RSWDFLDSISYTKIS  231
            RSWDFL+  S  +++
Sbjct  115  RSWDFLEQQSKIRLN  129



>ref|XP_006439186.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
 gb|ESR52426.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
Length=777

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 11/89 (12%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
             +++Y+Y +GF GF+ARLT  +A  IA+ PGVV V P+ IL L TTRSW+F+        
Sbjct  70   HSILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGILKLHTTRSWEFM--------  121

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
                L    S+      S+ G  TIIGI+
Sbjct  122  ---GLHYYQSSKNLSTESNMGEGTIIGII  147



>emb|CDP18580.1| unnamed protein product [Coffea canephora]
Length=796

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 16/109 (15%)
 Frame = +1

Query  4    KDQAQLIASLL--KRNGK-ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   QL++++   K++ K A++Y+Y +GF GFSA L + +A+ ++   GV+S+F    +H
Sbjct  46   KHHLQLLSTVFTSKKDAKQAMLYSYKHGFSGFSATLNSTQAQVLSNTKGVISIFKSKTVH  105

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPL--SSSGADTIIGIL  315
            L TTRSWDFL            L    ST  A P+   + G D I+G+ 
Sbjct  106  LHTTRSWDFL-----------GLSMDYSTEKATPMWQQAYGGDVIVGVF  143



>gb|KDO76781.1| hypothetical protein CISIN_1g042478mg [Citrus sinensis]
Length=954

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 11/88 (13%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            +++Y+Y +GF GF+ARLT  +A  IA+ PGVV V P+ IL L TTRSW+F+    Y   S
Sbjct  71   SILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQ--S  128

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
              NL            S+ G  TIIGI+
Sbjct  129  SKNLSTE---------SNMGEGTIIGII  147



>ref|XP_002992980.1| hypothetical protein SELMODRAFT_187138 [Selaginella moellendorffii]
 gb|EFJ05926.1| hypothetical protein SELMODRAFT_187138 [Selaginella moellendorffii]
Length=786

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 31/121 (26%)
 Frame = +1

Query  10   QAQLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPG----------------  141
             ++++AS+  R    +VY+Y +GF GF+AR+TA++A++IA  P                 
Sbjct  72   HSKILASVTSRQEVIIVYSYKHGFDGFAARMTAKQAKAIAGKPSQKALLPDDSILLLGSG  131

Query  142  ---VVSVFPDPILHLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGI  312
               VVSVFP   L L TTRSW FL++ S      T L  S S          GAD I+G+
Sbjct  132  LPDVVSVFPSKTLQLHTTRSWKFLETFS------TGLLYSRSKLG------EGADVIVGV  179

Query  313  L  315
            L
Sbjct  180  L  180



>ref|XP_008351708.1| PREDICTED: cucumisin-like [Malus domestica]
Length=237

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            + +VY+Y +GF GF+A+LT  + + +++ PGVV + P+ +  L+TTRSWDFL     +  
Sbjct  67   ELMVYSYKHGFSGFAAKLTESQTQQLSELPGVVRIIPNSLHKLETTRSWDFL---GLSPH  123

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SP+N+          P S+ G   IIG+L
Sbjct  124  SPSNIL---------PKSNMGDGVIIGVL  143



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   Q++ SLL   K    ++VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  47   KSHHQMLWSLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGFYE  106

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTR+WD+L     +  SP NL   T+          G   IIG++
Sbjct  107  LATTRTWDYL---GLSAASPKNLLNDTNM---------GDQVIIGVI  141



>ref|XP_006432516.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45756.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=780

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 11/104 (11%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSI-AQNPGVVSVFPDPILHLKT  183
            QL++S++   + +  +L++ Y + F GFSA LT +EA  + A +  +VSVFPDPIL L T
Sbjct  56   QLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSAGHEKIVSVFPDPILKLHT  115

Query  184  TRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TRSWDFL++ +  K         TST ++    +  +D IIGI+
Sbjct  116  TRSWDFLEAEAEAK-------APTSTWSSHKYHNISSDVIIGII  152



>gb|ABE66081.1| subtilase family protein [Arabidopsis thaliana]
Length=301

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  61   HHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRILKLK  120

Query  181  TTRSWDFLDSISYTKISPT-NLRRSTSTAAAQPL---SSSGADTIIGIL  315
            TTR WD L       +SP      S+S+A A+ L   +S G++ IIG++
Sbjct  121  TTRIWDHLG------LSPIPTSFSSSSSAKAKGLLHNTSMGSEAIIGVV  163



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R     ++AS++     A   +VY+Y +GF GF+A+LT  +A+ IA+ PGV+ V P+ + 
Sbjct  59   RDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSLH  118

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L+TTRSWD+L  +S+   SP N+  S         S+ G   IIG+L
Sbjct  119  QLQTTRSWDYL-GLSFQ--SPKNILHS---------SNMGDGVIIGVL  154


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 12/88 (14%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            ++VY+Y +GF GF+A+LT  +A+ +A  PGVV V P+ +  L+TTRSWD+L     +  S
Sbjct  788  SMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTTRSWDYL---GLSSQS  844

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            P+NL   T+          G   IIG+L
Sbjct  845  PSNLLHETNM---------GGGIIIGLL  863



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
               L+A ++    KA   +VY+Y +GF GF+A+LT  EA+ IA+ PGVV V P+ +  L+
Sbjct  39   HHHLLAKIVGSKQKASELMVYSYKHGFSGFAAKLTESEAKKIAELPGVVRVIPNTLHRLQ  98

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTRSWD L  +SY   S +NL  +         SS+G   IIG+ 
Sbjct  99   TTRSWDSL-GLSYE--SNSNLLHN---------SSNGDGVIIGVF  131



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            ++++Y+Y +GF GF+A LT  +A+ IA  PGVV V P+ +L+L TTRSW+FL   S+  I
Sbjct  32   QSILYSYKHGFSGFAAVLTQSQAKLIADIPGVVHVIPNRVLNLHTTRSWNFLQVNSH--I  89

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            S   L R          S SGA +IIGI+
Sbjct  90   SNGILSR----------SQSGAGSIIGII  108



>gb|AET04097.2| subtilisin-like serine protease [Medicago truncatula]
Length=781

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLL--KRNGK-ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL  K + K +L+Y+Y +GF GF+AR+T  +A  IA+ P VVSV P+ I 
Sbjct  60   KKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVVSVIPNGIH  119

Query  172  HLKTTRSWDFL  204
             L TTRSWDF+
Sbjct  120  KLHTTRSWDFI  130



>ref|XP_003629621.1| Subtilisin-like protease [Medicago truncatula]
Length=797

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLL--KRNGK-ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL  K + K +L+Y+Y +GF GF+AR+T  +A  IA+ P VVSV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVVSVIPNGIH  118

Query  172  HLKTTRSWDFL  204
             L TTRSWDF+
Sbjct  119  KLHTTRSWDFI  129



>emb|CDX93810.1| BnaA09g24100D [Brassica napus]
Length=750

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q+++SLL     A   +VY+Y +GF GF+ARLT  +A+ +A +P VV V PD    L 
Sbjct  53   HHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKELADSPEVVHVMPDGYYELA  112

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTR+WD+L     +   P NL   T+          G   IIG++
Sbjct  113  TTRTWDYL---GLSAAHPKNLLNDTNM---------GEHVIIGVI  145



>ref|XP_011020517.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=788

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 22/109 (20%)
 Frame = +1

Query  7    DQAQLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHL  177
            D  QL++S++  +     +L+  Y++ F GFSA LT  EA  +A + G+VS+F DPIL L
Sbjct  69   DHLQLLSSIIPSHESERISLIRHYSHAFKGFSAMLTENEASLLAGHGGIVSIFRDPILQL  128

Query  178  KTTRSWDFLDSIS---YTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             TTRSWDFL++ S   Y    P             P+SS   D IIG++
Sbjct  129  HTTRSWDFLEAASGMQYKHEHP-------------PMSS---DVIIGMI  161



>emb|CDP21113.1| unnamed protein product [Coffea canephora]
Length=381

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  16   QLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            QL++S++ R  +   ++ ++Y + F GFSA LT +EA  +  +  VVSVFPDP+L L TT
Sbjct  21   QLLSSIIPREERDRLSIRHSYQHSFSGFSAMLTEDEASILLAHSKVVSVFPDPVLKLHTT  80

Query  187  RSWDFLD  207
            RSWDFL+
Sbjct  81   RSWDFLE  87



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 12/88 (14%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            ++VYTY +GF GF+A+LT  +A+ I++ P VV V P+    L+TTR+WD+LD  SY   S
Sbjct  822  SMVYTYKHGFSGFAAKLTESQAQQISELPEVVHVIPNRFHSLQTTRTWDYLDISSY---S  878

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            P NL   T           G   IIG+L
Sbjct  879  PFNLLHDTDM---------GDGIIIGLL  897


 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGVV V P+ +  L+TTRSWDFL   S+    P
Sbjct  71   MVYSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHRLQTTRSWDFLGLSSHY---P  127

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TN+ ++         S  G   IIG+ 
Sbjct  128  TNILQN---------SKMGDGVIIGVF  145



>ref|XP_009396709.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 14/107 (13%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   +L+AS+LK   K   A+ Y+YT+   GF+A L  E+A  I++ PGVVSVFP+    
Sbjct  56   ESHHELLASVLKDKEKVEDAIFYSYTHNINGFAAYLGEEDAMEISKYPGVVSVFPNRGYS  115

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTRSW+FL            L R++ T +A   +  G D II  L
Sbjct  116  LHTTRSWEFL-----------GLERNSETHSAWNKARFGEDVIIANL  151



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = +1

Query  16   QLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            +L++ +L R   A   +V  YT  F GF+ARL+  EA ++ + PGVVSVF  P+ HL TT
Sbjct  61   RLVSGVLTRGKPAENVVVQQYTRVFSGFAARLSEPEAAALRRKPGVVSVFAAPVSHLHTT  120

Query  187  RSWDFLDSISYTKISPTNLRRSTST---------AAAQPLSSSGADTIIGIL  315
            RSWDFL   +   +     RR  S+          ++   SS+ ADTIIG+L
Sbjct  121  RSWDFLQQQTAVVVKTDRARRRRSSPDATATATAVSSASSSSATADTIIGLL  172



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q+++SLL     A   +VY+Y +GF GF+ARLT  +A+ +A +P VV V PD    L 
Sbjct  47   HHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKELADSPEVVHVMPDGYYELA  106

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTR+WD+L     +   P NL   T+          G   IIG++
Sbjct  107  TTRTWDYL---GLSAAHPKNLLNDTNM---------GEHVIIGVI  139



>ref|XP_008375386.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 13/88 (15%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKIS  231
            ++++ Y + F GFSA LT  EA +++ N G+VS+FPD IL L TTRSWDFLD  S     
Sbjct  76   SVIHKYNHAFRGFSAMLTETEASTLSGNDGIVSIFPDSILQLHTTRSWDFLDPKSVRAWK  135

Query  232  PTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               LR S+             D IIG++
Sbjct  136  NEYLRPSS-------------DVIIGMI  150



>ref|XP_010100157.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB81608.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 14/90 (16%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            ++++Y+Y +GF G +ARLT  EA++IA+ PGVV V PD I+   TTRSWDFL      K 
Sbjct  78   QSILYSYRHGFSGIAARLTDAEAKAIAKIPGVVKVIPDYIVKAHTTRSWDFLGVPH--KY  135

Query  229  SPTNLRRSTSTAAAQPLSSS-GADTIIGIL  315
            SP +           PLS++ G  TIIG++
Sbjct  136  SPQS-----------PLSNNLGQGTIIGVV  154



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   Q++ SLL   K    ++VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  47   KSHHQMLVSLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGFHE  106

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTR+WD+L     +  +P NL   T+          G   IIG++
Sbjct  107  LATTRTWDYL---GLSAANPKNLLNDTNM---------GDQVIIGVI  141



>tpg|DAA41966.1| TPA: putative subtilase family protein [Zea mays]
Length=576

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRSWDFL  +SY + 
Sbjct  80   RSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRSWDFL-GMSYGES  138

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               +        A       G D I+G++
Sbjct  139  PSLSSSSRLLRKAKY-----GEDVIVGVI  162



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   Q++++LL     A   ++Y+Y +GF GF+ARLT  +A  IA+ PGV+ V P+ I 
Sbjct  26   KKSHHQMLSTLLGSKEAAKSSILYSYKHGFSGFAARLTEAQAVKIAEFPGVIQVIPNRIH  85

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSW+F   I     S  NL        AQ  S+ G  TIIG++
Sbjct  86   KLHTTRSWEF---IGLNHHSSKNL-------LAQ--SNMGEGTIIGVI  121



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGVV V P+ +  L+TTRSWDFL     +  SP
Sbjct  70   MVYSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWDFL---GLSSQSP  126

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +N+            SS G   IIG+L
Sbjct  127  SNILHK---------SSMGDGVIIGVL  144



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ SLL     A   +VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  52   ESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYK  111

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            LKTTR+WD+L     +  SP N    T+          G   IIGI+
Sbjct  112  LKTTRTWDYL---GLSASSPKNHLNETNM---------GEQIIIGII  146



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGVV V P+ +  L+TTRSWDFL     +  SP
Sbjct  70   MVYSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWDFL---GLSSQSP  126

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +N+            SS G   IIG+L
Sbjct  127  SNILHK---------SSMGDGVIIGVL  144



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  67   HHQMLESLLQFKEDAHNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVIHVIPNRILKLK  126

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPL---SSSGADTIIGIL  315
            TTR+WD L       +SP     S+S+ + + L   ++ G++ IIG++
Sbjct  127  TTRTWDHLG------LSPIPTSFSSSSLSVKGLLHDTNMGSEAIIGVI  168



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = +1

Query  19   LIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
            ++ SLL     A   +VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    LKTTR
Sbjct  1    MLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYKLKTTR  60

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +WD+L     +  SP NL   T+          G   IIGI+
Sbjct  61   TWDYL---GLSASSPKNLLNETNM---------GEQIIIGII  90



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  52   ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDS  210
            AL + +++ F GFSA LT  EA +++ +  VVSVFPDP+L L TTRSWDFL+S
Sbjct  71   ALTHHFSHAFSGFSALLTEGEASALSGHDSVVSVFPDPVLQLHTTRSWDFLES  123



>gb|EPS69827.1| hypothetical protein M569_04935, partial [Genlisea aurea]
Length=721

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  16   QLIASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSW  195
            QL++SL+    K ++ +YT+ F GF+  LT  +A +++ +  VVSVF DPIL L TTRSW
Sbjct  13   QLLSSLIPSFEKQILNSYTHAFKGFAVMLTETQASALSDSRDVVSVFADPILELHTTRSW  72

Query  196  DFLD  207
            DFLD
Sbjct  73   DFLD  76



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 16/103 (16%)
 Frame = +1

Query  16   QLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            Q+++S++    K   +L+ +Y + F GFSA LT +EA  ++    VVSVFPD IL L TT
Sbjct  55   QMLSSVIPSEEKERVSLMQSYHHAFKGFSAMLTEKEAALLSGFDEVVSVFPDRILQLHTT  114

Query  187  RSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            RSWDFLD+ S   I    LRR  S+           D IIGI+
Sbjct  115  RSWDFLDAES--GIGSQRLRRKASS-----------DVIIGII  144



>ref|XP_008667162.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
 gb|ACN34723.1| unknown [Zea mays]
 tpg|DAA41967.1| TPA: putative subtilase family protein [Zea mays]
Length=758

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRSWDFL  +SY + 
Sbjct  80   RSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRSWDFL-GMSYGES  138

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               +        A       G D I+G++
Sbjct  139  PSLSSSSRLLRKAKY-----GEDVIVGVI  162



>tpg|DAA41968.1| TPA: putative subtilase family protein [Zea mays]
Length=710

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRSWDFL  +SY + 
Sbjct  32   RSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRSWDFL-GMSYGES  90

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               +        A       G D I+G++
Sbjct  91   PSLSSSSRLLRKAKY-----GEDVIVGVI  114



>gb|ACF86497.1| unknown [Zea mays]
Length=757

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRSWDFL  +SY + 
Sbjct  80   RSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRSWDFL-GMSYGES  138

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
               +        A       G D I+G++
Sbjct  139  PSLSSSSRLLRKAKY-----GEDVIVGVI  162



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q+++SLL     A   +V++Y +GF GF+A+LT  +A+ IA +PGVV V PD +  L 
Sbjct  51   HHQMLSSLLGSKEDAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPGVVHVVPDSLYKLA  110

Query  181  TTRSWDFL  204
            TTR+WD+L
Sbjct  111  TTRTWDYL  118



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            ++++Y+Y +GF GF+A LT  +A+ IA  PGVV V P+ IL + TTRSWDFL      ++
Sbjct  64   ESILYSYKHGFSGFAALLTQSQAKLIADFPGVVRVIPNRILRVHTTRSWDFL------QL  117

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             P  +    S       S SG D+IIG+L
Sbjct  118  KPEIMDGILSR------SQSGYDSIIGVL  140



>ref|XP_008794749.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=776

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R    +L+AS+L    KA   L Y+YT    GF+A L  EEA  I++ PGVVSVFP+   
Sbjct  55   RDSHHELLASVLGNKEKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVVSVFPNRGY  114

Query  172  HLKTTRSWDFL  204
             L TTRSWDFL
Sbjct  115  KLHTTRSWDFL  125



>ref|XP_007016589.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY34208.1| Subtilase family protein, putative [Theobroma cacao]
Length=765

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA--LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKT  183
             + ++ ++LK++  A  L+ +Y+  F GF+A+LT EEA  +A   GVVSVFP  + HL+T
Sbjct  75   HSSMLQAVLKQSSVANYLIRSYSRSFNGFAAKLTNEEANKLASMKGVVSVFPSKVYHLQT  134

Query  184  TRSWDFL  204
            TRSWDF+
Sbjct  135  TRSWDFM  141



>ref|XP_003581342.1| PREDICTED: subtilisin-like protease SBT3.3 [Brachypodium distachyon]
Length=740

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 11/89 (12%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A LT  +A +IA+ P V+SV P+      TTRSWDFLD + YT+ 
Sbjct  64   QSIVYSYKHGFSGFAAMLTKSQAETIAKFPEVISVKPNTYHQAHTTRSWDFLD-LDYTQQ  122

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
              + L++          ++ G DTIIG++
Sbjct  123  PASLLQK----------ANYGEDTIIGVI  141



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q+++SLL     A   +VY+Y +GF GF+ARLT  +A+ +A +P VV V PD    L 
Sbjct  720  HHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKKLADSPEVVHVMPDGYYELA  779

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTR+WD+L     +   P NL   T+          G   IIG++
Sbjct  780  TTRTWDYL---GLSAAHPKNLLNDTNM---------GDHVIIGVI  812


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q+++SLL    +A   +V++Y +GF GF+A+LT  +A+ IA +P VV V PD    
Sbjct  47   ESHHQMLSSLLGSEVEADDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSFYK  106

Query  175  LKTTRSWDFL  204
            L TTR+WD+L
Sbjct  107  LATTRTWDYL  116



>ref|XP_009420549.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  58   VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            VYTY+NGF GF+ARL+ E+A  +A  PGVVSV P+   +L TTRSWDF+
Sbjct  67   VYTYSNGFRGFAARLSKEQASQMADMPGVVSVLPNLKRNLHTTRSWDFI  115



>gb|KDO48661.1| hypothetical protein CISIN_1g0368302mg, partial [Citrus sinensis]
Length=408

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            + +  QL++S++        +L++ Y + F GFSA LT  EA +++ +  VVSVFPDP+L
Sbjct  58   KLNHMQLLSSIIPSEESERLSLIHHYKHAFKGFSAILTDSEASALSGHDHVVSVFPDPVL  117

Query  172  HLKTTRSWDFL  204
             L TTRSWDFL
Sbjct  118  QLHTTRSWDFL  128



>ref|XP_002867838.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44097.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   ++Y+Y +GF GF+A LT+ +A+ I+++P V+ V P+ IL LK
Sbjct  61   HHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRILKLK  120

Query  181  TTRSWDFL  204
            TTR+WD L
Sbjct  121  TTRTWDHL  128



>ref|XP_011048158.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=811

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 17/108 (16%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   QL++++L    +A   ++Y+Y +GF GFSA+L + +A ++A   GV+SVF   +L 
Sbjct  61   KSHIQLLSNVLSSEEEAKQSMLYSYKHGFSGFSAKLNSTQATTLANTKGVISVFRSKVLK  120

Query  175  LKTTRSWDFLDSISYT-KISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTRSWDFL    Y+ +++P  L             + G D ++G+ 
Sbjct  121  LHTTRSWDFLGLTLYSGEVTPLQL-------------TYGDDVVVGVF  155



>ref|XP_002962719.1| hypothetical protein SELMODRAFT_61337, partial [Selaginella moellendorffii]
 gb|EFJ36182.1| hypothetical protein SELMODRAFT_61337, partial [Selaginella moellendorffii]
Length=718

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 26/109 (24%)
 Frame = +1

Query  31   LLKRNGKAL--------------VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPI  168
            L+ R+GK L              VY+Y +GF GF+AR+T ++A++IA    VVSVFP   
Sbjct  18   LVHRHGKILDSVTSRQEVISPEIVYSYKHGFDGFAARMTPKQAKAIAGMRDVVSVFPSKT  77

Query  169  LHLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L L TTRSW+FL++             ST  + ++     GAD I+G++
Sbjct  78   LQLHTTRSWEFLETF------------STGRSYSRRRLGEGADVIVGVM  114



>ref|XP_004504377.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=599

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL     A   L+Y+Y +GF GF+AR+T  +A  IA+ P V+SV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEAAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVISVIPNSIH  118

Query  172  HLKTTRSWDFL  204
             L TTRSWDF+
Sbjct  119  KLHTTRSWDFI  129



>ref|XP_011048159.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Populus 
euphratica]
Length=804

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 17/108 (16%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   QL++++L    +A   ++Y+Y +GF GFSA+L + +A ++A   GV+SVF   +L 
Sbjct  61   KSHIQLLSNVLSSEEEAKQSMLYSYKHGFSGFSAKLNSTQATTLANTKGVISVFRSKVLK  120

Query  175  LKTTRSWDFLDSISYT-KISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTRSWDFL    Y+ +++P  L             + G D ++G+ 
Sbjct  121  LHTTRSWDFLGLTLYSGEVTPLQL-------------TYGDDVVVGVF  155



>gb|KCW72613.1| hypothetical protein EUGRSUZ_E01073, partial [Eucalyptus grandis]
Length=1447

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +1

Query  19   LIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
            ++AS+L   +   K+++Y+Y++GF GF+A+LT  +A+ +A  PGVV V P+ +  L+TTR
Sbjct  761  MLASVLGSKEAAAKSILYSYSHGFSGFAAKLTESQAQELAGFPGVVRVMPNTLFRLQTTR  820

Query  190  SWDFL  204
            SWDFL
Sbjct  821  SWDFL  825



>ref|XP_004504376.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=773

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   ++++SLL     A   L+Y+Y +GF GF+AR+T  +A  IA+ P V+SV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEAAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVISVIPNSIH  118

Query  172  HLKTTRSWDFL  204
             L TTRSWDF+
Sbjct  119  KLHTTRSWDFI  129



>ref|XP_010675509.1| PREDICTED: subtilisin-like protease SBT5.4 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010696044.1| PREDICTED: subtilisin-like protease SBT5.4 [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 14/108 (13%)
 Frame = +1

Query  4    KDQAQLIASLLKRNG------KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDP  165
            +    +I+S+  RNG      K L+Y+YT  F GF+A L  ++A  IA++P V+S+F + 
Sbjct  53   RSHQDMISSVSNRNGNEHDSSKFLIYSYTKVFNGFAATLNEKDAMEIAKHPNVISIFENR  112

Query  166  ILHLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIG  309
             +   T RSWDFLDS    + +P       S+ +    +SSG DTII 
Sbjct  113  FVKQHTIRSWDFLDSYQ-QQFAP-------SSESIWKKASSGEDTIIA  152



>ref|XP_004978766.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=743

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 10/89 (11%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            K++VY+Y +GF GF+A LT  +A +I   PGVVSV P+      TTRSWDFL    Y   
Sbjct  65   KSIVYSYKHGFSGFAAMLTKSQAETIKNLPGVVSVKPNTRYQTATTRSWDFLGLDYYQSS  124

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +P  LR+          +  G D I+G++
Sbjct  125  APDLLRK----------AKYGEDIIVGVV  143



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKAL---VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            K   +++AS+L      L   +Y+Y +GF GF+A++T  +AR IA+ PGVV V P+ +  
Sbjct  66   KSHHEMLASVLGSKEATLDSMIYSYRHGFSGFAAKMTDSQARYIAELPGVVQVLPNRLYK  125

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            + TTRSWD+L     +  S TNL   T         + G   IIG+ 
Sbjct  126  MHTTRSWDYL---GLSPHSTTNLLHDT---------NQGDGAIIGVF  160



>gb|KDP25529.1| hypothetical protein JCGZ_20685 [Jatropha curcas]
Length=770

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 20/102 (20%)
 Frame = +1

Query  19   LIASLLKRN---GKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTR  189
            ++ S+L  N    ++++Y+Y   F GF+A+LT EEAR+I++  GV+SV  +PIL L TTR
Sbjct  51   MLESVLPSNLSAKESIIYSYGRSFNGFAAKLTDEEARTISEMEGVISVILNPILKLHTTR  110

Query  190  SWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            SW+F+   +  KI P                S  AD ++G+L
Sbjct  111  SWEFM-GFTNAKIGP----------------SQEADVVVGLL  135



>ref|XP_011004403.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=759

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  58   VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            +Y+Y +GF GF+A+LT E+A  IAQ PGVVSVFP+    L TTRSWDF+
Sbjct  69   LYSYRHGFRGFAAKLTDEQASQIAQMPGVVSVFPNLKRKLHTTRSWDFM  117



>ref|XP_008794760.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=660

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  1    RKDQAQLIASLL--KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            R    +L+AS+L  K+   AL Y+YT    GF+A L  EEA  I++ PGV+SVFP+    
Sbjct  54   RDSHYELLASVLGNKKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVLSVFPNRGYK  113

Query  175  LKTTRSWDFL  204
            L TTRSWDFL
Sbjct  114  LHTTRSWDFL  123



>ref|XP_002963482.1| hypothetical protein SELMODRAFT_405382 [Selaginella moellendorffii]
 gb|EFJ35353.1| hypothetical protein SELMODRAFT_405382 [Selaginella moellendorffii]
Length=616

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  22   IASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDF  201
            +   L+    A+VY+Y++GF GFSA+LT ++A ++++ P ++SV+P    H++TTRSWDF
Sbjct  50   VTGTLESAMDAIVYSYSHGFSGFSAKLTPDQAEALSKFPEILSVYPSKTYHIQTTRSWDF  109

Query  202  L  204
            +
Sbjct  110  V  110



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 6/86 (7%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
               ++AS+L     A   +VY+Y +GF GF+A++T  +A+ IA+ PGV+ V P     L+
Sbjct  61   HHDMLASVLGSKEAAYDSMVYSYKHGFSGFAAKVTESQAQKIAELPGVIRVMPSHFYSLQ  120

Query  181  TTRSWDFLDSISYTKISPTNLRRSTS  258
            TTRSWD+L     +  SPTNL   T+
Sbjct  121  TTRSWDYL---GLSPSSPTNLLHDTN  143



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 7/105 (7%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q++ SLL+    A   L+Y+Y +GF GF+A LT+ +A+ I+++P V+   P+ IL LK
Sbjct  61   HHQMLESLLQSKEDARNSLIYSYQHGFSGFAALLTSSQAKKISEHPAVIHFIPNRILKLK  120

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTR+WD L     + I PT+    +S       ++ G + IIG++
Sbjct  121  TTRTWDHL---GLSPI-PTSFSSLSSVKGLLHDTNLGREAIIGVI  161



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q+++SLL     A   +VY+Y +GF GF+ARLT  +A+ I+ +P VV V PD    
Sbjct  47   ESHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKKISYSPEVVHVMPDSYYE  106

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTR+WD+L        +P NL  +T+          G   IIG++
Sbjct  107  LATTRTWDYL---GLGTANPKNLLNNTNM---------GDQVIIGVV  141



>ref|XP_002988191.1| hypothetical protein SELMODRAFT_426943 [Selaginella moellendorffii]
 gb|EFJ10610.1| hypothetical protein SELMODRAFT_426943 [Selaginella moellendorffii]
Length=666

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  22   IASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDF  201
            +   L+    A+VY+Y++GF GFSA+LT ++A ++++ P ++SV+P    H++TTRSWDF
Sbjct  100  VTGTLESAMDAIVYSYSHGFSGFSAKLTPDQAEALSKFPEILSVYPSKTYHIQTTRSWDF  159

Query  202  L  204
            +
Sbjct  160  V  160



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            +A+VY+Y +GF GF+A++TA +A+ ++++P VVSV P+   +L+TTRSWD+L
Sbjct  72   EAMVYSYRHGFSGFAAKITASQAQQLSEHPDVVSVMPNSFYNLQTTRSWDYL  123



>ref|XP_002317030.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
 gb|EEE97642.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
Length=759

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  58   VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            +Y+Y +GF GF+A+LT E+A  IAQ PGVVSVFP+    L TTRSWDF+
Sbjct  69   LYSYRHGFRGFAAKLTDEQASQIAQMPGVVSVFPNLKRKLHTTRSWDFM  117



>ref|XP_008667736.1| PREDICTED: uncharacterized protein LOC100278220 isoform X3 [Zea 
mays]
Length=730

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  22   IASLLKRNGKAL---VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRS  192
            +AS+L    +AL   VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRS
Sbjct  39   LASVLGSKDEALSSIVYSYKHGFSGFAAKLTQPQAEELKKYPGVVSVKPNTYHHVHTTRS  98

Query  193  WDFLDSISY  219
            WDFL  +SY
Sbjct  99   WDFL-GMSY  106



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +1

Query  16   QLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
             ++AS+L   +   K+++Y+Y++GF GF+A+LT  +A+ +A  PGVV V P+ +  L+TT
Sbjct  52   DMLASVLGSKEAAAKSILYSYSHGFSGFAAKLTESQAQELAGFPGVVRVMPNTLFRLQTT  111

Query  187  RSWDFL  204
            RSWDFL
Sbjct  112  RSWDFL  117



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGV+ V P+ +  L+TTRSWDFL   S+   SP
Sbjct  70   MVYSYKHGFSGFAAKLTVSQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLSSH---SP  126

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
             N             S+ G   IIG+L
Sbjct  127  VNTLHK---------SNMGDGVIIGVL  144



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +A+ PGVV V P+ +  L+T+RSWDFL   ++   SP
Sbjct  72   MVYSYKHGFYGFAAKLTESQAQKVAELPGVVRVIPNSLHRLQTSRSWDFLGLSAH---SP  128

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
             N   +         SS G   IIG+L
Sbjct  129  ANTLHN---------SSMGDGVIIGVL  146



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LTA +A+ ++++P VV V P+    L+TTRSWD+L     +  
Sbjct  78   ESMVYSYRHGFSGFAAKLTASQAQQLSEHPDVVGVMPNSFYKLQTTRSWDYL---GLSPQ  134

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +P NL            S+ G   IIG+L
Sbjct  135  TPNNLLNK---------SNMGDGVIIGVL  154



>ref|XP_008667735.1| PREDICTED: uncharacterized protein LOC100278220 isoform X2 [Zea 
mays]
Length=757

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  22   IASLLKRNGKAL---VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRS  192
            +AS+L    +AL   VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRS
Sbjct  66   LASVLGSKDEALSSIVYSYKHGFSGFAAKLTQPQAEELKKYPGVVSVKPNTYHHVHTTRS  125

Query  193  WDFLDSISY  219
            WDFL  +SY
Sbjct  126  WDFL-GMSY  133



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 15/105 (14%)
 Frame = +1

Query  10   QAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLK  180
              Q+++SL+     A   ++++Y +GF GF+A+LT  +A+ IA +PGVV V PD    L 
Sbjct  44   HHQMLSSLIGSEEDAHDSMLHSYRHGFSGFAAKLTESQAKKIADSPGVVHVIPDSFYELA  103

Query  181  TTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TTR+WD+L     +  SP NL    +          G   IIG++
Sbjct  104  TTRTWDYL---GLSAPSPKNLLNDVNM---------GDQVIIGVI  136



>gb|KHN03124.1| Cucumisin [Glycine soja]
Length=128

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  16   QLIASLL--KRNGK-ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTT  186
            ++++SLL  K   K +++Y+Y +GF GF+ARLT  +A  IA+ PGVVSV P+ I  L TT
Sbjct  60   KMLSSLLGSKEVAKNSILYSYKHGFSGFAARLTKYQAEEIAKFPGVVSVIPNGIHKLHTT  119

Query  187  RSWDFLDSI  213
            RS DF+  +
Sbjct  120  RSCDFMGKL  128



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 15/107 (14%)
 Frame = +1

Query  4    KDQAQLIASLL---KRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILH  174
            +   Q++ASLL   K    ++VY+Y +GF GF+A+LT  +A+ IA  P VV V PD    
Sbjct  50   ESHHQMLASLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGFHE  109

Query  175  LKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            L TTR+W++L     +  +P NL   T+          G   IIG++
Sbjct  110  LATTRTWEYL---GLSSANPKNLLNDTNM---------GDQVIIGVI  144



>ref|XP_008667730.1| PREDICTED: uncharacterized protein LOC100278220 isoform X1 [Zea 
mays]
 ref|XP_008667731.1| PREDICTED: uncharacterized protein LOC100278220 isoform X1 [Zea 
mays]
 ref|XP_008667732.1| PREDICTED: uncharacterized protein LOC100278220 isoform X1 [Zea 
mays]
 ref|XP_008667733.1| PREDICTED: uncharacterized protein LOC100278220 isoform X1 [Zea 
mays]
 ref|XP_008667734.1| PREDICTED: uncharacterized protein LOC100278220 isoform X1 [Zea 
mays]
 tpg|DAA42179.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  22   IASLLKRNGKAL---VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRS  192
            +AS+L    +AL   VY+Y +GF GF+A+LT  +A  + + PGVVSV P+   H+ TTRS
Sbjct  73   LASVLGSKDEALSSIVYSYKHGFSGFAAKLTQPQAEELKKYPGVVSVKPNTYHHVHTTRS  132

Query  193  WDFLDSISY  219
            WDFL  +SY
Sbjct  133  WDFL-GMSY  140



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 12/89 (13%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKI  228
            +++VY+Y +GF GF+A+LTA +A+ ++++P VV V P+    L+TTRSWD+L     +  
Sbjct  78   ESMVYSYRHGFSGFAAKLTASQAQQLSEHPDVVGVMPNSFYKLQTTRSWDYL---GLSPQ  134

Query  229  SPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
            +P NL            S+ G   IIG+L
Sbjct  135  TPNNLLNK---------SNMGDGVIIGVL  154



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +A+ PGVV V P+ +  L+T+RSWDFL   ++   SP
Sbjct  1    MVYSYKHGFYGFAAKLTESQAQKVAELPGVVRVIPNSLHRLQTSRSWDFLGLSAH---SP  57

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
             N   +         SS G   IIG+L
Sbjct  58   ANTLHN---------SSMGDGVIIGVL  75



>ref|XP_002278450.2| PREDICTED: subtilisin-like protease SBT3.3 [Vitis vinifera]
Length=787

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++++LL     A   ++Y+Y +GF GF+A+LT  +A  IA  PGVV V P+ I 
Sbjct  63   KKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGFPGVVQVIPNRIH  122

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL         PTN+   T+          G   IIG++
Sbjct  123  RLHTTRSWDFL---GLQHDYPTNVLTETNL---------GRGVIIGVI  158



>ref|XP_004149954.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=739

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            K L+Y+Y   F GF+ RLT EEA+ IA   GVVSVFP+   H+ TTRSWDF+
Sbjct  71   KHLLYSYKRSFNGFAVRLTEEEAQKIALKEGVVSVFPNGKKHVHTTRSWDFM  122



>ref|XP_008461717.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=740

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            K L+Y+Y   F GF+ RLT EEA+ IA   GVVSVFP+   H+ TTRSWDF+
Sbjct  73   KHLLYSYKRSFNGFAVRLTEEEAQKIALKEGVVSVFPNGKKHVHTTRSWDFM  124



>ref|XP_011098007.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=764

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  58   VYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            VY+Y +GF GF+ARLT E+A  +A+ PGVVSVFP+    L TT SWDF+
Sbjct  74   VYSYRHGFRGFAARLTEEQASEVAEMPGVVSVFPNTKRSLHTTHSWDFM  122



>ref|XP_004164258.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=752

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  49   KALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            K L+Y+Y   F GF+ RLT EEA+ IA   GVVSVFP+   H+ TTRSWDF+
Sbjct  71   KHLLYSYKRSFNGFAVRLTEEEAQKIALKEGVVSVFPNGKKHVHTTRSWDFM  122



>ref|XP_003534221.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=762

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +1

Query  4    KDQAQLIASL----LKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            K+  Q++AS+    ++    + +YTY +GF GF+A+L+ E+A  I++ PGVVSVFP+   
Sbjct  50   KENHQILASVHSGSIEEAQASHIYTYKHGFRGFAAKLSDEQASQISKMPGVVSVFPNSKR  109

Query  172  HLKTTRSWDFL  204
             L TT SWDF+
Sbjct  110  KLHTTHSWDFM  120



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGV+ V P+ +  L+TTRSWDFL   S+   SP
Sbjct  70   MVYSYKHGFSGFAAKLTESQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLSSH---SP  126

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
             N             S+ G   IIG+L
Sbjct  127  VNTLHK---------SNMGDGVIIGVL  144



>emb|CBI34615.3| unnamed protein product [Vitis vinifera]
Length=737

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 15/108 (14%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            +K   +++++LL     A   ++Y+Y +GF GF+A+LT  +A  IA  PGVV V P+ I 
Sbjct  13   KKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGFPGVVQVIPNRIH  72

Query  172  HLKTTRSWDFLDSISYTKISPTNLRRSTSTAAAQPLSSSGADTIIGIL  315
             L TTRSWDFL         PTN+   T+          G   IIG++
Sbjct  73   RLHTTRSWDFL---GLQHDYPTNVLTETNL---------GRGVIIGVI  108



>ref|XP_006599275.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=726

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +1

Query  4    KDQAQLIASL----LKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            K+  Q++AS+    +++   + +YTY +GF GF+A+L+ E+A  I++ PGVVSVFP+   
Sbjct  14   KENHQILASVHSGSIEQAQASHIYTYRHGFRGFAAKLSDEQASQISKMPGVVSVFPNSKR  73

Query  172  HLKTTRSWDFL  204
             L TT SWDF+
Sbjct  74   KLHTTHSWDFM  84



>gb|KHN38839.1| Subtilisin-like protease [Glycine soja]
Length=762

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +1

Query  4    KDQAQLIASL----LKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            K+  Q++AS+    ++    + +YTY +GF GF+A+L+ E+A  I++ PGVVSVFP+   
Sbjct  50   KENHQILASVHSGSIEEAQASHIYTYKHGFRGFAAKLSDEQASQISKMPGVVSVFPNSKR  109

Query  172  HLKTTRSWDFL  204
             L TT SWDF+
Sbjct  110  KLHTTHSWDFM  120



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFLDSISYTKISP  234
            +VY+Y +GF GF+A+LT  +A+ +++ PGVV V P+ +  L+TTRSW+FL   S+   SP
Sbjct  74   MVYSYKHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWNFLGLSSH---SP  130

Query  235  TNLRRSTSTAAAQPLSSSGADTIIGIL  315
            TN   +         SS G   IIG+ 
Sbjct  131  TNALHN---------SSMGDGVIIGVF  148



>gb|KCW65828.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=472

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  22   IASLLKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDF  201
            I+S  K    +L++ Y + F GFSA LT  EA  ++ +  V+SVFPDP+L L TTRSWDF
Sbjct  63   ISSRQKNQKVSLLHHYNHAFRGFSAMLTESEASKLSGHEKVLSVFPDPLLQLHTTRSWDF  122

Query  202  LD  207
            L+
Sbjct  123  LE  124



>ref|XP_006471314.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +1

Query  7    DQAQLIASLLKRNGK---ALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHL  177
            +  QL++S++        +L++ Y + F GFSA LT  EA +++ +  VVSVFPDP+L L
Sbjct  60   NHMQLLSSIIPSEESERLSLIHHYKHAFKGFSAILTDSEASALSGHDHVVSVFPDPVLQL  119

Query  178  KTTRSWDFL  204
             TTRSWDFL
Sbjct  120  HTTRSWDFL  128



>ref|XP_003547892.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=762

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +1

Query  4    KDQAQLIASL----LKRNGKALVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            K+  Q++AS+    +++   + +YTY +GF GF+A+L+ E+A  I++ PGVVSVFP+   
Sbjct  50   KENHQILASVHSGSIEQAQASHIYTYRHGFRGFAAKLSDEQASQISKMPGVVSVFPNSKR  109

Query  172  HLKTTRSWDFL  204
             L TT SWDF+
Sbjct  110  KLHTTHSWDFM  120



>ref|XP_008794759.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    RKDQAQLIASLLKRNGKA---LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPIL  171
            R    +L+AS+L    KA   L Y+YT    GF+A L  EEA  I++ PGV+SVFP+   
Sbjct  60   RDSHHELLASVLGNKEKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVLSVFPNRGY  119

Query  172  HLKTTRSWDFL  204
             L TTRSWDFL
Sbjct  120  KLHTTRSWDFL  130



>ref|XP_002461614.1| hypothetical protein SORBIDRAFT_02g005460 [Sorghum bicolor]
 gb|EER98135.1| hypothetical protein SORBIDRAFT_02g005460 [Sorghum bicolor]
Length=744

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  55   LVYTYTNGFCGFSARLTAEEARSIAQNPGVVSVFPDPILHLKTTRSWDFL  204
            ++Y+YT    GF+ARLT EE R ++   GVVSVFP    HL+TTRSWDFL
Sbjct  83   IIYSYTRSINGFAARLTEEEKRKLSSKEGVVSVFPSRTYHLQTTRSWDFL  132



Lambda      K        H        a         alpha
   0.317    0.130    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304