BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14948_g1_i1 len=857 path=[1:0-341 343:342-345 347:346-498
500:499-856]

Length=857
                                                                      Score     E

ref|XP_009597274.1|  PREDICTED: uncharacterized protein LOC104093253    256   5e-82   
ref|XP_009801469.1|  PREDICTED: uncharacterized protein LOC104247205    256   7e-82   
ref|XP_004232563.1|  PREDICTED: uncharacterized protein LOC101256829    248   9e-79   
ref|XP_006340835.1|  PREDICTED: uncharacterized protein LOC102593...    245   2e-77   
emb|CDP01793.1|  unnamed protein product                                244   5e-77   
gb|EYU22945.1|  hypothetical protein MIMGU_mgv1a014756mg                238   7e-75   
ref|XP_009601921.1|  PREDICTED: uncharacterized protein LOC104097...    238   1e-74   
gb|EYU25649.1|  hypothetical protein MIMGU_mgv1a014779mg                234   2e-73   
ref|XP_009767524.1|  PREDICTED: protein GET1-like isoform X2            233   5e-73   
gb|EYU22946.1|  hypothetical protein MIMGU_mgv1a014756mg                231   3e-72   
gb|EYU21148.1|  hypothetical protein MIMGU_mgv1a014807mg                230   8e-72   
ref|XP_009369805.1|  PREDICTED: uncharacterized protein LOC103959180    230   1e-71   
ref|XP_009767523.1|  PREDICTED: uncharacterized protein LOC104218...    228   6e-71   
ref|XP_008393408.1|  PREDICTED: uncharacterized protein LOC103455607    228   6e-71   
ref|XP_008392451.1|  PREDICTED: uncharacterized protein LOC103454...    228   6e-71   
ref|XP_008241943.1|  PREDICTED: tail-anchored protein insertion r...    228   7e-71   
ref|XP_008241944.1|  PREDICTED: tail-anchored protein insertion r...    226   5e-70   
ref|XP_002280184.1|  PREDICTED: uncharacterized protein LOC100252414    224   3e-69   Vitis vinifera
ref|XP_007046510.1|  Uncharacterized protein isoform 1                  223   4e-69   
ref|XP_007202635.1|  hypothetical protein PRUPE_ppa012068mg             224   4e-69   
ref|XP_006340002.1|  PREDICTED: uncharacterized protein LOC102590930    223   5e-69   
ref|XP_004253239.1|  PREDICTED: uncharacterized protein LOC101252673    223   7e-69   
ref|XP_004287728.1|  PREDICTED: uncharacterized protein LOC101299802    218   4e-67   
ref|XP_011069568.1|  PREDICTED: uncharacterized protein LOC105155392    218   9e-67   
ref|XP_011074867.1|  PREDICTED: uncharacterized protein LOC105159486    214   2e-65   
ref|XP_004509440.1|  PREDICTED: uncharacterized protein LOC101490...    211   3e-64   
gb|AFK41533.1|  unknown                                                 208   4e-63   
ref|XP_006470536.1|  PREDICTED: uncharacterized protein LOC102629...    208   5e-63   
gb|AET03607.2|  CHD5-like protein                                       207   1e-62   
ref|XP_006446302.1|  hypothetical protein CICLE_v10016602mg             207   1e-62   
ref|XP_009124527.1|  PREDICTED: uncharacterized protein LOC103849523    204   1e-61   
ref|XP_010449791.1|  PREDICTED: uncharacterized protein LOC104731973    204   1e-61   
ref|XP_006282729.1|  hypothetical protein CARUB_v10005861mg             202   6e-61   
ref|XP_010440154.1|  PREDICTED: protein GET1-like                       202   6e-61   
ref|XP_010434823.1|  PREDICTED: protein GET1                            202   1e-60   
ref|XP_011022170.1|  PREDICTED: uncharacterized protein LOC105124...    202   1e-60   
ref|XP_002868132.1|  hypothetical protein ARALYDRAFT_493236             201   2e-60   
ref|XP_002521719.1|  conserved hypothetical protein                     201   2e-60   Ricinus communis
ref|XP_006382996.1|  hypothetical protein POPTR_0005s10430g             201   2e-60   
ref|XP_009601925.1|  PREDICTED: uncharacterized protein LOC104097...    199   6e-60   
gb|EYU45666.1|  hypothetical protein MIMGU_mgv1a017706mg                198   7e-60   
gb|EPS66967.1|  hypothetical protein M569_07809                         199   1e-59   
gb|EYU34159.1|  hypothetical protein MIMGU_mgv1a019451mg                197   1e-59   
ref|XP_006414348.1|  hypothetical protein EUTSA_v10026376mg             198   2e-59   
gb|AAM64570.1|  unknown                                                 196   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027968.1|  PREDICTED: uncharacterized protein LOC104418342    196   1e-58   
ref|XP_009601924.1|  PREDICTED: uncharacterized protein LOC104097...    194   6e-58   
emb|CDX90523.1|  BnaA03g42580D                                          194   2e-57   
ref|XP_009136767.1|  PREDICTED: protein GET1-like                       193   3e-57   
ref|XP_009767525.1|  PREDICTED: protein GET1-like isoform X3            193   3e-57   
ref|XP_009767526.1|  PREDICTED: uncharacterized protein LOC104218...    192   4e-57   
ref|XP_003534235.1|  PREDICTED: uncharacterized protein LOC100815...    192   6e-57   
ref|XP_010671627.1|  PREDICTED: tail-anchored protein insertion r...    191   1e-56   
emb|CDY09693.1|  BnaC07g33680D                                          191   3e-56   
ref|XP_008448478.1|  PREDICTED: tail-anchored protein insertion r...    185   4e-54   
ref|XP_010266649.1|  PREDICTED: uncharacterized protein LOC104604117    184   5e-54   
ref|NP_567498.1|  uncharacterized protein                               184   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43767.1|  hypothetical protein JCGZ_22394                         182   3e-53   
ref|XP_004146176.1|  PREDICTED: uncharacterized protein LOC101204...    182   5e-53   
ref|XP_004512266.1|  PREDICTED: uncharacterized protein LOC101497483    182   7e-53   
ref|XP_003516524.1|  PREDICTED: uncharacterized protein LOC100790676    181   8e-53   
ref|XP_006470537.1|  PREDICTED: uncharacterized protein LOC102629...    181   1e-52   
ref|XP_006446301.1|  hypothetical protein CICLE_v10016602mg             179   5e-52   
ref|XP_006470538.1|  PREDICTED: uncharacterized protein LOC102629...    179   6e-52   
ref|XP_009601922.1|  PREDICTED: uncharacterized protein LOC104097...    179   6e-52   
ref|XP_006446300.1|  hypothetical protein CICLE_v10016602mg             179   3e-51   
ref|XP_003629131.1|  hypothetical protein MTR_8g073600                  180   2e-50   
ref|XP_003538910.1|  PREDICTED: uncharacterized protein LOC100778654    175   3e-50   
ref|XP_007156237.1|  hypothetical protein PHAVU_003G269900g             174   4e-50   
ref|XP_007138454.1|  hypothetical protein PHAVU_009G210400g             174   4e-50   
gb|KHN41820.1|  Tail-anchored protein insertion receptor WRB            174   5e-50   
ref|XP_008352412.1|  PREDICTED: uncharacterized protein LOC103415908    171   1e-48   
ref|XP_010547400.1|  PREDICTED: uncharacterized protein LOC104819160    170   2e-48   
ref|XP_008337938.1|  PREDICTED: uncharacterized protein LOC103401013    170   2e-48   
ref|XP_009392861.1|  PREDICTED: tail-anchored protein insertion r...    169   7e-48   
ref|XP_004957569.1|  PREDICTED: uncharacterized protein LOC101779...    168   1e-47   
ref|XP_009418672.1|  PREDICTED: uncharacterized protein LOC103998...    167   7e-47   
ref|XP_010557417.1|  PREDICTED: uncharacterized protein LOC104826422    162   5e-45   
ref|XP_006587568.1|  PREDICTED: uncharacterized protein LOC100815...    159   2e-44   
ref|XP_006855737.1|  hypothetical protein AMTR_s00044p00161930          159   5e-44   
ref|XP_008781300.1|  PREDICTED: uncharacterized protein LOC103701...    158   8e-44   
gb|AFW85445.1|  hypothetical protein ZEAMMB73_513382                    157   1e-43   
ref|XP_010935301.1|  PREDICTED: uncharacterized protein LOC105055...    156   5e-43   
ref|XP_009767527.1|  PREDICTED: uncharacterized protein LOC104218...    155   6e-43   
gb|ACG26961.1|  hypothetical protein                                    152   1e-41   Zea mays [maize]
ref|NP_001144064.1|  uncharacterized protein LOC100276891 precursor     150   6e-41   Zea mays [maize]
gb|ACN37033.1|  unknown                                                 150   8e-41   Zea mays [maize]
ref|XP_008812335.1|  PREDICTED: tail-anchored protein insertion r...    147   1e-39   
ref|NP_001057061.1|  Os06g0198700                                       147   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004146175.1|  PREDICTED: uncharacterized protein LOC101204...    147   2e-39   
ref|XP_011022172.1|  PREDICTED: uncharacterized protein LOC105124...    143   2e-38   
ref|XP_009418673.1|  PREDICTED: uncharacterized protein LOC103998...    144   2e-38   
ref|XP_004964583.1|  PREDICTED: uncharacterized protein LOC101782131    144   3e-38   
ref|XP_004957568.1|  PREDICTED: uncharacterized protein LOC101779...    141   3e-37   
ref|XP_003564144.1|  PREDICTED: uncharacterized protein LOC100836937    139   2e-36   
dbj|BAJ86747.1|  predicted protein                                      135   6e-35   
ref|XP_006340836.1|  PREDICTED: uncharacterized protein LOC102593...    132   2e-34   
ref|XP_008346560.1|  PREDICTED: uncharacterized protein LOC103409514    131   2e-34   
ref|XP_002436643.1|  hypothetical protein SORBIDRAFT_10g006470          131   1e-33   Sorghum bicolor [broomcorn]
ref|XP_006656737.1|  PREDICTED: tail-anchored protein insertion r...    129   2e-32   
gb|EMS68308.1|  hypothetical protein TRIUR3_11512                       128   2e-32   
ref|XP_008392459.1|  PREDICTED: uncharacterized protein LOC103454...    124   1e-30   
ref|XP_007046511.1|  Uncharacterized protein isoform 2                  122   2e-30   
ref|XP_009369806.1|  PREDICTED: uncharacterized protein LOC103959182    119   1e-29   
gb|EMT10208.1|  hypothetical protein F775_29686                         118   5e-28   
gb|ADE77856.1|  unknown                                                 107   4e-24   
gb|KDO54788.1|  hypothetical protein CISIN_1g033786mg                   103   4e-24   
emb|CAN61751.1|  hypothetical protein VITISV_026186                     105   5e-24   Vitis vinifera
gb|KHN35958.1|  hypothetical protein glysoja_003081                     103   2e-23   
ref|XP_007138455.1|  hypothetical protein PHAVU_009G210400g             100   3e-22   
ref|XP_008344182.1|  PREDICTED: uncharacterized protein LOC103406993  95.5    5e-21   
gb|KHG02964.1|  hypothetical protein F383_25227                       94.0    3e-20   
gb|ACU17964.1|  unknown                                               92.8    2e-19   Glycine max [soybeans]
gb|AFW85444.1|  hypothetical protein ZEAMMB73_513382                  89.0    2e-18   
ref|XP_010101923.1|  hypothetical protein L484_001714                 88.2    3e-18   
ref|XP_001760426.1|  predicted protein                                88.6    9e-18   
ref|XP_008781301.1|  PREDICTED: uncharacterized protein LOC103701...  84.3    2e-16   
ref|XP_010935302.1|  PREDICTED: uncharacterized protein LOC105055...  82.0    9e-16   
gb|AFW85443.1|  hypothetical protein ZEAMMB73_513382                  80.5    1e-15   
gb|KDO54789.1|  hypothetical protein CISIN_1g033786mg                 78.2    1e-14   
emb|CAB10420.1|  LET1 like protein                                    83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AFW85442.1|  hypothetical protein ZEAMMB73_513382                  72.0    2e-12   
ref|XP_002955700.1|  hypothetical protein VOLCADRAFT_119133           62.0    3e-08   
gb|KHN35589.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...  60.5    4e-07   
ref|XP_005829401.1|  hypothetical protein GUITHDRAFT_111699           55.1    2e-05   
ref|NP_001136965.1|  uncharacterized protein LOC100217125             51.6    4e-05   Zea mays [maize]
ref|XP_001695038.1|  predicted protein                                51.6    2e-04   Chlamydomonas reinhardtii



>ref|XP_009597274.1| PREDICTED: uncharacterized protein LOC104093253 [Nicotiana tomentosiformis]
Length=177

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+  K  +SIAAP++F IV   QFLSRY E+ K KGS S +D QL+AEIKQLLKEA+ 
Sbjct  1    MEESTAKVGRSIAAPMIFLIVVALQFLSRYFEINKKKGSTSSEDMQLRAEIKQLLKEASA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            LSQPSTF QAAKLRR+A AKEKELAKNQ I +KE ++ YD ++K L +L++ TY +L++W
Sbjct  61   LSQPSTFAQAAKLRRLATAKEKELAKNQAIRSKETKLSYDTYTKGLTILQVLTYLLLVIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            FWR+PVAS+S+QLVQPFG+MLSWRAGG  N+NVMVGIIPWLIL  RVSK+ICR++
Sbjct  121  FWRIPVASISKQLVQPFGKMLSWRAGGPTNENVMVGIIPWLILSTRVSKSICRRI  175



>ref|XP_009801469.1| PREDICTED: uncharacterized protein LOC104247205 [Nicotiana sylvestris]
Length=177

 Score =   256 bits (654),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+  K  +SIAAP++F IV   QFLSRY E+ K KGS S +D QL+AEIKQLLKEA+ 
Sbjct  1    MEESTAKVERSIAAPMIFLIVVALQFLSRYFEINKKKGSTSSEDIQLRAEIKQLLKEASA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            LSQPSTF QAAKLRR+A AKEKELAKNQ I +KE ++ YD ++K L +L++ TY +L++W
Sbjct  61   LSQPSTFAQAAKLRRLATAKEKELAKNQAIRSKETKLSYDTYTKGLTILQVLTYLLLVIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            FWR+PVAS+S+QLVQPFG+MLSWRAGG  N+NVMVGIIPWLIL  RVSK+ICR++
Sbjct  121  FWRIPVASISKQLVQPFGKMLSWRAGGPTNENVMVGIIPWLILSTRVSKSICRRI  175



>ref|XP_004232563.1| PREDICTED: uncharacterized protein LOC101256829 [Solanum lycopersicum]
Length=177

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+     +S+AAP++F IV   QFLSR++E+ K KGS S +D QL+AEIKQLLKEA+ 
Sbjct  1    MEESTANLERSVAAPMIFIIVLALQFLSRFIEINKKKGSTSSEDLQLRAEIKQLLKEASA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            LSQPSTF QAAKLRR+A AKEKELAKNQ IHNKE ++ +D ++K L + ++ TY +LI+W
Sbjct  61   LSQPSTFAQAAKLRRLATAKEKELAKNQEIHNKEAKLSHDSYTKGLTIFQVLTYLLLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+S+QLVQPFG+MLSWRAGG  N+NVMVGIIPWLIL  RV K+I R++ K
Sbjct  121  FWRIPVASISKQLVQPFGKMLSWRAGGPANENVMVGIIPWLILSTRVGKSISRRIFK  177



>ref|XP_006340835.1| PREDICTED: uncharacterized protein LOC102593949 isoform X1 [Solanum 
tuberosum]
Length=177

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+     +S+AAP++F IV   QFLSR  E+ K KGS S +D QL+AE+KQLLKEA+ 
Sbjct  1    MEESTANLERSVAAPMIFIIVLALQFLSRLFEINKKKGSTSSEDMQLRAEMKQLLKEASA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            LSQPSTF QAAKLRR+A AKEKELAKNQ IHNKE ++ +D ++K L + ++ TY +LI+W
Sbjct  61   LSQPSTFAQAAKLRRLATAKEKELAKNQEIHNKEAKLSHDSYTKGLTIFQVLTYLLLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+S+QLVQPFG+MLSWRAGG  N+NVMVGIIPWLIL  RV K+I R++ K
Sbjct  121  FWRIPVASISKQLVQPFGKMLSWRAGGPANENVMVGIIPWLILSTRVGKSISRRIFK  177



>emb|CDP01793.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            M E LE+H KS+AAPLVF IV VFQ LSRYLEL K KG  ++++ QL+ EI +LLKEAN 
Sbjct  1    MAEGLEEHGKSLAAPLVFLIVVVFQLLSRYLELNKKKGIKTDEELQLREEINKLLKEANS  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             S PSTF QAAKLRRMAAAKEKEL K Q +H+  ++  YD H+K L ++K+FTY +LI+W
Sbjct  61   YSGPSTFAQAAKLRRMAAAKEKELTKVQEMHSNVMKSSYDSHAKVLKMVKVFTYAVLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVA++SE+LVQPFG++LSWRAGG VNDNVMVGIIPWLI+  RVSK I RKV K
Sbjct  121  FWRIPVAAISERLVQPFGKILSWRAGGSVNDNVMVGIIPWLIVSSRVSKIISRKVFK  177



>gb|EYU22945.1| hypothetical protein MIMGU_mgv1a014756mg [Erythranthe guttata]
Length=179

 Score =   238 bits (608),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLEL-RKAKGSMSEKDAQLKAEIKQLLKEAN  583
            MEE L +H KS+AAP +F +V    F+S+YLE  +K KGSMSE D QL+AEIKQLLKEA+
Sbjct  2    MEENLTEHGKSLAAPAIFILVFSLHFVSKYLEFHKKKKGSMSELDVQLRAEIKQLLKEAS  61

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             L+QPSTF QAAKLRRMAAAKEKELAKNQ +H+K++++ +  + K L + K+ TY +LIL
Sbjct  62   SLTQPSTFAQAAKLRRMAAAKEKELAKNQEMHDKDMKLSFGTYEKLLTISKVLTYVVLIL  121

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            WFW++P+ ++S+QLVQPFG++LSWR+G ++ DNV+VGIIPWLI+  RVS+ ICRKVL+
Sbjct  122  WFWKIPITTISDQLVQPFGKLLSWRSGAYLKDNVVVGIIPWLIVSTRVSRFICRKVLE  179



>ref|XP_009601921.1| PREDICTED: uncharacterized protein LOC104097110 isoform X1 [Nicotiana 
tomentosiformis]
Length=177

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++EK   S+AAP++F IV   Q+LSRY+E+  ++ S++ ++ QL+AEIKQLLKEAN 
Sbjct  1    MEESMEKLEGSVAAPMIFLIVVTVQYLSRYVEINMSRVSVNAEELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN+    K ++  YD H+K L +LK+  Y +LI+W
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNREKLRKVMKSSYDSHTKTLMILKVLMYLLLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+ +QLVQPFG++LSWRAGG VN+NVMVGIIPWLIL  R+SK ICRK+ K
Sbjct  121  FWRIPVASIPKQLVQPFGKILSWRAGGHVNENVMVGIIPWLILSTRISKLICRKIFK  177



>gb|EYU25649.1| hypothetical protein MIMGU_mgv1a014779mg [Erythranthe guttata]
Length=178

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLEL-RKAKGSMSEKDAQLKAEIKQLLKEAN  583
            MEE L +H KS+AAP +F +V    F+S+YLE  +K KG MSE D QL+AEIKQLLKEA+
Sbjct  1    MEENLTEHGKSLAAPAIFILVFSLHFVSKYLEFHKKKKGLMSELDVQLRAEIKQLLKEAS  60

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             L+QPSTF QAAKLRRMAAAKEKELAKNQ +H+K++++ +  + K L + K+ TY +LIL
Sbjct  61   SLTQPSTFAQAAKLRRMAAAKEKELAKNQEMHDKDMKLSFGTYEKLLTISKVVTYVLLIL  120

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            WFW++P+ ++S+QLVQPFG++LSWR+G ++ DNV+VGIIPWLI+  RVS+ ICRKV++
Sbjct  121  WFWKIPITTISDQLVQPFGKLLSWRSGAYLKDNVVVGIIPWLIVSTRVSRFICRKVME  178



>ref|XP_009767524.1| PREDICTED: protein GET1-like isoform X2 [Nicotiana sylvestris]
Length=177

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++ K   S+AAP++FFIV   Q+LSRY+E+  ++ S++  + QL+AEIKQLLKEAN 
Sbjct  1    MEESMVKLEGSVAAPMIFFIVVAVQYLSRYVEINMSRVSVNAGELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN     KE++  YD H+K L +LK   Y +LI+W
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNHEKLRKEMKSSYDSHTKTLIILKFLMYLLLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+ +QLVQPFG++LSWRAGG +N+NVMVGIIPWLI   RVSK ICRK+ K
Sbjct  121  FWRIPVASIPKQLVQPFGKILSWRAGGHMNENVMVGIIPWLIFSTRVSKLICRKIFK  177



>gb|EYU22946.1| hypothetical protein MIMGU_mgv1a014756mg [Erythranthe guttata]
Length=177

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLEL-RKAKGSMSEKDAQLKAEIKQLLKEAN  583
            MEE L +H KS+AAP +F +V    F+S+YLE  +K KGSMSE D QL+AEIKQLLKEA+
Sbjct  2    MEENLTEHGKSLAAPAIFILVFSLHFVSKYLEFHKKKKGSMSELDVQLRAEIKQLLKEAS  61

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             L+QPSTF QAAKLRRMAAAKEKELAKNQ +H+K++++ +  + K L + K+ TY +LIL
Sbjct  62   SLTQPSTFAQAAKLRRMAAAKEKELAKNQEMHDKDMKLSFGTYEKLLTISKVLTYVVLIL  121

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            WFW++P+ ++S+QLVQPFG++LSWR+G ++ DN  VGIIPWLI+  RVS+ ICRKVL+
Sbjct  122  WFWKIPITTISDQLVQPFGKLLSWRSGAYLKDN--VGIIPWLIVSTRVSRFICRKVLE  177



>gb|EYU21148.1| hypothetical protein MIMGU_mgv1a014807mg [Erythranthe guttata]
Length=177

 Score =   230 bits (587),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRK-AKGSMSEKDAQLKAEIKQLLKEAN  583
            MEE L +H KS+AAP +F +V    F+S+YLE  K  KGSMSE D QL+AEIKQLLKEA+
Sbjct  2    MEENLTEHGKSLAAPAIFTLVFSLHFVSKYLEFHKQKKGSMSELDVQLRAEIKQLLKEAS  61

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             L+QPSTF QAAKLRR+AAAKEKELAKNQ +H+K++++ +  + K L + K+ TY +LIL
Sbjct  62   SLTQPSTFAQAAKLRRVAAAKEKELAKNQEMHDKDVKLSFGTYEKLLTISKVVTYVVLIL  121

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRK  238
            W W++P+ ++S+QLVQPFG++LSWR+G ++ DNV+VGIIPWLI+  RVS+ ICRK
Sbjct  122  WLWKIPITTISDQLVQPFGKLLSWRSGAYLKDNVVVGIIPWLIVSTRVSRFICRK  176



>ref|XP_009369805.1| PREDICTED: uncharacterized protein LOC103959180 [Pyrus x bretschneideri]
Length=180

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  H  S AAP+VF +V  FQFLSR+LE  K  G  +   ++L+ EIK LLKEA+ LS
Sbjct  6    ETLPAHRSSFAAPIVFIVVVAFQFLSRWLEQLKKGGVKNATASRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAAAKEKELA  Q +H KEI++ YD++ + LF+LK+ TY +L+ WFW
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKEIKLSYDLYLRILFILKVLTYIVLVCWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG+++SWRAGG VN+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKLISWRAGGLVNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_009767523.1| PREDICTED: uncharacterized protein LOC104218681 isoform X1 [Nicotiana 
sylvestris]
Length=182

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 141/182 (77%), Gaps = 5/182 (3%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++ K   S+AAP++FFIV   Q+LSRY+E+  ++ S++  + QL+AEIKQLLKEAN 
Sbjct  1    MEESMVKLEGSVAAPMIFFIVVAVQYLSRYVEINMSRVSVNAGELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFT-----YF  415
            +SQPSTF QAAKLRRMAAAKE+EL KN     KE++  YD H+K L +LK+       Y 
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNHEKLRKEMKSSYDSHTKTLIILKLLITQFLMYL  120

Query  414  MLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            +LI+WFWR+PVAS+ +QLVQPFG++LSWRAGG +N+NVMVGIIPWLI   RVSK ICRK+
Sbjct  121  LLIIWFWRIPVASIPKQLVQPFGKILSWRAGGHMNENVMVGIIPWLIFSTRVSKLICRKI  180

Query  234  LK  229
             K
Sbjct  181  FK  182



>ref|XP_008393408.1| PREDICTED: uncharacterized protein LOC103455607 [Malus domestica]
Length=180

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  H  S AAP+VF +V  FQ LSR+LE  K  G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLPAHRSSFAAPIVFIVVVAFQILSRWLEQLKKGGVKNATATRLRGEIKDLLKEASTLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAAAKEKELA  Q +H KEI++ YD++ + LF+LK+ TY +L+ WFW
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKEIKLSYDLYLRILFILKVLTYIVLVCWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG+++SWRAGG VN+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKLISWRAGGIVNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_008392451.1| PREDICTED: uncharacterized protein LOC103454631 isoform X1 [Malus 
domestica]
Length=180

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  H  S AAP VF +V  FQFLSR+LE  K  G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLSAHRNSFAAPAVFIVVVAFQFLSRWLEQLKKGGVKNATATRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAAAKEKELA  Q +H KE ++ YD++ + LF+LK+ TY +L+ WFW
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKETKLSYDLYQRILFILKVLTYIVLVCWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG+++SWRAGG VN+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKLISWRAGGVVNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_008241943.1| PREDICTED: tail-anchored protein insertion receptor WRB-like 
[Prunus mume]
Length=184

 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E LE H +S+AAPLVF +V VFQF+SR+L+  K +G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLEGHRRSVAAPLVFILVVVFQFVSRWLQQLKKRGVKTATANRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAAAKEKELA  Q +H KE ++ Y+++ K LF+ K+ TY +LI WFW
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKERKLSYELYLKVLFISKVLTYLVLIWWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG++LSWRAGG +N+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKVLSWRAGGILNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_008241944.1| PREDICTED: tail-anchored protein insertion receptor WRB-like 
[Prunus mume]
Length=184

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E LE H +S+AAPLVF +V V QF+SR+L+  K +G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLEGHRRSVAAPLVFILVVVLQFVSRWLQQLKKRGVKTATANRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAAAKEKELA  Q +H KE ++ Y+++ K LF+ K+ TY +LI WFW
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKERKLSYELYLKVLFISKVLTYLVLIWWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG++LSWRAGG +N+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKVLSWRAGGILNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_002280184.1| PREDICTED: uncharacterized protein LOC100252414 [Vitis vinifera]
 emb|CBI37646.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+L+ H  S+AAPL+F +V  FQF+S +LEL K +G  S +D +L+ EIKQLLKEA+ 
Sbjct  1    MEESLD-HRNSLAAPLIFTVVISFQFISVWLELSKKRGLRSAEDDKLRGEIKQLLKEASA  59

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKLRRMAAAKEKEL KNQ   N+E +  YD + K L  LK+F YF+L+ W
Sbjct  60   FSQPSTFAQAAKLRRMAAAKEKELLKNQESLNREKKSSYDSYLKALLFLKVFFYFVLVCW  119

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVL  232
            +W  PVA++S+QLVQPFG++LSWR+G   NDNVMVGIIPWLIL  RVSK ICRKVL
Sbjct  120  YWSSPVAAISKQLVQPFGKVLSWRSGVSSNDNVMVGIIPWLILSTRVSKFICRKVL  175



>ref|XP_007046510.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX90667.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=177

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E LE+  +S+AAPL+FFI+ VFQF +++L+  K   S ++K+ QL+ EIKQLLKEA  LS
Sbjct  5    ETLEQR-RSLAAPLIFFIIVVFQFATKWLQDLKKGASKTDKEIQLRGEIKQLLKEAASLS  63

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRR AAAKEKELA  Q   +KE+++ YD + K LF+LK+  Y +LI WFW
Sbjct  64   QPSTFAQAAKLRRSAAAKEKELANYQAQRSKEVKLSYDWYLKVLFMLKVIIYLVLIFWFW  123

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R PVASVS+QLVQPFG+MLSW+ GG +N+NVMVGIIPWLILC RVSK +CR
Sbjct  124  RSPVASVSQQLVQPFGKMLSWKTGGSLNNNVMVGIIPWLILCTRVSKFVCR  174



>ref|XP_007202635.1| hypothetical protein PRUPE_ppa012068mg [Prunus persica]
 gb|EMJ03834.1| hypothetical protein PRUPE_ppa012068mg [Prunus persica]
Length=184

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E LE H +S+AAPLVF +V V QF+SR L+  K +G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLEGHRRSVAAPLVFIVVVVLQFVSRGLQQLKKRGVKTATANRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRRMAA KEKELA  Q +H KE ++ Y+++ K LF+ K+ TY +LI WFW
Sbjct  66   QPSTFAQAAKLRRMAAVKEKELANYQELHGKERKLSYELYLKVLFISKVLTYLVLIWWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG++LSWRAGG +N+NVMVGIIPWLIL  RVSK +CR
Sbjct  126  RVPVASISQQLVQPFGKVLSWRAGGILNENVMVGIIPWLILSTRVSKFVCR  176



>ref|XP_006340002.1| PREDICTED: uncharacterized protein LOC102590930 [Solanum tuberosum]
Length=174

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            ME+++E    S+AAP++F IV   Q+LSRY+EL  ++ +++ ++ +L+AEIKQL KEAN 
Sbjct  1    MEKSMEG---SVAAPIIFLIVVAVQYLSRYVELNTSRVAVNAEELKLRAEIKQLQKEANA  57

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRR AAAKE+ELAKNQ    KE++  YD + K L V+KI TYF++I+W
Sbjct  58   MSQPSTFAQAAKLRRTAAAKEQELAKNQEKLMKEMKSSYDKNRKALMVVKILTYFLMIIW  117

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+ +QL+QPFGR+LSW++GG  N+NVMVG+IPWLIL  RVSK ICRK+ K
Sbjct  118  FWRIPVASIPKQLLQPFGRILSWQSGGPSNENVMVGVIPWLILSTRVSKLICRKIFK  174



>ref|XP_004253239.1| PREDICTED: uncharacterized protein LOC101252673 [Solanum lycopersicum]
Length=174

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            ME ++E    S+AAP++F IV   Q+ SR++EL  ++ +++  + +L+AEIKQL KEAN 
Sbjct  1    METSMEG---SVAAPIIFLIVVAVQYFSRHVELNTSRVAVNAAELKLRAEIKQLQKEANA  57

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRR AAAKE+ELAKNQ    KE++  YD H K L V+K+ TYFM+I+W
Sbjct  58   MSQPSTFAQAAKLRRTAAAKEQELAKNQEKLMKEMKSSYDKHRKALMVVKVLTYFMMIVW  117

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVAS+ +QL+QPFGR+LSWR+GG  N+NVMVG+IPWL+L  RVSK ICRK+ K
Sbjct  118  FWRIPVASIPKQLLQPFGRILSWRSGGSSNENVMVGVIPWLMLSTRVSKLICRKIFK  174



>ref|XP_004287728.1| PREDICTED: uncharacterized protein LOC101299802 [Fragaria vesca 
subsp. vesca]
Length=176

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L +H  S AAP VF IV  FQFLS++LE  K +G ++ ++ +L+ EIKQL KEA+ LS
Sbjct  2    ETLSEHRISAAAPAVFIIVVAFQFLSKWLEQSKKRGPVTAEETRLRREIKQLSKEASSLS  61

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QP+TF QAAKLRRMA AKEKELAK+Q +  KE++  Y+++   LF+ K+ TY +L+ WFW
Sbjct  62   QPATFAQAAKLRRMATAKEKELAKHQELQGKELKGSYNLYLNVLFISKVLTYLVLVCWFW  121

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PVAS+S+QLVQPFG+++SWRAGG +N NVMVGIIPWLIL  RVSK +CR
Sbjct  122  RVPVASISQQLVQPFGKVISWRAGGVLNGNVMVGIIPWLILSTRVSKFVCR  172



>ref|XP_011069568.1| PREDICTED: uncharacterized protein LOC105155392 [Sesamum indicum]
Length=176

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE L +  KS+AAP++F +V  F F+S Y+E  K K  +S+ D+QL+AEIKQLLKEA+ 
Sbjct  1    MEETLSERGKSLAAPVIFVLVFSFHFVSNYIESCKKKKGVSDVDSQLRAEIKQLLKEASS  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            LSQPSTF QAAKL+R+AAAKEKELAK Q +HNK++   + ++ K L + K+ TY  LILW
Sbjct  61   LSQPSTFAQAAKLKRIAAAKEKELAKYQEMHNKDMNFSFGIYEKLLIISKVVTYIALILW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRK  238
            FW++PV  +S+QLV PFG++LSWRAG  + D+V+VGIIPWLI+  RVSK ICRK
Sbjct  121  FWKIPVTRISDQLVHPFGKLLSWRAGNSLEDHVVVGIIPWLIVSTRVSKFICRK  174



>ref|XP_011074867.1| PREDICTED: uncharacterized protein LOC105159486 [Sesamum indicum]
Length=180

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEAN  583
            MEE       S+AAP +FF+V  F F S+ L+   K KGS+ + DAQL+AEI +LLKEA+
Sbjct  1    MEETQTARGNSMAAPAIFFLVFSFHFASKCLDSYTKKKGSIDDVDAQLRAEINKLLKEAS  60

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             LSQPSTF QAAKL+RMAAAKEKELAK+Q +H+K+I+  +D + K L +LK+  Y +L  
Sbjct  61   SLSQPSTFAQAAKLKRMAAAKEKELAKHQEMHDKDIKSSFDKYGKPLMILKVLMYVLLTF  120

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            WFWR PVA++  QL QPFG+MLSW AG  + DNV VGIIPW+++  RVSK ICRK+LK
Sbjct  121  WFWRAPVATIPSQLAQPFGKMLSWTAGPSIKDNVKVGIIPWMVISFRVSKLICRKMLK  178



>ref|XP_004509440.1| PREDICTED: uncharacterized protein LOC101490653 isoform X1 [Cicer 
arietinum]
 ref|XP_004509441.1| PREDICTED: uncharacterized protein LOC101490653 isoform X2 [Cicer 
arietinum]
Length=177

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            E A E+H +S++APL+FFIV  F F S + +  K  GS  EK+ QL+AEIKQLLKEAN L
Sbjct  5    EAASEEHQRSLSAPLIFFIVLAFHFASHWTDHFKKGGSEKEKEIQLRAEIKQLLKEANSL  64

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPSTF QAAK++R AAAKEKELAK Q +H K+  ++    S+ LF  KI TY +L++WF
Sbjct  65   SQPSTFAQAAKIKRQAAAKEKELAKCQHLHAKDTALY----SQVLFTSKILTYLILLIWF  120

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            W  PVAS+S+QLVQPFGR+LSWR GG  N+N+MVGIIPWL +  RVS+ IC+
Sbjct  121  WSSPVASISQQLVQPFGRLLSWRTGGVQNNNIMVGIIPWLAVSSRVSRFICK  172



>gb|AFK41533.1| unknown [Lotus japonicus]
Length=174

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 130/172 (76%), Gaps = 5/172 (3%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            + A E H +S+AAPL+FF+V  FQF S +++  K  G  + K+ QL+ EIKQLLKEAN L
Sbjct  3    DGASEGHQRSLAAPLIFFVVIAFQFASHWIDQFKKSGD-NGKEIQLRGEIKQLLKEANSL  61

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPST+ QAAKL+R AAAKE+ELAK   +H+K+  +    +S  L V K+ TY +L++WF
Sbjct  62   SQPSTYAQAAKLKRQAAAKERELAKCHNLHDKDTAL----YSNVLLVSKVLTYLILLIWF  117

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            W  PVAS+S+QLVQPFGR+LSWR GG  N+N+MVGIIPWL++C RVS+ ICR
Sbjct  118  WSAPVASISQQLVQPFGRLLSWRTGGVQNNNIMVGIIPWLVVCCRVSRFICR  169



>ref|XP_006470536.1| PREDICTED: uncharacterized protein LOC102629536 isoform X1 [Citrus 
sinensis]
Length=179

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -3

Query  762  NMEEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEA  586
              EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S K+ QL+ EIKQLLKEA
Sbjct  2    GQEETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSGKEIQLRREIKQLLKEA  61

Query  585  NVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLI  406
            +  SQPSTF QAAKL+R+A AKEKELA  Q  H+KEI M YD++ K L +LK+  YF+LI
Sbjct  62   SSFSQPSTFAQAAKLKRLATAKEKELANYQESHSKEIHMSYDLYLKVLRILKVVIYFVLI  121

Query  405  LWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTIC  244
             WFWR PVA++S+QLVQPFG+ LSW  GG   +NVMVGIIPWLIL  RVSK +C
Sbjct  122  CWFWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMVGIIPWLILSTRVSKFVC  175



>gb|AET03607.2| CHD5-like protein [Medicago truncatula]
Length=173

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 4/168 (2%)
 Frame = -3

Query  744  EKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPS  565
            E+H +S AAPL+F IV  FQF S +++  K  GS  EK+ QL+AEIK+LLKEA+ LSQPS
Sbjct  5    EEHERSFAAPLIFLIVLAFQFASYWIDQFKQSGSEKEKETQLRAEIKELLKEASSLSQPS  64

Query  564  TFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMP  385
            TF QAAKLRR AAAKEKELAK   +H+++      ++SK LF  K+ T+  L++WFW  P
Sbjct  65   TFAQAAKLRRQAAAKEKELAKCHNLHDEDTA----LYSKVLFSTKVLTHLTLLIWFWSTP  120

Query  384  VASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            VAS+S+QLVQPFGR+LSW+ GG  N+N+MVGIIPWL +  RVSK IC+
Sbjct  121  VASISQQLVQPFGRLLSWKTGGLQNNNIMVGIIPWLAISSRVSKFICK  168



>ref|XP_006446302.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
 gb|ESR59542.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
Length=179

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -3

Query  756  EEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S+K+ QL+ EIKQLLKEA+ 
Sbjct  4    EETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSDKEIQLRREIKQLLKEASS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKL+R+A AKEKELA  Q   +KEI M YD++ K L +LK+  YF+LI W
Sbjct  64   FSQPSTFAQAAKLKRLATAKEKELANYQESQSKEIHMSYDLYVKVLRILKVVIYFVLICW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTIC  244
            FWR PVA++S+QLVQPFG+ LSW  GG   +NVMVGIIPWLIL  RVSK +C
Sbjct  124  FWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMVGIIPWLILSTRVSKFVC  175



>ref|XP_009124527.1| PREDICTED: uncharacterized protein LOC103849523 [Brassica rapa]
 emb|CDY64873.1| BnaAnng19680D [Brassica napus]
 emb|CDY56535.1| BnaC08g47820D [Brassica napus]
Length=178

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 126/171 (74%), Gaps = 0/171 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L K    +AAPL FF+V +FQ LS+ L+  K KGS + ++A+L++EIKQLL+EA  LS
Sbjct  4    ENLIKDRGFVAAPLTFFVVVIFQLLSKRLDQLKKKGSKNTREAELRSEIKQLLREATGLS  63

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QP+TF QAAKLRR AAAKEKELA+     NKEI + YDM+ K L   K+  Y +L+LWFW
Sbjct  64   QPATFAQAAKLRRSAAAKEKELAQYLEQQNKEINLSYDMYGKVLLASKVLVYVILVLWFW  123

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R P+A +++QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK +CR
Sbjct  124  RTPIAIIAKQLVQPFGNLLSWGTGGHLTGHVMVGIIPWLILSTRVSKYVCR  174



>ref|XP_010449791.1| PREDICTED: uncharacterized protein LOC104731973 [Camelina sativa]
Length=179

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++L+  K KGS + +++QL++EIKQLL+EA+ LSQP+TF QAA
Sbjct  14   LAAPLTFFVVVVFQLLSKWLDQLKKKGSKNTRESQLRSEIKQLLREASALSQPATFAQAA  73

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    HNKEI + YD++ K L   K+  Y +L+LWFWR P+A +++
Sbjct  74   KLRRSAATKEKELAQYLEQHNKEINLSYDLYGKVLLASKVVIYLILVLWFWRTPIAIIAK  133

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +V+VGIIPWLIL  RVSK +CR
Sbjct  134  QLVQPFGTLLSWGTGGHLTGHVLVGIIPWLILSTRVSKYVCR  175



>ref|XP_006282729.1| hypothetical protein CARUB_v10005861mg [Capsella rubella]
 gb|EOA15627.1| hypothetical protein CARUB_v10005861mg [Capsella rubella]
Length=178

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++L+  K KGS +  +++L++EIKQLL+EA+ LSQP+TF QAA
Sbjct  13   LAAPLTFFVVVVFQLLSKWLDQLKKKGSKNTTESELRSEIKQLLREASALSQPATFAQAA  72

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    HNKEI + YD++ K L   K+  Y +L+LWFWR P+A +++
Sbjct  73   KLRRSAATKEKELAQYLEQHNKEINLSYDLYGKALLASKVVIYLILVLWFWRTPIAIIAK  132

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +V+VGIIPWLIL  RVSK +CR
Sbjct  133  QLVQPFGTLLSWGTGGHLTGHVLVGIIPWLILSTRVSKYVCR  174



>ref|XP_010440154.1| PREDICTED: protein GET1-like [Camelina sativa]
Length=179

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++L+  K KGS + ++++L++EIKQLL+EA+ LSQP+TF QAA
Sbjct  14   LAAPLTFFVVVVFQLLSKWLDQLKKKGSKNTRESELRSEIKQLLREASALSQPATFAQAA  73

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    HNKEI + YD++ K L   K+  Y +L+ WFWR P+A +++
Sbjct  74   KLRRSAATKEKELAQYMEQHNKEINLSYDLYGKVLLASKVVIYLILVFWFWRTPIAIIAK  133

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +V+VGIIPWLIL  RVSK +CR
Sbjct  134  QLVQPFGTLLSWGTGGHITGHVLVGIIPWLILSTRVSKYVCR  175



>ref|XP_010434823.1| PREDICTED: protein GET1 [Camelina sativa]
Length=179

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++LE  K KGS + ++++L++EIKQLL+EA+ LSQP+TF QAA
Sbjct  14   LAAPLTFFVVVVFQLLSKWLEQLKKKGSKNTRESELRSEIKQLLREASALSQPATFAQAA  73

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    HNK I + YD++ K L V K+  Y +L+ WFWR P+A +++
Sbjct  74   KLRRSAATKEKELAQYLEQHNKVINLSYDLYGKVLLVSKVVIYLILVFWFWRTPIAIIAK  133

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +V+VGIIPWLIL  RVSK +CR
Sbjct  134  QLVQPFGTLLSWGTGGHITGHVLVGIIPWLILSTRVSKYVCR  175



>ref|XP_011022170.1| PREDICTED: uncharacterized protein LOC105124035 isoform X1 [Populus 
euphratica]
 ref|XP_011022171.1| PREDICTED: uncharacterized protein LOC105124035 isoform X1 [Populus 
euphratica]
Length=181

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  744  EKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPS  565
            E+  +S+AAPL+FFIV  FQF+S YL   K KGS S  + QL+AEIKQLLK+A+ LSQPS
Sbjct  10   EQPRRSLAAPLIFFIVVTFQFVSIYLHQLKKKGSKSAAEIQLRAEIKQLLKDASALSQPS  69

Query  564  TFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMP  385
            TF QAAKLRR+AAAKEKELA  +  H+K +++  D + K LF+ K+ TYF+LI WFWR P
Sbjct  70   TFAQAAKLRRLAAAKEKELANYKEAHDKGMKLSSDSYPKILFISKVVTYFVLICWFWRTP  129

Query  384  VASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            VA +S+QLVQPFGR LSWRAGG +N+NVMVGIIPWLIL  RVSK +CR
Sbjct  130  VAEISQQLVQPFGRFLSWRAGGRLNNNVMVGIIPWLILSTRVSKFVCR  177



>ref|XP_002868132.1| hypothetical protein ARALYDRAFT_493236 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44391.1| hypothetical protein ARALYDRAFT_493236 [Arabidopsis lyrata subsp. 
lyrata]
Length=178

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++L+  K KGS + ++++L++EIKQLL+EA+ LSQP+TF QAA
Sbjct  13   LAAPLTFFVVVVFQLLSKWLDQLKKKGSKNTRESELRSEIKQLLREASALSQPATFAQAA  72

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    HNKEI++ YDM+ K L   K+  Y +L+L FWR P+A +++
Sbjct  73   KLRRSAATKEKELAQYLEQHNKEIKLSYDMYGKVLLASKVVIYLILVLCFWRTPIAIIAK  132

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK +CR
Sbjct  133  QLVQPFGTLLSWGTGGHLTGHVMVGIIPWLILSTRVSKYVCR  174



>ref|XP_002521719.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40706.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  732  KSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQ  553
            +S+AAPL+F +V  FQ +S YLE  K + + +  + QL+ EIKQLLKEA+  SQPSTF Q
Sbjct  14   RSLAAPLIFLVVVFFQLVSTYLEQLKKRAAKTSTEVQLRTEIKQLLKEASSYSQPSTFAQ  73

Query  552  AAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASV  373
            AAKLRR+AAAKEKELA  Q +HNKE+++ YD++ K +F+ KI TYF++I WFWR PVA++
Sbjct  74   AAKLRRLAAAKEKELANLQEMHNKEMKLSYDLYLKIIFLSKIVTYFVMICWFWRTPVAAI  133

Query  372  SEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            S+QLVQPFGRMLSW AGG  NDNV+VGIIPWLIL  RVSK +CR +
Sbjct  134  SQQLVQPFGRMLSWGAGGLFNDNVLVGIIPWLILSTRVSKFVCRVI  179



>ref|XP_006382996.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
 ref|XP_006382997.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
 ref|XP_002307214.2| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
 gb|ERP60793.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
 gb|ERP60794.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
 gb|EEE94210.2| hypothetical protein POPTR_0005s10430g [Populus trichocarpa]
Length=181

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  744  EKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPS  565
            E+  +S+AAPL+FFIV  FQF+S +L   K KGS S  + QL+AEIKQLLK+A+ LSQPS
Sbjct  10   EQPRRSLAAPLIFFIVVAFQFVSIHLHQLKKKGSKSAAEIQLRAEIKQLLKDASALSQPS  69

Query  564  TFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMP  385
            TF QAAKLRR+AAAKEKELA  +  H+KE++   D + K LF+ K+ TYF+LI WFWR P
Sbjct  70   TFAQAAKLRRLAAAKEKELANYKEAHDKEMKRSSDSYPKILFISKVVTYFVLICWFWRTP  129

Query  384  VASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            VA +S+QLVQPFGR LSWRAGG +N+NVMVGIIPWLIL  RVSK +CR
Sbjct  130  VAEISQQLVQPFGRFLSWRAGGRLNNNVMVGIIPWLILSTRVSKFVCR  177



>ref|XP_009601925.1| PREDICTED: uncharacterized protein LOC104097110 isoform X4 [Nicotiana 
tomentosiformis]
Length=147

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  645  SMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMW  466
            S++ ++ QL+AEIKQLLKEAN +SQPSTF QAAKLRRMAAAKE+EL KN+    K ++  
Sbjct  9    SVNAEELQLRAEIKQLLKEANAMSQPSTFAQAAKLRRMAAAKEQELVKNREKLRKVMKSS  68

Query  465  YDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGII  286
            YD H+K L +LK+  Y +LI+WFWR+PVAS+ +QLVQPFG++LSWRAGG VN+NVMVGII
Sbjct  69   YDSHTKTLMILKVLMYLLLIIWFWRIPVASIPKQLVQPFGKILSWRAGGHVNENVMVGII  128

Query  285  PWLILCIRVSKTICRKVLK  229
            PWLIL  R+SK ICRK+ K
Sbjct  129  PWLILSTRISKLICRKIFK  147



>gb|EYU45666.1| hypothetical protein MIMGU_mgv1a017706mg, partial [Erythranthe 
guttata]
Length=141

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -3

Query  651  KGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQ  472
            KGSMSE D QL+AEI+QLLKEA+ L QPSTFVQAAKLRRMAAAKEKELAKN+ +H+K+++
Sbjct  1    KGSMSELDVQLRAEIRQLLKEASSLMQPSTFVQAAKLRRMAAAKEKELAKNEEMHDKDMK  60

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
            + +  + K L + K+ TY +LILWFW++P+ ++S+QLVQPFG++LSWR+G ++ DNV+VG
Sbjct  61   LSFGTYEKLLTISKVLTYVVLILWFWKIPITTISDQLVQPFGKLLSWRSGAYLKDNVVVG  120

Query  291  IIPWLILCIRVSKTICRKVLK  229
            II WLI+  RVS+ ICRKVL+
Sbjct  121  IILWLIVSTRVSRFICRKVLE  141



>gb|EPS66967.1| hypothetical protein M569_07809, partial [Genlisea aurea]
Length=171

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -3

Query  732  KSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFV  556
            KS+AAP +F IV  F   S+YLE  +K K SMS++D  L+AEIK+LLKEA+ LSQPSTF 
Sbjct  3    KSLAAPAIFIIVFAFHLGSKYLESCKKKKESMSDEDTPLRAEIKRLLKEASSLSQPSTFA  62

Query  555  QAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVAS  376
            QAAKLRR+AA KEKELA+NQ +H K+I+       K   + K+  Y  LILWFW +PV +
Sbjct  63   QAAKLRRLAATKEKELARNQELHGKDIKRSLGPFEKLFLISKVVIYIALILWFWHVPVTT  122

Query  375  VSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            +S+QLV+PFG++LSWRAG +  D V VGIIPWLI+  RVSK ICRK+
Sbjct  123  ISKQLVKPFGKLLSWRAGRYFQDRVAVGIIPWLIVSTRVSKFICRKI  169



>gb|EYU34159.1| hypothetical protein MIMGU_mgv1a019451mg, partial [Erythranthe 
guttata]
Length=141

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  651  KGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQ  472
            KGSMSE D QL+AEI+QLLKEA+ L QPSTFVQAAKLRRMAAAKEKELAKN+ + +K+++
Sbjct  1    KGSMSELDVQLRAEIRQLLKEASSLMQPSTFVQAAKLRRMAAAKEKELAKNEEMDDKDMK  60

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
            + +  + K L + K+ TY +LILWFW++P+ ++S+QLVQPFG++LSWR+G ++ DNV+VG
Sbjct  61   LSFGTYEKLLTISKVLTYVVLILWFWKIPITTISDQLVQPFGKLLSWRSGAYLKDNVVVG  120

Query  291  IIPWLILCIRVSKTICRKVLK  229
             IPWLI+  RVS+ ICRKVL+
Sbjct  121  TIPWLIVSTRVSRFICRKVLE  141



>ref|XP_006414348.1| hypothetical protein EUTSA_v10026376mg [Eutrema salsugineum]
 gb|ESQ55801.1| hypothetical protein EUTSA_v10026376mg [Eutrema salsugineum]
Length=176

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+ APL FF+V VFQ LS++L+  K KGS + K+A+L++EIKQLLKEA+ LSQP+TF QA
Sbjct  10   SLVAPLTFFLVVVFQLLSKWLDQLKKKGSRNTKEAELRSEIKQLLKEASALSQPATFAQA  69

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKLRR AA KEKELA+    HNKE ++ YD + K L   K+  Y +L+ WFWR P+A ++
Sbjct  70   AKLRRSAATKEKELAQYLEQHNKESKLSYDRYGKILLASKVVVYLILVFWFWRTPIAIIA  129

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            +QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK + R
Sbjct  130  KQLVQPFGNLLSWGTGGRLTGHVMVGIIPWLILSTRVSKYVSR  172



>gb|AAM64570.1| unknown [Arabidopsis thaliana]
Length=178

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL FF+V VFQ LS++ +  K KGS + ++++L+ EIKQLL+EA+ LSQP+TF QAA
Sbjct  13   LAAPLTFFVVVVFQLLSKWFDQLKKKGSKNTRESELRTEIKQLLREASALSQPATFAQAA  72

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    H+KEI++ YDM+ K L   K+  Y +L+L FWR P+A +++
Sbjct  73   KLRRSAATKEKELAQYLEQHHKEIKLSYDMYGKGLLASKVVIYLILVLCFWRTPIAIIAK  132

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK +CR
Sbjct  133  QLVQPFGTLLSWGTGGHMTGHVMVGIIPWLILSTRVSKYVCR  174



>ref|XP_010027968.1| PREDICTED: uncharacterized protein LOC104418342 [Eucalyptus grandis]
 gb|KCW54621.1| hypothetical protein EUGRSUZ_I00568 [Eucalyptus grandis]
Length=176

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            EE LE+   S+AAPLVF +V  F  LS + +  K  GS S  +  L+ EI++LLKEA+ L
Sbjct  3    EETLERRG-SVAAPLVFAVVMAFHVLSWWFDRLKKGGSTSAMEVPLRGEIRELLKEASAL  61

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPSTF QAAKLRR+A AKEKELAK Q   +KEI+  YD++ + LF+ K+F YF+LI WF
Sbjct  62   SQPSTFAQAAKLRRLATAKEKELAKIQESRSKEIKNSYDLYLRVLFLTKVFMYFVLICWF  121

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            W+ P+A +S+QLVQPFGR+LSW AG  +  NVMVGIIPWLIL  RVS+ + + +
Sbjct  122  WKAPIAMISQQLVQPFGRLLSWGAGSHLGGNVMVGIIPWLILSTRVSRFVVKHL  175



>ref|XP_009601924.1| PREDICTED: uncharacterized protein LOC104097110 isoform X3 [Nicotiana 
tomentosiformis]
Length=155

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 22/177 (12%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++EK   S+AAP++F IV   Q+LSRY+E+  ++ S++ ++ QL+AEIKQLLKEAN 
Sbjct  1    MEESMEKLEGSVAAPMIFLIVVTVQYLSRYVEINMSRVSVNAEELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN+    K ++  YD H+K L +LK          
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNREKLRKVMKSSYDSHTKTLMILK----------  110

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
                        LVQPFG++LSWRAGG VN+NVMVGIIPWLIL  R+SK ICRK+ K
Sbjct  111  ------------LVQPFGKILSWRAGGHVNENVMVGIIPWLILSTRISKLICRKIFK  155



>emb|CDX90523.1| BnaA03g42580D [Brassica napus]
Length=182

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGS----MSEKDAQLKAEIKQLLKEANVLSQPSTF  559
            +AAPL FF+V  FQ LS++L+  + KGS     + K+A+L++EIKQLL+EA  LSQP+TF
Sbjct  13   LAAPLTFFLVVAFQLLSKWLDQLQKKGSSNNNTNTKEAELRSEIKQLLREATALSQPATF  72

Query  558  VQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVA  379
             QAAKLRR AA KEKELA     HNK+I + YD++   L   K+  Y +L+LWFWR P+A
Sbjct  73   AQAAKLRRSAATKEKELALYVEQHNKDINLSYDLYGNVLNASKVVVYLILVLWFWRTPIA  132

Query  378  SVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
             +++QLVQPFGR+LSW  GG +  +VMVGIIPWLIL  RVSK +C+
Sbjct  133  MIAKQLVQPFGRLLSWGTGGHLTGHVMVGIIPWLILSTRVSKYVCK  178



>ref|XP_009136767.1| PREDICTED: protein GET1-like [Brassica rapa]
Length=181

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSE---KDAQLKAEIKQLLKEANVLSQPSTFV  556
            +AAPL FF+V VFQ LS++L+  + KGS +    K+A+L++EIKQLL+EA  LSQP+TF 
Sbjct  13   LAAPLTFFLVVVFQLLSKWLDQLQKKGSSNNNNTKEAELRSEIKQLLREATALSQPATFA  72

Query  555  QAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVAS  376
            QAAKLRR AA KEKEL+     HNK+I + YD++   L   K+  Y +L+ WFWR P+A 
Sbjct  73   QAAKLRRSAATKEKELSLYVEQHNKDINLSYDLYGNVLIASKVVVYLILVFWFWRTPIAM  132

Query  375  VSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            +++QLVQPFGR+LSW  GG +  +VMVGIIPWLIL  RVSK +C+ V
Sbjct  133  IAKQLVQPFGRLLSWGTGGHLTGHVMVGIIPWLILSTRVSKYVCKFV  179



>ref|XP_009767525.1| PREDICTED: protein GET1-like isoform X3 [Nicotiana sylvestris]
Length=170

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 123/159 (77%), Gaps = 5/159 (3%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++ K   S+AAP++FFIV   Q+LSRY+E+  ++ S++  + QL+AEIKQLLKEAN 
Sbjct  1    MEESMVKLEGSVAAPMIFFIVVAVQYLSRYVEINMSRVSVNAGELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFT-----YF  415
            +SQPSTF QAAKLRRMAAAKE+EL KN     KE++  YD H+K L +LK+       Y 
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNHEKLRKEMKSSYDSHTKTLIILKLLITQFLMYL  120

Query  414  MLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVM  298
            +LI+WFWR+PVAS+ +QLVQPFG++LSWRAGG +N+NVM
Sbjct  121  LLIIWFWRIPVASIPKQLVQPFGKILSWRAGGHMNENVM  159



>ref|XP_009767526.1| PREDICTED: uncharacterized protein LOC104218681 isoform X4 [Nicotiana 
sylvestris]
Length=155

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 123/177 (69%), Gaps = 22/177 (12%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++ K   S+AAP++FFIV   Q+LSRY+E+  ++ S++  + QL+AEIKQLLKEAN 
Sbjct  1    MEESMVKLEGSVAAPMIFFIVVAVQYLSRYVEINMSRVSVNAGELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN     KE++  YD H+K L +LK          
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNHEKLRKEMKSSYDSHTKTLIILK----------  110

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
                        LVQPFG++LSWRAGG +N+NVMVGIIPWLI   RVSK ICRK+ K
Sbjct  111  ------------LVQPFGKILSWRAGGHMNENVMVGIIPWLIFSTRVSKLICRKIFK  155



>ref|XP_003534235.1| PREDICTED: uncharacterized protein LOC100815853 isoform X1 [Glycine 
max]
 ref|XP_006587566.1| PREDICTED: uncharacterized protein LOC100815853 isoform X2 [Glycine 
max]
 ref|XP_006587567.1| PREDICTED: uncharacterized protein LOC100815853 isoform X3 [Glycine 
max]
 gb|KHN38870.1| Tail-anchored protein insertion receptor WRB [Glycine soja]
Length=175

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 134/172 (78%), Gaps = 4/172 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            +EA E+H +S+AAP +FF+V  FQF S +++  K  GS  EK+ +L+ EIK+LLKEA+ L
Sbjct  3    DEASEEHQRSLAAPFIFFVVLAFQFASHWIDHFKKSGSDKEKETKLRGEIKELLKEASSL  62

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPSTF QAAKL+R+AAAKE+ELAK Q +H+K+      ++SK L + K+ TY +L++WF
Sbjct  63   SQPSTFAQAAKLKRLAAAKERELAKCQNLHHKDDA----LYSKVLLISKVLTYLILLIWF  118

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            W +PV+S+S+QLVQPFGR+LSWR GG  N N+MVGIIPWLI+  RVS+ ICR
Sbjct  119  WSVPVSSISQQLVQPFGRLLSWRTGGVQNSNIMVGIIPWLIVSTRVSRFICR  170



>ref|XP_010671627.1| PREDICTED: tail-anchored protein insertion receptor WRB [Beta 
vulgaris subsp. vulgaris]
Length=174

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 126/172 (73%), Gaps = 1/172 (1%)
 Frame = -3

Query  747  LEKHAKSIAAPLVFFIVGVFQFLSRYLELR-KAKGSMSEKDAQLKAEIKQLLKEANVLSQ  571
            ++    S+AAP +F +V + QF+ RY E + +  G+ S ++ +L+AEIKQLLKEA  L+Q
Sbjct  1    MDDDGSSLAAPTIFILVALLQFIPRYFEHQIRNGGATSAEEKKLRAEIKQLLKEAGSLTQ  60

Query  570  PSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWR  391
            PSTF QAAKLRR AAAKEKELAK Q     E +  YD + K +  +K  +Y +L +WFW+
Sbjct  61   PSTFAQAAKLRRTAAAKEKELAKYQEQQMLERKSSYDPYMKYVTPVKALSYLLLGVWFWK  120

Query  390  MPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
             PVA++S++++QPFG+MLSW++GG   + VM+GI+PWL+LC RVSK ICRKV
Sbjct  121  YPVAAISKEILQPFGKMLSWKSGGSSEEKVMIGIVPWLVLCTRVSKLICRKV  172



>emb|CDY09693.1| BnaC07g33680D [Brassica napus]
Length=181

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFL-SRYLELRKAKGSMSE--KDAQLKAEIKQLLKEANVLSQPSTFV  556
            +AAP+ FF+V VFQ L S++L+  K KGS +   K+A+L++EIKQLL+EA  LSQP+TF 
Sbjct  13   LAAPVTFFLVVVFQLLLSKWLDQLKKKGSSNNNTKEAELRSEIKQLLREATALSQPATFA  72

Query  555  QAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVAS  376
            QAAKLRR AA KEKELA     HNK++ + YD++   L V K+  Y +L+LWFWR P+A 
Sbjct  73   QAAKLRRSAATKEKELALYMEKHNKDVNLSYDLYGNVLIVSKVVVYLILVLWFWRTPIAM  132

Query  375  VSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            +++QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK +C+
Sbjct  133  IAKQLVQPFGELLSWGTGGHLAGHVMVGIIPWLILSTRVSKYVCK  177



>ref|XP_008448478.1| PREDICTED: tail-anchored protein insertion receptor WRB [Cucumis 
melo]
Length=179

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E + +H  SIAAP +FFIV  FQFL+R+LE  K  GS S+ + +L+  IKQLL+EA+ LS
Sbjct  6    EGIVEHGSSIAAPFIFFIVIGFQFLARWLEHLKKGGSNSQVELELRKSIKQLLREASTLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRR+AAAKEKELA  Q   NKEI+  Y ++S+ L + K+  Y +L+ WFW
Sbjct  66   QPSTFAQAAKLRRLAAAKEKELANYQESRNKEIKTSYGLYSQVLLISKVIIYIVLVCWFW  125

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            R  VA+V   LVQPFG+ LSW+AGG VND V VGIIPWLIL  RVSK +C+ V
Sbjct  126  RASVATVPHHLVQPFGKFLSWKAGGTVNDYVKVGIIPWLILSTRVSKFVCQVV  178



>ref|XP_010266649.1| PREDICTED: uncharacterized protein LOC104604117 [Nelumbo nucifera]
Length=176

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 1/177 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEEAL+    SIAAP +F IV   Q  S  LE  K KG +S ++ +L+ EIK+LLKEA  
Sbjct  1    MEEALQNRI-SIAAPFIFLIVVALQLASIRLEQLKKKGLVSAEEIELRNEIKKLLKEAGS  59

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            L+ PSTF QAAKLRRMAA+KEKEL K Q   N+  ++ YD H K L ++K   Y  L+ W
Sbjct  60   LTNPSTFAQAAKLRRMAASKEKELQKYQSTKNQSKKLSYDTHVKALMIVKALAYLFLVFW  119

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FW  PVA++S+QL+QPFG+ LS+ AGG +N    VG+IPW+ L  RVS  +C K LK
Sbjct  120  FWGAPVATISQQLLQPFGKALSFGAGGRLNGRTTVGVIPWIALSTRVSNFLCHKFLK  176



>ref|NP_567498.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF58950.1| At4g16444 [Arabidopsis thaliana]
 dbj|BAE99422.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83750.1| uncharacterized protein AT4G16444 [Arabidopsis thaliana]
Length=178

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL F +V VFQ LS++L+  K KGS + ++++L+ EIKQLL+EA+ LSQP+TF QAA
Sbjct  13   LAAPLTFVVVVVFQLLSKWLDQLKKKGSKNTRESELRTEIKQLLREASALSQPATFAQAA  72

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR AA KEKELA+    H+KEI++ YDM+ K L   K+  Y +L+L FWR P+A +++
Sbjct  73   KLRRSAATKEKELAQYLEQHHKEIKLSYDMYGKGLLASKVVIYLILVLCFWRTPIAIIAK  132

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            QLVQPFG +LSW  GG +  +VMVGIIPWLIL  RVSK +CR
Sbjct  133  QLVQPFGTLLSWGTGGHMTGHVMVGIIPWLILSNRVSKYVCR  174



>gb|KDP43767.1| hypothetical protein JCGZ_22394 [Jatropha curcas]
Length=178

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = -3

Query  756  EEALE-KHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE  E +H   +AAP++F +V  F  L+R+LE  + K S S+ D QL+AEIK+LLKEA  
Sbjct  4    EETGEGQHGSYLAAPVIFLVVAFFHLLTRWLEHLRRKASRSDSDVQLRAEIKRLLKEATS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKLRR+AAAKEKELA  Q +  K++++ YD++ K +F+LKI TY +L  W
Sbjct  64   YSQPSTFAQAAKLRRLAAAKEKELANCQEMRKKQMKLSYDLYLKIVFILKIATYVLLTCW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            FWR PVA++S +LVQPFG++LS  AG  +NDNV+VGIIPWLIL  RVSK +C+
Sbjct  124  FWRTPVAAISHKLVQPFGKLLSLGAGHHLNDNVLVGIIPWLILSTRVSKFVCQ  176



>ref|XP_004146176.1| PREDICTED: uncharacterized protein LOC101204142 isoform 2 [Cucumis 
sativus]
 ref|XP_004159742.1| PREDICTED: uncharacterized protein LOC101231527 isoform 2 [Cucumis 
sativus]
 gb|KGN55607.1| hypothetical protein Csa_3G002280 [Cucumis sativus]
Length=177

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E + +H  SIAAP +FFIV  FQFL+++LE  K +GS S+ + +L+  IKQLLKEA+ LS
Sbjct  4    EGIVEHRSSIAAPFIFFIVIGFQFLAKWLEHLKKRGSNSQVEMELRKSIKQLLKEASTLS  63

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRR+AAAKEKELA  Q   NKEI+  Y ++S+ L V K+  + +L+ WFW
Sbjct  64   QPSTFAQAAKLRRLAAAKEKELANYQESRNKEIKTSYGLYSQVLLVSKVIIHIVLVCWFW  123

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            R  VA+V   LVQPFG+ LSWRAGG VND V VGIIPWLIL  RVSK + R V
Sbjct  124  RASVATVPHHLVQPFGKFLSWRAGGTVNDYVKVGIIPWLILSTRVSKFVFRVV  176



>ref|XP_004512266.1| PREDICTED: uncharacterized protein LOC101497483 [Cicer arietinum]
Length=176

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            +E+ ++H  S+AAP +F IV  FQ     L+  K  GS +EK+ QL+ EIK LLKEA++L
Sbjct  3    DESNQEHQISLAAPFIFLIVAAFQSAYYCLDQLKKNGSDNEKENQLRGEIKHLLKEASLL  62

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPSTF QA+KL+R+A  KEKELAK Q +H K++ ++     + + + K  TY ML++WF
Sbjct  63   SQPSTFAQASKLKRLAKVKEKELAKYQNLHRKDLVLYL----RVILIGKYITYGMLVIWF  118

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            WR+PVAS+S QLVQPFGR+LSW+ G   +DN++VGII WLI+  RV + + R
Sbjct  119  WRVPVASISLQLVQPFGRLLSWKTGAIQDDNIVVGIIAWLIVSARVCRYVRR  170



>ref|XP_003516524.1| PREDICTED: uncharacterized protein LOC100790676 [Glycine max]
Length=174

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 124/172 (72%), Gaps = 4/172 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            +EA ++  +S+AAPL+F IV  FQF    L+  K  GS SEK+ QL+AEIKQLLKEAN +
Sbjct  3    DEASQERERSLAAPLIFLIVAAFQFAYYCLDHVKKSGSDSEKEIQLRAEIKQLLKEANSM  62

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            SQPSTF QAAKL+R+A AKE+EL+K Q   +K+       ++K L +LK  TY +L++WF
Sbjct  63   SQPSTFAQAAKLKRLAVAKERELSKYQNSCHKDDA----SYAKVLLILKYLTYGVLLIWF  118

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            WR+PVAS+S QLVQPFG +LSW+  G  N++V +GII WLI+  RV + + R
Sbjct  119  WRVPVASISLQLVQPFGSLLSWKTRGVQNNSVTIGIISWLIVSARVCRFVRR  170



>ref|XP_006470537.1| PREDICTED: uncharacterized protein LOC102629536 isoform X2 [Citrus 
sinensis]
Length=158

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -3

Query  756  EEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S K+ QL+ EIKQLLKEA+ 
Sbjct  4    EETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSGKEIQLRREIKQLLKEASS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKL+R+A AKEKELA  Q  H+KEI M YD++ K L +LK+  YF+LI W
Sbjct  64   FSQPSTFAQAAKLKRLATAKEKELANYQESHSKEIHMSYDLYLKVLRILKVVIYFVLICW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMV  295
            FWR PVA++S+QLVQPFG+ LSW  GG   +NVMV
Sbjct  124  FWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMV  158



>ref|XP_006446301.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
 gb|ESR59541.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
Length=171

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  756  EEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S+K+ QL+ EIKQLLKEA+ 
Sbjct  4    EETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSDKEIQLRREIKQLLKEASS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKL+R+A AKEKELA  Q   +KEI M YD++ K L +LK+  YF+LI W
Sbjct  64   FSQPSTFAQAAKLKRLATAKEKELANYQESQSKEIHMSYDLYVKVLRILKVVIYFVLICW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVM-VGIIPWLILCI  265
            FWR PVA++S+QLVQPFG+ LSW  GG   +NVM  G+ P+ I+ I
Sbjct  124  FWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMDSGVKPFDIIRI  169



>ref|XP_006470538.1| PREDICTED: uncharacterized protein LOC102629536 isoform X3 [Citrus 
sinensis]
Length=158

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -3

Query  756  EEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S K+ QL+ EIKQLLKEA+ 
Sbjct  4    EETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSGKEIQLRREIKQLLKEASS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKL+R+A AKEKELA  Q  H+KEI M YD++ K L +LK+  YF+LI W
Sbjct  64   FSQPSTFAQAAKLKRLATAKEKELANYQESHSKEIHMSYDLYLKVLRILKVVIYFVLICW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVM  298
            FWR PVA++S+QLVQPFG+ LSW  GG   +NVM
Sbjct  124  FWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVM  157



>ref|XP_009601922.1| PREDICTED: uncharacterized protein LOC104097110 isoform X2 [Nicotiana 
tomentosiformis]
Length=159

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++EK   S+AAP++F IV   Q+LSRY+E+  ++ S++ ++ QL+AEIKQLLKEAN 
Sbjct  1    MEESMEKLEGSVAAPMIFLIVVTVQYLSRYVEINMSRVSVNAEELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN+    K ++  YD H+K L +LK+  Y +LI+W
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNREKLRKVMKSSYDSHTKTLMILKVLMYLLLIIW  120

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGF  316
            FWR+PVAS+ +QLVQPFG +LS    GF
Sbjct  121  FWRIPVASIPKQLVQPFGNVLSSSILGF  148



>ref|XP_006446300.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
 gb|ESR59540.1| hypothetical protein CICLE_v10016602mg [Citrus clementina]
Length=223

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = -3

Query  756  EEALEKH-AKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            EE L +H + S AAPL+  +V  FQF+S++L+  K +G+ S+K+ QL+ EIKQLLKEA+ 
Sbjct  4    EETLAQHRSSSFAAPLILLLVLAFQFVSKWLDQLKKRGARSDKEIQLRREIKQLLKEASS  63

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
             SQPSTF QAAKL+R+A AKEKELA  Q   +KEI M YD++ K L +LK+  YF+LI W
Sbjct  64   FSQPSTFAQAAKLKRLATAKEKELANYQESQSKEIHMSYDLYVKVLRILKVVIYFVLICW  123

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
            FWR PVA++S+QLVQPFG+ LSW  GG   +NVMV 
Sbjct  124  FWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMVN  159



>ref|XP_003629131.1| hypothetical protein MTR_8g073600 [Medicago truncatula]
Length=342

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 4/154 (3%)
 Frame = -3

Query  744  EKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPS  565
            E+H +S AAPL+F IV  FQF S +++  K  GS  EK+ QL+AEIK+LLKEA+ LSQPS
Sbjct  4    EEHERSFAAPLIFLIVLAFQFASYWIDQFKQSGSEKEKETQLRAEIKELLKEASSLSQPS  63

Query  564  TFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMP  385
            TF QAAKLRR AAAKEKELAK   +H+++      ++SK LF  K+ T+  L++WFW  P
Sbjct  64   TFAQAAKLRRQAAAKEKELAKCHNLHDEDTA----LYSKVLFSTKVLTHLTLLIWFWSTP  119

Query  384  VASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIP  283
            VAS+S+QLVQPFGR+LSW+ GG  N+N+M  + P
Sbjct  120  VASISQQLVQPFGRLLSWKTGGLQNNNIMDNLFP  153



>ref|XP_003538910.1| PREDICTED: uncharacterized protein LOC100778654 [Glycine max]
Length=176

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            +E  ++  +S+AAPL+F IV VF+F    L+  +K  GS SEK+ QL+AEIKQLLKEA+ 
Sbjct  3    DEISQERERSLAAPLIFLIVAVFKFAYYCLDHAKKKSGSDSEKEIQLRAEIKQLLKEASS  62

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKL+R+A AKE+EL+K Q   +K+    Y   +K L +LK  TY +L++W
Sbjct  63   MSQPSTFAQAAKLKRLAVAKERELSKYQNSSHKDDNASY---TKVLLILKYLTYGVLLIW  119

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            FWR+PVAS+S QLVQPFG +LSW+  G  N+++ +GII WL++  RV + + R
Sbjct  120  FWRVPVASISLQLVQPFGCLLSWKTRGVQNNSIAIGIISWLLVSARVCRFVRR  172



>ref|XP_007156237.1| hypothetical protein PHAVU_003G269900g [Phaseolus vulgaris]
 ref|XP_007156238.1| hypothetical protein PHAVU_003G269900g [Phaseolus vulgaris]
 gb|ESW28231.1| hypothetical protein PHAVU_003G269900g [Phaseolus vulgaris]
 gb|ESW28232.1| hypothetical protein PHAVU_003G269900g [Phaseolus vulgaris]
Length=177

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            ++  E++ +S+AAP +FF+V  F F S+ +   K  GS  EK+A+L  EIK+LLKEA+ L
Sbjct  5    DKTSEENQRSLAAPFIFFVVLAFHFASQRINQSKKSGSDKEKEAELHREIKELLKEASSL  64

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            +QPSTF Q AKL+R AAAKEKELAK Q +H K+  +    +SK L + K+ TY + ++WF
Sbjct  65   AQPSTFAQGAKLKRKAAAKEKELAKFQNLHVKDTAL----YSKFLLISKVLTYLIFLMWF  120

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            W +PVAS+S+QLVQPFGR+LSWR GG  N+N+MVGIIPWLI   RVS+ +CR
Sbjct  121  WSVPVASISQQLVQPFGRLLSWRTGGIENNNIMVGIIPWLIASTRVSRFVCR  172



>ref|XP_007138454.1| hypothetical protein PHAVU_009G210400g [Phaseolus vulgaris]
 gb|ESW10448.1| hypothetical protein PHAVU_009G210400g [Phaseolus vulgaris]
Length=175

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            +E      +S+AAPL+F IV  FQF    L+ + K  GS  EK+ +L+AEIKQLLKEA+ 
Sbjct  3    DEGSHVRERSLAAPLIFLIVAAFQFAYYCLDHVAKQSGSDREKEDRLRAEIKQLLKEASS  62

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF +AAKL+R+A AKE+EL+K +   +K+    Y ++SK + + K  TY ML++W
Sbjct  63   MSQPSTFARAAKLKRLATAKERELSKYRHSSHKD----YAVYSKVVLIFKYLTYAMLLMW  118

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            FWR+PVASV  QLVQPFG +LSW++GG  +++  +GII WL++C RV + + R   K
Sbjct  119  FWRVPVASVHRQLVQPFGSLLSWKSGGVQSNSAPIGIISWLVICARVCRFVRRAYSK  175



>gb|KHN41820.1| Tail-anchored protein insertion receptor WRB [Glycine soja]
Length=176

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            +E  ++  +S+AAPL+F IV VF+F    L+  +K  GS SEK+ QL+AEIKQLLKEA+ 
Sbjct  3    DEISQERERSLAAPLIFLIVAVFKFAYYCLDHAKKKSGSDSEKEIQLRAEIKQLLKEASS  62

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKL+R+A AKE+EL+K Q   +K+    Y   +K L +LK  TY +L++W
Sbjct  63   MSQPSTFAQAAKLKRLAVAKERELSKYQNSSHKDDNASY---TKVLLILKYLTYGVLLIW  119

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            FWR+PVAS+S QLVQPFG  LSW+  G  N++V +GII WL++  RV + + R
Sbjct  120  FWRVPVASISLQLVQPFGCFLSWKTRGVQNNSVAIGIISWLLVSARVCRFVRR  172



>ref|XP_008352412.1| PREDICTED: uncharacterized protein LOC103415908 [Malus domestica]
Length=167

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 114/171 (67%), Gaps = 13/171 (8%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L +H   ++AP+VF IV  FQF SR+LE  K KG  S    +L+ EIK +LKE ++  
Sbjct  6    ETLPEHRSLLSAPIVFIIVVAFQFFSRWLEQLK-KGVKSATATRLRGEIKDILKEVSLTH  64

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            Q            +  +       +Q +H KEI++ YD++ + LF+LK+ TY +L+ WFW
Sbjct  65   Q------------VKDSNSGTCLPDQELHGKEIKLSYDVYLRILFILKVLTYVVLVCWFW  112

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PV S+S+QLVQPFG+M+SWRAGG VN+NVMVGIIPWLIL  RVSK ICR
Sbjct  113  RVPVGSISQQLVQPFGKMISWRAGGVVNENVMVGIIPWLILSTRVSKFICR  163



>ref|XP_010547400.1| PREDICTED: uncharacterized protein LOC104819160 [Tarenaya hassleriana]
Length=178

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E+L        APL FFIV +FQ LS++L+  K  GS +  +A+L++EIK+LLKEA   S
Sbjct  4    ESLVHSRVHFVAPLSFFIVVLFQLLSKWLDRLKKNGSRNTGEAELRSEIKRLLKEAGTFS  63

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            +PSTF QAAKLRR+AAAKEKELAK   +  +EI + Y+++ K LFV K   Y   + WFW
Sbjct  64   EPSTFAQAAKLRRLAAAKEKELAKCLELQKREINLSYELYGKVLFVSKAVIYISWVFWFW  123

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            R P+A V +QLVQPFGR++SW AGG ++ +VMVGIIPWLIL  RVSK +CR +
Sbjct  124  RSPIAIVPKQLVQPFGRLISWGAGGELSGHVMVGIIPWLILSTRVSKYVCRAI  176



>ref|XP_008337938.1| PREDICTED: uncharacterized protein LOC103401013 [Malus domestica]
Length=167

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 113/171 (66%), Gaps = 13/171 (8%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L +H   + AP+VF IV  FQF SR+LE  K KG  S    +L+ EIK +LKE ++  
Sbjct  6    ETLPEHRSLLXAPIVFIIVVAFQFFSRWLEQLK-KGVKSATATRLRGEIKDILKEVSLTH  64

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            Q            +  +       +Q +H KEI++ YD++ + LF+LK+ TY +L+ WFW
Sbjct  65   Q------------VKDSNSGTCLPDQELHGKEIKLSYDVYLRILFILKVLTYVVLVCWFW  112

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            R+PV S+S+QLVQPFG+M+SWRAGG VN+NVMVGIIPWLIL  RVSK ICR
Sbjct  113  RVPVGSISQQLVQPFGKMISWRAGGVVNENVMVGIIPWLILSTRVSKFICR  163



>ref|XP_009392861.1| PREDICTED: tail-anchored protein insertion receptor WRB-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 118/178 (66%), Gaps = 1/178 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPL-VFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEAN  583
            M+        +  +PL +F +V V Q L   LEL K KG  S ++ QL+ EIKQLLKEA+
Sbjct  1    MDGGTSGGGDAFLSPLFIFLLVVVLQTLDGLLELVKRKGMKSAEEVQLRKEIKQLLKEAS  60

Query  582  VLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLIL  403
             LS PSTF Q+AKLRR+AAAKEKEL K Q  HNKE    Y++  + L V K+  Y  L+L
Sbjct  61   SLSTPSTFAQSAKLRRLAAAKEKELLKKQEEHNKEKSWSYELCGRALLVSKVLLYAALVL  120

Query  402  WFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
             FW +PVA+V + L+QPFG++LSWRAG  V   +MVG++PWL+L  RVSK   +K+ K
Sbjct  121  RFWGVPVAAVPQHLLQPFGKILSWRAGDAVTGQIMVGMVPWLVLTSRVSKFFWQKLSK  178



>ref|XP_004957569.1| PREDICTED: uncharacterized protein LOC101779546 isoform X2 [Setaria 
italica]
Length=173

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF +V   Q L  YL+L K +GS SE+  +L+ EIKQLL EAN LS PSTF QA
Sbjct  2    SLAAIFVFVLVFALQLLDGYLDLAKKRGSQSEEQIKLRLEIKQLLTEANQLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+A AKEKEL K Q    K  Q  YD + K + V K+  Y +L+LWFW  PV +V 
Sbjct  62   AKLKRLAVAKEKELGKIQEQDTKGTQSLYDKYGKFMLVTKVLIYALLVLWFWSTPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRK  238
              L+QPFG+M S R       +V+VGI+PWL L  RVSK +C+K
Sbjct  122  RHLLQPFGKMFSLRGVDSATGHVVVGILPWLFLTSRVSKLLCQK  165



>ref|XP_009418672.1| PREDICTED: uncharacterized protein LOC103998811 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=215

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 116/170 (68%), Gaps = 1/170 (1%)
 Frame = -3

Query  735  AKSIAAPL-VFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTF  559
               + +PL +FFIV V Q L   L+  K KG  S ++ QL+ EIKQLLKEA+ LS PSTF
Sbjct  41   GSGLLSPLFIFFIVVVLQTLDGLLDFVKRKGIHSAEEVQLRKEIKQLLKEASSLSTPSTF  100

Query  558  VQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVA  379
             Q+AKLRR+AAAKEKEL + Q  H KE   +Y++  + L V+K+  Y  L+L FW +PVA
Sbjct  101  AQSAKLRRLAAAKEKELLRKQEEHRKEKSWFYELCGRVLLVIKVLLYATLVLQFWGVPVA  160

Query  378  SVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK  229
            +V   L+QPFG++LSWRAG      +MVG++PWLIL  RVSK + +K+ K
Sbjct  161  AVPHHLLQPFGKILSWRAGNSATGQIMVGMVPWLILTSRVSKFLWQKLSK  210



>ref|XP_010557417.1| PREDICTED: uncharacterized protein LOC104826422 [Tarenaya hassleriana]
Length=181

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = -3

Query  720  APLVFFIVGVFQFLSRYLELRKAKGSMSE--KDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            APL FF+V +F+FLS +L+  K KGS +   ++ +L++EIK LLKEA+  SQPSTF QAA
Sbjct  16   APLTFFLVVLFRFLSMWLDQVKKKGSSTSNTREDELRSEIKMLLKEASSFSQPSTFAQAA  75

Query  546  KLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSE  367
            KLRR+AAAKE+ELAK Q    KEI   YD++ K L V K+  Y  L +WFWR P+A VS+
Sbjct  76   KLRRLAAAKERELAKFQEQDKKEINQCYDLYGKVLLVSKVVIYISLGVWFWRTPIAIVSK  135

Query  366  QLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            QLVQPFG  LS   GG +N +VMVGI PWLIL  RVSK +CR V
Sbjct  136  QLVQPFGSFLSLGTGGHLNGHVMVGIAPWLILSTRVSKYVCRVV  179



>ref|XP_006587568.1| PREDICTED: uncharacterized protein LOC100815853 isoform X4 [Glycine 
max]
Length=143

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 109/136 (80%), Gaps = 4/136 (3%)
 Frame = -3

Query  648  GSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQM  469
            GS  EK+ +L+ EIK+LLKEA+ LSQPSTF QAAKL+R+AAAKE+ELAK Q +H+K+   
Sbjct  7    GSDKEKETKLRGEIKELLKEASSLSQPSTFAQAAKLKRLAAAKERELAKCQNLHHKD---  63

Query  468  WYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGI  289
               ++SK L + K+ TY +L++WFW +PV+S+S+QLVQPFGR+LSWR GG  N N+MVGI
Sbjct  64   -DALYSKVLLISKVLTYLILLIWFWSVPVSSISQQLVQPFGRLLSWRTGGVQNSNIMVGI  122

Query  288  IPWLILCIRVSKTICR  241
            IPWLI+  RVS+ ICR
Sbjct  123  IPWLIVSTRVSRFICR  138



>ref|XP_006855737.1| hypothetical protein AMTR_s00044p00161930 [Amborella trichopoda]
 gb|ERN17204.1| hypothetical protein AMTR_s00044p00161930 [Amborella trichopoda]
Length=183

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  744  EKHAKS--IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQ  571
            E+H  S  IAAPL+FF +     L+++L   K +GS + +  +L+ EIKQLLKEA+ L  
Sbjct  4    ERHQASSDIAAPLIFFFILALHLLTQFLGHIKKRGSQNIELIKLRQEIKQLLKEASSLLV  63

Query  570  PSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMW-YDMHSKCLFVLKIFTYFMLILWFW  394
            PSTF +AAKLRR+AA KEKEL + Q    K+ ++W +D +   L ++K   YF LI WFW
Sbjct  64   PSTFAKAAKLRRVAAEKEKELLRIQKSQEKD-KLWAFDFYLGSLQIVKTCAYFGLIWWFW  122

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
             +PVA +S QL+ PFGR+LSW+AG   ++ + VGIIPWLIL  RVS  +C+KV
Sbjct  123  GVPVAVISRQLLDPFGRLLSWKAGDSTSNQIKVGIIPWLILTSRVSTFLCQKV  175



>ref|XP_008781300.1| PREDICTED: uncharacterized protein LOC103701105 isoform X1 [Phoenix 
dactylifera]
Length=179

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQG  493
            ++E  + +G  S ++ QL+ EIKQLLKEA  LS P+TF QAAKLRRMAA KEKEL+K   
Sbjct  25   FVEFLRKRGLRSHEEVQLRQEIKQLLKEAGKLSTPTTFAQAAKLRRMAATKEKELSKKHE  84

Query  492  IHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFV  313
             H+KE +  YD  ++ L +LK+  Y  L   FW +PVA+V + L+QPFGR LSWR+G   
Sbjct  85   EHSKEKRWSYDTFARALLILKVILYVGLSWHFWGVPVAAVPQHLLQPFGRFLSWRSGDAA  144

Query  312  NDNVMVGIIPWLILCIRVSKTICRKVLK  229
               VMVGI+PWL+L  RVSK +C+K+ K
Sbjct  145  TGQVMVGILPWLVLTNRVSKFLCQKLSK  172



>gb|AFW85445.1| hypothetical protein ZEAMMB73_513382 [Zea mays]
Length=173

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S +A  VF +V     L   L+L++ +GS+S+   +L+ EI QLLKEA+ LS PSTF QA
Sbjct  2    SPSAIFVFLLVSAVHMLECILDLKRRRGSISDDQLRLRVEITQLLKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+A AKEKELAK Q +  +  Q  Y+ + K L   K+  Y +L+LWFW  PV +V 
Sbjct  62   AKLKRLAGAKEKELAKMQDVDIRGKQSLYEKYRKVLLAAKVVVYGVLVLWFWSTPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFGRM SWR        V+VGI+PWL L  RVSK +  K+
Sbjct  122  KHLLQPFGRMFSWRGVDASTGRVVVGILPWLFLTSRVSKLLSEKL  166



>ref|XP_010935301.1| PREDICTED: uncharacterized protein LOC105055231 isoform X1 [Elaeis 
guineensis]
Length=184

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQG  493
            ++E  + +G  S ++ QL+ EIK+LLKEA  LS PSTF QAAKLRRMAA KEKEL+K   
Sbjct  30   FVEFLRKRGLRSSEEVQLRQEIKELLKEAGKLSTPSTFAQAAKLRRMAATKEKELSKKHE  89

Query  492  IHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFV  313
             ++KE +  YDM ++ L +LK+  Y  L   FW +PVA V + L+QPFG  LSWR+G   
Sbjct  90   EYSKEKRWSYDMFARALLILKVILYIGLTWHFWGVPVAEVPQHLLQPFGSFLSWRSGNPA  149

Query  312  NDNVMVGIIPWLILCIRVSKTICRKVLK  229
               VMVGIIPWL+L  RVSK +C+K+ K
Sbjct  150  TGQVMVGIIPWLVLTNRVSKFLCQKLSK  177



>ref|XP_009767527.1| PREDICTED: uncharacterized protein LOC104218681 isoform X5 [Nicotiana 
sylvestris]
Length=143

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 105/154 (68%), Gaps = 22/154 (14%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE++ K   S+AAP++FFIV   Q+LSRY+E+  ++ S++  + QL+AEIKQLLKEAN 
Sbjct  1    MEESMVKLEGSVAAPMIFFIVVAVQYLSRYVEINMSRVSVNAGELQLRAEIKQLLKEANA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF QAAKLRRMAAAKE+EL KN     KE++  YD H+K L +LK          
Sbjct  61   MSQPSTFAQAAKLRRMAAAKEQELVKNHEKLRKEMKSSYDSHTKTLIILK----------  110

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVM  298
                        LVQPFG++LSWRAGG +N+NVM
Sbjct  111  ------------LVQPFGKILSWRAGGHMNENVM  132



>gb|ACG26961.1| hypothetical protein [Zea mays]
 tpg|DAA62637.1| TPA: hypothetical protein ZEAMMB73_284787 [Zea mays]
Length=173

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF IV   Q L RYL+L +  G +S++  +++ EIKQLLKEA+ LS PSTF QA
Sbjct  2    SLAAIFVFLIVSALQLLYRYLDLARKSGGLSDEQIKVRLEIKQLLKEADQLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q    K  Q  YD ++K L V K+  Y +L+L FW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKMQEHDLKGKQSLYDKYTKFLLVTKVIIYAVLVLCFWSTPVTAVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFG+M SWR       NV+VGI+PWL L  RVSK +C+K+
Sbjct  122  QHLLQPFGKMFSWRGVDTATGNVVVGILPWLFLTSRVSKMLCQKL  166



>ref|NP_001144064.1| uncharacterized protein LOC100276891 precursor [Zea mays]
 gb|ACG37677.1| hypothetical protein [Zea mays]
Length=173

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF +V   Q L RYL+L +  G +S++  +++ EIKQLLKEA+ LS PSTF QA
Sbjct  2    SLAAIFVFLLVSALQLLDRYLDLARKSGGLSDEQIKVRLEIKQLLKEADQLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q    K  Q  YD ++K L V K+  Y +L+L FW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKMQEHDLKGKQSLYDKYTKFLSVTKVIIYAVLVLCFWSTPVTAVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFG+M SWR       NV+VGI+PWL L  RVSK +C+K+
Sbjct  122  QHLLQPFGKMFSWRCVDTATGNVVVGILPWLFLTSRVSKMLCQKL  166



>gb|ACN37033.1| unknown [Zea mays]
Length=173

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 112/165 (68%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF IV   Q L RYL+L +  G +S++  +++ EIKQLLKEA+ LS PSTF QA
Sbjct  2    SLAAIFVFLIVSALQLLYRYLDLARKSGGLSDEQIKVRLEIKQLLKEADQLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q    K  Q  YD ++K L V K+  Y +L+L  W  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKMQEHDLKGKQSLYDKYTKFLLVTKVIIYAVLVLCLWSTPVTAVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFG+M SWR       NV+VGI+PWL L  RVSK +C+K+
Sbjct  122  QHLLQPFGKMFSWRGVDTATGNVVVGILPWLFLTSRVSKMLCQKL  166



>ref|XP_008812335.1| PREDICTED: tail-anchored protein insertion receptor WRB-like 
[Phoenix dactylifera]
Length=180

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQG  493
            ++E  + +G  S ++ QL+ EI+QLLKEA  LS PSTF Q  KL+R AAAKEKEL+K   
Sbjct  30   FVEFLRKRGLRSNEEFQLRQEIEQLLKEAGKLSMPSTFAQVVKLKRAAAAKEKELSKRHE  89

Query  492  IHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFV  313
             ++KE +  YDM ++ L VLK+  Y  LI  FW +PVA+V + L+QPFGR LS R+G  V
Sbjct  90   EYSKEKKWSYDMFARALLVLKVILYAGLIWHFWGVPVAAVPQHLLQPFGRFLSCRSGDAV  149

Query  312  NDNVMVGIIPWLILCIRVSKTICRKV  235
               +MVGIIPWL+L  +VSK +C+K+
Sbjct  150  TGQIMVGIIPWLLLATQVSKFLCQKL  175



>ref|NP_001057061.1| Os06g0198700 [Oryza sativa Japonica Group]
 dbj|BAD36639.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18975.1| Os06g0198700 [Oryza sativa Japonica Group]
 gb|EAZ00039.1| hypothetical protein OsI_22040 [Oryza sativa Indica Group]
 gb|EAZ36149.1| hypothetical protein OsJ_20459 [Oryza sativa Japonica Group]
 dbj|BAG87269.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF +V   Q L + L+L K +GS+++   +L+ EI Q+LKEA+ LS PSTF QA
Sbjct  2    SLAATFVFLLVSALQMLDQVLDLVKKRGSITDDQLKLRLEITQILKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q    K  Q  Y+ + + +   K+  Y +LILWFW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKLQQQDIKGKQSLYNQYGRVMLFSKVLIYGLLILWFWSAPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFGRM SWR        V+VGIIPWL+L  RVSK +C+K+
Sbjct  122  KHLLQPFGRMFSWRGVDAATGRVVVGIIPWLLLTSRVSKLLCQKL  166



>ref|XP_004146175.1| PREDICTED: uncharacterized protein LOC101204142 isoform 1 [Cucumis 
sativus]
 ref|XP_004159741.1| PREDICTED: uncharacterized protein LOC101231527 isoform 1 [Cucumis 
sativus]
Length=187

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -3

Query  651  KGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQ  472
            +GS S+ + +L+  IKQLLKEA+ LSQPSTF QAAKLRR+AAAKEKELA  Q   NKEI+
Sbjct  48   RGSNSQVEMELRKSIKQLLKEASTLSQPSTFAQAAKLRRLAAAKEKELANYQESRNKEIK  107

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
              Y ++S+ L V K+  + +L+ WFWR  VA+V   LVQPFG+ LSWRAGG VND V VG
Sbjct  108  TSYGLYSQVLLVSKVIIHIVLVCWFWRASVATVPHHLVQPFGKFLSWRAGGTVNDYVKVG  167

Query  291  IIPWLILCIRVSKTICRKV  235
            IIPWLIL  RVSK + R V
Sbjct  168  IIPWLILSTRVSKFVFRVV  186



>ref|XP_011022172.1| PREDICTED: uncharacterized protein LOC105124035 isoform X2 [Populus 
euphratica]
 ref|XP_011022173.1| PREDICTED: uncharacterized protein LOC105124035 isoform X2 [Populus 
euphratica]
Length=159

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  744  EKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPS  565
            E+  +S+AAPL+FFIV  FQF+S YL   K KGS S  + QL+AEIKQLLK+A+ LSQPS
Sbjct  10   EQPRRSLAAPLIFFIVVTFQFVSIYLHQLKKKGSKSAAEIQLRAEIKQLLKDASALSQPS  69

Query  564  TFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMP  385
            TF QAAKLRR+AAAKEKELA  +  H+K +++  D + K LF+ K+ TYF+LI WFWR P
Sbjct  70   TFAQAAKLRRLAAAKEKELANYKEAHDKGMKLSSDSYPKILFISKVVTYFVLICWFWRTP  129

Query  384  VASVSEQLVQPFG  346
            VA +S+QLVQPFG
Sbjct  130  VAEISQQLVQPFG  142



>ref|XP_009418673.1| PREDICTED: uncharacterized protein LOC103998811 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=179

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = -3

Query  720  APL-VFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAK  544
            +PL +FFIV V Q L   L+  K KG  S ++ QL+ EIKQLLKEA+ LS PSTF Q+AK
Sbjct  12   SPLFIFFIVVVLQTLDGLLDFVKRKGIHSAEEVQLRKEIKQLLKEASSLSTPSTFAQSAK  71

Query  543  LRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQ  364
            LRR+AAAKEKEL + Q  H KE   +Y++  + L V+K+  Y  L+L FW +PVA+V   
Sbjct  72   LRRLAAAKEKELLRKQEEHRKEKSWFYELCGRVLLVIKVLLYATLVLQFWGVPVAAVPHH  131

Query  363  LVQPFGRMLSWRAGGFVNDNVM  298
            L+QPFG++LSWRAG      +M
Sbjct  132  LLQPFGKILSWRAGNSATGQIM  153



>ref|XP_004964583.1| PREDICTED: uncharacterized protein LOC101782131 [Setaria italica]
Length=173

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 110/165 (67%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF +V   Q L   L+L + +GS+S++  +L+ EI Q+LKEA+ LS PSTF QA
Sbjct  2    SLAAIFVFLLVSALQMLDGVLDLARRRGSLSDEQLKLRMEITQILKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q ++ K  +  Y+ + K L + K+  Y  L+LWFW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKIQDLNIKGKESLYEQYGKVLLITKVLIYGALVLWFWSTPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFGR+ SWR        V+VGI+PWL L  RVSK +  K+
Sbjct  122  KHLLQPFGRLFSWRGVDAATGRVVVGILPWLFLTSRVSKLLSEKL  166



>ref|XP_004957568.1| PREDICTED: uncharacterized protein LOC101779546 isoform X1 [Setaria 
italica]
Length=183

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S+AA  VF +V   Q L  YL+L K +GS SE+  +L+ EIKQLL EAN LS PSTF QA
Sbjct  2    SLAAIFVFVLVFALQLLDGYLDLAKKRGSQSEEQIKLRLEIKQLLTEANQLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+A AKEKEL K Q    K  Q  YD + K + V K+  Y +L+LWFW  PV +V 
Sbjct  62   AKLKRLAVAKEKELGKIQEQDTKGTQSLYDKYGKFMLVTKVLIYALLVLWFWSTPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVG  292
              L+QPFG+M S R       +V+V 
Sbjct  122  RHLLQPFGKMFSLRGVDSATGHVVVN  147



>ref|XP_003564144.1| PREDICTED: uncharacterized protein LOC100836937 [Brachypodium 
distachyon]
Length=173

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 109/165 (66%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            ++AA  VF +V     L R L++ + +GS+S++  +L+ EI ++LK A++LS PSTF QA
Sbjct  2    ALAAIFVFLLVSALHVLDRMLDIARKRGSLSDEQLRLRVEITEILKNASLLSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q    +  Q  +D + K L + K  TY  L+LWFW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKLQQQDIQGKQSLHDKYGKVLLIAKGLTYGALVLWFWSAPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFGRM SWR       +V+VGIIPWL L  RVSK +  K+
Sbjct  122  KHLLQPFGRMFSWRGVDAATGHVVVGIIPWLFLTSRVSKLLSEKL  166



>dbj|BAJ86747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            ++AA  VF +V     L   L+L K +GS+S++  +L+ EI Q+LKE++ LS PSTF QA
Sbjct  2    ALAAIFVFLLVCAVHVLESMLDLAKKRGSVSDEQLKLRLEISQILKESSALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKEL+K Q    K  Q  ++ + K L   K+  Y +L+LWFW  PV +V 
Sbjct  62   AKLKRLAAAKEKELSKMQQTDIKGKQSLHEKYGKVLMGTKVLVYGLLVLWFWSAPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFGRM SWR        V+VGI+PWL L  RVSK + +K+
Sbjct  122  KHLLQPFGRMFSWRGVDAATGRVVVGIMPWLFLTSRVSKLLSQKL  166



>ref|XP_006340836.1| PREDICTED: uncharacterized protein LOC102593949 isoform X2 [Solanum 
tuberosum]
Length=133

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+     +S+AAP++F IV   QFLSR  E+ K KGS S +D QL+AE+KQLLKEA+ 
Sbjct  1    MEESTANLERSVAAPMIFIIVLALQFLSRLFEINKKKGSTSSEDMQLRAEMKQLLKEASA  60

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLK  430
            LSQPSTF QAAKLRR+A AKEKELAKNQ IHNKE ++ +D ++K L + +
Sbjct  61   LSQPSTFAQAAKLRRLATAKEKELAKNQEIHNKEAKLSHDSYTKGLTIFQ  110



>ref|XP_008346560.1| PREDICTED: uncharacterized protein LOC103409514 [Malus domestica]
Length=100

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  501  NQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAG  322
            +Q +H KE ++ YD++ + LF+LK+ TY +L+ WFWR+PVAS+S+QLVQPFG+++SWRAG
Sbjct  10   DQELHGKETKLSYDLYQRILFILKVLTYIVLVCWFWRVPVASISQQLVQPFGKLISWRAG  69

Query  321  GFVNDNVMVGIIPWLILCIRVSKTICR  241
            G VN+NVMVGIIPWLIL  RVSK +CR
Sbjct  70   GVVNENVMVGIIPWLILSTRVSKFVCR  96



>ref|XP_002436643.1| hypothetical protein SORBIDRAFT_10g006470 [Sorghum bicolor]
 gb|EER88010.1| hypothetical protein SORBIDRAFT_10g006470 [Sorghum bicolor]
Length=173

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S +A  VF +V     L   L+L K +GS+S++  +L+ +I +LLKEA+ LS PSTF QA
Sbjct  2    SPSAIFVFLLVSALHMLECILDLVKRRGSISDEQLKLRVQITELLKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEKELAK Q ++ K  Q  Y+ + K L   K+  Y + ILWFW  PV +V 
Sbjct  62   AKLKRLAAAKEKELAKMQELNIKGKQSLYEQYGKALLATKVLIYVVFILWFWSTPVTTVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            + L+QPFG M SWR        V+VGI+PWL L   VSK +  K+
Sbjct  122  KHLLQPFGWMFSWRGVDASTGRVVVGILPWLFLTSHVSKLLSEKL  166



>ref|XP_006656737.1| PREDICTED: tail-anchored protein insertion receptor WRB-like 
[Oryza brachyantha]
Length=218

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -3

Query  651  KGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQ  472
            +GS++++  +L+ EI Q+LKEA+ LS PSTF QAAKL+R+AAAKEKELAK Q    K  Q
Sbjct  73   RGSITDQQLKLRLEITQILKEASALSTPSTFAQAAKLKRLAAAKEKELAKLQEQDIKGKQ  132

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
              Y+ + + L   K+  Y +LILWFW +PV +V + L+QPFGRM SWR       +VMVG
Sbjct  133  SLYNQYGRVLLFTKVLIYGLLILWFWSVPVTTVPKHLLQPFGRMFSWRGVDAATGHVMVG  192

Query  291  IIPWLILCIRVSKTICRKV  235
            I+PWL L  RVSK +C+K+
Sbjct  193  ILPWLFLTSRVSKLLCQKL  211



>gb|EMS68308.1| hypothetical protein TRIUR3_11512 [Triticum urartu]
Length=172

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            ++AA  VF +V     L   L+L K +GS+S++  +L+  I QLLKE++ LS PSTF QA
Sbjct  2    ALAAIFVFLLVCAVHVLESMLDLAKKRGSVSDEQVKLRVAITQLLKESSALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVS  370
            AKL+R+AAAKEK+LAK Q    K  Q  ++ + K L   K+  Y +L+L FW  PVA+V 
Sbjct  62   AKLKRLAAAKEKDLAKLQQSDIKGKQSQHEKYGKVLKATKVLVYGLLVLSFWSAPVATVP  121

Query  369  EQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
              L+QPFGRM SW+        V+VGI+PWL L  RVSK + +K+
Sbjct  122  NHLLQPFGRMFSWKGVDAATGRVVVGIMPWLFLTSRVSKLLSQKL  166



>ref|XP_008392459.1| PREDICTED: uncharacterized protein LOC103454631 isoform X2 [Malus 
domestica]
Length=177

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  H  S AAP VF +V  FQFLSR+LE  K  G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLSAHRNSFAAPAVFIVVVAFQFLSRWLEQLKKGGVKNATATRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIF  424
            QPSTF QAAKLRRMAAAKEKELA  Q +H KE ++ YD++ + LF+LK++
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELANYQELHGKETKLSYDLYQRILFILKVY  115



>ref|XP_007046511.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX90668.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=154

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 103/171 (60%), Gaps = 24/171 (14%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E LE+  +S+AAPL+FFI+ VFQF +++L+  K   S ++K+ QL+ EIKQLLKEA  LS
Sbjct  5    ETLEQR-RSLAAPLIFFIIVVFQFATKWLQDLKKGASKTDKEIQLRGEIKQLLKEAASLS  63

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFW  394
            QPSTF QAAKLRR AAAKEKELA     HN        +    L VL++   F +     
Sbjct  64   QPSTFAQAAKLRRSAAAKEKELA---NCHN--------LSCANLLVLEVSCCFRV-----  107

Query  393  RMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
                A++ E ++     +  W  G F      VGIIPWLILC RVSK +CR
Sbjct  108  SATCATLWEDVI-----LEDW--GFFKQQCHGVGIIPWLILCTRVSKFVCR  151



>ref|XP_009369806.1| PREDICTED: uncharacterized protein LOC103959182 [Pyrus x bretschneideri]
Length=115

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  H  S AAP+VF +V  FQFLSR+LE  K  G  S    +L+ EIK LLKEA+ LS
Sbjct  7    ETLPAHRSSFAAPIVFIVVVAFQFLSRWLEQLKKGGVKSATATRLRGEIKGLLKEASSLS  66

Query  573  QPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLK  430
            QPSTF QA KLRRMAAAKEKELA  Q +H+KEI++  D++ + LF+LK
Sbjct  67   QPSTFAQAVKLRRMAAAKEKELANYQELHSKEIKLSNDLYLRILFILK  114



>gb|EMT10208.1| hypothetical protein F775_29686 [Aegilops tauschii]
Length=230

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = -3

Query  651  KGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQ  472
            +GS+S++  +L+  I QLLKE++ LS PSTF QAAKL+R+AAAKEKELAK Q    K  Q
Sbjct  86   RGSVSDEQVKLRVAITQLLKESSALSTPSTFAQAAKLKRLAAAKEKELAKLQQSDIKGKQ  145

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
              ++ + K L   K+  Y +L+L FW  PVA+V   L+QPFGRM SW+        V+VG
Sbjct  146  SLHEKYGKVLKATKVLVYGLLVLSFWSAPVATVPNHLLQPFGRMFSWKGVDAATGRVVVG  205

Query  291  IIPWLILCIRVSKTICRKV  235
            IIPWL L  RVSK + +K+
Sbjct  206  IIPWLFLTSRVSKLLSQKL  224



>gb|ADE77856.1| unknown [Picea sitchensis]
Length=199

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 103/174 (59%), Gaps = 3/174 (2%)
 Frame = -3

Query  723  AAPLVFFIVGVFQFLSRYLEL---RKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQ  553
            AAPL+  +V +    S +++    +  K +M+ ++ Q+  EIK+LLKEA  LS PSTF Q
Sbjct  19   AAPLILVVVLIIHIFSGHIQQYLGKLQKRTMNPEEVQVVQEIKRLLKEAKSLSTPSTFAQ  78

Query  552  AAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASV  373
            AAKLR+ AAAKEKEL + +   + E  +   +H     +LK   Y     WFW +P+A V
Sbjct  79   AAKLRQAAAAKEKELLQIRQKLSVEKGLSSKLHLMAPKILKACIYLGFAWWFWGVPIAVV  138

Query  372  SEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKVLK*ENRTI  211
            S QL+QPFG   S R GG  +  V +GIIPWL+L  RVS  + RK++     T+
Sbjct  139  STQLLQPFGNAFSLRVGGSTDGLVKIGIIPWLLLTTRVSVFVSRKLVSKHTATV  192



>gb|KDO54788.1| hypothetical protein CISIN_1g033786mg [Citrus sinensis]
Length=80

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  465  YDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGII  286
            YD++ K L +LK+  YF+LI WFWR PVA++S+QLVQPFG+ LSW  GG   +NVMVGII
Sbjct  3    YDLYVKVLRILKVVIYFVLICWFWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMVGII  62

Query  285  PWLILCIRVSKTIC  244
            PWLIL  RVSK +C
Sbjct  63   PWLILSTRVSKFVC  76



>emb|CAN61751.1| hypothetical protein VITISV_026186 [Vitis vinifera]
Length=156

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  759  MEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            MEE+L+ H  S+AAPL+F +V  FQF+S +LEL K +G  S +D +L+ EIKQLLKEA+ 
Sbjct  1    MEESLD-HRNSLAAPLIFTVVISFQFISVWLELSKKRGLRSAEDDKLRGEIKQLLKEASA  59

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQ  496
             SQPSTF QAAKLRRMAAAKEKEL K +
Sbjct  60   FSQPSTFAQAAKLRRMAAAKEKELLKRK  87



>gb|KHN35958.1| hypothetical protein glysoja_003081 [Glycine soja]
Length=168

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 93/172 (54%), Gaps = 10/172 (6%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            +EA ++  +S+AAPL+F IV  FQF    L+  K   ++       KA   Q      V+
Sbjct  3    DEASQERERSLAAPLIFLIVAAFQFAYYCLDHVKKAINLCTSSKTQKAGSCQGEGTFKVV  62

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWF  397
            S    +    K + M    +K+       H  +       ++K L +LK  TY +L++WF
Sbjct  63   S--GLYKHNMKPKLMNGLTKKD---QNSCHKDDAS-----YAKVLLILKYLTYGVLLIWF  112

Query  396  WRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
            WR+PVAS+S QLVQPFG +LSW+  G  N++V +GII WLI+  RV + + R
Sbjct  113  WRVPVASISLQLVQPFGSLLSWKTRGVQNNSVTIGIISWLIVSARVCRFVRR  164



>ref|XP_007138455.1| hypothetical protein PHAVU_009G210400g [Phaseolus vulgaris]
 gb|ESW10449.1| hypothetical protein PHAVU_009G210400g [Phaseolus vulgaris]
Length=128

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 89/173 (51%), Gaps = 52/173 (30%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLE-LRKAKGSMSEKDAQLKAEIKQLLKEANV  580
            +E      +S+AAPL+F IV  FQF    L+ + K  GS  EK+ +L+AEIKQLLKEA+ 
Sbjct  3    DEGSHVRERSLAAPLIFLIVAAFQFAYYCLDHVAKQSGSDREKEDRLRAEIKQLLKEASS  62

Query  579  LSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILW  400
            +SQPSTF +AAKL+R+A AKE+EL+K           W                      
Sbjct  63   MSQPSTFARAAKLKRLATAKERELSK-----------WS---------------------  90

Query  399  FWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICR  241
                               +LSW++GG  +++  +GII WL++C RV + + R
Sbjct  91   -------------------LLSWKSGGVQSNSAPIGIISWLVICARVCRFVRR  124



>ref|XP_008344182.1| PREDICTED: uncharacterized protein LOC103406993 [Malus domestica]
Length=90

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  753  EALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLS  574
            E L  +  S AAP+VF +V  FQFLSR+LE  K  G  +    +L+ EIK LLKEA+ LS
Sbjct  6    ETLPAYRSSFAAPIVFIVVVAFQFLSRWLEQLKKGGVKNATATRLRGEIKDLLKEASSLS  65

Query  573  QPSTFVQAAKLRRMAAAKEKELA  505
            QPSTF QAAKLRRMAAAKEKELA
Sbjct  66   QPSTFAQAAKLRRMAAAKEKELA  88



>gb|KHG02964.1| hypothetical protein F383_25227 [Gossypium arboreum]
Length=110

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -3

Query  741  KHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPST  562
            +  +S+AAP VFFI+  FQF ++ L+  K   S ++K+ QL+AEIKQLLK+A   SQPST
Sbjct  31   ERTRSLAAPFVFFIIIAFQFAAKRLQDLKRGASKTDKEMQLRAEIKQLLKDAASYSQPST  90

Query  561  FVQAAKLRRMAAAKEKELA  505
            F QAAKLRRMAAAKEKELA
Sbjct  91   FAQAAKLRRMAAAKEKELA  109



>gb|ACU17964.1| unknown [Glycine max]
Length=153

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = -3

Query  756  EEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVL  577
            +EA E+H +S+AAP +FF+V  FQF S +++  K  GS  EK+ +L+ EIK+LLKEA+ L
Sbjct  3    DEASEEHQRSLAAPFIFFVVLAFQFASHWIDHFKKSGSDKEKETKLRGEIKELLKEASSL  62

Query  576  SQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLK  430
            SQPSTF QAAKL+R+AAAKE+ELAK Q +H+K+  ++    SK L + K
Sbjct  63   SQPSTFAQAAKLKRLAAAKERELAKCQNLHHKDDALY----SKVLLISK  107



>gb|AFW85444.1| hypothetical protein ZEAMMB73_513382 [Zea mays]
Length=119

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S +A  VF +V     L   L+L++ +GS+S+   +L+ EI QLLKEA+ LS PSTF QA
Sbjct  2    SPSAIFVFLLVSAVHMLECILDLKRRRGSISDDQLRLRVEITQLLKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIF  424
            AKL+R+A AKEKELAK Q +  +  Q  Y+ + K L   K+ 
Sbjct  62   AKLKRLAGAKEKELAKMQDVDIRGKQSLYEKYRKVLLAAKVL  103



>ref|XP_010101923.1| hypothetical protein L484_001714 [Morus notabilis]
 gb|EXB90560.1| hypothetical protein L484_001714 [Morus notabilis]
Length=115

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 76/157 (48%), Gaps = 52/157 (33%)
 Frame = -3

Query  762  NMEEALEKHAKSIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEK-DAQLKAEIKQLLKEA  586
            ++ E LE    S+A  L+F IV  FQFLSR+LE  K K       + QL+ EI QLLKEA
Sbjct  3    DIAETLEPRRGSLAPTLIFSIVIAFQFLSRWLESLKKKKGSKSAMEIQLRGEINQLLKEA  62

Query  585  NVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLI  406
            +  SQPSTF QAAKLRR+AAAKEKELA                                 
Sbjct  63   SSFSQPSTFAQAAKLRRVAAAKEKELAN--------------------------------  90

Query  405  LWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMV  295
               W+                +LSW+ GG +NDNVMV
Sbjct  91   ---WK----------------VLSWKGGGILNDNVMV  108



>ref|XP_001760426.1| predicted protein [Physcomitrella patens]
 gb|EDQ74817.1| predicted protein [Physcomitrella patens]
Length=176

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 90/163 (55%), Gaps = 3/163 (2%)
 Frame = -3

Query  720  APLVFF-IVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAK  544
            APL+ F ++ + Q   R+L     K  M  ++A+L  +IKQL +EA+ L+ P+TF +++K
Sbjct  2    APLIIFALLFILQIFLRFLPSSGNKKRMPPQEAELVRQIKQLNREADALNTPATFAKSSK  61

Query  543  LRRMAAAKEKELAKNQGIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQ  364
            LRR A AK+KELA  +         W         ++K+     +  WF ++ VASV   
Sbjct  62   LRRAAVAKDKELALLRQSTGGTGYGWLVKKLSASLLIKVILILGIGGWFRQIHVASVPAS  121

Query  363  LVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSKTICRKV  235
            L+QPFG ML+ ++    ++ + V I+PW+IL   V+  +   V
Sbjct  122  LLQPFGGMLAAKSDN--SEMINVSIMPWMILSTTVASYLVNMV  162



>ref|XP_008781301.1| PREDICTED: uncharacterized protein LOC103701105 isoform X2 [Phoenix 
dactylifera]
Length=151

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQG  493
            ++E  + +G  S ++ QL+ EIKQLLKEA  LS P+TF QAAKLRRMAA KEKEL+K   
Sbjct  25   FVEFLRKRGLRSHEEVQLRQEIKQLLKEAGKLSTPTTFAQAAKLRRMAATKEKELSKKHE  84

Query  492  IHNKEIQMWYDMHSKCLFVLKI  427
             H+KE +  YD  ++ L +LK+
Sbjct  85   EHSKEKRWSYDTFARALLILKL  106



>ref|XP_010935302.1| PREDICTED: uncharacterized protein LOC105055231 isoform X2 [Elaeis 
guineensis]
Length=141

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQG  493
            ++E  + +G  S ++ QL+ EIK+LLKEA  LS PSTF QAAKLRRMAA KEKEL+K   
Sbjct  30   FVEFLRKRGLRSSEEVQLRQEIKELLKEAGKLSTPSTFAQAAKLRRMAATKEKELSKKHE  89

Query  492  IHNKEIQMWYDMHSKCLFVLK  430
             ++KE +  YDM ++ L +LK
Sbjct  90   EYSKEKRWSYDMFARALLILK  110



>gb|AFW85443.1| hypothetical protein ZEAMMB73_513382 [Zea mays]
Length=97

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  729  SIAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQA  550
            S +A  VF +V     L   L+L++ +GS+S+   +L+ EI QLLKEA+ LS PSTF QA
Sbjct  2    SPSAIFVFLLVSAVHMLECILDLKRRRGSISDDQLRLRVEITQLLKEASALSTPSTFAQA  61

Query  549  AKLRRMAAAKEKELAKNQGI  490
            AKL+R+A AKEKELAK+  +
Sbjct  62   AKLKRLAGAKEKELAKSCSL  81



>gb|KDO54789.1| hypothetical protein CISIN_1g033786mg [Citrus sinensis]
Length=111

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  471  MWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
            M YD++ K L +LK+  YF+LI WFWR PVA++S+QLVQPFG+ LSW  GG   +NVMV 
Sbjct  1    MSYDLYVKVLRILKVVIYFVLICWFWRAPVAAISQQLVQPFGKFLSWWTGGQSKNNVMVN  60



>emb|CAB10420.1| LET1 like protein [Arabidopsis thaliana]
 emb|CAB78686.1| LET1 like protein [Arabidopsis thaliana]
Length=578

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  726  IAAPLVFFIVGVFQFLSRYLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAA  547
            +AAPL F +V VFQ LS++L+  K KGS + ++++L+ EIKQLL+EA+ LSQP+TF QAA
Sbjct  13   LAAPLTFVVVVVFQLLSKWLDQLKKKGSKNTRESELRTEIKQLLREASALSQPATFAQAA  72

Query  546  KLRRMAAAKEKELAK  502
            KLRR AA KEKELA+
Sbjct  73   KLRRSAATKEKELAQ  87



>gb|AFW85442.1| hypothetical protein ZEAMMB73_513382 [Zea mays]
Length=123

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -3

Query  432  KIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVGIIPWLILCIRVSK  253
            ++  Y +L+LWFW  PV +V + L+QPFGRM SWR        V+VGI+PWL L  RVSK
Sbjct  51   QVVVYGVLVLWFWSTPVTTVPKHLLQPFGRMFSWRGVDASTGRVVVGILPWLFLTSRVSK  110

Query  252  TICRKV  235
             +  K+
Sbjct  111  LLSEKL  116



>ref|XP_002955700.1| hypothetical protein VOLCADRAFT_119133 [Volvox carteri f. nagariensis]
 gb|EFJ43340.1| hypothetical protein VOLCADRAFT_119133 [Volvox carteri f. nagariensis]
Length=216

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 70/146 (48%), Gaps = 5/146 (3%)
 Frame = -3

Query  672  YLELRKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAK-NQ  496
            +L  R    +   + A+L AEI  L +EA  L+ PST+ + AK +R+A AK+K+LA  N 
Sbjct  27   WLARRHKAATSGSRRAKLTAEIAFLRREAAKLNTPSTYARCAKYQRLANAKDKDLADLNA  86

Query  495  GIHNKEIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASV-SEQLVQPFGRMLSWRAGG  319
            G     +    D        +K      + L  W  PVA V    +V P GR+L++  G 
Sbjct  87   G---PGVSGTADRLLVLGRAVKTLVLCAVTLAVWEAPVARVMPRAVVAPLGRLLAFPHGA  143

Query  318  FVNDNVMVGIIPWLILCIRVSKTICR  241
             +     V + PWL+L    ++ + R
Sbjct  144  ELAGFGGVAVAPWLLLLDLATEALAR  169



>gb|KHN35589.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=361

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  426  FTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
             TY +L++WFWR+PVAS+S QLVQPFG  LSW+  G  N++V V 
Sbjct  32   LTYGVLLIWFWRVPVASISLQLVQPFGCFLSWKTRGVQNNSVAVA  76



>ref|XP_005829401.1| hypothetical protein GUITHDRAFT_111699 [Guillardia theta CCMP2712]
 gb|EKX42421.1| hypothetical protein GUITHDRAFT_111699 [Guillardia theta CCMP2712]
Length=374

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 25/153 (16%)
 Frame = -3

Query  636  EKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKE---KELAKN----QGIHNKE  478
            ++  +L  EIK + ++   L  P  FV+A+K++R     E   KEL ++       HN+ 
Sbjct  238  DEAVELSEEIKSMKQQHKALDTPDNFVKASKMKRQIDQMEMRLKELKESLRSVSNSHNRN  297

Query  477  IQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVM  298
                  +HS    +L++    +L++ FW  P+  + + ++ PF  + S+ A    ++   
Sbjct  298  F-----VHS----LLEVIIPAVLVIMFWATPMHKLPKDMLWPFAGIFSFPA----HEEGA  344

Query  297  VGIIPWLILCIRVSKTICRKVLK*ENRTITEIV  199
            +GIIPW+ +C R     C  VL    R I E+V
Sbjct  345  IGIIPWVFMCQR-----CFDVLVEIARGIAELV  372



>ref|NP_001136965.1| uncharacterized protein LOC100217125 [Zea mays]
 gb|ACF82982.1| unknown [Zea mays]
 gb|AFW85441.1| hypothetical protein ZEAMMB73_513382 [Zea mays]
Length=103

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -3

Query  432  KIFTYFMLILWFWRMPVASVSEQLVQPFGRMLSWRAGGFVNDNVMVG  292
            ++  Y +L+LWFW  PV +V + L+QPFGRM SWR        V+V 
Sbjct  51   QVVVYGVLVLWFWSTPVTTVPKHLLQPFGRMFSWRGVDASTGRVVVS  97



>ref|XP_001695038.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02190.1| predicted protein [Chlamydomonas reinhardtii]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 71/143 (50%), Gaps = 3/143 (2%)
 Frame = -3

Query  660  RKAKGSMSEKDAQLKAEIKQLLKEANVLSQPSTFVQAAKLRRMAAAKEKELAKNQGIHNK  481
            R    +   + A+L AEI  L +E+  L+ P+T+ + AK +R+A AK+KELA+       
Sbjct  34   RHKNATTGVRRARLNAEIGYLRRESAKLNAPATYAKCAKFQRLANAKDKELAELTAA--P  91

Query  480  EIQMWYDMHSKCLFVLKIFTYFMLILWFWRMPVASVSEQ-LVQPFGRMLSWRAGGFVNDN  304
             +    D        +K+       LW W  PVA V+ + L+ P G +L++  G  +   
Sbjct  92   AVPGLGDRMVLLANAVKLLAVGAASLWLWDTPVAQVAPRSLLSPLGGLLAFPRGSELAPF  151

Query  303  VMVGIIPWLILCIRVSKTICRKV  235
             ++ + PWL +    +K++ R V
Sbjct  152  GVITLTPWLFVADSATKSLVRAV  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1688554632492