BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14919_g1_i1 len=1753 path=[1731:0-500 2232:501-829 2561:830-1752]

Length=1753
                                                                      Score     E

gb|AFO84085.1|  hexokinase                                              700   0.0      
ref|XP_006362320.1|  PREDICTED: hexokinase-3-like                       698   0.0      
ref|XP_004251354.1|  PREDICTED: hexokinase-3-like                       695   0.0      
gb|EYU46224.1|  hypothetical protein MIMGU_mgv1a004779mg                695   0.0      
ref|XP_011090147.1|  PREDICTED: hexokinase-3-like                       694   0.0      
gb|AAS60198.1|  hexokinase 6                                            689   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009622479.1|  PREDICTED: hexokinase-3-like                       686   0.0      
ref|XP_009798645.1|  PREDICTED: hexokinase-3-like                       686   0.0      
ref|XP_003517518.1|  PREDICTED: hexokinase-3-like                       682   0.0      
ref|XP_008450397.1|  PREDICTED: hexokinase-3-like                       682   0.0      
ref|XP_004154641.1|  PREDICTED: hexokinase-3-like                       681   0.0      
ref|XP_002274759.1|  PREDICTED: hexokinase-3 isoform X1                 682   0.0      Vitis vinifera
ref|XP_004139044.1|  PREDICTED: hexokinase-3-like                       681   0.0      
ref|XP_004511503.1|  PREDICTED: hexokinase-3-like                       679   0.0      
ref|XP_010273315.1|  PREDICTED: hexokinase-3-like                       679   0.0      
ref|XP_006590474.1|  PREDICTED: hexokinase-3-like                       677   0.0      
ref|XP_010246625.1|  PREDICTED: hexokinase-3-like                       676   0.0      
ref|XP_010673708.1|  PREDICTED: hexokinase-3-like isoform X1            675   0.0      
ref|XP_011032066.1|  PREDICTED: hexokinase-3 isoform X1                 674   0.0      
ref|XP_007156986.1|  hypothetical protein PHAVU_002G034000g             674   0.0      
ref|XP_002313358.2|  hexokinase family protein                          673   0.0      Populus trichocarpa [western balsam poplar]
gb|AIU64847.1|  hexokinase-3                                            672   0.0      
ref|XP_008227191.1|  PREDICTED: hexokinase-3 isoform X1                 672   0.0      
ref|XP_006446203.1|  hypothetical protein CICLE_v10014962mg             672   0.0      
ref|XP_003610965.1|  Hexokinase                                         671   0.0      
gb|KHN09247.1|  Hexokinase-3                                            670   0.0      
ref|XP_002298298.1|  hexokinase family protein                          671   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003537744.1|  PREDICTED: hexokinase-3-like                       671   0.0      
ref|XP_007015149.1|  Hexokinase-like 1                                  671   0.0      
ref|XP_006470700.1|  PREDICTED: hexokinase-3-like                       668   0.0      
gb|KDP22128.1|  hypothetical protein JCGZ_25959                         667   0.0      
emb|CDP09609.1|  unnamed protein product                                667   0.0      
ref|XP_008385759.1|  PREDICTED: hexokinase-3-like                       665   0.0      
ref|XP_007211826.1|  hypothetical protein PRUPE_ppa004471mg             664   0.0      
ref|XP_008363245.1|  PREDICTED: hexokinase-3                            664   0.0      
ref|XP_002513538.1|  hexokinase, putative                               663   0.0      Ricinus communis
ref|XP_003540378.1|  PREDICTED: hexokinase-3-like                       663   0.0      
ref|XP_011080375.1|  PREDICTED: hexokinase-3 isoform X1                 663   0.0      
ref|XP_007131563.1|  hypothetical protein PHAVU_011G023700g             661   0.0      
ref|XP_011080376.1|  PREDICTED: hexokinase-3 isoform X2                 660   0.0      
gb|AHY84733.1|  hexokinase                                              660   0.0      
ref|XP_009366073.1|  PREDICTED: hexokinase-3                            659   0.0      
gb|KHG14450.1|  hypothetical protein F383_08688                         658   0.0      
gb|AHY84732.1|  hexokinase                                              658   0.0      
ref|XP_010031755.1|  PREDICTED: hexokinase-3 isoform X1                 655   0.0      
ref|XP_009343799.1|  PREDICTED: hexokinase-3-like                       655   0.0      
ref|XP_009337028.1|  PREDICTED: hexokinase-3-like                       653   0.0      
ref|XP_008449690.1|  PREDICTED: hexokinase-3                            649   0.0      
gb|KGN48114.1|  hypothetical protein Csa_6G434340                       645   0.0      
gb|AHZ34665.1|  hexokinase 3 (chloroplast)                              644   0.0      
gb|ADN33926.1|  hexokinase                                              641   0.0      
ref|XP_004140206.1|  PREDICTED: hexokinase-3-like                       637   0.0      
ref|XP_010938649.1|  PREDICTED: hexokinase-3-like                       636   0.0      
ref|XP_011045448.1|  PREDICTED: hexokinase-3-like                       632   0.0      
gb|KHN05494.1|  Hexokinase-3                                            630   0.0      
ref|XP_010031756.1|  PREDICTED: hexokinase-3 isoform X2                 628   0.0      
ref|XP_009414963.1|  PREDICTED: hexokinase-3-like                       626   0.0      
ref|XP_010921910.1|  PREDICTED: hexokinase-3-like isoform X1            624   0.0      
gb|KFK35941.1|  hypothetical protein AALP_AA4G057200                    623   0.0      
ref|XP_006307314.1|  hypothetical protein CARUB_v10008936mg             619   0.0      
ref|XP_002891576.1|  hypothetical protein ARALYDRAFT_474175             617   0.0      
emb|CDY07303.1|  BnaC05g26650D                                          616   0.0      
ref|NP_175463.1|  hexokinase-like 1                                     615   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144955.1|  PREDICTED: hexokinase-3-like                       615   0.0      
ref|XP_008775017.1|  PREDICTED: hexokinase-3-like isoform X2            614   0.0      
ref|XP_009107216.1|  PREDICTED: hexokinase-3-like                       614   0.0      
ref|XP_010092207.1|  hypothetical protein L484_013525                   610   0.0      
emb|CDY22797.1|  BnaA06g02800D                                          612   0.0      
ref|XP_010479505.1|  PREDICTED: hexokinase-3 isoform X1                 611   0.0      
ref|XP_008775016.1|  PREDICTED: hexokinase-3-like isoform X1            610   0.0      
ref|XP_010031757.1|  PREDICTED: hexokinase-3 isoform X3                 608   0.0      
ref|XP_010461899.1|  PREDICTED: hexokinase-3-like                       608   0.0      
emb|CDY03607.1|  BnaC03g68660D                                          607   0.0      
emb|CDY45062.1|  BnaA08g02130D                                          603   0.0      
ref|XP_009147837.1|  PREDICTED: hexokinase-3                            602   0.0      
ref|XP_010651825.1|  PREDICTED: hexokinase-3 isoform X2                 597   0.0      
ref|XP_009405453.1|  PREDICTED: hexokinase-3-like                       597   0.0      
ref|XP_008227192.1|  PREDICTED: hexokinase-3 isoform X2                 592   0.0      
gb|EPS64171.1|  hypothetical protein M569_10608                         588   0.0      
ref|XP_006393149.1|  hypothetical protein EUTSA_v10011415mg             584   0.0      
ref|XP_010921911.1|  PREDICTED: hexokinase-3-like isoform X2            581   0.0      
ref|XP_006843448.1|  hypothetical protein AMTR_s00053p00173580          581   0.0      
ref|XP_009145689.1|  PREDICTED: hexokinase-4                            578   0.0      
ref|XP_002883225.1|  hexokinase                                         577   0.0      
dbj|BAD93730.1|  hexokinase                                             576   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EAY77169.1|  hypothetical protein OsI_05139                          577   0.0      Oryza sativa Indica Group [Indian rice]
sp|Q2KNB4.1|HXK3_ORYSJ  RecName: Full=Hexokinase-3; AltName: Full...    577   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_188639.2|  hexokinase-4                                          576   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487967.1|  PREDICTED: hexokinase-4                            576   0.0      
ref|XP_006297494.1|  hypothetical protein CARUB_v10013513mg             576   0.0      
emb|CDY24565.1|  BnaC05g32490D                                          575   0.0      
emb|CDY25373.1|  BnaA05g19110D                                          574   0.0      
ref|XP_009382578.1|  PREDICTED: hexokinase-3-like isoform X1            574   0.0      
ref|XP_010508397.1|  PREDICTED: hexokinase-4-like                       573   0.0      
ref|XP_004971218.1|  PREDICTED: hexokinase-3-like                       572   0.0      
ref|XP_010045034.1|  PREDICTED: hexokinase-4-like                       570   0.0      
ref|XP_010466178.1|  PREDICTED: hexokinase-4-like                       570   0.0      
dbj|BAD87613.1|  putative hexokinase                                    568   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAN74594.1|  hypothetical protein VITISV_003476                     565   0.0      Vitis vinifera
ref|XP_008674565.1|  PREDICTED: hexokinase-3                            564   0.0      
ref|XP_006406425.1|  hypothetical protein EUTSA_v10020562mg             563   0.0      
ref|XP_002459072.1|  hypothetical protein SORBIDRAFT_03g045420          562   0.0      Sorghum bicolor [broomcorn]
ref|XP_003565048.1|  PREDICTED: hexokinase-3                            560   0.0      
ref|XP_006645311.1|  PREDICTED: hexokinase-3-like                       556   0.0      
ref|XP_008656880.1|  PREDICTED: hexokinase-3-like                       556   0.0      
dbj|BAJ85932.1|  predicted protein                                      541   0.0      
emb|CDY37134.1|  BnaC06g03650D                                          533   0.0      
ref|XP_010501937.1|  PREDICTED: hexokinase-3-like                       530   1e-180   
ref|XP_009382579.1|  PREDICTED: hexokinase-3-like isoform X2            531   1e-180   
emb|CDY68234.1|  BnaCnng58160D                                          526   2e-179   
emb|CDY29586.1|  BnaA05g15840D                                          523   2e-178   
ref|XP_007013021.1|  Hexokinase 1 isoform 2                             520   6e-176   
ref|XP_009388038.1|  PREDICTED: hexokinase-3-like                       516   7e-176   
ref|XP_010673709.1|  PREDICTED: hexokinase-3-like isoform X2            514   2e-175   
gb|KHG25517.1|  Hexokinase-1 -like protein                              513   2e-173   
ref|NP_001275786.1|  hexokinase                                         511   2e-172   
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1            509   8e-172   
gb|AAS60197.1|  hexokinase 5                                            509   9e-172   Nicotiana tabacum [American tobacco]
gb|AFO84084.1|  hexokinase                                              506   8e-171   
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                       506   9e-171   
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                       506   1e-170   Vitis vinifera
gb|AEJ95926.1|  HXK1                                                    505   2e-170   
ref|XP_002988103.1|  hypothetical protein SELMODRAFT_269350             506   3e-170   
ref|XP_007013020.1|  Hexokinase 1 isoform 1                             506   3e-170   
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3            504   6e-170   
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2            504   7e-170   
gb|ABI18156.1|  hexokinase                                              504   9e-170   Helianthus annuus
ref|NP_001234710.1|  hexokinase                                         504   1e-169   
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                       503   1e-169   
ref|XP_010249484.1|  PREDICTED: hexokinase-1                            503   2e-169   
gb|ACJ04704.1|  hexokinase 1                                            503   2e-169   Cucumis melo [Oriental melon]
emb|CAN83149.1|  hypothetical protein VITISV_024177                     503   2e-169   Vitis vinifera
ref|XP_002972691.1|  hypothetical protein SELMODRAFT_441916             503   4e-169   
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1            505   5e-169   
ref|XP_004141023.1|  PREDICTED: hexokinase-1-like                       501   1e-168   
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2            501   1e-168   
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                       501   2e-168   
ref|XP_008242483.1|  PREDICTED: hexokinase-1                            500   3e-168   
ref|XP_002325031.1|  Hexokinase 1 family protein                        500   4e-168   Populus trichocarpa [western balsam poplar]
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg             499   8e-168   
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                       499   1e-167   
ref|XP_007024321.1|  Hexokinase 2                                       499   1e-167   
gb|AHG98487.1|  hexokinase                                              498   1e-167   
ref|XP_010098150.1|  hypothetical protein L484_026284                   498   3e-167   
ref|XP_002514221.1|  hexokinase, putative                               498   3e-167   Ricinus communis
gb|KDP33801.1|  hypothetical protein JCGZ_07372                         498   3e-167   
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                       498   4e-167   
gb|AID50967.1|  hexokinase 1                                            497   4e-167   
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                       497   6e-167   
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                       496   9e-167   
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                       496   9e-167   
dbj|BAJ89593.1|  predicted protein                                      496   1e-166   
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg             496   1e-166   
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                       496   2e-166   
ref|NP_194642.1|  hexokinase 1                                          495   2e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287480.1|  PREDICTED: hexokinase-1-like                       495   2e-166   
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                       495   2e-166   
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...    495   2e-166   Spinacia oleracea
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...    495   3e-166   Oryza sativa Japonica Group [Japonica rice]
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                    494   5e-166   
gb|EAY98804.1|  hypothetical protein OsI_20748                          494   6e-166   Oryza sativa Indica Group [Indian rice]
ref|XP_011093636.1|  PREDICTED: hexokinase-1                            494   7e-166   
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                       494   7e-166   
gb|AET05183.2|  hexokinase                                              493   1e-165   
gb|KHG22031.1|  Hexokinase-1                                            494   1e-165   
ref|NP_001284452.1|  hexokinase-1-like                                  493   2e-165   
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1                 493   2e-165   
ref|XP_002886018.1|  ATHXK2                                             493   2e-165   
gb|AAL60584.1|AF454962_1  hexokinase                                    493   3e-165   Brassica oleracea
ref|XP_001754148.1|  hexokinase protein HXK7                            493   4e-165   
ref|XP_002867423.1|  ATHXK1                                             492   5e-165   
ref|XP_010688341.1|  PREDICTED: hexokinase-1                            491   1e-164   
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                       491   2e-164   
ref|XP_004962258.1|  PREDICTED: hexokinase-10-like                      491   2e-164   
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                       490   2e-164   
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g             490   3e-164   
ref|XP_006853711.1|  hypothetical protein AMTR_s00056p00151260          490   3e-164   
gb|ADZ96378.1|  hexokinase 1                                            490   3e-164   
emb|CDY35895.1|  BnaA07g00920D                                          490   4e-164   
ref|XP_003630707.1|  Hexokinase                                         493   5e-164   
ref|XP_004135675.1|  PREDICTED: hexokinase-2-like                       489   6e-164   
ref|XP_009102132.1|  PREDICTED: hexokinase-1                            488   1e-163   
ref|XP_009352555.1|  PREDICTED: hexokinase-1                            488   1e-163   
ref|XP_002441001.1|  hypothetical protein SORBIDRAFT_09g018720          488   1e-163   Sorghum bicolor [broomcorn]
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                       488   2e-163   
gb|AAS60195.1|  hexokinase 4a                                           488   2e-163   Nicotiana tabacum [American tobacco]
emb|CDP03250.1|  unnamed protein product                                488   2e-163   
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                       487   4e-163   
gb|KHN40378.1|  Hexokinase-1                                            486   4e-163   
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                       487   5e-163   
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                       486   6e-163   
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                       486   6e-163   
ref|XP_010536106.1|  PREDICTED: hexokinase-4-like                       485   9e-163   
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                    486   1e-162   
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                       486   1e-162   
ref|XP_010447886.1|  PREDICTED: hexokinase-1                            486   1e-162   
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg             486   1e-162   
gb|AHB32106.1|  hexokinase                                              485   2e-162   
ref|NP_179576.1|  hexokinase 2                                          486   2e-162   Arabidopsis thaliana [mouse-ear cress]
gb|AHD25654.1|  hexokinase 1                                            485   2e-162   
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                       485   2e-162   
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                       485   2e-162   
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                       485   3e-162   
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1                 485   3e-162   
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                       485   3e-162   
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1            486   3e-162   
gb|AAO24584.1|  At2g19860                                               485   3e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                       484   4e-162   
gb|AAS60196.1|  hexokinase 4b                                           484   4e-162   Nicotiana tabacum [American tobacco]
ref|XP_001752229.1|  hexokinase protein HXK8                            485   4e-162   
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1            484   5e-162   
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                       484   7e-162   
gb|AHY84731.1|  hexokinase                                              484   7e-162   
gb|EMT24694.1|  Hexokinase-10                                           484   7e-162   
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                       484   8e-162   
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2            483   1e-161   
ref|XP_001784334.1|  hexokinase protein HXK3                            484   1e-161   
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg             483   1e-161   
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                     481   1e-161   
ref|XP_002515958.1|  hexokinase, putative                               483   2e-161   Ricinus communis
gb|AIX02984.1|  hexokinase                                              483   2e-161   
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                       483   3e-161   
gb|AAL60583.1|AF454961_1  hexokinase                                    482   3e-161   Brassica oleracea
emb|CDY48733.1|  BnaA09g10080D                                          482   3e-161   
emb|CBI27996.3|  unnamed protein product                                480   3e-161   
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                       482   5e-161   
emb|CDY03331.1|  BnaC09g10170D                                          482   5e-161   
sp|Q2KNB5.1|HXK10_ORYSJ  RecName: Full=Hexokinase-10; AltName: Fu...    482   6e-161   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40854.1|  hypothetical protein JCGZ_24853                         481   1e-160   
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2            481   1e-160   
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g             480   3e-160   Populus trichocarpa [western balsam poplar]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                       479   3e-160   
ref|XP_010526433.1|  PREDICTED: hexokinase-1                            479   3e-160   
gb|ABR18277.1|  unknown                                                 481   4e-160   Picea sitchensis
ref|XP_001784630.1|  hexokinase protein HXK2                            479   1e-159   
ref|XP_003627048.1|  Hexokinase                                         478   2e-159   
gb|AHY84734.1|  hexokinase                                              478   2e-159   
ref|NP_001280783.1|  uncharacterized protein LOC103443741               477   3e-159   
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                       477   4e-159   
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g             476   5e-159   
gb|KHG28915.1|  Hexokinase-1                                            475   2e-158   
gb|AFW83994.1|  hypothetical protein ZEAMMB73_545591                    483   2e-158   
gb|AAP40021.1|  hexokinase                                              475   2e-158   Nicotiana benthamiana
ref|XP_009606563.1|  PREDICTED: hexokinase-1                            474   3e-158   
gb|AAT01343.1|  putative hexokinase                                     475   3e-158   Oryza sativa Japonica Group [Japonica rice]
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg                474   4e-158   
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...    474   4e-158   Nicotiana tabacum [American tobacco]
ref|XP_009622660.1|  PREDICTED: hexokinase-2                            474   7e-158   
gb|AAS60194.1|  hexokinase 3                                            473   9e-158   Nicotiana tabacum [American tobacco]
dbj|BAP47497.1|  hexokinase                                             473   1e-157   
ref|XP_009803252.1|  PREDICTED: hexokinase-1                            473   2e-157   
ref|XP_009777315.1|  PREDICTED: hexokinase-2                            472   3e-157   
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                       472   4e-157   
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg                472   4e-157   
gb|AEB00838.1|  hexokinase 2                                            471   4e-157   
ref|XP_003566310.1|  PREDICTED: hexokinase-10-like                      471   6e-157   
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg                470   2e-156   
gb|AFO84083.1|  hexokinase                                              470   2e-156   
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g             469   3e-156   
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                       469   4e-156   
gb|AAT77515.1|  hexokinase 7                                            469   5e-156   Nicotiana tabacum [American tobacco]
ref|NP_001233957.1|  hexokinase                                         468   8e-156   
gb|AAA60333.1|  hexokinase                                              466   9e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1            469   1e-155   
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                       468   1e-155   
ref|XP_006655256.1|  PREDICTED: hexokinase-10-like                      466   2e-155   
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                       468   3e-155   
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1            466   5e-155   
gb|EMS67591.1|  Hexokinase-3                                            464   1e-154   
gb|KHN40379.1|  Hexokinase-2                                            465   2e-154   
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1            466   2e-154   
ref|XP_002974995.1|  hypothetical protein SELMODRAFT_150326             464   2e-154   
ref|XP_002977412.1|  hypothetical protein SELMODRAFT_232972             464   2e-154   
gb|AAT77513.1|  hexokinase 3                                            464   4e-154   Nicotiana sylvestris
gb|ABA01010.1|  hexokinase                                              464   5e-154   Solanum chacoense
emb|CDO97969.1|  unnamed protein product                                464   5e-154   
ref|XP_010322313.1|  PREDICTED: hexokinase isoform X1                   464   6e-154   
ref|NP_001234406.1|  hexokinase                                         463   9e-154   
ref|XP_006465701.1|  PREDICTED: hexokinase-1-like                       462   2e-153   
gb|KEH27216.1|  hexokinase                                              462   2e-153   
gb|EPS70676.1|  hexokinase 1a                                           461   3e-153   
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1            462   3e-153   
ref|XP_002283574.1|  PREDICTED: hexokinase-2                            461   4e-153   
ref|NP_001274841.1|  hexokinase-2                                       461   4e-153   
gb|KHN41674.1|  Hexokinase-1                                            459   4e-153   
gb|KHN27811.1|  Hexokinase-1                                            458   1e-152   
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                       459   1e-152   
ref|XP_003568782.1|  PREDICTED: hexokinase-7                            457   4e-152   
ref|XP_006426867.1|  hypothetical protein CICLE_v10025452mg             459   5e-152   
gb|AFW83996.1|  hypothetical protein ZEAMMB73_545591                    454   1e-151   
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                       457   2e-151   
ref|XP_002984124.1|  hypothetical protein SELMODRAFT_234446             456   2e-151   
ref|XP_010536108.1|  PREDICTED: hexokinase-4-like isoform X2            456   4e-151   
ref|XP_006473649.1|  PREDICTED: hexokinase-2, chloroplastic-like        456   7e-151   
gb|KDO84849.1|  hypothetical protein CISIN_1g011283mg                   454   3e-150   
ref|NP_001152293.1|  hexokinase-1                                       454   3e-150   
gb|EAY75659.1|  hypothetical protein OsI_03566                          454   4e-150   
ref|XP_006435174.1|  hypothetical protein CICLE_v10000939mg             453   6e-150   
ref|XP_010536107.1|  PREDICTED: hexokinase-4-like isoform X1            452   1e-149   
ref|XP_002972212.1|  hypothetical protein SELMODRAFT_231902             450   3e-149   
gb|EMT23999.1|  Hexokinase-3                                            457   4e-149   
ref|XP_011080413.1|  PREDICTED: hexokinase-1-like                       451   4e-149   
ref|XP_008387945.1|  PREDICTED: hexokinase-2, chloroplastic             449   2e-148   
emb|CAN74362.1|  hypothetical protein VITISV_016381                     450   3e-148   
ref|XP_007017793.1|  Hexokinase 3                                       449   3e-148   
gb|KHN35090.1|  Hexokinase-3                                            442   4e-148   
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                   447   6e-148   
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                       447   6e-148   
ref|XP_004960890.1|  PREDICTED: hexokinase-7-like isoform X1            446   8e-148   
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1            447   1e-147   
gb|AHY84730.1|  hexokinase                                              447   1e-147   
emb|CBI36049.3|  unnamed protein product                                445   1e-147   
ref|XP_009335085.1|  PREDICTED: hexokinase-2, chloroplastic             446   2e-147   
gb|KDP36930.1|  hypothetical protein JCGZ_08221                         446   2e-147   
ref|XP_002440735.1|  hypothetical protein SORBIDRAFT_09g005840          445   3e-147   
sp|Q1WM16.2|HXK7_ORYSJ  RecName: Full=Hexokinase-7; AltName: Full...    445   4e-147   
ref|XP_003564653.1|  PREDICTED: hexokinase-8-like                       444   5e-147   
gb|ACG47843.1|  hexokinase-1                                            446   8e-147   
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...    446   8e-147   
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190          446   1e-146   
ref|NP_001130970.1|  uncharacterized protein LOC100192075               445   1e-146   
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2            444   1e-146   
gb|AAZ93624.1|  hexokinase 7                                            443   2e-146   
ref|XP_002510526.1|  hexokinase, putative                               444   2e-146   
gb|ACG43712.1|  hexokinase-1                                            444   3e-146   
ref|XP_011045105.1|  PREDICTED: hexokinase-2, chloroplastic             443   7e-146   
ref|XP_004960891.1|  PREDICTED: hexokinase-7-like isoform X2            441   9e-146   
gb|AIT55904.1|  hexokinase                                              442   1e-145   
sp|Q6Q8A5.1|HXK2_TOBAC  RecName: Full=Hexokinase-2, chloroplastic...    442   2e-145   
ref|NP_001045354.1|  Os01g0940100                                       436   2e-145   
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...    440   2e-145   
ref|XP_009626314.1|  PREDICTED: hexokinase-2, chloroplastic             441   6e-145   
gb|ACN29323.1|  unknown                                                 440   7e-145   
ref|NP_001042264.1|  Os01g0190400                                       440   7e-145   
ref|NP_001146056.1|  hypothetical protein                               440   1e-144   
gb|AHD25655.1|  hexokinase 2                                            439   2e-144   
emb|CDP07402.1|  unnamed protein product                                439   2e-144   
ref|XP_009780796.1|  PREDICTED: hexokinase-2, chloroplastic             439   3e-144   
gb|AAZ93625.1|  hexokinase 8                                            436   5e-144   
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...    438   1e-143   
gb|EEC78650.1|  hypothetical protein OsI_18744                          436   1e-143   
ref|NP_001056082.1|  Os05g0522500                                       437   1e-143   
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                       437   2e-143   
ref|NP_001234717.1|  plastidic hexokinase                               436   2e-143   
ref|XP_010110881.1|  hypothetical protein L484_006996                   432   3e-143   
ref|NP_001044214.1|  Os01g0742500                                       436   4e-143   
ref|XP_004291365.1|  PREDICTED: hexokinase-2, chloroplastic-like        435   6e-143   
gb|EMT04435.1|  Hexokinase-6                                            434   1e-142   
gb|EEC70091.1|  hypothetical protein OsI_00720                          434   1e-142   
gb|EPS60819.1|  hexokinase                                              431   3e-142   
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080          434   3e-142   
gb|KDO66587.1|  hypothetical protein CISIN_1g010895mg                   431   3e-142   
ref|XP_004136385.1|  PREDICTED: hexokinase-2, chloroplastic-like        433   3e-142   
gb|AAT47078.1|  unknown protein                                         452   4e-142   
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...    432   7e-142   
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                       433   7e-142   
ref|NP_001275315.1|  hexokinase-related protein 1                       432   8e-142   
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...    432   9e-142   
ref|XP_010920252.1|  PREDICTED: hexokinase-2, chloroplastic             433   9e-142   
gb|EEE54030.1|  hypothetical protein OsJ_00699                          431   1e-141   
ref|XP_006829458.1|  hypothetical protein AMTR_s00254p00018780          432   1e-141   
dbj|BAK01318.1|  predicted protein                                      432   1e-141   
ref|XP_008466487.1|  PREDICTED: hexokinase-2, chloroplastic             431   2e-141   
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                       432   2e-141   
gb|KHG14299.1|  Hexokinase-2, chloroplastic                             431   3e-141   
ref|XP_006661182.1|  PREDICTED: hexokinase-1-like                       429   5e-141   
ref|XP_007222248.1|  hypothetical protein PRUPE_ppa004715mg             430   5e-141   
ref|NP_001267834.1|  hexokinase                                         429   8e-141   
gb|AEJ95927.1|  HXK2                                                    429   8e-141   
emb|CDM84036.1|  unnamed protein product                                430   1e-140   
ref|XP_008221267.1|  PREDICTED: hexokinase-2, chloroplastic             429   1e-140   
ref|NP_001105529.1|  LOC542510                                          429   2e-140   
gb|ACG44289.1|  hexokinase-2                                            429   3e-140   
gb|AFW78822.1|  hexokinase-2                                            429   3e-140   
ref|XP_010695425.1|  PREDICTED: hexokinase-2, chloroplastic             428   3e-140   
gb|EAY98739.1|  hypothetical protein OsI_20669                          428   5e-140   
gb|AFW82530.1|  hexokinase                                              427   1e-139   
ref|XP_010061051.1|  PREDICTED: hexokinase-2, chloroplastic             427   1e-139   
dbj|BAK06520.1|  predicted protein                                      427   1e-139   
ref|NP_001123599.1|  hexokinase2                                        427   1e-139   
gb|ACN25682.1|  unknown                                                 424   3e-139   
ref|XP_006657535.1|  PREDICTED: hexokinase-4, chloroplastic-like        423   3e-139   
gb|EAZ03118.1|  hypothetical protein OsI_25263                          425   8e-139   
ref|NP_001059124.1|  Os07g0197100                                       424   1e-138   
ref|XP_008675068.1|  PREDICTED: hexokinase-6                            424   2e-138   
gb|EEE63508.1|  hypothetical protein OsJ_18324                          421   2e-138   
dbj|BAJ93240.1|  predicted protein                                      424   2e-138   
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230          423   3e-138   
ref|XP_011083536.1|  PREDICTED: hexokinase-2, chloroplastic             422   5e-138   
ref|XP_010231125.1|  PREDICTED: hexokinase-2 isoform X2                 420   6e-138   
ref|NP_001150106.1|  hexokinase-1                                       421   1e-137   
gb|EAY97811.1|  hypothetical protein OsI_19731                          419   1e-137   
ref|XP_010104447.1|  Hexokinase-2                                       421   3e-137   
ref|XP_001772444.1|  hexokinase protein HXK1                            421   4e-137   
gb|AAQ72424.1|  hexokinase PpHxk1                                       421   4e-137   
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                       418   4e-137   
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                       422   4e-137   
ref|XP_003569773.1|  PREDICTED: hexokinase-6                            420   6e-137   
ref|XP_010268380.1|  PREDICTED: hexokinase-2, chloroplastic             419   8e-137   
ref|XP_003589478.1|  Hexokinase I                                       419   1e-136   
emb|CDY20902.1|  BnaC06g01220D                                          419   2e-136   
emb|CDY06724.1|  BnaA10g05030D                                          416   2e-135   
ref|XP_001779478.1|  hexokinase protein HXK11                           417   2e-135   
ref|XP_002894073.1|  hypothetical protein ARALYDRAFT_314227             415   3e-135   
gb|EMT15586.1|  Hexokinase-7                                            413   3e-135   
gb|ACN35115.1|  unknown                                                 413   4e-135   
ref|XP_009338735.1|  PREDICTED: hexokinase-1-like isoform X2            411   4e-135   
ref|XP_004499271.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-2...    415   5e-135   
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2            414   8e-135   
ref|XP_010467923.1|  PREDICTED: hexokinase-2 isoform X2                 410   2e-134   
ref|XP_010500300.1|  PREDICTED: hexokinase-like 1 protein               413   2e-134   
ref|XP_009118944.1|  PREDICTED: hexokinase-like 1 protein               413   2e-134   
ref|XP_002987642.1|  hypothetical protein SELMODRAFT_269299             412   4e-134   
ref|XP_003580531.1|  PREDICTED: hexokinase-4, chloroplastic             411   1e-133   
ref|XP_007222247.1|  hypothetical protein PRUPE_ppa004715mg             410   2e-133   
ref|XP_007160669.1|  hypothetical protein PHAVU_001G007000g             410   4e-133   
ref|XP_008380854.1|  PREDICTED: hexokinase-1-like isoform X2            406   6e-133   
gb|KCW82326.1|  hypothetical protein EUGRSUZ_C03728                     406   7e-133   
ref|XP_001770177.1|  hexokinase protein HXK9                            410   8e-133   
ref|XP_009382580.1|  PREDICTED: hexokinase-3-like isoform X3            407   9e-133   
ref|XP_003550424.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    409   9e-133   
ref|XP_010479187.1|  PREDICTED: hexokinase-like 1 protein isoform X1    409   9e-133   
gb|EMT31348.1|  Hexokinase-9                                            416   2e-132   
emb|CBI19858.3|  unnamed protein product                                405   2e-132   
ref|XP_001776765.1|  hexokinase protein HXK10                           408   3e-132   
ref|XP_001762951.1|  hexokinase protein HXK6                            408   6e-132   
ref|XP_002983299.1|  hypothetical protein SELMODRAFT_117919             406   7e-132   
ref|XP_006393517.1|  hypothetical protein EUTSA_v10011426mg             406   1e-131   
ref|XP_001766433.1|  hexokinase protein HXK5                            405   4e-131   
ref|XP_006451309.1|  hypothetical protein CICLE_v10008086mg             401   5e-131   
ref|XP_006303965.1|  hypothetical protein CARUB_v10008846mg             405   7e-131   
gb|AEB00839.1|  hexokinase 3                                            399   7e-131   
gb|AAT77511.1|  hexokinase                                              400   9e-131   
gb|KDO50429.1|  hypothetical protein CISIN_1g0104562mg                  394   3e-130   
ref|XP_006585565.1|  PREDICTED: hexokinase-1-like isoform X2            398   6e-130   
gb|KDO66588.1|  hypothetical protein CISIN_1g010895mg                   395   2e-129   
gb|EPS65982.1|  hypothetical protein M569_08795                         395   2e-129   
ref|NP_175220.2|  hexokinase 3                                          400   3e-129   
ref|XP_003545034.1|  PREDICTED: hexokinase-2, chloroplastic-like        399   1e-128   
gb|EAZ13494.1|  hypothetical protein OsJ_03410                          396   3e-128   
gb|KEH21333.1|  hexokinase                                              390   2e-127   
gb|KGN60032.1|  hypothetical protein Csa_3G872140                       393   6e-127   
ref|XP_010941986.1|  PREDICTED: hexokinase-2-like                       392   2e-126   
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...    392   4e-126   
gb|KCW82327.1|  hypothetical protein EUGRSUZ_C03728                     385   3e-125   
ref|XP_010271549.1|  PREDICTED: probable hexokinase-like 2 protein      389   7e-125   
ref|XP_001760948.1|  hexokinase protein HXK4                            388   1e-124   
ref|XP_010273376.1|  PREDICTED: hexokinase-3-like                       379   2e-124   
ref|XP_008787361.1|  PREDICTED: hexokinase-2-like                       388   6e-124   
gb|KFK39984.1|  hypothetical protein AALP_AA3G314800                    384   5e-123   
gb|EMT13168.1|  Hexokinase-8                                            381   1e-122   
ref|XP_006585567.1|  PREDICTED: hexokinase-1-like isoform X4            376   6e-122   
gb|AFK45195.1|  unknown                                                 379   1e-121   
gb|KDO66584.1|  hypothetical protein CISIN_1g010895mg                   375   3e-121   
ref|NP_001059538.1|  Os07g0446800                                       379   3e-121   
gb|KFK39985.1|  hypothetical protein AALP_AA3G314900                    378   5e-121   
ref|XP_006585566.1|  PREDICTED: hexokinase-1-like isoform X3            374   6e-121   
gb|EAZ03706.1|  hypothetical protein OsI_25838                          378   1e-120   
ref|NP_001077921.1|  hexokinase 2                                       373   3e-120   
gb|AAT77512.1|  hexokinase 2                                            373   4e-120   
gb|KFK39983.1|  hypothetical protein AALP_AA3G314700                    374   2e-119   
gb|EMS52197.1|  Hexokinase-8                                            370   4e-119   
tpg|DAA57819.1|  TPA: hypothetical protein ZEAMMB73_547897              370   6e-119   
gb|EEE55981.1|  hypothetical protein OsJ_04720                          379   7e-119   
gb|KEH21332.1|  hexokinase                                              368   8e-119   
ref|NP_001054835.1|  Os05g0187100                                       368   2e-118   
ref|XP_006658518.1|  PREDICTED: hexokinase-1-like                       369   1e-117   
gb|EMT08969.1|  Hexokinase-5                                            366   2e-117   
gb|AAT77514.1|  hexokinase 4                                            364   3e-117   
gb|EMT06972.1|  Hexokinase-4, chloroplastic                             368   6e-117   
gb|EMS55979.1|  Hexokinase-5                                            365   6e-117   
gb|KHN39431.1|  Hexokinase-2, chloroplastic                             369   4e-116   
ref|XP_010461576.1|  PREDICTED: hexokinase-like 1 protein isoform X1    360   8e-115   
ref|XP_002306924.2|  hypothetical protein POPTR_0005s25980g             355   7e-114   
gb|KEH40228.1|  hexokinase                                              355   2e-113   
emb|CDM84160.1|  unnamed protein product                                354   2e-113   
tpg|DAA57818.1|  TPA: hypothetical protein ZEAMMB73_547897              354   3e-113   
ref|XP_010443879.1|  PREDICTED: hexokinase-3-like isoform X2            353   4e-113   
ref|XP_010443756.1|  PREDICTED: hexokinase-3-like isoform X1            353   4e-113   
ref|XP_008778614.1|  PREDICTED: hexokinase-2-like isoform X1            351   5e-112   
ref|XP_006451308.1|  hypothetical protein CICLE_v10008086mg             350   6e-112   
ref|XP_010665884.1|  PREDICTED: hexokinase-1-like                       352   4e-111   
ref|XP_006466389.1|  PREDICTED: probable hexokinase-like 2 protei...    350   9e-110   
ref|XP_006426179.1|  hypothetical protein CICLE_v10027315mg             346   1e-108   
ref|XP_003635485.1|  PREDICTED: probable hexokinase-like 2 protein      346   2e-108   
ref|XP_008440464.1|  PREDICTED: probable hexokinase-like 2 protei...    347   2e-108   
ref|XP_002456268.1|  hypothetical protein SORBIDRAFT_03g033200          342   3e-108   
ref|XP_006654122.1|  PREDICTED: hexokinase-7-like                       340   5e-108   
gb|AEB00837.1|  hexokinase 1                                            338   1e-107   
gb|AAF99786.1|AC012463_3  T2E6.5                                        353   6e-107   
gb|EMS52462.1|  Hexokinase-2                                            339   8e-107   
gb|KDO78770.1|  hypothetical protein CISIN_1g038487mg                   340   2e-106   
gb|KCW82328.1|  hypothetical protein EUGRSUZ_C03728                     335   4e-106   
ref|XP_004143424.1|  PREDICTED: probable hexokinase-like 2 protei...    339   1e-105   
emb|CBI23516.3|  unnamed protein product                                338   2e-105   
gb|EMS60419.1|  Hexokinase-9                                            332   9e-105   
gb|KFK39986.1|  hypothetical protein AALP_AA3G315000                    335   1e-104   
ref|XP_002528913.1|  hexokinase, putative                               335   4e-104   
ref|XP_008365574.1|  PREDICTED: probable hexokinase-like 2 protein      334   3e-103   
ref|XP_009382581.1|  PREDICTED: hexokinase-3-like isoform X4            330   3e-103   



>gb|AFO84085.1| hexokinase [Actinidia chinensis]
Length=509

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/459 (78%), Positives = 407/459 (89%), Gaps = 4/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+ + VLEEL++ CA  VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD   NGSE
Sbjct  34    WRRAVVVLEELDQGCAAEVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDSFLNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLG TNFRVLRVQLGG  SA + H+V+++PIPQHL+T TSEDLFDFIASSL +
Sbjct  94    KGTYYALDLGSTNFRVLRVQLGGNSSAILEHEVERKPIPQHLMTSTSEDLFDFIASSLNE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++  D E S  + R LGFTFSFPVKQTSVSSGILIKWT+GF IE++VG++VSECL+ 
Sbjct  154   FVEKEG-DPELSSVKRRELGFTFSFPVKQTSVSSGILIKWTKGFSIENLVGKDVSECLEQ  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A S++GLD+RVAAL+NDTV TLALGHY+DEDTVAAVI GTGTNACY+ERADAIIK QGLL
Sbjct  213   AMSKRGLDMRVAALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERADAIIKSQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MV+NMEWGNFWS+HLPRTSYD DLDADSPNPNDQ FEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGGMVINMEWGNFWSTHLPRTSYDVDLDADSPNPNDQSFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE DVFGPVSS+L+ PF+LRTPLM AMH+DDSP+L EVAR+L ++LE+PDVPLK+RKL
Sbjct  333   MSQESDVFGPVSSRLSEPFILRTPLMVAMHEDDSPDLREVARILNDVLEIPDVPLKVRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S S+++RTVVAIEGGL
Sbjct  393   VVNVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT-SARIKTGSQSKIRRTVVAIEGGL  451

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSY+ FREYLNEA+AEILGEEVS HV + VTEDGSGIG
Sbjct  452   YTSYSMFREYLNEAMAEILGEEVSPHVILKVTEDGSGIG  490



>ref|XP_006362320.1| PREDICTED: hexokinase-3-like [Solanum tuberosum]
Length=512

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/459 (81%), Positives = 415/459 (90%), Gaps = 3/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K+++VLEELEE+C T V RL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE
Sbjct  34    WLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EGT+YALDLGGTNFRVLRV LG QRSA +  D+++QPIPQHL+T TSEDLFDFIASSLKD
Sbjct  94    EGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIASSLKD  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +D E +  + R LGFTFSFPVKQ+SVSSGIL+KWT+GF IED +GR+VSECLQ 
Sbjct  154   FIEKEGNDLEQTSPRRRELGFTFSFPVKQSSVSSGILMKWTKGFAIEDTIGRDVSECLQL  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A SRKGLD+RVAALINDTV TLALGHYNDEDTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   ALSRKGLDVRVAALINDTVGTLALGHYNDEDTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLD  SPNPNDQGFEKMISGMYLGDIVRRVLLR
Sbjct  274   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDVASPNPNDQGFEKMISGMYLGDIVRRVLLR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS++ D FGP SSKLA+PF+LRTPLMAAMH+DDSP+LSEVA++L E+LELPDVP+K+RKL
Sbjct  334   MSKQSDDFGPSSSKLAIPFVLRTPLMAAMHEDDSPDLSEVAKILEEVLELPDVPVKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDV+TRRAARLAAAGIVGILKKIGRDG+GGIA       +  SRM+RTVVAIEGGL
Sbjct  394   VVKVCDVITRRAARLAAAGIVGILKKIGRDGSGGIA-SGKFRSNRPSRMRRTVVAIEGGL  452

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSYT+FREYLNEA+AEILGEEVS +V + V EDGSG G
Sbjct  453   YTSYTTFREYLNEAMAEILGEEVSPYVVLRVMEDGSGTG  491



>ref|XP_004251354.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
 ref|XP_010313255.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
Length=511

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/459 (81%), Positives = 414/459 (90%), Gaps = 3/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K+++VLEELEE+C T V RL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG E
Sbjct  34    WLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EGT+YALDLGGTNFRVLRV LG QRSA +  D+++QPIPQHL+T TSEDLFDFIASSLKD
Sbjct  94    EGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIASSLKD  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +D E +  + R LGFTFSFPVKQ+SVSSGIL+KWT+GF IED +GR+VSECLQ 
Sbjct  154   FIEKEGNDLEQTSPRRRGLGFTFSFPVKQSSVSSGILMKWTKGFAIEDTIGRDVSECLQL  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A SRKGLD+RVAALINDTV TLALGHYNDEDTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   ALSRKGLDVRVAALINDTVGTLALGHYNDEDTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLD  SPNPNDQGFEKMISGMYLGDIVRRVLLR
Sbjct  274   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDVASPNPNDQGFEKMISGMYLGDIVRRVLLR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS++ D FGP SSKLA+PF+LRTPLMAAMH+DDSP+LSEVA++L E+LELPDVP+K+RKL
Sbjct  334   MSKQSDDFGPSSSKLAVPFVLRTPLMAAMHEDDSPDLSEVAKILEEVLELPDVPVKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDV+TRRAARLAAAGIVGILKKIGRDG+GGIA       +  SR++RTVVAIEGGL
Sbjct  394   VVKVCDVITRRAARLAAAGIVGILKKIGRDGSGGIA-SGKFRSNRPSRLRRTVVAIEGGL  452

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSYT+FREYLNEA+AEILGEEVS +V + V EDGSG G
Sbjct  453   YTSYTTFREYLNEAMAEILGEEVSPYVILRVMEDGSGTG  491



>gb|EYU46224.1| hypothetical protein MIMGU_mgv1a004779mg [Erythranthe guttata]
Length=510

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/459 (78%), Positives = 403/459 (88%), Gaps = 3/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+VLRVLEELEE CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT++  LP G+E
Sbjct  34    WRRVLRVLEELEEGCATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFIHNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFRVLRV+LGG+RS+    DV ++PIPQHL+T T+E+LFDFIA+SLKD
Sbjct  94    KGIYYALDLGGTNFRVLRVKLGGERSSITELDVDRKPIPQHLMTSTTEELFDFIATSLKD  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ +  E SQG  R LGFTFSFP KQ S SSG LIKWT+GF IEDMVGR+VS+CLQ 
Sbjct  154   FVEKEENVPEPSQGERRELGFTFSFPFKQISSSSGTLIKWTKGFSIEDMVGRDVSQCLQE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A SRKGLD+RV ALINDTV TLALGHY+DEDTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   AMSRKGLDMRVTALINDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDADSPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGSMVVNMEWGNFWSSHLPRTSYDVDLDADSPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS E DVFG +SSKL +PF+LRTP++AAMH+DDSP L EV R+L + LE+ +VPL +RKL
Sbjct  334   MSLESDVFGLISSKLHVPFILRTPMIAAMHEDDSPNLEEVGRILQDTLEISEVPLNVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVT RAARLAAAGIVGILKKIGRDG+GGI       G  S +MKRTVVA+EGGL
Sbjct  394   VVKVCDVVTCRAARLAAAGIVGILKKIGRDGSGGIT-NAKSKGGGSMKMKRTVVAVEGGL  452

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+YT FREYLNEA+ +ILG++V+SHV I  TEDGSGIG
Sbjct  453   YTNYTMFREYLNEAMVQILGDDVASHVIIKATEDGSGIG  491



>ref|XP_011090147.1| PREDICTED: hexokinase-3-like [Sesamum indicum]
Length=506

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/446 (79%), Positives = 393/446 (88%), Gaps = 2/446 (0%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV KLP G E GT+YAL LGGTN
Sbjct  47    GCATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHKLPTGKERGTYYALHLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
              RVLRVQLGGQRS  I  D+ +QPIPQ+L+T TSE+LFDF+A+ LKDF+ER+   S  +Q
Sbjct  107   SRVLRVQLGGQRSTIIGRDLDRQPIPQNLMTSTSEELFDFVATLLKDFVEREEKGSITTQ  166

Query  401   --GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
                R LGFTFSFPVKQTS SSG LIKWT+GF +EDMVGR+VSECLQ A SRKGLD+RVA 
Sbjct  167   QESRELGFTFSFPVKQTSSSSGNLIKWTKGFSVEDMVGRDVSECLQQAISRKGLDMRVAV  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHY+DEDTVAAVIFGTGTNACY+ERADAIIKCQGLLTTSG MVVNMEWG
Sbjct  227   LVNDTVGTLALGHYDDEDTVAAVIFGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLDADSPNPNDQGFEKMISGMYLGDIVRRV+L+MSQE DVFGPVSS
Sbjct  287   NFWSSHLPRTSYDIDLDADSPNPNDQGFEKMISGMYLGDIVRRVILQMSQESDVFGPVSS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL +PF+LRT LMAAMH+DDSP L+EVARVL + LE+PDVP  +R+LVV +CDVVTRRAA
Sbjct  347   KLHVPFILRTHLMAAMHEDDSPNLTEVARVLKDTLEIPDVPFSVRRLVVNICDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA GK + GS +  M+RTVVA+EGGLYT YT FREYLNE
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIAGGKTKVGSKNKMMRRTVVAVEGGLYTDYTMFREYLNE  466

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGE+V+ +V I +T+DGSGIG
Sbjct  467   AMEEILGEDVAPYVVIKMTKDGSGIG  492



>gb|AAS60198.1| hexokinase 6 [Nicotiana tabacum]
Length=510

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/446 (81%), Positives = 399/446 (89%), Gaps = 3/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C TPVGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG E+GT+YAL LGGTN
Sbjct  47    SCGTPVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGREKGTYYALHLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLRV LGGQRSA +  D+++QPIPQHL+T TSEDL DF+ASSLKDFIE++ +  E   
Sbjct  107   FRVLRVHLGGQRSAILGQDIERQPIPQHLMTSTSEDLLDFVASSLKDFIEKEGNGLEQPS  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQTS SSGILIKWT+GF IEDM+GR+VSECLQ A +RKG D+RVAA
Sbjct  167   PRRRELGFTFSFPVKQTSASSGILIKWTKGFSIEDMIGRDVSECLQQAIARKGQDVRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             LINDTV TLALGHYNDEDTVAAV+ GTGTNACY+ERADAIIKCQGLLTTSG MVVNMEWG
Sbjct  227   LINDTVGTLALGHYNDEDTVAAVVIGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLD  SPNPNDQGFEKMISG+YLGDIVRRVLLRMSQE D FGP SS
Sbjct  287   NFWSSHLPRTSYDIDLDVASPNPNDQGFEKMISGLYLGDIVRRVLLRMSQESDDFGPASS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KLA+PF LRTPLMAAMH+DDSP+LSEVAR+LGE+LELPDVP+K+RKLVV+VCDV+TRRAA
Sbjct  347   KLAVPFALRTPLMAAMHEDDSPDLSEVARILGEVLELPDVPVKVRKLVVKVCDVITRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA G        SRM+RTVVAIEGGLYTSYT FREYLNE
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA-GGKFRSDRPSRMRRTVVAIEGGLYTSYTLFREYLNE  465

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGEE+SS+V + V EDGSGIG
Sbjct  466   AMKEILGEEISSNVILRVMEDGSGIG  491



>ref|XP_009622479.1| PREDICTED: hexokinase-3-like [Nicotiana tomentosiformis]
Length=510

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/446 (81%), Positives = 398/446 (89%), Gaps = 3/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C TPVGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG E+GT+YAL LGGTN
Sbjct  47    SCGTPVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGREKGTYYALHLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLRV LGGQRSA +  D+++QPIPQHL+T TSEDL DF+ASSLKDFIE++ +  E   
Sbjct  107   FRVLRVHLGGQRSAILGQDIERQPIPQHLMTSTSEDLLDFVASSLKDFIEKEGNGLEQPS  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQTS SSGILIKWT+GF IEDM+GR+VSECLQ A +RKG D+RVAA
Sbjct  167   PRRRELGFTFSFPVKQTSASSGILIKWTKGFSIEDMIGRDVSECLQQAIARKGQDVRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             LINDTV TLALGHY DEDTVAAV+ GTGTNACY+ERADAIIKCQGLLTTSG MVVNMEWG
Sbjct  227   LINDTVGTLALGHYTDEDTVAAVVIGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLD  SPNPNDQGFEKMISG+YLGDIVRRVLLRMSQE D FGP SS
Sbjct  287   NFWSSHLPRTSYDIDLDVASPNPNDQGFEKMISGLYLGDIVRRVLLRMSQESDDFGPASS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KLA+PF LRTPLMAAMH+DDSP+LSEVAR+LGE+LELPDVP+K+RKLVV+VCDV+TRRAA
Sbjct  347   KLAVPFALRTPLMAAMHEDDSPDLSEVARILGEVLELPDVPVKVRKLVVKVCDVITRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA G        SRM+RTVVAIEGGLYTSYT FREYLNE
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA-GGKFRSDRPSRMRRTVVAIEGGLYTSYTLFREYLNE  465

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGEE+SS+V + V EDGSGIG
Sbjct  466   AMKEILGEEISSNVILRVMEDGSGIG  491



>ref|XP_009798645.1| PREDICTED: hexokinase-3-like [Nicotiana sylvestris]
Length=510

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/446 (81%), Positives = 398/446 (89%), Gaps = 3/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C TPVGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG E+GT+YAL LGGTN
Sbjct  47    SCGTPVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGREKGTYYALHLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FRVLRV LG QRSA +  D+++QPIPQHL+T TSEDL DF+ASSLK+FIE++    E   
Sbjct  107   FRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLLDFVASSLKNFIEKEGDGLEQPS  166

Query  401   GR--SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              R   LGFTFSFPVKQTSVSSGILIKWT+GF IEDM+GR+VSECLQ A +RKG D+RVAA
Sbjct  167   PRRKELGFTFSFPVKQTSVSSGILIKWTKGFAIEDMIGRDVSECLQQAIARKGQDVRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             LINDTV TLALGHYNDEDTVAAV+ GTGTNACY+ERADAIIKCQGLLTTSGSMVVNMEWG
Sbjct  227   LINDTVGTLALGHYNDEDTVAAVVIGTGTNACYLERADAIIKCQGLLTTSGSMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLD  SPNPNDQGFEKMISG+YLGDIVRRVLLRMSQE D FGP SS
Sbjct  287   NFWSSHLPRTSYDVDLDVASPNPNDQGFEKMISGLYLGDIVRRVLLRMSQESDDFGPASS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KLA+PF LRTPLMAAMH+DDSP+LSEVA++LGE+LELPDVP+K+RKLVV+VCDV+TRRAA
Sbjct  347   KLAVPFALRTPLMAAMHEDDSPDLSEVAKILGEVLELPDVPVKVRKLVVKVCDVITRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA G        SRM+RTVVAIEGGLYTSYT FREYLNE
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA-GGKFRSDRPSRMRRTVVAIEGGLYTSYTLFREYLNE  465

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGEE+SS+V + V EDGSGIG
Sbjct  466   AMKEILGEEISSNVILRVMEDGSGIG  491



>ref|XP_003517518.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=498

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/458 (76%), Positives = 396/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W+KV  V+ ELEE CAT VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WKKVANVVRELEEGCATRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGGTNFRVLRVQL GQ S+   H+V++QPIPQH++T TSEDLFDFIASSLK+
Sbjct  94    RGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQGR-SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             FI ++   S  SQ R  LGFTFSFPVKQ SVSSGILIKWT+GF I +MVGR+V+ CLQ A
Sbjct  154   FIAKEGDGSNISQDRRELGFTFSFPVKQMSVSSGILIKWTKGFSIGNMVGRDVATCLQEA  213

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
              +RKGLD+RVAAL+NDTV TLA+GHY+D DTVAA+I GTGTNACY+ER DAIIKCQGLL 
Sbjct  214   LARKGLDVRVAALVNDTVGTLAVGHYHDPDTVAAIIIGTGTNACYLERVDAIIKCQGLLM  273

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+L+M
Sbjct  274   TSGRMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILKM  333

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             S E D+FGP+S KL+MPF+L TPLMAAMH+D+SP+L EVAR+L +I E+PDVPLK RK+V
Sbjct  334   SLESDMFGPISPKLSMPFILWTPLMAAMHEDNSPDLREVARILNDIFEIPDVPLKARKIV  393

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RTVVAIEGGLY
Sbjct  394   VKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDMKMRRTVVAIEGGLY  450

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             + YT FREYL EA+ EILGE+++ HV + VTEDGSGIG
Sbjct  451   SKYTLFREYLREALNEILGEDIAKHVILKVTEDGSGIG  488



>ref|XP_008450397.1| PREDICTED: hexokinase-3-like [Cucumis melo]
Length=507

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 398/458 (87%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VLEELE  C TPV RLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LPNGSE
Sbjct  35    WKRVVGVLEELEATCDTPVRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGSE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GTFYALDLGGTNFRVLRV LGGQRS T++HDV++QPIPQ+L+TGT E LFDFIASSLK+
Sbjct  95    KGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFDFIASSLKE  154

Query  362   FIER-DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             F+E+ D  D    + + LGFTFSFPVKQTS SSG+LIKWT+GF IEDMVGR+ +E LQ A
Sbjct  155   FVEKTDDPDELAPRRKELGFTFSFPVKQTSASSGVLIKWTKGFSIEDMVGRDAAESLQQA  214

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
               + GLD+RV+ LINDTV TLA+GHY D DTVAAVI GTGTNACYVER DAIIKCQGL T
Sbjct  215   IDKIGLDMRVSVLINDTVGTLAVGHYQDPDTVAAVIIGTGTNACYVERTDAIIKCQGLCT  274

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSGSMV+NMEWGNFWSSHLPRT+YD DLDADSPNP+DQGFEKMISGMYLGDIVRRV+LR+
Sbjct  275   TSGSMVINMEWGNFWSSHLPRTTYDIDLDADSPNPSDQGFEKMISGMYLGDIVRRVILRI  334

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             SQE DVFGP S++L+MPF LRTP+MAAMH+D S EL+EVAR+  +ILE+ D+PLK+RKLV
Sbjct  335   SQESDVFGPASTRLSMPFKLRTPMMAAMHEDSSLELTEVARIFEDILEITDIPLKVRKLV  394

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V++CD+VTRRAARLAAAGIVGILKKIGRDGT GIA        +  +++RTVVAIEGGLY
Sbjct  395   VKICDIVTRRAARLAAAGIVGILKKIGRDGTSGIA---GGRSRADVKLRRTVVAIEGGLY  451

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             TSYT FREYL+EA+ EILGE+++ HV +  TEDGSGIG
Sbjct  452   TSYTIFREYLHEALVEILGEDIAPHVILKPTEDGSGIG  489



>ref|XP_004154641.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
Length=507

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 396/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VLEELE  C TP+ RLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LPNGSE
Sbjct  35    WKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGSE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GTFYALDLGGTNFRVLRV LGGQRS T++HDV++QPIPQ+L+TGT E LFDFIASSLK+
Sbjct  95    IGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFDFIASSLKE  154

Query  362   FIER-DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             F+E+ D  D    + + LGFTFSFPVKQTS SSG+LIKWT+GF IEDMVGR+ +E LQ A
Sbjct  155   FVEKTDDPDELAPRRKELGFTFSFPVKQTSASSGVLIKWTKGFSIEDMVGRDAAESLQQA  214

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
               R GL +RV+ LINDTV TLA+GHY D DTVAAVI GTG+NACYVER DAIIKCQGL T
Sbjct  215   IDRIGLGLRVSVLINDTVGTLAVGHYQDPDTVAAVIIGTGSNACYVERTDAIIKCQGLCT  274

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSGSMV+NMEWGNFWSSHLPRT+YD DLDADSPNP+DQGFEKMISGMYLGDIVRRV+LR+
Sbjct  275   TSGSMVINMEWGNFWSSHLPRTTYDIDLDADSPNPSDQGFEKMISGMYLGDIVRRVILRI  334

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             SQE DVFGP S++L+MPF LRTP+MAAMH+D SPEL+EVAR+  +ILE+ D+PLK+RKLV
Sbjct  335   SQESDVFGPASTRLSMPFKLRTPMMAAMHEDSSPELTEVARIFEDILEITDIPLKVRKLV  394

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V++CD+VTRRAARLAAAGIVGILKKIGRDGT GIA        +  + +RTVVAIEGGLY
Sbjct  395   VKICDIVTRRAARLAAAGIVGILKKIGRDGTSGIA---GGRSRADVKPRRTVVAIEGGLY  451

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             TSYT FREYL+EA+ EILGEE++ HV +  TEDGSGIG
Sbjct  452   TSYTIFREYLHEALVEILGEEIAPHVILKPTEDGSGIG  489



>ref|XP_002274759.1| PREDICTED: hexokinase-3 isoform X1 [Vitis vinifera]
 emb|CBI17194.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/446 (78%), Positives = 393/446 (88%), Gaps = 4/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VDKLPNGSE G +YALDLGGTN
Sbjct  47    ACETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDKLPNGSERGKYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVL++QLGG+ S+ +  DV++QPIPQ L+T TSEDLFDFIASSLK F+ER++ +SE S 
Sbjct  107   FRVLQIQLGGKTSSILSCDVERQPIPQDLMTSTSEDLFDFIASSLKQFVEREAQNSEFSP  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQTSVSSGILIKWT+ F ++DMVG++VSECLQ A +R GLD+RVA 
Sbjct  167   VKRRELGFTFSFPVKQTSVSSGILIKWTKRFSVKDMVGKDVSECLQHAMTRNGLDMRVAV  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHYND DTVAAVI GTGTNACY+ER DAIIKCQGLLTTSG MVVNMEWG
Sbjct  227   LVNDTVGTLALGHYNDPDTVAAVIIGTGTNACYLERTDAIIKCQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLD DSPNPNDQGFEKMISGMYLGDIVRRV+LRMSQE D+FGPVSS
Sbjct  287   NFWSSHLPRTSYDIDLDGDSPNPNDQGFEKMISGMYLGDIVRRVILRMSQESDIFGPVSS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             +L+MPF+L TP MA MH D+SPEL EVAR+L E L++PDVPLK+RKLVV+VCDVVTRRAA
Sbjct  347   RLSMPFILSTPSMADMHADESPELMEVARILKEDLQIPDVPLKVRKLVVKVCDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GG+A    RS  S  +M+RTVVA++G LYT YT F+EYL+E
Sbjct  407   RLAAAGIVGILKKIGRDGSGGVA--SGRSRGSDGKMRRTVVAMDGSLYTRYTMFKEYLHE  464

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGEEV+ +V + VTEDGSGIG
Sbjct  465   ALCEILGEEVAQYVILKVTEDGSGIG  490



>ref|XP_004139044.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
 gb|KGN66504.1| hypothetical protein Csa_1G615730 [Cucumis sativus]
Length=507

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 396/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VLEELE  C TP+ RLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LPNGSE
Sbjct  35    WKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGSE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GTFYALDLGGTNFRVLRV LGGQRS T++HDV++QPIPQ+L+TGT E LFDFIASSLK+
Sbjct  95    IGTFYALDLGGTNFRVLRVPLGGQRSLTLKHDVERQPIPQNLMTGTREGLFDFIASSLKE  154

Query  362   FIER-DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             F+E+ D  D    + + LGFTFSFPVKQTS SSG+LIKWT+GF IEDMVGR+ +E LQ A
Sbjct  155   FVEKTDDPDELAPRRKELGFTFSFPVKQTSASSGVLIKWTKGFSIEDMVGRDAAESLQQA  214

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
               R GL +RV+ LINDTV TLA+GHY D DTVAAVI GTG+NACYVER DAIIKCQGL T
Sbjct  215   IDRIGLGLRVSVLINDTVGTLAVGHYQDPDTVAAVIIGTGSNACYVERTDAIIKCQGLCT  274

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSGSMV+NMEWGNFWSSHLPRT+YD DLDADSPNP+DQGFEKMISGMYLGDIVRRV+LR+
Sbjct  275   TSGSMVINMEWGNFWSSHLPRTTYDIDLDADSPNPSDQGFEKMISGMYLGDIVRRVILRI  334

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             SQE DVFGP S++L+MPF LRTP+MAAMH+D SPEL+EVAR+  +ILE+ D+PLK+RKLV
Sbjct  335   SQESDVFGPASTRLSMPFKLRTPMMAAMHEDSSPELTEVARIFEDILEITDIPLKVRKLV  394

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V++CD+VTRRAARLAAAGIVGILKKIGRDGT GIA        +  + +RTVVAIEGGLY
Sbjct  395   VKICDIVTRRAARLAAAGIVGILKKIGRDGTSGIA---GGRSRADVKPRRTVVAIEGGLY  451

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             TSYT FREYL+EA+ EILGEE++ HV +  TEDGSGIG
Sbjct  452   TSYTIFREYLHEALVEILGEEIAPHVILKPTEDGSGIG  489



>ref|XP_004511503.1| PREDICTED: hexokinase-3-like [Cicer arietinum]
Length=498

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/458 (76%), Positives = 393/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WRKV  VL+ELEE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LPNG+E
Sbjct  34    WRKVANVLKELEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YAL LGGTNFRV RV L GQ S  + H+V++QPIP HL+T TSEDLFDFIASSLK+
Sbjct  94    KGPYYALHLGGTNFRVTRVHLTGQPSPVLEHEVERQPIPPHLMTSTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQGR-SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             FI ++   S  SQ R  LGFTFSFPVKQ SVSSGILIKWT+GF I DMVGR+V+ CLQ A
Sbjct  154   FIAKEGDGSNTSQDRRELGFTFSFPVKQMSVSSGILIKWTKGFSIVDMVGRDVAACLQEA  213

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
               RKGL + VAAL+NDTV TLALGHY+D DTVAA+I GTGTNACY+ER DAIIKCQGLLT
Sbjct  214   LERKGLHVHVAALVNDTVGTLALGHYHDPDTVAAIIIGTGTNACYLERIDAIIKCQGLLT  273

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSG MVVNMEWGNFWSSHLPRT YD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+LRM
Sbjct  274   TSGRMVVNMEWGNFWSSHLPRTPYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRM  333

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             S E D+FGP+SSKL+ PF+LRTPLMAAMH+DDSP+L EV+R+L +  E+PDVPLK RK+V
Sbjct  334   SLESDMFGPISSKLSTPFVLRTPLMAAMHEDDSPDLIEVSRILNDTFEIPDVPLKARKIV  393

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +MKRTVVAIEGGLY
Sbjct  394   VKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDMKMKRTVVAIEGGLY  450

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +SYT FREYL+EA+ EILGE+++ HVT+ VTEDGSGIG
Sbjct  451   SSYTLFREYLHEALNEILGEDIAKHVTLNVTEDGSGIG  488



>ref|XP_010273315.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=513

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/459 (75%), Positives = 407/459 (89%), Gaps = 2/459 (0%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL+ELEE C+T +GRL+QVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP+G+E
Sbjct  34    WSRVVGVLKELEEGCSTSIGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGTNFRVLRVQLGG+ S  + H+V +QPIPQHL+T TSE LFDFI S L+ 
Sbjct  94    KGTYYALHLGGTNFRVLRVQLGGENSLILGHEVDRQPIPQHLMTSTSEGLFDFIVSKLEQ  153

Query  362   FIERDSSDSEH--SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+ + S     + R LGFTFSFPVKQTSVSSGILIKWT+GF IEDM+G++VSECLQ 
Sbjct  154   FVEREGNGSMSMLDKRRELGFTFSFPVKQTSVSSGILIKWTKGFSIEDMIGKDVSECLQQ  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RVAAL+NDTV TLALGHY+D DTVAAVI GTGTNACYVER D+IIKCQGLL
Sbjct  214   AIRKRGLDMRVAALVNDTVGTLALGHYHDADTVAAVIIGTGTNACYVERTDSIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWS+HLPRTSYD DLD+DSPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TKSGGMVVNMEWGNFWSTHLPRTSYDIDLDSDSPNPNDQGFEKMISGMYLGDIVRRVMLR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS+E D+FG  +S+L++PF+L+TPLMAAMH+DDSP+L +V+R+L E LE+ DVPLK+RKL
Sbjct  334   MSKESDIFGDATSRLSVPFILKTPLMAAMHEDDSPDLKDVSRILKETLEISDVPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V +CDVVTRRAARLAAAGIVGILKKIGRDG+GGI SG+ +SG +SSR +RTVVAIEGGL
Sbjct  394   IVRICDVVTRRAARLAAAGIVGILKKIGRDGSGGIMSGRTKSGETSSRKRRTVVAIEGGL  453

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSY+ FREYLNEAVAEILGEE++ +V + V+EDGSGIG
Sbjct  454   YTSYSLFREYLNEAVAEILGEEMAPYVVLKVSEDGSGIG  492



>ref|XP_006590474.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=498

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/458 (75%), Positives = 393/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W+KV  V+ ELEE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WKKVANVVRELEEGCDTRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGGTNFRVLRVQL GQ S+   H+V++QPIPQH++T TSEDLFDFIASSLK+
Sbjct  94    RGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQGR-SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             FI ++   S  SQ R  LGFTFSFPVKQ SVSSGILIKWT+GF I DMVGR+V+ CLQ A
Sbjct  154   FIAKEGDGSNISQDRRELGFTFSFPVKQMSVSSGILIKWTKGFSIVDMVGRDVAACLQEA  213

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
              +RKGLD+RVAAL+NDTV TLA+GHY+D DTVAA+I GTGTNACY ER DAIIKCQGLL 
Sbjct  214   LTRKGLDMRVAALVNDTVGTLAVGHYHDPDTVAAIIIGTGTNACYWERVDAIIKCQGLLM  273

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+L+M
Sbjct  274   TSGRMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILKM  333

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             S E D+FGP+S KL+MPF++RTPLM+AMH+D+SP+L EVAR+L +I E+PD+PLK RK V
Sbjct  334   SLESDMFGPISPKLSMPFIMRTPLMSAMHEDNSPDLREVARILNDIFEIPDIPLKARKFV  393

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RTVVAIEGGLY
Sbjct  394   VKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDMKMRRTVVAIEGGLY  450

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             + Y  FREYL EA+ EILGE+++ HV + VTEDGSGIG
Sbjct  451   SKYALFREYLREALNEILGEDIAKHVILKVTEDGSGIG  488



>ref|XP_010246625.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=511

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/459 (75%), Positives = 406/459 (88%), Gaps = 2/459 (0%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL ELEE C+T +GRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WNRVVGVLRELEEGCSTSIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRVQLGG+ S  + H+V++QPIP+HL+T TSEDLFDFIAS+L+ 
Sbjct  94    KGTYYALDLGGTNFRVLRVQLGGKNSLILGHEVERQPIPEHLMTSTSEDLFDFIASTLEK  153

Query  362   FIERDSSDS--EHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ +       + R LGFTFSFPVKQTSVSSGILIKWT+GF IEDMVG++V+ECLQ 
Sbjct  154   FVEKEGNGYIVPLDRRRELGFTFSFPVKQTSVSSGILIKWTKGFSIEDMVGKDVAECLQQ  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A SR+GLD+RV AL+NDTV TLALGHY+DEDTVAAVI GTGTNACYVER DAIIK QGLL
Sbjct  214   AISRRGLDMRVVALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYVERTDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWS+HLPRTSYD+DLDADSPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TKSGGMVVNMEWGNFWSTHLPRTSYDTDLDADSPNPNDQGFEKMISGMYLGDIVRRVMLR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M++E D+FG  + +L+ PF+LRTPLMAA+H+D+SP+L EV+R+L E LEL +VPLK+RK+
Sbjct  334   MAEESDIFGDATCRLSEPFILRTPLMAAIHEDESPDLREVSRILQETLELTNVPLKVRKV  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V VCD+VTRRAARLAAAGIVGILKKIGRDG+GG+ S + ++G  SSRM+RTVVAIEGGL
Sbjct  394   IVRVCDIVTRRAARLAAAGIVGILKKIGRDGSGGVMSVRTKTGEPSSRMRRTVVAIEGGL  453

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y SY+ FREYL+EAVAEILGEEV+ +V + + EDGSGIG
Sbjct  454   YASYSMFREYLSEAVAEILGEEVAPYVVLKILEDGSGIG  492



>ref|XP_010673708.1| PREDICTED: hexokinase-3-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 403/460 (88%), Gaps = 3/460 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL+ELEE C T V RL+QVVDAMAVEMHAGLASEGGSKLKMLLT+VDKLPNGSE
Sbjct  34    WQRVVGVLKELEECCGTHVSRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDKLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFRVLRVQLGG+RS  +RHDV+++PIP+HL+T TSEDLFDFIA+SLKD
Sbjct  94    KGIYYALDLGGTNFRVLRVQLGGRRSGIVRHDVERKPIPEHLMTSTSEDLFDFIATSLKD  153

Query  362   FIERD---SSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             F  ++   SSD      R LGFTFSFPVKQ SVSSGIL+KWT+GF I DMVG +VSECL 
Sbjct  154   FYGQENDKSSDLSPVSRRKLGFTFSFPVKQISVSSGILMKWTKGFSIRDMVGSDVSECLH  213

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A SR+GLD+ +AAL+ND+V TLALGHYNDEDTVAAVI GTGTNACY ERADAIIK QGL
Sbjct  214   QAMSRQGLDMHIAALVNDSVGTLALGHYNDEDTVAAVIIGTGTNACYFERADAIIKSQGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
              T+SG MVVNMEWGNFWSSHLPRTSYD +LDA+SPNPNDQGFEKMISGMYLG+IVRRV+L
Sbjct  274   PTSSGGMVVNMEWGNFWSSHLPRTSYDIELDAESPNPNDQGFEKMISGMYLGEIVRRVIL  333

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             RMS+E DVFGP+SS L   F+LRTPLM+ MH+DDSP+L EVAR+L E+L + DVPLK+RK
Sbjct  334   RMSKESDVFGPISSSLCEAFILRTPLMSTMHEDDSPDLEEVARILEEVLGICDVPLKVRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV VCDVVTRRAARLAAAGIVGILKKIGRDG+GG+AS + +  SSS+R+KRTVVA+EGG
Sbjct  394   LVVNVCDVVTRRAARLAAAGIVGILKKIGRDGSGGVASSRAKGSSSSNRLKRTVVAVEGG  453

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY++Y  FREYLN+AVAEILGEE++  V + VTEDGSGIG
Sbjct  454   LYSNYRMFREYLNDAVAEILGEEIAPFVILKVTEDGSGIG  493



>ref|XP_011032066.1| PREDICTED: hexokinase-3 isoform X1 [Populus euphratica]
 ref|XP_011032067.1| PREDICTED: hexokinase-3 isoform X2 [Populus euphratica]
Length=508

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/459 (76%), Positives = 397/459 (86%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL ELEEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPRGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRVLR+QLGG+RS+ +  DV++QPIPQHL+T TSEDLFDFIAS+LK 
Sbjct  94    IGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ S SE S  + R LG TFSFPVKQ S+ SGIL KWT+GF IEDMVG+ V   L+A
Sbjct  154   FVEKEESGSEPSSVRARELGLTFSFPVKQLSMHSGILEKWTKGFAIEDMVGKEVVALLEA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ VA L+NDTV TLALGHY+D DTVAAVI GTGTNACY+ERADAIIKCQG+L
Sbjct  214   ALVRSGLDMHVAVLVNDTVGTLALGHYDDADTVAAVIIGTGTNACYLERADAIIKCQGVL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD +SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGCMVVNMEWGNFWSSHLPRTSYDIDLDLESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQ+ D+FGPVSS+L++PF+L+TPL+AAMH+DDSPEL EV ++L E LE+ +V LK+RKL
Sbjct  334   MSQDSDIFGPVSSRLSIPFILQTPLLAAMHEDDSPELKEVDKILKETLEISEVSLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RTVVAIEGGL
Sbjct  394   VVRVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDVKMRRTVVAIEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSYT FREYL+EA+ EILGE+V+ HV + VTEDGSGIG
Sbjct  451   YTSYTMFREYLHEALNEILGEDVAQHVILKVTEDGSGIG  489



>ref|XP_007156986.1| hypothetical protein PHAVU_002G034000g [Phaseolus vulgaris]
 ref|XP_007156987.1| hypothetical protein PHAVU_002G034000g [Phaseolus vulgaris]
 gb|ESW28980.1| hypothetical protein PHAVU_002G034000g [Phaseolus vulgaris]
 gb|ESW28981.1| hypothetical protein PHAVU_002G034000g [Phaseolus vulgaris]
Length=498

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/458 (75%), Positives = 394/458 (86%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W+KV  V+ ELEE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WKKVANVVRELEEGCDTRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGGTNFRVLRVQL GQ ++ + H+V++QPIP +++T TSEDLFDFIASSLKD
Sbjct  94    RGTYYALHLGGTNFRVLRVQLSGQPTSDLEHEVERQPIPYNVMTSTSEDLFDFIASSLKD  153

Query  362   FIERDSSDSEHSQGR-SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             FI ++   S  SQ R  LGFTFSFPVKQ SVSSGILIKWT+GF I DMVGR+V+ CLQ A
Sbjct  154   FIAKEGEGSNISQDRRELGFTFSFPVKQMSVSSGILIKWTKGFSIVDMVGRDVAACLQEA  213

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
              +R GLD+RVAAL+NDTV TLA+GHY+D DTVAA+I GTGTNACY+ER DAIIKCQGLL 
Sbjct  214   LTRNGLDVRVAALVNDTVGTLAVGHYHDPDTVAAIIIGTGTNACYLERVDAIIKCQGLLM  273

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGD+VRRV+LRM
Sbjct  274   TSGRMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDLVRRVILRM  333

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             S E D+FGP+S KL++PF+LRTPLMAAMH+D+SP+L EVAR+L +  E+P+VPLK RK+V
Sbjct  334   SLESDMFGPISPKLSVPFILRTPLMAAMHEDNSPDLREVARILTDTFEIPEVPLKARKIV  393

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V+VCDVVTRRA RLAAAGIVGILKKIGRDG+GGI         S ++MKRTVVAIEGGLY
Sbjct  394   VKVCDVVTRRAGRLAAAGIVGILKKIGRDGSGGIT---GGRSRSDTKMKRTVVAIEGGLY  450

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             + YT FREYL EA+ EILGE+++ HV + VTEDGSGIG
Sbjct  451   SKYTLFREYLREALDEILGEDIAKHVVLKVTEDGSGIG  488



>ref|XP_002313358.2| hexokinase family protein [Populus trichocarpa]
 gb|EEE87313.2| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/459 (75%), Positives = 397/459 (86%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL ELEEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRVLRVQLGG+RS+ +  DV+++PIP+HL+T TSEDLFDFIAS+LK 
Sbjct  94    IGTYYALDLGGTNFRVLRVQLGGRRSSILSQDVERRPIPRHLMTSTSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ S SE S  + R LG TFSFPVKQ S+ SGIL+KWT+GF IEDMVG+ V   L+A
Sbjct  154   FVEKEESGSEPSSVRARELGLTFSFPVKQLSIRSGILMKWTKGFAIEDMVGKEVVGLLEA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVA L+NDT  TLALGHY+D DTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   ALVRSGLDMRVAVLVNDTAGTLALGHYDDADTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD +SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGCMVVNMEWGNFWSSHLPRTSYDIDLDLESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQ+ D+FGPVSS+L++PF+L+TPL+AAMH+DDSPEL EV ++L E LE+ +V LK+RKL
Sbjct  334   MSQDSDIFGPVSSRLSIPFILQTPLLAAMHEDDSPELKEVDKILKETLEISEVSLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAAGIVGILKKIGRDG+GG+         S  +M+RTVVAIEGGL
Sbjct  394   VVRVCDVVTRRAARLAAAGIVGILKKIGRDGSGGVT---GGRSRSDVKMRRTVVAIEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSYT FREYL+EA+ EILGE+V+ HV + VTEDGSG G
Sbjct  451   YTSYTMFREYLHEALNEILGEDVAHHVILKVTEDGSGTG  489



>gb|AIU64847.1| hexokinase-3 [Prunus sibirica]
Length=508

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/446 (75%), Positives = 393/446 (88%), Gaps = 5/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLPNGSE+GT+YALDLGGTN
Sbjct  47    SCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPNGSEKGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLRV+L G RS+T+ HDV +Q IPQ L+TG+SEDLFDFIASSLK+F+ER+   SE S 
Sbjct  107   FRVLRVKLEGTRSSTLEHDVYRQAIPQDLMTGSSEDLFDFIASSLKEFVEREGDISELSL  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR ++ECL+ A +RKGL++RVAA
Sbjct  167   DRRRELGFTFSFPVKQMSVSSGTLLKWTKGFSIEDMVGREIAECLENAMTRKGLNMRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+ND+V +LALGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLLTTSG MVVNMEWG
Sbjct  227   LVNDSVGSLALGHYHDTDTVAAVIIGTGTNACYLERTDAIIKSQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VRRV++RMSQE D+F P+SS
Sbjct  287   NFWSSHLPRTLYDIELDADSPNPNDQGFEKLISGMYLGDVVRRVIVRMSQESDIFDPISS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL+MPF+LRTPL+AAMH+DDSP+L EV R+L + LE+PDVPLK+RKL+V+VCDVVTRRAA
Sbjct  347   KLSMPFILRTPLIAAMHEDDSPDLEEVRRILRDNLEIPDVPLKVRKLIVKVCDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA        S  +M+RTVVA+EGGLYT YT FR+YL+E
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA---GGRSRSDQKMRRTVVAMEGGLYTGYTMFRDYLHE  463

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGE+++ HV I VTEDGS +G
Sbjct  464   ALTEILGEDIAQHVIIKVTEDGSAMG  489



>ref|XP_008227191.1| PREDICTED: hexokinase-3 isoform X1 [Prunus mume]
Length=508

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/446 (75%), Positives = 393/446 (88%), Gaps = 5/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLPNGSE+GT+YALDLGGTN
Sbjct  47    SCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPNGSEKGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLRV+L G RS+T+ HDV +Q IPQ L+TG+SEDLFDFIASSLK+F+ER+   SE S 
Sbjct  107   FRVLRVKLEGTRSSTLEHDVYRQAIPQDLMTGSSEDLFDFIASSLKEFVEREGDISELSL  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR ++ECL+ A +RKGL++RVAA
Sbjct  167   DRRRELGFTFSFPVKQMSVSSGTLLKWTKGFSIEDMVGREIAECLENAMTRKGLNMRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+ND+V +LALGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLLTTSG MVVNMEWG
Sbjct  227   LVNDSVGSLALGHYHDTDTVAAVIIGTGTNACYLERTDAIIKSQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VRRV++RMSQE D+F P+SS
Sbjct  287   NFWSSHLPRTLYDIELDADSPNPNDQGFEKLISGMYLGDVVRRVIVRMSQESDIFDPISS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL+MPF+LRTPL+AAMH+DDSP+L EV R+L + LE+PDVPLK+RKL+V+VCDVVTRRAA
Sbjct  347   KLSMPFILRTPLIAAMHEDDSPDLEEVRRILRDNLEIPDVPLKVRKLIVKVCDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA        S  +M+RTVVA+EGGLYT YT FR+YL+E
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA---GGRSRSDQKMRRTVVAMEGGLYTGYTMFRDYLHE  463

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGE+++ HV I VTEDGS +G
Sbjct  464   ALTEILGEDIAQHVIIKVTEDGSAMG  489



>ref|XP_006446203.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
 gb|ESR59443.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
Length=510

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/459 (76%), Positives = 402/459 (88%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL ELEE C T V RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  36    WKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPTGSE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFRVLRVQLGGQRS+ +  DV++QPIP  L+TGTSEDLFDFIAS+L+ 
Sbjct  96    KGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDFIASALQQ  155

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ + SE    + R LGFTFSFPVKQTSVSSGILIKWT+GF IE MVG+ V+E LQ 
Sbjct  156   FVEKEGNGSEPPPIRRRELGFTFSFPVKQTSVSSGILIKWTKGFAIESMVGQEVAESLQR  215

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RVAAL+NDTV TLALGHY+DEDTVAAVI GTGTNACY+ER DAIIKCQGLL
Sbjct  216   ALDKRGLDMRVAALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERTDAIIKCQGLL  275

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  276   TTSGGMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILR  335

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS+E D+FGP SS+L+MPF+LRTPLMAAMH+DDSPEL+EVAR+L ++LE+PDVPLK+RKL
Sbjct  336   MSEESDIFGPASSRLSMPFILRTPLMAAMHEDDSPELTEVARILNDVLEIPDVPLKVRKL  395

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V++CDVVTRRAARLAAAGIVGILKKIGRDG+            S  RM+RTVVAIEGGL
Sbjct  396   IVKICDVVTRRAARLAAAGIVGILKKIGRDGS---GGISSGRSRSDIRMRRTVVAIEGGL  452

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FREYL+EA+ +ILG++++ HV + VTEDGSGIG
Sbjct  453   YSSYTLFREYLHEALTDILGDDIAQHVILKVTEDGSGIG  491



>ref|XP_003610965.1| Hexokinase [Medicago truncatula]
 gb|AES93923.1| hexokinase [Medicago truncatula]
Length=496

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/457 (74%), Positives = 390/457 (85%), Gaps = 3/457 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W+KV  VL+E EE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LPNG+E
Sbjct  34    WKKVANVLKEFEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YAL LGGTNFRV RV L GQ S  + H+V++QPIP HL+TGTS+DLFDFIASSLK+
Sbjct  94    KGPYYALHLGGTNFRVTRVHLSGQPSPVLEHEVERQPIPPHLMTGTSKDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             F+ ++   +     R LGFTFSFP+KQ SVSSGILIKWT+GF I DMVGR+V+ CLQ AF
Sbjct  154   FVAKEDGSNSSQDRRELGFTFSFPMKQMSVSSGILIKWTKGFSIVDMVGRDVAACLQEAF  213

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
             +R GLD+ VAAL+NDTV TLA+GHY+D DTVAA++ GTGTNACY+ER DAIIKCQGLLTT
Sbjct  214   ARNGLDVHVAALVNDTVGTLAVGHYHDPDTVAAIVIGTGTNACYLERIDAIIKCQGLLTT  273

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG MVVNMEWGNFWSSHLPRT YD +LDA+SPNPNDQGFEKMISGMYLGDIVRRV+LRMS
Sbjct  274   SGRMVVNMEWGNFWSSHLPRTQYDIELDAESPNPNDQGFEKMISGMYLGDIVRRVILRMS  333

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
              E D+F P+SSKL  PF+LRTPLMAAMH+DDSP+L EVAR+L +  E+PD+PLK RK+VV
Sbjct  334   LESDMFEPISSKLLTPFILRTPLMAAMHEDDSPDLIEVARILNDTFEIPDLPLKARKIVV  393

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
             +VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +MKRTVVAIEGGLY+
Sbjct  394   KVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDIKMKRTVVAIEGGLYS  450

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             SYT FREYL+EA+ EILGE+++ HV + VTEDGSGIG
Sbjct  451   SYTLFREYLHEALNEILGEDIAKHVILNVTEDGSGIG  487



>gb|KHN09247.1| Hexokinase-3 [Glycine soja]
Length=477

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/459 (76%), Positives = 405/459 (88%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+RVL E+EE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKML+T+V  LPNG+E
Sbjct  7     WKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHNLPNGTE  66

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV L GQ+S+ + H+V++QPIPQHL+T TSEDLFDFIASSLK+
Sbjct  67    KGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFIASSLKE  126

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + SE S  + R LGFTFSFPVKQ SVSSGIL+KWT+GF I DMVG +V  C+Q 
Sbjct  127   FIEKEGNASELSLDRRRELGFTFSFPVKQMSVSSGILLKWTKGFSIVDMVGIDVPACMQE  186

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGLD+RVAAL NDTV TLALGHYND DTVA+VI GTGTNACY+ER DAIIKCQGLL
Sbjct  187   ALTRKGLDVRVAALANDTVGTLALGHYNDSDTVASVIIGTGTNACYLERVDAIIKCQGLL  246

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  247   TASGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  306

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M  E D+FGP+SSKL++PF+LRTP+MAAMH+DDSP+L EVAR+L +ILE+PDVPLKLRK+
Sbjct  307   MLLESDMFGPISSKLSIPFMLRTPMMAAMHEDDSPDLREVARILKDILEIPDVPLKLRKV  366

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +MKRTVVAIEGGL
Sbjct  367   VVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT----GGRRSEMKMKRTVVAIEGGL  422

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FREYL+EA+ +ILGE+++ HVT+ VTEDGSG+G
Sbjct  423   YSSYTLFREYLHEALNDILGEDIAKHVTLKVTEDGSGVG  461



>ref|XP_002298298.1| hexokinase family protein [Populus trichocarpa]
 gb|EEE83103.1| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/459 (76%), Positives = 401/459 (87%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+RVLEELEEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WKRVVRVLEELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRVLR+QLGG+RS+ +  DV++QPIPQHL+T TSEDLFDFIAS+LK 
Sbjct  94    IGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ S SE S  + R LGFTFSFPVKQ+S+ SGILIKWT+GF IEDMVG+ V E L+A
Sbjct  154   FVEKEESGSEPSPVRTRELGFTFSFPVKQSSLRSGILIKWTKGFAIEDMVGKEVVELLEA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVA L+NDTV TLALG Y+D DTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   ALVRSGLDMRVALLVNDTVGTLALGRYHDADTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             +S E D+FGPVSS+L++PF+L+TPL+AAMH+DDSPEL EVA++L E LE+ +V LK+RKL
Sbjct  334   ISLESDIFGPVSSRLSIPFILQTPLLAAMHEDDSPELKEVAKILKETLEISEVSLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV +CDVVT RAARLAAAGIVGILKKIGRDG+   A G      S  +MKRTVVAIEGGL
Sbjct  394   VVRICDVVTCRAARLAAAGIVGILKKIGRDGS--GAGGTGGRNRSDVKMKRTVVAIEGGL  451

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSYT FR+YL+EA+ EILG +V+ HV + VTEDGSGIG
Sbjct  452   YTSYTMFRKYLHEALNEILG-DVAQHVILQVTEDGSGIG  489



>ref|XP_003537744.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/459 (76%), Positives = 405/459 (88%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+RVL E+EE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKML+T+V  LPNG+E
Sbjct  34    WKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV L GQ+S+ + H+V++QPIPQHL+T TSEDLFDFIASSLK+
Sbjct  94    KGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + SE S  + R LGFTFSFPVKQ SVSSGIL+KWT+GF I DMVG +V  C+Q 
Sbjct  154   FIEKEGNASELSLDRRRELGFTFSFPVKQMSVSSGILLKWTKGFSIVDMVGMDVPACMQE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGLD+RVAAL NDTV TLALGHYND DTVA+VI GTGTNACY+ER DAIIKCQGLL
Sbjct  214   ALTRKGLDVRVAALANDTVGTLALGHYNDSDTVASVIIGTGTNACYLERVDAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TASGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M  E D+FGP+SSKL++PF+LRTP+MAAMH+DDSP+L EVAR+L +ILE+PDVPLKLRK+
Sbjct  334   MLLESDMFGPISSKLSIPFMLRTPMMAAMHEDDSPDLREVARILKDILEIPDVPLKLRKV  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +MKRTVVAIEGGL
Sbjct  394   VVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT----GGRRSEMKMKRTVVAIEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FREYL+EA+ +ILGE+++ HVT+ VTEDGSG+G
Sbjct  450   YSSYTLFREYLHEALNDILGEDIAKHVTLKVTEDGSGVG  488



>ref|XP_007015149.1| Hexokinase-like 1 [Theobroma cacao]
 gb|EOY32768.1| Hexokinase-like 1 [Theobroma cacao]
Length=506

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/457 (75%), Positives = 393/457 (86%), Gaps = 3/457 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL+ELEE+C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP+GSE
Sbjct  34    WKRVVGVLKELEESCETTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV+LGGQRS+ +  DV++QPIPQ L++G SEDL DFIASSL+ 
Sbjct  94    KGTYYALDLGGTNFRVLRVELGGQRSSVLDQDVERQPIPQQLMSGRSEDLLDFIASSLQQ  153

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             F E  +   + S  + LGFTFSFPVKQTSVSSGILIKWT+GF I+DMVG  V+  LQ A 
Sbjct  154   FDENANDFEKSSIRKELGFTFSFPVKQTSVSSGILIKWTKGFAIKDMVGEEVAGALQQAL  213

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
              RKGL++RVA L+NDTV TLALGHY+D DTVAAVI GTGTNACY ER DAIIKCQGLLTT
Sbjct  214   DRKGLNMRVAVLVNDTVGTLALGHYHDADTVAAVIIGTGTNACYWERTDAIIKCQGLLTT  273

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG MVVNMEWGNFWSSHLPRTSYD +LDA+SPN NDQGFEKMISGMYLG+IVRRV+L+MS
Sbjct  274   SGGMVVNMEWGNFWSSHLPRTSYDIELDAESPNSNDQGFEKMISGMYLGEIVRRVILKMS  333

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             QE D+FGPVSS L+MPF LRTPLMA MH+DDSPEL+EVAR+L  +LE+PDVPLK RKLVV
Sbjct  334   QESDIFGPVSSSLSMPFSLRTPLMAMMHEDDSPELTEVARILKNVLEIPDVPLKARKLVV  393

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
             +VCDVVTRRAARLAAAGIVGILKKIGRDG+ GI         S  +M+RTVVA+EG LYT
Sbjct  394   KVCDVVTRRAARLAAAGIVGILKKIGRDGSSGIT---GGRSRSDIKMRRTVVAVEGSLYT  450

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              YT FREYL+EA+ EILGE+++ HV + VTEDGSGIG
Sbjct  451   QYTMFREYLHEALHEILGEDIAQHVILKVTEDGSGIG  487



>ref|XP_006470700.1| PREDICTED: hexokinase-3-like [Citrus sinensis]
Length=510

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/459 (75%), Positives = 401/459 (87%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL ELEE C T V RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  36    WKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPTGSE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFRVLRVQLGGQRS+ +  DV++QPIP  L+TGTSEDLFDFIAS+L+ 
Sbjct  96    KGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDFIASALQQ  155

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ + SE    + R LGFTFSFPVKQTSVSSGILIKWT+GF IE MVG+ V+E LQ 
Sbjct  156   FVEKEGNGSEPPPIRRRELGFTFSFPVKQTSVSSGILIKWTKGFAIESMVGQEVTESLQR  215

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RVAAL+NDTV TLALGHY+DEDTVAAVI GTGTNACY+ER DAIIKCQGLL
Sbjct  216   ALDKRGLDMRVAALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERTDAIIKCQGLL  275

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  276   TTSGGMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILR  335

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS+E D+FGP SS+L+M F+LRTPLMAAMH+DDSPEL+EVAR+L ++LE+PDVPLK+RKL
Sbjct  336   MSEESDIFGPASSRLSMAFILRTPLMAAMHEDDSPELTEVARILNDVLEIPDVPLKVRKL  395

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V++CDVVTRRAARLAAAGIVGILKKIGRDG+            S  RM+RTVVAIEGGL
Sbjct  396   IVKICDVVTRRAARLAAAGIVGILKKIGRDGS---GGISSGRSRSDIRMRRTVVAIEGGL  452

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FREYL+EA+ +ILG++++ HV + VTEDGSGIG
Sbjct  453   YSSYTLFREYLHEALTDILGDDIAQHVILMVTEDGSGIG  491



>gb|KDP22128.1| hypothetical protein JCGZ_25959 [Jatropha curcas]
Length=499

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/459 (75%), Positives = 392/459 (85%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+VL VL+ELEE+C T +GRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVD LP GSE
Sbjct  34    WRRVLGVLKELEESCETTIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLG TNFRVLRVQLGG+ S  +  DV+QQPIPQHL+T +SEDLFDFIAS+LK 
Sbjct  94    IGTYYALDLGDTNFRVLRVQLGGRESLMLSKDVEQQPIPQHLMTSSSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ S SE +  + R LGFTFSFPVKQTS+ +G LIKWT+GF IEDMVGR+V ECLQA
Sbjct  154   FVEKEESGSEFASVRTRELGFTFSFPVKQTSIRTGNLIKWTKGFAIEDMVGRDVLECLQA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
               +R GLD++V  L+NDTV +LALGHY D DTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   GLTRNGLDMQVVLLVNDTVGSLALGHYCDADTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD +S NPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGGMVVNMEWGNFWSSHLPRTSYDIDLDVESLNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGPVSS+L  PF+L T L+  MH+DDSP+L EVAR+L EILE+ ++PLK RKL
Sbjct  334   MSQETDIFGPVSSRLTTPFILETYLVVDMHEDDSPDLQEVARILKEILEITEIPLKARKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV +CDVVTRRAARLAAAGIVGILKKIGRDGTGGI       G S  +MKRTVVAIEG L
Sbjct  394   VVRICDVVTRRAARLAAAGIVGILKKIGRDGTGGIT---SGRGRSDIKMKRTVVAIEGDL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+YT FREYL+EA+ EILGE+V+ HV +  TEDGSGIG
Sbjct  451   YTTYTMFREYLHEALNEILGEDVAPHVILKATEDGSGIG  489



>emb|CDP09609.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/460 (75%), Positives = 399/460 (87%), Gaps = 4/460 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS-  178
             W KV++VLEE EE CATPV +LRQVVDAMAVEMHAGLASEGGSKLKMLLT+V  LP G  
Sbjct  35    WTKVVKVLEEFEEGCATPVEKLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVQNLPTGYV  94

Query  179   EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLK  358
             E+G +Y LDLGGTNFRVLRVQLGGQRSA +   V++QPIP+HL+T TSE+LFDFIA+SL+
Sbjct  95    EKGVYYGLDLGGTNFRVLRVQLGGQRSAILEPGVERQPIPEHLMTSTSEELFDFIAASLQ  154

Query  359   DFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              F+E++ + S   +G  R LGFTFSFPVKQ SVSSGILIKWT+GF I D VG++VSECL 
Sbjct  155   KFVEKEGNGSVALEGKLRELGFTFSFPVKQASVSSGILIKWTKGFSIHDTVGKDVSECLN  214

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R+GLD+RVA LINDTV TLALGHY+DEDTVAAVI GTGTNACY+ER+D IIKCQGL
Sbjct  215   QALERRGLDMRVAVLINDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERSDDIIKCQGL  274

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             LTTSG+MVVNMEWGNFWSSHLPRTSYD +LD++SPNPNDQGFEKMISGMYLGDIVRRV+L
Sbjct  275   LTTSGAMVVNMEWGNFWSSHLPRTSYDIELDSESPNPNDQGFEKMISGMYLGDIVRRVIL  334

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +MSQE DVFG   SKL  PF+LR+PL+AAMH+DDSP+L EVAR+LGEILE+ DVPLK+RK
Sbjct  335   KMSQESDVFGLSFSKLLTPFILRSPLIAAMHEDDSPDLREVARILGEILEIGDVPLKVRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCDVVTRRAARLAAAGIVGILKK+GRDG+G  A      G S ++M+RTVVAIEG 
Sbjct  395   LVVKVCDVVTRRAARLAAAGIVGILKKMGRDGSGSTA-SGKVKGGSHTKMRRTVVAIEGA  453

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LYTSYT FREYLN+A+A+ILGE++SSHV + V EDGSG+G
Sbjct  454   LYTSYTLFREYLNDAIADILGEDISSHVVLKVMEDGSGMG  493



>ref|XP_008385759.1| PREDICTED: hexokinase-3-like [Malus domestica]
Length=508

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/459 (74%), Positives = 398/459 (87%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL++LE +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLPNG E
Sbjct  34    WSRVVGVLKDLEHSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPNGXE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV+LGG RS+T+ HDV +Q IPQ L+TGTSEDLFDFIASSLK+
Sbjct  94    KGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVYRQAIPQDLMTGTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+   S+ S  + R LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR +  CL+ 
Sbjct  154   FVERERDVSKLSLDRRRELGFTFSFPVKQISVSSGTLLKWTKGFAIEDMVGREIXGCLEK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGL++RVAAL+ND+V TL+LGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  214   AMTRKGLNMRVAALVNDSVGTLSLGHYHDTDTVAAVIIGTGTNACYLERIDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SGSMVVNMEWGNFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VRRV++R
Sbjct  274   TASGSMVVNMEWGNFWSSHLPRTVYDIELDADSPNPNDQGFEKLISGMYLGDVVRRVIVR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+F P+SSKL+MPF+LRTPL+AAMH+D +P+L EV  +L + LE+PDVPLK+RKL
Sbjct  334   MSQESDIFEPISSKLSMPFILRTPLIAAMHEDXTPDLEEVGSILRDNLEIPDVPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  RM+RTVVA+EGGL
Sbjct  394   IVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDHRMRRTVVAMEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT YT FREYL+EA+ EILGE+++ HV + VTEDGS +G
Sbjct  451   YTGYTMFREYLHEALTEILGEDIAQHVVLKVTEDGSAMG  489



>ref|XP_007211826.1| hypothetical protein PRUPE_ppa004471mg [Prunus persica]
 gb|EMJ13025.1| hypothetical protein PRUPE_ppa004471mg [Prunus persica]
Length=508

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/446 (75%), Positives = 390/446 (87%), Gaps = 5/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLPNGSE+GT+YALDLGGTN
Sbjct  47    SCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPNGSEKGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FRVLRV+L G RS+T+ HDV +Q IPQ L+TG+SEDLFDFIASSLK+F+ER+   SE S 
Sbjct  107   FRVLRVKLEGTRSSTLEHDVYRQAIPQDLMTGSSEDLFDFIASSLKEFVEREGDISELSL  166

Query  401   GR--SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              R   LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR ++ CL+ A +RKGL++RVAA
Sbjct  167   DRRGELGFTFSFPVKQMSVSSGTLLKWTKGFSIEDMVGREIAGCLENAMTRKGLNMRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+ND+V +LALGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLLTTSG MVVNMEWG
Sbjct  227   LVNDSVGSLALGHYHDTDTVAAVIIGTGTNACYLERTDAIIKSQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VRRV++RMSQE D+F P+SS
Sbjct  287   NFWSSHLPRTLYDIELDADSPNPNDQGFEKLISGMYLGDVVRRVIVRMSQESDIFDPISS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL+MPF+LRTPL+AAMH+DDSP+L EV R+L + LE+ DVPLK+RKL+V+VCDVVTRRAA
Sbjct  347   KLSMPFILRTPLIAAMHEDDSPDLEEVRRILRDNLEILDVPLKVRKLIVKVCDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GGIA        S  +M+RTVVA+EGGLYT YT FR+YL+E
Sbjct  407   RLAAAGIVGILKKIGRDGSGGIA---GGRSRSDQKMRRTVVAMEGGLYTGYTMFRDYLHE  463

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGE+++ HV I VTEDGS +G
Sbjct  464   ALTEILGEDIAQHVIIKVTEDGSAMG  489



>ref|XP_008363245.1| PREDICTED: hexokinase-3 [Malus domestica]
Length=509

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/460 (73%), Positives = 400/460 (87%), Gaps = 6/460 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  VL++LE +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLP+GSE
Sbjct  34    WGRVFGVLKDLELSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPDGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV+LGG RS+T+ HDV QQ IPQ+L+TGTSE LFDFIASS+K+
Sbjct  94    KGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVHQQDIPQNLMTGTSEVLFDFIASSVKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER++ DS+ S  + R LGF FSFPVKQTSVSSG L+KWT+GF IEDM+G+ V+ CL+ 
Sbjct  154   FVERETDDSKLSLDRRRELGFMFSFPVKQTSVSSGTLLKWTKGFAIEDMIGKEVAGCLEK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++KGL++ VAAL+ND+V TL+LGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  214   AMTKKGLNMSVAALVNDSVGTLSLGHYHDTDTVAAVIIGTGTNACYLERTDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRT YD++LDADSPNPNDQGFEK+ISGMYLGD+VRRV++R
Sbjct  274   TASGGMVVNMEWGNFWSSHLPRTVYDTELDADSPNPNDQGFEKLISGMYLGDVVRRVIVR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE ++F P+SSKL MPF+LRTPL+AAMH+DDSP+L EV R+L E LE+PDVPLK+RKL
Sbjct  334   MSQESEIFEPISSKLYMPFILRTPLIAAMHEDDSPDLEEVGRILRENLEIPDVPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  RM+RTVVA+EGGL
Sbjct  394   IVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDHRMRRTVVAMEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVT-ITVTEDGSGIG  1372
             YT YT FREYL+EA+ EILGE+++ HV  I VTEDGS  G
Sbjct  451   YTEYTMFREYLHEALTEILGEDIAKHVVLIKVTEDGSATG  490



>ref|XP_002513538.1| hexokinase, putative [Ricinus communis]
 gb|EEF48941.1| hexokinase, putative [Ricinus communis]
Length=508

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/446 (76%), Positives = 382/446 (86%), Gaps = 5/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP G+E GT+YALDLGGTN
Sbjct  47    SCETTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGNEIGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLRVQLGG+RS  +  DV+ QP+PQHL+  TSE+LFDFIAS+LK F+E++ + SE S 
Sbjct  107   FRVLRVQLGGRRSLILSKDVESQPVPQHLMESTSEELFDFIASTLKQFVEKEENGSEFSS  166

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQ S  SGILIKWT+G+ IEDMVGR V E LQA  +R  LD++VA 
Sbjct  167   VRRRELGFTFSFPVKQMSTCSGILIKWTKGYHIEDMVGREVVERLQAGLTRNDLDMQVAV  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHY+D DTVAAVI GTGTNACY+ERADAIIKCQGLLTTSG MVVNMEWG
Sbjct  227   LVNDTVGTLALGHYHDADTVAAVIIGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+LRM+QE D+FGPVSS
Sbjct  287   NFWSSHLPRTSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMTQESDIFGPVSS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             +L++PF L+TPL+A MH+DDSP+L+EVA +L E L +P+VPLK RKLVV VCDVVTRRAA
Sbjct  347   RLSVPFNLKTPLVAKMHEDDSPDLTEVAHILKETLGIPEVPLKFRKLVVRVCDVVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDGTGGI       G S  +M+RTVV IEGGLYTSYT FREYL+E
Sbjct  407   RLAAAGIVGILKKIGRDGTGGIT---SGRGRSDIKMRRTVVVIEGGLYTSYTMFREYLHE  463

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A  EILGE+V+ HV +  TEDGSGIG
Sbjct  464   AFNEILGEDVAQHVILKATEDGSGIG  489



>ref|XP_003540378.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/459 (76%), Positives = 404/459 (88%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V RVL+E+EE C T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LPNG+E
Sbjct  34    WKRVARVLKEVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHNLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV L GQ+S+ + H+V++QPIPQ+L+T TSEDLFDFIASSLK+
Sbjct  94    KGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQNLMTSTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++   SE S  + R LGFTFSFPVKQ SVSSGIL+KWT+GF I D+VG +V  CLQ 
Sbjct  154   FIEKEGDGSELSPDRRRELGFTFSFPVKQMSVSSGILLKWTKGFSIVDLVGIDVPACLQE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGLD+RVAAL+NDTV TLALGHY+D DTVA+VI GTGTNACY+ER DAIIKCQGL 
Sbjct  214   ALTRKGLDVRVAALVNDTVGTLALGHYHDSDTVASVIIGTGTNACYLERVDAIIKCQGLP  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS E D+ GP+SSKL+MPF+LRTP+MAAMH+DDSP+L EVAR+L  ILE+PDVPLKLRK+
Sbjct  334   MSLESDMLGPISSKLSMPFMLRTPMMAAMHEDDSPDLREVARILKGILEIPDVPLKLRKV  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGIA        S  +MKRTVVAIEGGL
Sbjct  394   VVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIA----GGRRSDMKMKRTVVAIEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FR+YL+EA+ +ILGE+++ HV + VTEDGSG+G
Sbjct  450   YSSYTLFRDYLHEALNDILGEDIARHVILKVTEDGSGVG  488



>ref|XP_011080375.1| PREDICTED: hexokinase-3 isoform X1 [Sesamum indicum]
Length=512

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/445 (76%), Positives = 385/445 (87%), Gaps = 4/445 (1%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CAT VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LP G+E+G +YALDLGGTNF
Sbjct  48    CATTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPTGNEKGIYYALDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRV+LGGQR   I HDV  QPIPQHL+T +S +LFDFIA+SLKDF+ER+ + SE SQ 
Sbjct  108   RVLRVKLGGQR-CIIEHDVDLQPIPQHLMTSSSVELFDFIATSLKDFVEREENISEPSQR  166

Query  404   --RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
               R LGFTFSFPVKQTS SSG L+KWT+GF IED VGR+VS+CLQ A SRKGLD++V  L
Sbjct  167   ERRELGFTFSFPVKQTSSSSGTLMKWTKGFSIEDAVGRDVSQCLQEALSRKGLDMQVTVL  226

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             INDTV TLALGHY+DEDTVAAVI GTGTNACY+ERADAIIKCQGLLTTS  MV+NMEWGN
Sbjct  227   INDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERADAIIKCQGLLTTSAGMVINMEWGN  286

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             FWSSHLPRT YD++LDADSPNPNDQGFEKMISGMYLGDIVRRV+LRMSQE DVFGPVSSK
Sbjct  287   FWSSHLPRTPYDAELDADSPNPNDQGFEKMISGMYLGDIVRRVILRMSQESDVFGPVSSK  346

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L  PF+LRTP++AAMH+DDS  L+EVA++L + LE+PDVPL +RKLVV+VCDVVTRRAAR
Sbjct  347   LHEPFILRTPMVAAMHEDDSSNLNEVAQILKDTLEIPDVPLNVRKLVVKVCDVVTRRAAR  406

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGIVGILKKIGRDG     +G    G S  +M+RTVVA+EGGLY +YT FREYLNEA
Sbjct  407   LAAAGIVGILKKIGRDGN-SGMTGGKTKGGSRIKMRRTVVAVEGGLYANYTMFREYLNEA  465

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + +ILGE+V+ +V + VT DGSGIG
Sbjct  466   MRQILGEDVAPYVILNVTNDGSGIG  490



>ref|XP_007131563.1| hypothetical protein PHAVU_011G023700g [Phaseolus vulgaris]
 gb|ESW03557.1| hypothetical protein PHAVU_011G023700g [Phaseolus vulgaris]
Length=499

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/459 (75%), Positives = 402/459 (88%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+RVL E+EE C + V RLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LP+G+E
Sbjct  34    WKRVVRVLREVEEGCESSVERLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHNLPDGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFRVLRV L  Q+S+ + H+V++QPIPQHL+T T +DLFDFIASSLK+
Sbjct  94    KGIYYALDLGGTNFRVLRVHLHDQQSSVLEHEVERQPIPQHLMTSTGKDLFDFIASSLKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++   SE S  + R LGFTFSFP+KQTSVSSGIL+KWT+GF I DMVG +V  CLQ 
Sbjct  154   FIEKEGDGSELSLDRRRELGFTFSFPLKQTSVSSGILMKWTKGFSIVDMVGVDVPACLQE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKGLD+RVAAL+NDTV TLALGHY+D DTVA++I GTGTNACY+ER DAIIKCQGLL
Sbjct  214   ALIRKGLDMRVAALVNDTVGTLALGHYHDSDTVASIIIGTGTNACYLERVDAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS E D+FGPVSSKL+MPF+LRTP+MAAMH+DDSP+L EVAR+L +ILE+PDVPLKLRK+
Sbjct  334   MSLESDMFGPVSSKLSMPFMLRTPMMAAMHEDDSPDLREVARILKDILEIPDVPLKLRKV  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         +  +MKRTVVAIEGGL
Sbjct  394   VVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT----SGRRNDVKMKRTVVAIEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+SYT FREYL+EA+ EILGE+++ HV + VTEDGSG+G
Sbjct  450   YSSYTFFREYLHEALNEILGEDIAKHVILKVTEDGSGVG  488



>ref|XP_011080376.1| PREDICTED: hexokinase-3 isoform X2 [Sesamum indicum]
Length=511

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/445 (77%), Positives = 385/445 (87%), Gaps = 5/445 (1%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CAT VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LP G+E+G +YALDLGGTNF
Sbjct  48    CATTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPTGNEKGIYYALDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRV+LGGQR   I HDV  QPIPQHL+T +SE LFDFIA+SLKDF+ER+ + SE SQ 
Sbjct  108   RVLRVKLGGQR-CIIEHDVDLQPIPQHLMTSSSE-LFDFIATSLKDFVEREENISEPSQR  165

Query  404   --RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
               R LGFTFSFPVKQTS SSG L+KWT+GF IED VGR+VS+CLQ A SRKGLD++V  L
Sbjct  166   ERRELGFTFSFPVKQTSSSSGTLMKWTKGFSIEDAVGRDVSQCLQEALSRKGLDMQVTVL  225

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             INDTV TLALGHY+DEDTVAAVI GTGTNACY+ERADAIIKCQGLLTTS  MV+NMEWGN
Sbjct  226   INDTVGTLALGHYHDEDTVAAVIIGTGTNACYLERADAIIKCQGLLTTSAGMVINMEWGN  285

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             FWSSHLPRT YD++LDADSPNPNDQGFEKMISGMYLGDIVRRV+LRMSQE DVFGPVSSK
Sbjct  286   FWSSHLPRTPYDAELDADSPNPNDQGFEKMISGMYLGDIVRRVILRMSQESDVFGPVSSK  345

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L  PF+LRTP++AAMH+DDS  L+EVA++L + LE+PDVPL +RKLVV+VCDVVTRRAAR
Sbjct  346   LHEPFILRTPMVAAMHEDDSSNLNEVAQILKDTLEIPDVPLNVRKLVVKVCDVVTRRAAR  405

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGIVGILKKIGRDG     +G    G S  +M+RTVVA+EGGLY +YT FREYLNEA
Sbjct  406   LAAAGIVGILKKIGRDGN-SGMTGGKTKGGSRIKMRRTVVAVEGGLYANYTMFREYLNEA  464

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + +ILGE+V+ +V + VT DGSGIG
Sbjct  465   MRQILGEDVAPYVILNVTNDGSGIG  489



>gb|AHY84733.1| hexokinase [Manihot esculenta]
Length=506

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/459 (74%), Positives = 391/459 (85%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L ELEE+C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WSRVVGLLRELEESCETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRV+RVQLGG+RS+ +  DV+ QPIPQHL+T T EDLFDFIAS+LK 
Sbjct  94    VGTYYALDLGGTNFRVIRVQLGGRRSSILSKDVELQPIPQHLMTSTREDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + SE S  + R LGFTFSFPVKQ S+ SGILIKWT+GF I+ MVGR V E LQA
Sbjct  154   FIEKEENVSEFSSLRKRELGFTFSFPVKQMSIHSGILIKWTKGFAIDGMVGREVVEHLQA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A SR GLD++VA L+NDTV TLALGHY+D DTVAAVI GTGTNA Y+ERADAIIKCQGLL
Sbjct  214   ALSRNGLDVQVAVLVNDTVGTLALGHYHDADTVAAVIIGTGTNASYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRT+YD +LDA+SPNPNDQGFEKMISG+YLG+IVRRV+LR
Sbjct  274   TTSGGMVVNMEWGNFWSSHLPRTTYDINLDAESPNPNDQGFEKMISGLYLGEIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+S  L +PF+L TP ++ MH+DDSP L EVAR+L   LE+P+ PLK+RKL
Sbjct  334   MSQESDIFGPISPSLLVPFILHTPFVSKMHEDDSPNLQEVARILKLKLEIPEGPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV +CDVVTRRAARLAAAGIVGILKKIGRDGTGGI       G S  +M+RTVVAIEGGL
Sbjct  394   VVRICDVVTRRAARLAAAGIVGILKKIGRDGTGGIT---SLRGRSDMKMRRTVVAIEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YTSY  FREYL+EA+ EILGE+++ HV +  TEDGSG+G
Sbjct  451   YTSYAMFREYLHEALNEILGEDIAQHVILKATEDGSGLG  489



>ref|XP_009366073.1| PREDICTED: hexokinase-3 [Pyrus x bretschneideri]
 ref|XP_009375355.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
Length=508

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/456 (73%), Positives = 397/456 (87%), Gaps = 5/456 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL++LE++C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLP+GSE
Sbjct  34    WSRVVGVLKDLEQSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRV+LGG RS+T+ HDV +Q IPQ L+TGTSEDLFDFIASSLK+
Sbjct  94    KGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVCRQAIPQDLMTGTSEDLFDFIASSLKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+   S+ S  + R LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR ++ CL+ 
Sbjct  154   FVERERDVSKLSLDRRRELGFTFSFPVKQISVSSGTLLKWTKGFAIEDMVGREIAGCLEK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGL++RVAAL+ND+V TL+LGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  214   AMTRKGLNMRVAALVNDSVGTLSLGHYHDTDTVAAVIIGTGTNACYLERIDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VRRV++R
Sbjct  274   TASGGMVVNMEWGNFWSSHLPRTVYDIELDADSPNPNDQGFEKLISGMYLGDVVRRVIVR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS+E D+F P+SSKL+MPF+LRTPL+AAMH+DD+P+L EV  +L + LE+PD PLK+RKL
Sbjct  334   MSKESDIFEPISSKLSMPFILRTPLIAAMHEDDTPDLEEVGSILRDNLEIPDAPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  RM+RTVVA+EG L
Sbjct  394   IVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDHRMRRTVVAMEGSL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGS  1363
             YT YT FREYL+EA+ EILGE+++ HV + VTEDGS
Sbjct  451   YTGYTMFREYLHEALTEILGEDIAQHVVLKVTEDGS  486



>gb|KHG14450.1| hypothetical protein F383_08688 [Gossypium arboreum]
Length=504

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/457 (74%), Positives = 393/457 (86%), Gaps = 5/457 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL+ELEE+C T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP+GSE
Sbjct  34    WKRVVGVLKELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDSLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRV+LGGQRS  +  DV+QQPIP+ L+TG SEDLFDFIASSL  
Sbjct  94    KGIFYALDLGGTNFRVLRVELGGQRS-DLDPDVEQQPIPEQLMTGRSEDLFDFIASSLYQ  152

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             F+E++ S  +    + LGFTFSFPVKQTSVSSG+LIKWT+GF I DMV + V+  LQ A 
Sbjct  153   FVEKNDS-VQSPITKLLGFTFSFPVKQTSVSSGVLIKWTKGFAIRDMVEKEVAGALQQAL  211

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
             +RKGL++RV+ L+NDTV TLALGHY+D DTVAAVI GTGTNACY ER DAIIKCQGLLTT
Sbjct  212   TRKGLNMRVSVLVNDTVGTLALGHYHDADTVAAVIIGTGTNACYWERTDAIIKCQGLLTT  271

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG MVVNMEWGNFWSSHLPRTSYD  LDA+SPNPNDQGFEKMISGMYLGDIVRRV+LRMS
Sbjct  272   SGGMVVNMEWGNFWSSHLPRTSYDVKLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMS  331

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             +E DVFGPVSS+L +PF LRTPLMAAMH+DDSPEL++VAR+L + L++PD+PLK RKLVV
Sbjct  332   EESDVFGPVSSRLYVPFTLRTPLMAAMHEDDSPELTQVARILKDFLDIPDIPLKARKLVV  391

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
             ++CDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RT VA+EG LYT
Sbjct  392   KICDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDIKMRRTAVAVEGSLYT  448

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              YT FR+YL+EA+ EILGE+++ HV I VTEDGSG G
Sbjct  449   QYTMFRDYLHEALNEILGEDIARHVVIIVTEDGSGTG  485



>gb|AHY84732.1| hexokinase [Manihot esculenta]
Length=508

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/459 (74%), Positives = 390/459 (85%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL ELEE+C T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WGRVVGVLRELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRVLRVQLGG+ S+ +  DV+ QPIPQHL+  TSEDLFDFIAS+LK 
Sbjct  94    VGTYYALDLGGTNFRVLRVQLGGRLSSILSKDVELQPIPQHLMRSTSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S+ S  + R LGFTFSFPVKQ S+ SGIL+KWT+GF IEDMVG+ V ECL+A
Sbjct  154   FIEKEENGSKFSSLRTRELGFTFSFPVKQMSLCSGILLKWTKGFAIEDMVGKEVVECLRA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
               +R GLD++VA L+NDTV TLALGHY+D DTVAAVI GTGTNA Y+ERADAIIKCQGLL
Sbjct  214   GLTRNGLDMQVAVLVNDTVGTLALGHYHDADTVAAVIIGTGTNASYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRT YD DLDA+SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TTSGGMVVNMEWGNFWSSHLPRTPYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGPVSS L  PF+L TP +A MH+DDS +L EVAR+L E LE+ +VPLK+RKL
Sbjct  334   MSQESDIFGPVSSSLLEPFILHTPFVAKMHEDDSSDLQEVARILKEKLEISEVPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV +CDVVTRRAARLAAAGIVGILKKIGRDGTGGI+      G S  +M+RTVVAIEG L
Sbjct  394   VVRICDVVTRRAARLAAAGIVGILKKIGRDGTGGIS---SVRGRSDIKMRRTVVAIEGAL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT YT FREYL+EA+ +ILGEE++ HV +  TEDGSGIG
Sbjct  451   YTGYTMFREYLHEALNDILGEEIAQHVILRATEDGSGIG  489



>ref|XP_010031755.1| PREDICTED: hexokinase-3 isoform X1 [Eucalyptus grandis]
 gb|KCW51132.1| hypothetical protein EUGRSUZ_J00734 [Eucalyptus grandis]
Length=508

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/459 (73%), Positives = 391/459 (85%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL VL E+EE C T VGRL+QVVDAMAVEMHAGLASEGGSKL+MLLT+VD LP+GSE
Sbjct  34    WGRVLGVLREVEEGCETSVGRLKQVVDAMAVEMHAGLASEGGSKLRMLLTFVDNLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL +GGT FR+LRV+LGGQRS+ + HDV++Q IPQHL+T T+E LFDF+ASSLK+
Sbjct  94    KGTYYALHVGGTYFRMLRVKLGGQRSSILAHDVERQLIPQHLMTSTTEALFDFVASSLKE  153

Query  362   FIERDSSDSEH--SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+ S S     + R LGFTFS+PVKQTSVSSGILIKWT+GF I+DMVG+ V ECLQ 
Sbjct  154   FVEREESSSSFPLDRRRELGFTFSYPVKQTSVSSGILIKWTKGFAIKDMVGKEVVECLQQ  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGL +RV+AL+NDTV TLALGHY+DEDTVAAVI GTGTNACYVER DAIIKCQG+L
Sbjct  214   ALTRKGLSMRVSALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYVERMDAIIKCQGIL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPN+QGFEKMISGMYLGDIVRRVLLR
Sbjct  274   TSSGVMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNEQGFEKMISGMYLGDIVRRVLLR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+ GP+S  L  PF+L T L+A MH+DDS +L+EVA +L + LE+PDVPLK+RKL
Sbjct  334   MSQESDILGPISPTLLKPFILSTRLVANMHEDDSLDLAEVAEILRDNLEIPDVPLKVRKL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAA IVGILKKIGRDG+GGI         S  +M+RT VAIEG L
Sbjct  394   VVNVCDVVTRRAARLAAAAIVGILKKIGRDGSGGIT---SGRSRSDIKMRRTAVAIEGSL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+Y+ FREYLNEA+ EILGE+V+ HV + V EDGSGIG
Sbjct  451   YTNYSMFREYLNEAMVEILGEDVAEHVILNVMEDGSGIG  489



>ref|XP_009343799.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
 ref|XP_009343800.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
Length=508

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/459 (72%), Positives = 397/459 (86%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  VL++LE +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLP+GSE
Sbjct  34    WGRVFGVLKDLELSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPDGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGT+FRVLRV+LGG RS+T+ HDV  Q IPQ+L+TGT E LFDFIASS+K+
Sbjct  94    KGTYYALDLGGTDFRVLRVKLGGTRSSTLEHDVYLQAIPQNLMTGTGEVLFDFIASSVKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER++ DS+ S  + R LGFTFSFPVKQTSVSSG L+KWT+GF IEDM+G+ V+ CL+ 
Sbjct  154   FVERETDDSKLSLDRRRELGFTFSFPVKQTSVSSGTLLKWTKGFAIEDMIGKEVAGCLEK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++KGL++RVAAL+ND+V TL+LGHY+D DTVAAVI G GTNACY+ER DAIIK QGLL
Sbjct  214   AMTKKGLNMRVAALVNDSVGTLSLGHYHDTDTVAAVIIGIGTNACYLERTDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRT YD++LDADSPNPNDQGFEK+ISGMYLGD+VRRV++R
Sbjct  274   TASGGMVVNMEWGNFWSSHLPRTVYDTELDADSPNPNDQGFEKLISGMYLGDVVRRVIVR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+F P+SSKL+MPF+L TPL+AAMH DDSP+L +V  +L E LE+PDVPLK R+L
Sbjct  334   MSQESDIFEPISSKLSMPFILSTPLIAAMHKDDSPDLEKVGSILRESLEIPDVPLKGRRL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RTVVA+EGGL
Sbjct  394   IVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDHKMRRTVVAMEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT YT FREYL+EA+ EILGE+++ HV + VTEDGS +G
Sbjct  451   YTDYTMFREYLHEALTEILGEDIAKHVVLKVTEDGSAMG  489



>ref|XP_009337028.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
 ref|XP_009337029.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
Length=508

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/459 (72%), Positives = 396/459 (86%), Gaps = 5/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  VL++LE +C T VGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT+VDKLP+GSE
Sbjct  34    WGRVFGVLKDLELSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDKLPDGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRV+RV+LGG RS+T+ HDV +  I Q+L+TGT E LFDFIASS+K+
Sbjct  94    KGTYYALDLGGTNFRVMRVKLGGTRSSTLEHDVYRPAITQNLMTGTGEVLFDFIASSVKE  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER++ DS+ S  + R LGFTFSFPVKQTSVSSG L+KWT+GF IEDM+G+ V+ CL+ 
Sbjct  154   FVERETDDSKLSLDRRRELGFTFSFPVKQTSVSSGTLLKWTKGFAIEDMIGKEVAGCLEK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++KGL++RVAAL+ND+V TL+LGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  214   AMTKKGLNMRVAALVNDSVGTLSLGHYHDTDTVAAVIIGTGTNACYLERTDAIIKSQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T SG MVVNMEWGNFWSSHLPRT YD++LDADSPNPNDQGFEK+ISGMYLGD+VRRV++R
Sbjct  274   TASGGMVVNMEWGNFWSSHLPRTVYDTELDADSPNPNDQGFEKLISGMYLGDVVRRVIVR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+F P SSKL+MPF+L TPL+AAMH DDSP+L +V  +L E LE+PDVPLK R+L
Sbjct  334   MSQESDIFEPRSSKLSMPFILSTPLIAAMHKDDSPDLEKVGSILRESLEIPDVPLKGRRL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGI         S  +M+RTVVA+EGGL
Sbjct  394   IVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIT---GGRSRSDHKMRRTVVAMEGGL  450

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT YT FREYL+EA+ EILGE+++ HV + VTEDGS +G
Sbjct  451   YTDYTMFREYLHEALTEILGEDIAKHVVLKVTEDGSAMG  489



>ref|XP_008449690.1| PREDICTED: hexokinase-3 [Cucumis melo]
Length=501

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/459 (73%), Positives = 388/459 (85%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+V+RVL+ELEEAC T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVD LP+G+E
Sbjct  34    WRRVVRVLKELEEACETSVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT YALDLGGTNFRVL +QL G RS+ + HDV++ P+PQHL+T T  DLFDFIASSLK+
Sbjct  94    MGTHYALDLGGTNFRVLSIQLQGNRSSILEHDVERLPVPQHLMTSTGNDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI++  +DSE   G  R LGFTFSFP KQ S+SSG+LIKWT+GF I DMVG++V+ECL+ 
Sbjct  154   FIDK-GNDSEVLLGGKRDLGFTFSFPTKQNSISSGVLIKWTKGFSIGDMVGKDVAECLEQ  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A + KGL+IRV ALINDTV TLALGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  213   AMTSKGLNIRVTALINDTVGTLALGHYHDADTVAAVIIGTGTNACYLERTDAIIKRQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD DS NPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGFMVVNMEWGNFWSSHLPRTSYDIDLDCDSSNPNDQGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FG  SS+L+MPF+L TPLMA MH+D S +L +VAR+L + L +P+V LK RKL
Sbjct  333   MSQESDIFGLGSSRLSMPFVLTTPLMAEMHEDGSLDLRDVARILKDTLGIPEVSLKTRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV +CDVVTRRAARL AAGI+GILKK+GRDGTGG+         S   MKRTVVA+EGGL
Sbjct  393   VVRICDVVTRRAARLVAAGILGILKKMGRDGTGGVT---GTRSRSDVNMKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+YT FREYL+EA+ EILGEE++ +V + VTEDGSGIG
Sbjct  450   YTNYTMFREYLHEAMVEILGEEIAKNVILKVTEDGSGIG  488



>gb|KGN48114.1| hypothetical protein Csa_6G434340 [Cucumis sativus]
Length=502

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/460 (73%), Positives = 390/460 (85%), Gaps = 7/460 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+V+RVL+ELEEAC T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVD LP+G+E
Sbjct  34    WRRVVRVLKELEEACETSVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT YALDLGGTNFRVL +QL G RS+ + HDV+++PIPQHL+T T  DLFDFIASSLK+
Sbjct  94    LGTHYALDLGGTNFRVLSIQLQGNRSSILEHDVERRPIPQHLMTSTGNDLFDFIASSLKE  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI++  +DSE   G  R LGFTFSFP KQ S+SSG+LIKWT+GF I DMVG++V+E L+ 
Sbjct  154   FIDK-GNDSEVLLGGKRDLGFTFSFPTKQNSISSGVLIKWTKGFSIGDMVGKDVAESLEQ  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++KGL++RV ALINDTV TLALGHY+D DTVAAVI GTGTNACY+ER DAIIK QGLL
Sbjct  213   AMTKKGLNMRVTALINDTVGTLALGHYHDADTVAAVIIGTGTNACYLERTDAIIKRQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLD DSPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGFMVVNMEWGNFWSSHLPRTSYDIDLDCDSPNPNDQGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             MSQE D+FG   SS+L+M F+L TPLMA MH+D S +L +VAR+L +IL +P+V LK RK
Sbjct  333   MSQESDIFGLGGSSRLSMSFVLTTPLMAEMHEDRSLDLRDVARILKDILGIPEVSLKARK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV +CDVVTRRAARL AAGI+GILKK+GRDGTGGI         S   MKRTVVA+EGG
Sbjct  393   LVVRICDVVTRRAARLVAAGILGILKKMGRDGTGGIT---GTRSRSDVNMKRTVVAVEGG  449

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LYT+YT FREYL+EA+ EILGEE++ +V + VTEDGSGIG
Sbjct  450   LYTNYTMFREYLHEAMIEILGEEIAKNVILKVTEDGSGIG  489



>gb|AHZ34665.1| hexokinase 3 (chloroplast) (chloroplast) [Camellia sinensis]
Length=509

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/446 (74%), Positives = 379/446 (85%), Gaps = 4/446 (1%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC+T V RLRQVVDAMA E H G + EG SKLKMLLTYVDKLPNGSE+GT+YALDLGGTN
Sbjct  47    ACSTSVLRLRQVVDAMAGEKHPGFSPEG-SKLKMLLTYVDKLPNGSEKGTYYALDLGGTN  105

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             FRVLR+QL G RSA    DV+++PIP +L   T E+LFD IASSLK+FIE+     E S 
Sbjct  106   FRVLRLQLVGDRSAIPDPDVERKPIPLNLKASTGEELFDLIASSLKEFIEKKEGVHELSA  165

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQ SVSSGILIKWT+GF IEDMVGR+VSECLQ   S+KG+++ VAA
Sbjct  166   VKRRELGFTFSFPVKQLSVSSGILIKWTKGFTIEDMVGRDVSECLQQTMSKKGVNMGVAA  225

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHY+DEDTVAAVI GTGTNACY+ERADAIIKCQGLLTTSG MVVNMEWG
Sbjct  226   LVNDTVGTLALGHYDDEDTVAAVIIGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWG  285

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD+DLDADS NPNDQGFEKMIS MYLGDIVRRVLLRMSQE D+FGPV+S
Sbjct  286   NFWSSHLPRTSYDTDLDADSLNPNDQGFEKMISAMYLGDIVRRVLLRMSQESDIFGPVAS  345

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL++P +L T  MAAMH+DDSP+L EV R+L ++LE+P VPLK+RKLVV+VCDVVTRRAA
Sbjct  346   KLSVPSILSTEHMAAMHEDDSPDLKEVVRILNDVLEIPGVPLKVRKLVVKVCDVVTRRAA  405

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAA+GIVGILKKIGRDG+GGI         S S+++RTVVAIEGGLYT Y  FREYLNE
Sbjct  406   RLAASGIVGILKKIGRDGSGGIT-SGRIKSGSHSKIRRTVVAIEGGLYTGYLMFREYLNE  464

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGE+VS+HV + +T+DG GIG
Sbjct  465   AMTEILGEDVSAHVILRITKDGPGIG  490



>gb|ADN33926.1| hexokinase [Cucumis melo subsp. melo]
Length=511

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/469 (72%), Positives = 388/469 (83%), Gaps = 16/469 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS-  178
             WR+V+RVL+ELEEAC T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVD LP+G+ 
Sbjct  34    WRRVVRVLKELEEACETSVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPDGTY  93

Query  179   ---------EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDL  331
                      E GT YALDLGGTNFRVL +QL G RS+ + HDV++ P+PQHL+T T  DL
Sbjct  94    VDDTLHIRNEMGTHYALDLGGTNFRVLSIQLQGNRSSILEHDVERLPVPQHLMTSTGNDL  153

Query  332   FDFIASSLKDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMV  505
             FDFIASSLK+FI++  +DSE   G  R LGFTFSFP KQ S+SSG+LIKWT+GF I DMV
Sbjct  154   FDFIASSLKEFIDK-GNDSEVLLGGKRDLGFTFSFPTKQNSISSGVLIKWTKGFSIGDMV  212

Query  506   GRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERA  685
             G++V+ECL+ A + KGL+IRV ALINDTV TLALGHY+D DTVAAVI GTGTNACY+ER 
Sbjct  213   GKDVAECLEQAMTSKGLNIRVTALINDTVGTLALGHYHDADTVAAVIIGTGTNACYLERT  272

Query  686   DAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYL  865
             DAIIK QGLLTTSG MVVNMEWGNFWSSHLPRTSYD DLD DS NPNDQGFEKMISGMYL
Sbjct  273   DAIIKRQGLLTTSGFMVVNMEWGNFWSSHLPRTSYDIDLDCDSSNPNDQGFEKMISGMYL  332

Query  866   GDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILEL  1045
             GDIVRRV+LRMSQE D+FG  SS+L+MPF+L TPLMA MH+D S +L +VAR+L + L +
Sbjct  333   GDIVRRVILRMSQESDIFGLGSSRLSMPFVLTTPLMAEMHEDGSLDLRDVARILKDTLGI  392

Query  1046  PDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmk  1225
             P+V LK RKLVV +CDVVTRRAARL AAGI+GILKK+GRDGTGG+         S   MK
Sbjct  393   PEVSLKTRKLVVRICDVVTRRAARLVAAGILGILKKMGRDGTGGVT---GTRSRSDVNMK  449

Query  1226  rTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             RTVVA+EGGLYT+YT FREYL+EA+ EILGEE++ +V + VTEDGSGIG
Sbjct  450   RTVVAVEGGLYTNYTMFREYLHEAMVEILGEEIAKNVILKVTEDGSGIG  498



>ref|XP_004140206.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
 ref|XP_004156313.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
Length=512

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/470 (72%), Positives = 390/470 (83%), Gaps = 17/470 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS-  178
             WR+V+RVL+ELEEAC T VGRL+QVVDAMAVEMHAGLASEGGSKLKMLLTYVD LP+G+ 
Sbjct  34    WRRVVRVLKELEEACETSVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPDGTY  93

Query  179   ---------EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDL  331
                      E GT YALDLGGTNFRVL +QL G RS+ + HDV+++PIPQHL+T T  DL
Sbjct  94    VDDTLHIRNELGTHYALDLGGTNFRVLSIQLQGNRSSILEHDVERRPIPQHLMTSTGNDL  153

Query  332   FDFIASSLKDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMV  505
             FDFIASSLK+FI++  +DSE   G  R LGFTFSFP KQ S+SSG+LIKWT+GF I DMV
Sbjct  154   FDFIASSLKEFIDK-GNDSEVLLGGKRDLGFTFSFPTKQNSISSGVLIKWTKGFSIGDMV  212

Query  506   GRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERA  685
             G++V+E L+ A ++KGL++RV ALINDTV TLALGHY+D DTVAAVI GTGTNACY+ER 
Sbjct  213   GKDVAESLEQAMTKKGLNMRVTALINDTVGTLALGHYHDADTVAAVIIGTGTNACYLERT  272

Query  686   DAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYL  865
             DAIIK QGLLTTSG MVVNMEWGNFWSSHLPRTSYD DLD DSPNPNDQGFEKMISGMYL
Sbjct  273   DAIIKRQGLLTTSGFMVVNMEWGNFWSSHLPRTSYDIDLDCDSPNPNDQGFEKMISGMYL  332

Query  866   GDIVRRVLLRMSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILE  1042
             GDIVRRV+LRMSQE D+FG   SS+L+M F+L TPLMA MH+D S +L +VAR+L +IL 
Sbjct  333   GDIVRRVILRMSQESDIFGLGGSSRLSMSFVLTTPLMAEMHEDRSLDLRDVARILKDILG  392

Query  1043  LPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrm  1222
             +P+V LK RKLVV +CDVVTRRAARL AAGI+GILKK+GRDGTGGI         S   M
Sbjct  393   IPEVSLKARKLVVRICDVVTRRAARLVAAGILGILKKMGRDGTGGIT---GTRSRSDVNM  449

Query  1223  krTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             KRTVVA+EGGLYT+YT FREYL+EA+ EILGEE++ +V + VTEDGSGIG
Sbjct  450   KRTVVAVEGGLYTNYTMFREYLHEAMIEILGEEIAKNVILKVTEDGSGIG  499



>ref|XP_010938649.1| PREDICTED: hexokinase-3-like [Elaeis guineensis]
Length=500

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/446 (73%), Positives = 375/446 (84%), Gaps = 8/446 (2%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             C T +GRLRQVVDAMAVEMHAGLAS+GGSKLKMLL+++D LPNG+E GT+YALDLGGTNF
Sbjct  48    CVTSIGRLRQVVDAMAVEMHAGLASDGGSKLKMLLSFIDSLPNGNEIGTYYALDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIER---DSSDSEH  394
             RVLRVQLGG+ S  +   V+ +PIPQ L+ GTSE LF FIA +LK F+E+   D S+ + 
Sbjct  108   RVLRVQLGGRGSMILSRQVECRPIPQELMNGTSEGLFHFIAVTLKQFVEQQEDDDSEKKP  167

Query  395   SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + + LGFTFSFPV+Q SVSSGILIKWT+GF +ED VG++V+ CL+ A ++ GL++RVAA
Sbjct  168   DEKKVLGFTFSFPVRQMSVSSGILIKWTKGFSVEDAVGKDVARCLEEAMTKAGLNMRVAA  227

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHY DEDTVAAVIFGTGTNACYVER DAIIKCQGLLT SG MVVNMEWG
Sbjct  228   LVNDTVGTLALGHYYDEDTVAAVIFGTGTNACYVERTDAIIKCQGLLTNSGGMVVNMEWG  287

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD  LD +SPN NDQGFEKMISGMYLGDI RRVL RM+QE D+FG  + 
Sbjct  288   NFWSSHLPRTSYDIALDEESPNCNDQGFEKMISGMYLGDIARRVLYRMAQESDIFGDGAY  347

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
              L+M F+LRTPLMAAMH+DDSP+L EV R+L E L++PDV LK R+LVV VCDVVTRRAA
Sbjct  348   NLSMCFILRTPLMAAMHEDDSPDLREVGRILTESLQIPDVSLKARRLVVRVCDVVTRRAA  407

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GG+A     SG +  R +RTVVAIEGGLY +Y+ FREYLNE
Sbjct  408   RLAAAGIVGILKKIGRDGSGGVA-----SGRTKGRPRRTVVAIEGGLYANYSMFREYLNE  462

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             AVAEILGEEV+ +V I VTEDGSGIG
Sbjct  463   AVAEILGEEVAQNVVIRVTEDGSGIG  488



>ref|XP_011045448.1| PREDICTED: hexokinase-3-like [Populus euphratica]
Length=488

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/465 (70%), Positives = 377/465 (81%), Gaps = 37/465 (8%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++V+ VL+ELEEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP GSE
Sbjct  34    WKRVVSVLKELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YALDLGGTNFRVLR+QLGG+RS+ +  DV++QPIPQHLLT TSEDLFDFIAS+LK 
Sbjct  94    IGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLLTSTSEDLFDFIASTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++ S SE S  + R LGFTFSFPVKQ+S+ SGILIKWT+GF IEDMVG+ V   L+A
Sbjct  154   FVEKEESGSEPSPVRTRELGFTFSFPVKQSSLRSGILIKWTKGFAIEDMVGKEVVTLLEA  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVA L+NDTV TLALG Y+D DTVAAVI GTGTNACY+ERADAIIKCQGLL
Sbjct  214   ALVRSGLDMRVALLVNDTVGTLALGRYHDADTVAAVIIGTGTNACYLERADAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG MVVNMEWGNFWSSHLPRTSYD DLD++SPNPNDQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   TSSGYMVVNMEWGNFWSSHLPRTSYDIDLDSESPNPNDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILEL------PDVP  1057
             +S E D+FGPVSS+L++PF+L+TPL+AAMH+D SPEL EVA++L E LE+      P  P
Sbjct  334   ISLESDIFGPVSSRLSIPFILQTPLLAAMHEDHSPELKEVAKILKETLEVDGLHARPATP  393

Query  1058  LKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVV  1237
             L                         VGILKKIGRDG+GGI         S  +MKRTVV
Sbjct  394   L-------------------------VGILKKIGRDGSGGIT---GGRNRSDVKMKRTVV  425

Query  1238  AIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             AIEGGLYTSYT FREYL+EA+ EILG +V+ HV++ VTEDGSGIG
Sbjct  426   AIEGGLYTSYTMFREYLHEALNEILG-DVAQHVSLQVTEDGSGIG  469



>gb|KHN05494.1| Hexokinase-3 [Glycine soja]
Length=443

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/431 (76%), Positives = 380/431 (88%), Gaps = 6/431 (1%)
 Frame = +2

Query  86    MAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRVLRVQLGGQRSAT  265
             MAVEMHAGLASEGGSKLKMLLTYV  LPNG+E+GT+YALDLGGTNFRVLRV L GQ+S+ 
Sbjct  1     MAVEMHAGLASEGGSKLKMLLTYVHNLPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSV  60

Query  266   IRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS--QGRSLGFTFSFPVK  439
             + H+V++QPIPQ+L+T TSEDLFDFIASSLK+FIE++   SE S  + R LGFTFSFPVK
Sbjct  61    LEHEVERQPIPQNLMTSTSEDLFDFIASSLKEFIEKEGDGSELSPDRRRELGFTFSFPVK  120

Query  440   QTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYN  619
             Q SVSSGIL+KWT+GF I D+VG +V  CLQ A +RKGLD+RVAAL+NDTV TLALGHY+
Sbjct  121   QMSVSSGILLKWTKGFSIVDLVGIDVPACLQEALTRKGLDVRVAALVNDTVGTLALGHYH  180

Query  620   DEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSD  799
             D DTVA+VI GTGTNACY+ER DAIIKCQGL TTSG MVVNMEWGNFWSSHLPRTSYD D
Sbjct  181   DSDTVASVIIGTGTNACYLERVDAIIKCQGLPTTSGYMVVNMEWGNFWSSHLPRTSYDID  240

Query  800   LDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAA  979
             LD++SPNPNDQGFEKMISGMYLGDIVRRV+LRMS E D+ GP+SSKL+MPF+LRTP+MAA
Sbjct  241   LDSESPNPNDQGFEKMISGMYLGDIVRRVILRMSLESDMLGPISSKLSMPFMLRTPMMAA  300

Query  980   MHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIG  1159
             MH+DDSP+L EVAR+L  ILE+PDVPLKLRK+VV+VCDVVTRRAARLAAAGIVGILKKIG
Sbjct  301   MHEDDSPDLREVARILKGILEIPDVPLKLRKVVVKVCDVVTRRAARLAAAGIVGILKKIG  360

Query  1160  RDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVT  1339
             RDG+GGIA        S  +MKRTVVAIEGGLY+SYT FR+YL+EA+ +ILGE+++ HV 
Sbjct  361   RDGSGGIA----GGRRSDMKMKRTVVAIEGGLYSSYTLFRDYLHEALNDILGEDIARHVI  416

Query  1340  ITVTEDGSGIG  1372
             + VTEDGSG+G
Sbjct  417   LKVTEDGSGVG  427



>ref|XP_010031756.1| PREDICTED: hexokinase-3 isoform X2 [Eucalyptus grandis]
Length=497

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/459 (71%), Positives = 381/459 (83%), Gaps = 16/459 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL VL E+EE C T VGRL+QVVDAMAVEMHAGLASEGGSKL+MLLT+VD LP+GSE
Sbjct  34    WGRVLGVLREVEEGCETSVGRLKQVVDAMAVEMHAGLASEGGSKLRMLLTFVDNLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL +GGT FR+LRV+LGGQRS+ + HDV++Q IPQHL+T T+E+           
Sbjct  94    KGTYYALHVGGTYFRMLRVKLGGQRSSILAHDVERQLIPQHLMTSTTEE-----------  142

Query  362   FIERDSSDSEH--SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+ S S     + R LGFTFS+PVKQTSVSSGILIKWT+GF I+DMVG+ V ECLQ 
Sbjct  143   FVEREESSSSFPLDRRRELGFTFSYPVKQTSVSSGILIKWTKGFAIKDMVGKEVVECLQQ  202

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGL +RV+AL+NDTV TLALGHY+DEDTVAAVI GTGTNACYVER DAIIKCQG+L
Sbjct  203   ALTRKGLSMRVSALVNDTVGTLALGHYHDEDTVAAVIIGTGTNACYVERMDAIIKCQGIL  262

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPN+QGFEKMISGMYLGDIVRRVLLR
Sbjct  263   TSSGVMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNEQGFEKMISGMYLGDIVRRVLLR  322

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+ GP+S  L  PF+L T L+A MH+DDS +L+EVA +L + LE+PDVPLK+RKL
Sbjct  323   MSQESDILGPISPTLLKPFILSTRLVANMHEDDSLDLAEVAEILRDNLEIPDVPLKVRKL  382

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAA IVGILKKIGRDG+GGI         S  +M+RT VAIEG L
Sbjct  383   VVNVCDVVTRRAARLAAAAIVGILKKIGRDGSGGIT---SGRSRSDIKMRRTAVAIEGSL  439

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+Y+ FREYLNEA+ EILGE+V+ HV + V EDGSGIG
Sbjct  440   YTNYSMFREYLNEAMVEILGEDVAEHVILNVMEDGSGIG  478



>ref|XP_009414963.1| PREDICTED: hexokinase-3-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/446 (70%), Positives = 374/446 (84%), Gaps = 7/446 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC TPVGRLRQVVDAMAVEMHAGLAS+GGSKLKMLLT++D LP+G+EEGT+YALDLGGTN
Sbjct  47    ACDTPVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGTEEGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFI--ERDSSDSEH  394
             FRVLRVQLGG+ S  + H V+ QPIPQ L+TGTSE+LF FIAS LK F+  E D      
Sbjct  107   FRVLRVQLGGKGSMILSHKVESQPIPQELMTGTSEELFTFIASILKRFVQSENDGFQQLP  166

Query  395   SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
                + LGFTFSFPVKQ S+SSG+LIKWT+GF IED VG+++++CL  A ++ GL++RVAA
Sbjct  167   DDRKDLGFTFSFPVKQLSISSGVLIKWTKGFSIEDAVGKDIAQCLNEAMTKIGLNMRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHYNDEDTVAAVI GTGTNACY+ER DAIIKCQGLLT SG+MVVNMEWG
Sbjct  227   LVNDTVGTLALGHYNDEDTVAAVIIGTGTNACYLERTDAIIKCQGLLTNSGAMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD  LD +SPN N+QGFEKMISGMYLGDIVRRVL RM++E D+F   + 
Sbjct  287   NFWSSHLPRTSYDIALDDESPNRNEQGFEKMISGMYLGDIVRRVLYRMAEESDIFLDPAK  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
              L++PF+LRTPLMA MH+DDSP+L+EV RVL E L++  VPLK+R+LVV VCD+VTRRA+
Sbjct  347   NLSVPFILRTPLMANMHEDDSPDLTEVGRVLEEHLKISRVPLKVRRLVVRVCDIVTRRAS  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVG+LKK GRDG+GG+A     SG +  + +RTVV +EGGLY  YT F++YLNE
Sbjct  407   RLAAAGIVGMLKKTGRDGSGGVA-----SGRTRGKPRRTVVVVEGGLYIGYTMFKQYLNE  461

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILG+EV+ +V + V+EDGSGIG
Sbjct  462   AIGEILGDEVAPYVLLKVSEDGSGIG  487



>ref|XP_010921910.1| PREDICTED: hexokinase-3-like isoform X1 [Elaeis guineensis]
Length=498

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/459 (69%), Positives = 381/459 (83%), Gaps = 7/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+ + +L+E EE CAT +GRLRQVVDAMAVEMHAGLAS+GGSKL+MLLT+VD LP+G+E
Sbjct  34    WRRAVEMLQEFEEGCATSIGRLRQVVDAMAVEMHAGLASDGGSKLRMLLTFVDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRVQLGG+ S  + H V+  PIPQ L++GTSEDLFDFIA +LK 
Sbjct  94    KGTYYALDLGGTNFRVLRVQLGGRGSMILSHQVKHHPIPQELMSGTSEDLFDFIARTLKQ  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++   SE    + + LGFTFSFPV+Q SVSSGIL+KWT+GF +ED VG++V+ CL+ 
Sbjct  154   FVEQEDDGSEQKVDEKKELGFTFSFPVRQMSVSSGILVKWTKGFSVEDAVGKDVARCLEE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++ GL+++VAAL++D V TLAL HY D+DTVAAV+ GTGTNACYVER DAIIKCQGLL
Sbjct  214   AMTKAGLNMQVAALVDDIVGTLALCHYYDKDTVAAVVIGTGTNACYVERTDAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG  VVNMEWGNFWSSHLPRTSYD  LD +SPN NDQGFEKMISGMYLGDI RRVL R
Sbjct  274   TSSGGTVVNMEWGNFWSSHLPRTSYDIALDDESPNSNDQGFEKMISGMYLGDIARRVLYR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M+QE D+FG  +  L++ F+ RTPLMAAMH+D+SP+L EV R+L E L LP V LK+R+L
Sbjct  334   MAQEADIFGDDAYNLSIQFIFRTPLMAAMHEDESPDLREVRRILTENLLLPHVSLKVRRL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V VCD+VTRRAARLAAAGIVGILKKIGRDG+GG+A     SG +    +RTVVAIEGGL
Sbjct  394   IVRVCDIVTRRAARLAAAGIVGILKKIGRDGSGGVA-----SGRTKGTPRRTVVAIEGGL  448

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y  Y+ FREYLNEAV EILGEEV+ +V + V+EDGSGIG
Sbjct  449   YAHYSMFREYLNEAVVEILGEEVAQNVVLRVSEDGSGIG  487



>gb|KFK35941.1| hypothetical protein AALP_AA4G057200 [Arabis alpina]
Length=498

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/459 (70%), Positives = 382/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPV RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WRTVVGILKELEDVCDTPVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDDLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT  R+LRV LGGQRS     DV++ PIP HL+  TSE LF+F+A S++ 
Sbjct  94    KGTYYALHLGGTYIRILRVHLGGQRSYLDVQDVERHPIPSHLMNSTSEILFNFLAFSMER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ ++S  SQG  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ 
Sbjct  154   FIEKEGNESS-SQGVKRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGKDIAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+ VAAL+NDTV  L+LG+Y+D DTVAAV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALDRRGLDMHVAALVNDTVGALSLGYYHDPDTVAAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNANDMGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP SS L+ P++LRT  ++ MH+DD+PEL EVAR+L + L + +VPLK+RKL
Sbjct  333   MSQESDIFGPTSSTLSEPYVLRTNSVSVMHEDDTPELQEVARILKD-LGVTEVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S  +  KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEITMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYTMFREYMEEALNEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_006307314.1| hypothetical protein CARUB_v10008936mg [Capsella rubella]
 gb|EOA40212.1| hypothetical protein CARUB_v10008936mg [Capsella rubella]
Length=498

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/458 (70%), Positives = 377/458 (82%), Gaps = 4/458 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP G E
Sbjct  34    WRTVVEILKELEDDCDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDDLPTGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LG QRS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGAQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSE-HSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAA  538
             FIE++ + S+  S  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ A
Sbjct  154   FIEKEENGSDSQSVTRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGKDIAECLQGA  213

Query  539   FSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLT  718
              +R+GL++ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLLT
Sbjct  214   LNRRGLNMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLLT  273

Query  719   TSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRM  898
             TSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LRM
Sbjct  274   TSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMISGMYLGDIVRRVILRM  333

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             SQE DVFGP SS L+ P++L T  ++AMH+DD+PEL EVAR+L + L   DVPLK+RKLV
Sbjct  334   SQESDVFGPTSSVLSEPYVLSTNSVSAMHEDDTPELQEVARILKD-LGGSDVPLKVRKLV  392

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGLY
Sbjct  393   VKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGLY  450

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  451   MNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_002891576.1| hypothetical protein ARALYDRAFT_474175 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67835.1| hypothetical protein ARALYDRAFT_474175 [Arabidopsis lyrata subsp. 
lyrata]
Length=498

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/459 (69%), Positives = 381/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP G E
Sbjct  34    WRTVVEILKELEDDCDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDDLPTGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LGGQRS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGGQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S +SQG  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ 
Sbjct  154   FIEKEGNGS-NSQGVRRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGQDIAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +R+GLD+ V AL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALNRRGLDMHVGALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNANDMGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+S  L+ P++LRT  ++AMH+DD+PEL EVAR+L + L + D+P+K+RKL
Sbjct  333   MSQESDIFGPISPVLSEPYVLRTNSVSAMHEDDTPELQEVARILKD-LGVSDLPVKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FREY+ EA+ EILG+EVS +V +   EDGS IG
Sbjct  450   YMNYTMFREYMEEALVEILGDEVSQYVVVKAMEDGSSIG  488



>emb|CDY07303.1| BnaC05g26650D [Brassica napus]
Length=498

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/459 (69%), Positives = 381/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+E+EEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+V  LPNG+E
Sbjct  34    WRAVVEILKEMEEACRTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVHHLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A S++ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSMER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++  +S +SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++V+ECLQ 
Sbjct  154   FIEKEGKES-NSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDVAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QGLL
Sbjct  213   ALNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGS+VVNMEWGNFWSSHLPRTSYD DLDA+S NPND GFEKMI+G+YLGDIVRRV+  
Sbjct  273   TTSGSVVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVIRH  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQ  D+FGP SS L+ P++LRT  ++AMH+DD+PEL +VAR+L + L + DVPLK+RKL
Sbjct  333   MSQVSDIFGPTSSMLSEPYVLRTNSVSAMHEDDTPELQQVARILKD-LGVSDVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKK+GRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKVGRDGSGGIT--SGRSRSEMRMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|NP_175463.1| hexokinase-like 1 [Arabidopsis thaliana]
 sp|Q9LPS1.1|HXK3_ARATH RecName: Full=Hexokinase-3 [Arabidopsis thaliana]
 gb|AAF87885.1|AC012561_18 Putative hexokinase [Arabidopsis thaliana]
 gb|AAL67011.1| putative hexokinase [Arabidopsis thaliana]
 gb|AAM20056.1| putative hexokinase [Arabidopsis thaliana]
 gb|AEE32553.1| hexokinase-like 1 [Arabidopsis thaliana]
Length=498

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/459 (69%), Positives = 381/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP G E
Sbjct  34    WRTVVEILKELEDDCDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDDLPTGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LG QRS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVLLGDQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S+ SQG  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ 
Sbjct  154   FIEKEENGSD-SQGVRRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGQDIAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +R+GLD+ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALNRRGLDMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNANDMGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MS++ D+FGP+S  L+ P++LRT  ++A+H+DD+PEL EVAR+L +I  + DVPLK+RKL
Sbjct  333   MSEDSDIFGPISPVLSEPYVLRTNSVSAIHEDDTPELQEVARILKDI-GVSDVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_009144955.1| PREDICTED: hexokinase-3-like [Brassica rapa]
Length=498

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/459 (69%), Positives = 381/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+E+EEA  TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+V  LPNG+E
Sbjct  34    WRAVVEILKEMEEASDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVHHLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A S++ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSMER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++  +S +SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++V+ECLQ 
Sbjct  154   FIEKEGKES-NSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDVAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QGLL
Sbjct  213   ALNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S NPND GFEK+I+G+YLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEKIIAGLYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQ  D+FGP S  L+ P++LRT  ++AMH+DD+PEL EVAR+L + L + +VPLK+RKL
Sbjct  333   MSQVSDIFGPTSPMLSEPYVLRTNSVSAMHEDDTPELQEVARILKD-LGVSEVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEMRMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_008775017.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=498

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/459 (68%), Positives = 376/459 (82%), Gaps = 8/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+ + VL E EE CAT +GRL QVVDAMAVEMHAGLAS+GGSKLKMLLT++D LP+G+E
Sbjct  34    WRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRVQLGG+ S  I H V+  PIPQ L++GTSEDLFD+IA +LK 
Sbjct  94    KGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIAMTLKQ  153

Query  362   FIER--DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER  D S+ +  + + LGFTFSFPV+Q SVSSGIL+KWT+GF +ED VG+++++CL+ 
Sbjct  154   FVERADDGSEQKADEKKELGFTFSFPVRQMSVSSGILVKWTKGFSVEDAVGKDIAQCLEE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++ GL+++VAAL+ND V TLAL HY D+DTVAAVI GTGTNACYVER DAIIKCQGLL
Sbjct  214   AMTKAGLNMQVAALVNDIVGTLALCHYYDKDTVAAVIIGTGTNACYVERTDAIIKCQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG  VVNMEWGNFWSSHLPRTSYD  LD +SPN NDQGFEKMISGMYLG+I RRVL R
Sbjct  274   KNSGGTVVNMEWGNFWSSHLPRTSYDIALDDESPNSNDQGFEKMISGMYLGEITRRVLYR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M+QE D+FG  +  L++ F+LRTP MAAMH+DDSP+L EV R+L E L++P V L+ R+L
Sbjct  334   MAQESDIFGDGAYNLSIRFILRTPSMAAMHEDDSPDLREVRRILTETLQVPHVSLRARRL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V VCD+VTRRAARLAAAGIVGILKKIGRDG+G      + SG +    +RTVVAIEG L
Sbjct  394   IVRVCDIVTRRAARLAAAGIVGILKKIGRDGSG------VASGRAKGTPRRTVVAIEGAL  447

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y+ FREYLNEAV EILGEE + +V + V+EDGSGIG
Sbjct  448   YVNYSMFREYLNEAVVEILGEEAAQNVVLIVSEDGSGIG  486



>ref|XP_009107216.1| PREDICTED: hexokinase-3-like [Brassica rapa]
Length=499

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/456 (69%), Positives = 376/456 (82%), Gaps = 6/456 (1%)
 Frame = +2

Query  11    VLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGT  190
             V+ +L+E EE C  PVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LPNG+E+GT
Sbjct  37    VVEILKEFEEGCDAPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGT  96

Query  191   FYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE  370
             +YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL+ FI+
Sbjct  97    YYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIQ  156

Query  371   RDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFS  544
             ++ ++S +SQG  R L FTFSFPVK T +SSG+LIKWT+GFEI +MVG++++ECLQ A +
Sbjct  157   KEGNES-NSQGVKRELAFTFSFPVKHTCISSGVLIKWTKGFEISEMVGKDIAECLQGALN  215

Query  545   RKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTS  724
             R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLLTTS
Sbjct  216   RRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTS  275

Query  725   GSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQ  904
             GSMVVNMEWGNFWSSHLPRT+YD DLDA+S NPND GFEKMI+G+YLGDIVRRV+LRMSQ
Sbjct  276   GSMVVNMEWGNFWSSHLPRTAYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMSQ  335

Query  905   EFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVE  1084
             E D+FGP SS  + P++LRT  ++AMH+DD+PEL EVAR+L + L + DVPLK+RKL+V+
Sbjct  336   ESDIFGPSSSVFSQPYVLRTNSVSAMHEDDTPELQEVARILKD-LGVSDVPLKVRKLMVK  394

Query  1085  VCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTS  1264
             +CDVVTRRA RLAAAGI GILKKIGRDG GGI     RS       +RTVVA+EGGLY  
Sbjct  395   ICDVVTRRAGRLAAAGIAGILKKIGRDGGGGIT--SGRSRGEMQMQRRTVVAVEGGLYMK  452

Query  1265  YTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  453   YTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_010092207.1| hypothetical protein L484_013525 [Morus notabilis]
 gb|EXB50433.1| hypothetical protein L484_013525 [Morus notabilis]
Length=455

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/403 (76%), Positives = 357/403 (89%), Gaps = 6/403 (1%)
 Frame = +2

Query  170   NGSEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIAS  349
             NGSE+GT YALDLGGTNFRVLRV LGG+RS+ + HDV++QPIPQ L+T TSEDLFDFIAS
Sbjct  38    NGSEKGTHYALDLGGTNFRVLRVHLGGRRSSILGHDVERQPIPQELMTSTSEDLFDFIAS  97

Query  350   SLKDFIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSE  523
             +LK+F+E++   SE S  + R LGFTFSFPVKQ SVSSGILIKWT+GF I DMVG+ V+ 
Sbjct  98    ALKEFVEKEGDGSETSLDRRRDLGFTFSFPVKQMSVSSGILIKWTKGFAIVDMVGKEVAG  157

Query  524   CLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKC  703
             CL+ A +RKGL+++VAAL+NDTV TLALGHY+DEDTVAAV+ GTGTNACY+ER DAIIKC
Sbjct  158   CLEQALTRKGLNMQVAALVNDTVGTLALGHYHDEDTVAAVLIGTGTNACYLERTDAIIKC  217

Query  704   QGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRR  883
             QGLLTT+G MVVNMEWGNFW+SHLPRT+YD DLDADSPNPNDQGFEKMISGMYLGDIVRR
Sbjct  218   QGLLTTTGCMVVNMEWGNFWTSHLPRTTYDIDLDADSPNPNDQGFEKMISGMYLGDIVRR  277

Query  884   VLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLK  1063
             V+LRM+QE D+FGPVSSKL++PF+LRTPLMAAMH+DDSP+L EV R+L ++LE+PDVPLK
Sbjct  278   VILRMAQETDIFGPVSSKLSVPFILRTPLMAAMHEDDSPDLQEVGRILRDVLEIPDVPLK  337

Query  1064  LRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAI  1243
             +RKLVV+VCDVVTRRAARLAAAGI GILKKIGRDG+GG+         S ++M+RTVVAI
Sbjct  338   VRKLVVKVCDVVTRRAARLAAAGIAGILKKIGRDGSGGLT----GGRRSDNKMRRTVVAI  393

Query  1244  EGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             EGGLYTSYT FREYL+EA+ EILGEEV+ HV + VTEDGSGIG
Sbjct  394   EGGLYTSYTMFREYLHEALIEILGEEVAQHVVLKVTEDGSGIG  436



>emb|CDY22797.1| BnaA06g02800D [Brassica napus]
Length=498

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/456 (69%), Positives = 381/456 (84%), Gaps = 6/456 (1%)
 Frame = +2

Query  11    VLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGT  190
             V+ +L+ELEE C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+V +LP G+E+GT
Sbjct  37    VVEILKELEEGCDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVHELPKGTEKGT  96

Query  191   FYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE  370
             +YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL+ FIE
Sbjct  97    YYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLEKFIE  156

Query  371   RDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFS  544
             ++ + S +SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++++ECLQ A +
Sbjct  157   KEGNGS-NSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDIAECLQVALN  215

Query  545   RKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTS  724
             R+GLD+ VA L+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QGLLTTS
Sbjct  216   RRGLDMHVAVLVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQGLLTTS  275

Query  725   GSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQ  904
             GSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV++RMSQ
Sbjct  276   GSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMISGMYLGDIVRRVIVRMSQ  335

Query  905   EFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVE  1084
             E D+FGP SS L+ P++LRT L++AMH+DD+PEL EVAR+L + L + +VPLK+RKLVV+
Sbjct  336   ESDIFGPSSSLLSEPYVLRTNLVSAMHEDDTPELQEVARILKD-LGVSEVPLKVRKLVVK  394

Query  1085  VCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTS  1264
             VCDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGLY +
Sbjct  395   VCDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGLYMN  452

Query  1265  YTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+ FREY++EA+ EILGEEVS +V +   EDGS IG
Sbjct  453   YSMFREYMDEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_010479505.1| PREDICTED: hexokinase-3 isoform X1 [Camelina sativa]
 ref|XP_010479506.1| PREDICTED: hexokinase-3 isoform X2 [Camelina sativa]
Length=498

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/459 (69%), Positives = 375/459 (82%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPV RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+V  LP G E
Sbjct  34    WRTVVEILKELEDDCDTPVARLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVHVLPTGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LG QRS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGAQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S  SQG  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ 
Sbjct  154   FIEKEENGS-ISQGVKRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGKDIAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GL++ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALDRRGLNMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE DVFGP +S L+ P++L T  ++AMH+DD+PEL EVARVL + L + DVPLK+RKL
Sbjct  333   MSQESDVFGPTTSVLSDPYVLSTNSVSAMHEDDTPELQEVARVLKD-LGVSDVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYVMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_008775016.1| PREDICTED: hexokinase-3-like isoform X1 [Phoenix dactylifera]
Length=499

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/460 (68%), Positives = 376/460 (82%), Gaps = 9/460 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+ + VL E EE CAT +GRL QVVDAMAVEMHAGLAS+GGSKLKMLLT++D LP+G+E
Sbjct  34    WRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YALDLGGTNFRVLRVQLGG+ S  I H V+  PIPQ L++GTSEDLFD+IA +LK 
Sbjct  94    KGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIAMTLKQ  153

Query  362   FIER--DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER  D S+ +  + + LGFTFSFPV+Q SVSSGIL+KWT+GF +ED VG+++++CL+ 
Sbjct  154   FVERADDGSEQKADEKKELGFTFSFPVRQMSVSSGILVKWTKGFSVEDAVGKDIAQCLEE  213

Query  536   AFSRKGLDIRVAAL-INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
             A ++ GL+++VAAL +ND V TLAL HY D+DTVAAVI GTGTNACYVER DAIIKCQGL
Sbjct  214   AMTKAGLNMQVAALQVNDIVGTLALCHYYDKDTVAAVIIGTGTNACYVERTDAIIKCQGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG  VVNMEWGNFWSSHLPRTSYD  LD +SPN NDQGFEKMISGMYLG+I RRVL 
Sbjct  274   LKNSGGTVVNMEWGNFWSSHLPRTSYDIALDDESPNSNDQGFEKMISGMYLGEITRRVLY  333

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             RM+QE D+FG  +  L++ F+LRTP MAAMH+DDSP+L EV R+L E L++P V L+ R+
Sbjct  334   RMAQESDIFGDGAYNLSIRFILRTPSMAAMHEDDSPDLREVRRILTETLQVPHVSLRARR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             L+V VCD+VTRRAARLAAAGIVGILKKIGRDG+G      + SG +    +RTVVAIEG 
Sbjct  394   LIVRVCDIVTRRAARLAAAGIVGILKKIGRDGSG------VASGRAKGTPRRTVVAIEGA  447

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY +Y+ FREYLNEAV EILGEE + +V + V+EDGSGIG
Sbjct  448   LYVNYSMFREYLNEAVVEILGEEAAQNVVLIVSEDGSGIG  487



>ref|XP_010031757.1| PREDICTED: hexokinase-3 isoform X3 [Eucalyptus grandis]
Length=483

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/459 (70%), Positives = 371/459 (81%), Gaps = 30/459 (7%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL VL E+EE C T VGRL+QVVDAMAVEMHAGLASEGGSKL+MLLT+VD LP+GSE
Sbjct  34    WGRVLGVLREVEEGCETSVGRLKQVVDAMAVEMHAGLASEGGSKLRMLLTFVDNLPSGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL +GGT FR+LRV+LGGQRS+ + HDV++Q IPQHL+T T+E LFDF+ASSLK+
Sbjct  94    KGTYYALHVGGTYFRMLRVKLGGQRSSILAHDVERQLIPQHLMTSTTEALFDFVASSLKE  153

Query  362   FIERDSSDSEH--SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER+ S S     + R LGFTFS+PVKQTSVSSGILIKWT+GF I+DMV          
Sbjct  154   FVEREESSSSFPLDRRRELGFTFSYPVKQTSVSSGILIKWTKGFAIKDMV----------  203

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
                            NDTV TLALGHY+DEDTVAAVI GTGTNACYVER DAIIKCQG+L
Sbjct  204   ---------------NDTVGTLALGHYHDEDTVAAVIIGTGTNACYVERMDAIIKCQGIL  248

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG MVVNMEWGNFWSSHLPRTSYD DLDA+SPNPN+QGFEKMISGMYLGDIVRRVLLR
Sbjct  249   TSSGVMVVNMEWGNFWSSHLPRTSYDIDLDAESPNPNEQGFEKMISGMYLGDIVRRVLLR  308

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+ GP+S  L  PF+L T L+A MH+DDS +L+EVA +L + LE+PDVPLK+RKL
Sbjct  309   MSQESDILGPISPTLLKPFILSTRLVANMHEDDSLDLAEVAEILRDNLEIPDVPLKVRKL  368

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCDVVTRRAARLAAA IVGILKKIGRDG+GGI         S  +M+RT VAIEG L
Sbjct  369   VVNVCDVVTRRAARLAAAAIVGILKKIGRDGSGGIT---SGRSRSDIKMRRTAVAIEGSL  425

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT+Y+ FREYLNEA+ EILGE+V+ HV + V EDGSGIG
Sbjct  426   YTNYSMFREYLNEAMVEILGEDVAEHVILNVMEDGSGIG  464



>ref|XP_010461899.1| PREDICTED: hexokinase-3-like [Camelina sativa]
Length=498

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/459 (69%), Positives = 375/459 (82%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELE+ C TPV RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LP G E
Sbjct  34    WRTVVEILKELEDDCDTPVARLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDVLPTGRE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LG QRS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGAQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S +S G  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG++++ECLQ 
Sbjct  154   FIEKEENVS-NSLGVKRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGKDIAECLQD  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GL++ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALDRRGLNMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMISGMYLGDIVRRV+LR
Sbjct  273   TTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMISGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE DVFGP +S L+ P++L T  ++AMH+DD+PEL +V R+L + L + DVPLK+RKL
Sbjct  333   MSQESDVFGPTTSVLSEPYVLSTNSVSAMHEDDTPELQDVTRILKD-LGVSDVPLKVRKL  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGL
Sbjct  392   VVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYIMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>emb|CDY03607.1| BnaC03g68660D [Brassica napus]
Length=488

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/456 (68%), Positives = 371/456 (81%), Gaps = 17/456 (4%)
 Frame = +2

Query  11    VLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGT  190
             V+ +L+E EE C  PVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  LPNG+E+GT
Sbjct  37    VVEILKEFEEGCDAPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGT  96

Query  191   FYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE  370
             +YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+ASSL+ FI+
Sbjct  97    YYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLASSLERFIQ  156

Query  371   RDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFS  544
             ++ ++S +SQG  R L FTFSFPVK T +SSG+LIKWT+GFEI +MVG++++ECLQ A +
Sbjct  157   KEGNES-NSQGVIRELAFTFSFPVKHTCISSGVLIKWTKGFEISEMVGKDIAECLQGALN  215

Query  545   RKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTS  724
             R+GLDI VAAL+NDTV  L+LG+Y+D DTV  V+FGTG+NACY+ER DAIIKCQGLLTTS
Sbjct  216   RRGLDIHVAALVNDTVGALSLGYYHDPDTVVTVVFGTGSNACYLERTDAIIKCQGLLTTS  275

Query  725   GSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQ  904
             GSMVVNMEWGNFWSSHLPRT+YD DLDA+S NPND GFEKMI+G+YLGDIVRRV+LRMSQ
Sbjct  276   GSMVVNMEWGNFWSSHLPRTAYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMSQ  335

Query  905   EFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVE  1084
             E D+FGP SS  + P++LRT  ++AMH+DD+PEL EVAR+L + L L DVPLK+RKL+V+
Sbjct  336   ESDIFGPSSSVFSQPYVLRTNSVSAMHEDDTPELQEVARILRD-LGLSDVPLKVRKLMVK  394

Query  1085  VCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTS  1264
             +CDVVTRRA RLAAAGI GILKKIGRDG                  +RTVV +EGGLY +
Sbjct  395   ICDVVTRRAGRLAAAGIAGILKKIGRDGE-------------MQMQRRTVVGVEGGLYMN  441

Query  1265  YTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  442   YTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  477



>emb|CDY45062.1| BnaA08g02130D [Brassica napus]
Length=488

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/456 (67%), Positives = 369/456 (81%), Gaps = 17/456 (4%)
 Frame = +2

Query  11    VLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGT  190
             V+ +++E EE C  PVGRLR VVDAMAVEMHAGLASEGGSKLKMLLTYV  LPNG+E+GT
Sbjct  37    VVEIVKEFEEGCDAPVGRLRHVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGT  96

Query  191   FYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE  370
             +YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL+ FI+
Sbjct  97    YYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIQ  156

Query  371   RDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFS  544
             ++ ++S +SQG  R L FTFSFPVK T +SSG+LIKWT+GFEI +MVG++++ECLQ A +
Sbjct  157   KEGNES-NSQGVKRELAFTFSFPVKHTCISSGVLIKWTKGFEISEMVGKDIAECLQGALN  215

Query  545   RKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTS  724
             R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLLTTS
Sbjct  216   RRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTS  275

Query  725   GSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQ  904
             GSMVVNMEWGNFWSSHLPRT+YD DLDA+S NPND GFEKMI+G+YLGDIVRRV+LRMSQ
Sbjct  276   GSMVVNMEWGNFWSSHLPRTAYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMSQ  335

Query  905   EFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVE  1084
             E D+FGP SS  + P++LRT  ++AMH+DD+PEL EVAR+L + L + DVPLK+RKL+V+
Sbjct  336   ESDIFGPSSSVFSQPYVLRTNSVSAMHEDDTPELQEVARILKD-LGVSDVPLKVRKLMVK  394

Query  1085  VCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTS  1264
             +CDVVTRRA RLAAAGI GILKKIGRDG                  +RTVV +EGGLY  
Sbjct  395   ICDVVTRRAGRLAAAGIAGILKKIGRDGE-------------MQMQRRTVVGVEGGLYMK  441

Query  1265  YTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  442   YTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  477



>ref|XP_009147837.1| PREDICTED: hexokinase-3 [Brassica rapa]
Length=498

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/456 (68%), Positives = 375/456 (82%), Gaps = 6/456 (1%)
 Frame = +2

Query  11    VLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGT  190
             V+ +L+ELEE C TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+V +LP G+E+GT
Sbjct  37    VVEILKELEEGCDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVHELPKGTEKGT  96

Query  191   FYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE  370
             +YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL+ FIE
Sbjct  97    YYALHLGGTYFRILRVLLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIE  156

Query  371   RDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFS  544
             ++  D   SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++++ECLQ A +
Sbjct  157   KEG-DGSSSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDIAECLQVALN  215

Query  545   RKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTS  724
             R+GLD+ VA L+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DA+IK QGLLTTS
Sbjct  216   RRGLDMHVAVLVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAMIKSQGLLTTS  275

Query  725   GSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQ  904
             GSMVVNMEWGNFWSSHLPRTSYD DLDA+S N N+ GFEKM+SGMYLGDIVRRV+LRMSQ
Sbjct  276   GSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNEMGFEKMLSGMYLGDIVRRVILRMSQ  335

Query  905   EFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVE  1084
             E D+FGP SS L+ P+ LRT  ++AMH+DD+PEL EV R+L + L + +VPLK+RKLVV+
Sbjct  336   ESDIFGPSSSLLSEPYALRTNSVSAMHEDDTPELQEVTRILKD-LGVSEVPLKVRKLVVK  394

Query  1085  VCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTS  1264
             VCDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EGGLY +
Sbjct  395   VCDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEIQMQKRTVVAVEGGLYMN  452

Query  1265  YTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y+ FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  453   YSMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  488



>ref|XP_010651825.1| PREDICTED: hexokinase-3 isoform X2 [Vitis vinifera]
Length=433

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/401 (76%), Positives = 350/401 (87%), Gaps = 4/401 (1%)
 Frame = +2

Query  176   SEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSL  355
             SE G +YALDLGGTNFRVL++QLGG+ S+ +  DV++QPIPQ L+T TSEDLFDFIASSL
Sbjct  2     SERGKYYALDLGGTNFRVLQIQLGGKTSSILSCDVERQPIPQDLMTSTSEDLFDFIASSL  61

Query  356   KDFIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECL  529
             K F+ER++ +SE S  + R LGFTFSFPVKQTSVSSGILIKWT+ F ++DMVG++VSECL
Sbjct  62    KQFVEREAQNSEFSPVKRRELGFTFSFPVKQTSVSSGILIKWTKRFSVKDMVGKDVSECL  121

Query  530   QAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQG  709
             Q A +R GLD+RVA L+NDTV TLALGHYND DTVAAVI GTGTNACY+ER DAIIKCQG
Sbjct  122   QHAMTRNGLDMRVAVLVNDTVGTLALGHYNDPDTVAAVIIGTGTNACYLERTDAIIKCQG  181

Query  710   LLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVL  889
             LLTTSG MVVNMEWGNFWSSHLPRTSYD DLD DSPNPNDQGFEKMISGMYLGDIVRRV+
Sbjct  182   LLTTSGGMVVNMEWGNFWSSHLPRTSYDIDLDGDSPNPNDQGFEKMISGMYLGDIVRRVI  241

Query  890   LRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             LRMSQE D+FGPVSS+L+MPF+L TP MA MH D+SPEL EVAR+L E L++PDVPLK+R
Sbjct  242   LRMSQESDIFGPVSSRLSMPFILSTPSMADMHADESPELMEVARILKEDLQIPDVPLKVR  301

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KLVV+VCDVVTRRAARLAAAGIVGILKKIGRDG+GG+A    RS  S  +M+RTVVA++G
Sbjct  302   KLVVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGVA--SGRSRGSDGKMRRTVVAMDG  359

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              LYT YT F+EYL+EA+ EILGEEV+ +V + VTEDGSGIG
Sbjct  360   SLYTRYTMFKEYLHEALCEILGEEVAQYVILKVTEDGSGIG  400



>ref|XP_009405453.1| PREDICTED: hexokinase-3-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/446 (68%), Positives = 365/446 (82%), Gaps = 7/446 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             ACAT VGRLRQVVDAMAVEMHAGLASEGGSKL+MLLT++D LP+GSEEGT+YALDLGGTN
Sbjct  47    ACATSVGRLRQVVDAMAVEMHAGLASEGGSKLRMLLTFIDNLPDGSEEGTYYALDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIER--DSSDSEH  394
             FRVL++Q  G+ S  + H VQ+Q I Q L+TGT E+LF+FIAS+LK F++R  D  D   
Sbjct  107   FRVLQIQFSGKGSMILTHRVQRQQISQELMTGTREELFNFIASTLKQFVQREDDGIDQIP  166

Query  395   SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
                + LGFTFSFPV+Q SVSSG+LIKWT+GF I+D VG++V++CL  A  + GL++RVAA
Sbjct  167   DVRKDLGFTFSFPVRQLSVSSGLLIKWTKGFSIKDAVGKDVAQCLTEAMLKTGLNMRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHY D DTVAAVI GTGTNACY+ER DAIIK QGLLT SG MVVNMEWG
Sbjct  227   LVNDTVGTLALGHYYDVDTVAAVIIGTGTNACYLERTDAIIKYQGLLTNSGDMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRT YD  LD +SPN N+QGFEKMISGMYLG+IVRRVL RM++E D+F     
Sbjct  287   NFWSSHLPRTPYDISLDDESPNRNEQGFEKMISGMYLGEIVRRVLQRMAEESDIFPDAVQ  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
              L++PF++RTPLMAAMH+DDSP+L EV ++L + L++  V LK R+L+V VCD+VTRRAA
Sbjct  347   NLSVPFVIRTPLMAAMHEDDSPDLREVGKILEDHLKISGVSLKARRLLVRVCDIVTRRAA  406

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+ G+A     SG +  + +RTVVA+EGGLY  Y+ FREYLNE
Sbjct  407   RLAAAGIVGILKKIGRDGSAGVA-----SGRTKGKPRRTVVAVEGGLYVGYSMFREYLNE  461

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             AVAEILGEEV+ +V + V EDGSG G
Sbjct  462   AVAEILGEEVAPYVCLRVCEDGSGTG  487



>ref|XP_008227192.1| PREDICTED: hexokinase-3 isoform X2 [Prunus mume]
Length=432

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/404 (74%), Positives = 352/404 (87%), Gaps = 5/404 (1%)
 Frame = +2

Query  167   PNGSEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIA  346
             P+ SE+GT+YALDLGGTNFRVLRV+L G RS+T+ HDV +Q IPQ L+TG+SEDLFDFIA
Sbjct  13    PHWSEKGTYYALDLGGTNFRVLRVKLEGTRSSTLEHDVYRQAIPQDLMTGSSEDLFDFIA  72

Query  347   SSLKDFIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVS  520
             SSLK+F+ER+   SE S  + R LGFTFSFPVKQ SVSSG L+KWT+GF IEDMVGR ++
Sbjct  73    SSLKEFVEREGDISELSLDRRRELGFTFSFPVKQMSVSSGTLLKWTKGFSIEDMVGREIA  132

Query  521   ECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIK  700
             ECL+ A +RKGL++RVAAL+ND+V +LALGHY+D DTVAAVI GTGTNACY+ER DAIIK
Sbjct  133   ECLENAMTRKGLNMRVAALVNDSVGSLALGHYHDTDTVAAVIIGTGTNACYLERTDAIIK  192

Query  701   CQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVR  880
              QGLLTTSG MVVNMEWGNFWSSHLPRT YD +LDADSPNPNDQGFEK+ISGMYLGD+VR
Sbjct  193   SQGLLTTSGGMVVNMEWGNFWSSHLPRTLYDIELDADSPNPNDQGFEKLISGMYLGDVVR  252

Query  881   RVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPL  1060
             RV++RMSQE D+F P+SSKL+MPF+LRTPL+AAMH+DDSP+L EV R+L + LE+PDVPL
Sbjct  253   RVIVRMSQESDIFDPISSKLSMPFILRTPLIAAMHEDDSPDLEEVRRILRDNLEIPDVPL  312

Query  1061  KLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVA  1240
             K+RKL+V+VCDVVTRRAARLAAAGIVGILKKIGRDG+GGIA        S  +M+RTVVA
Sbjct  313   KVRKLIVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGIA---GGRSRSDQKMRRTVVA  369

Query  1241  IEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +EGGLYT YT FR+YL+EA+ EILGE+++ HV I VTEDGS +G
Sbjct  370   MEGGLYTGYTMFRDYLHEALTEILGEDIAQHVIIKVTEDGSAMG  413



>gb|EPS64171.1| hypothetical protein M569_10608, partial [Genlisea aurea]
Length=510

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/464 (67%), Positives = 367/464 (79%), Gaps = 7/464 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+R+LEELEE  ATPV RLRQ+VDAMA+EMHAGL SEGGSKLKML+TYV  LP G E
Sbjct  35    WGRVMRILEELEEGFATPVERLRQIVDAMAIEMHAGLVSEGGSKLKMLVTYVHDLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV L  +RSA   HDV +QPIPQ+L++ TSE+LFDFIA SLK 
Sbjct  95    KGIFYALDLGGTNFRVVRVVLDSRRSAISGHDVHRQPIPQNLMSSTSEELFDFIALSLKS  154

Query  362   FIER--DSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ER  + SD    + R LGFTFSFPVKQTS SSG LI+WT+GF + DMVG+NVSE LQ 
Sbjct  155   FVERVENVSDPSQLERRDLGFTFSFPVKQTSSSSGNLIRWTKGFSVSDMVGKNVSEVLQQ  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +RKGL++RVA L+NDTV TLAL +Y+DEDTVAAVIFGTGTNACY+E+ +A+IKCQ L 
Sbjct  215   AINRKGLNMRVAVLVNDTVGTLALSNYHDEDTVAAVIFGTGTNACYLEQTEAVIKCQSLR  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG   VN+EWGNFWSSHLPRTSYD+ LD+D+PNPN+Q FEKMISGMYLGDIVRRV+L+
Sbjct  275   KNSGRTAVNIEWGNFWSSHLPRTSYDAGLDSDTPNPNEQCFEKMISGMYLGDIVRRVILK  334

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D FG  SSKL +PF+LRTPLMAAMH DDSP+L+ VA +L ++ E+PD P  +RKL
Sbjct  335   MSQESDFFGHSSSKLHVPFILRTPLMAAMHGDDSPDLTAVAAILDDVFEIPDAPPHVRKL  394

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssr-----mkrTVVA  1240
             VV+VCD VTRRAARLAAAG+VGILKK+GRDG+   +S    S            +RTVVA
Sbjct  395   VVKVCDSVTRRAARLAAAGVVGILKKVGRDGSSSSSSLGNSSCRRRRAEGDGGRRRTVVA  454

Query  1241  IEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +EGGLY +Y  FRE L E + EILGE  S  V I   EDGSGIG
Sbjct  455   VEGGLYKNYGGFRECLTETIDEILGENYSRRVVIKQMEDGSGIG  498



>ref|XP_006393149.1| hypothetical protein EUTSA_v10011415mg [Eutrema salsugineum]
 gb|ESQ30435.1| hypothetical protein EUTSA_v10011415mg [Eutrema salsugineum]
Length=498

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/459 (69%), Positives = 381/459 (83%), Gaps = 6/459 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR V+ +L+ELEEAC TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WRTVVEILKELEEACDTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDDLPNGTE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL+ 
Sbjct  94    KGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLER  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ + S +SQG  R L FTFSFPVK TS+SSG+LIKWT+GFEI +MVG +++ECLQ 
Sbjct  154   FIEKEGNGS-NSQGVKRELAFTFSFPVKHTSISSGVLIKWTKGFEISEMVGNDIAECLQG  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +R+GL++ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGLL
Sbjct  213   ALNRRGLNMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSG MVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMI+GMYLGDIVRRV+LR
Sbjct  273   TTSGCMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMIAGMYLGDIVRRVILR  332

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP SS L+ P++LRT  ++AMH+DD+ EL EVAR+L + L + DVPLK+RK+
Sbjct  333   MSQESDIFGPSSSVLSEPYVLRTNSVSAMHEDDTSELQEVARILKD-LGVSDVPLKVRKV  391

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV+VCDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS +     KRTVVA+EGGL
Sbjct  392   VVKVCDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRNEVQMQKRTVVAVEGGL  449

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +YT FRE + EA+ EILGEEVS +V +   EDGS IG
Sbjct  450   YMNYTMFRESMEEALVEILGEEVSQYVIVKAMEDGSSIG  488



>ref|XP_010921911.1| PREDICTED: hexokinase-3-like isoform X2 [Elaeis guineensis]
Length=481

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/459 (66%), Positives = 364/459 (79%), Gaps = 24/459 (5%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+ + +L+E EE CAT +GRLRQVVDAMAVEMHAGLAS+GGSKL+MLLT+VD LP+G  
Sbjct  34    WRRAVEMLQEFEEGCATSIGRLRQVVDAMAVEMHAGLASDGGSKLRMLLTFVDNLPDG--  91

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
                            VLRVQLGG+ S  + H V+  PIPQ L++GTSEDLFDFIA +LK 
Sbjct  92    ---------------VLRVQLGGRGSMILSHQVKHHPIPQELMSGTSEDLFDFIARTLKQ  136

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E++   SE    + + LGFTFSFPV+Q SVSSGIL+KWT+GF +ED VG++V+ CL+ 
Sbjct  137   FVEQEDDGSEQKVDEKKELGFTFSFPVRQMSVSSGILVKWTKGFSVEDAVGKDVARCLEE  196

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A ++ GL+++VAAL++D V TLAL HY D+DTVAAV+ GTGTNACYVER DAIIKCQGLL
Sbjct  197   AMTKAGLNMQVAALVDDIVGTLALCHYYDKDTVAAVVIGTGTNACYVERTDAIIKCQGLL  256

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             T+SG  VVNMEWGNFWSSHLPRTSYD  LD +SPN NDQGFEKMISGMYLGDI RRVL R
Sbjct  257   TSSGGTVVNMEWGNFWSSHLPRTSYDIALDDESPNSNDQGFEKMISGMYLGDIARRVLYR  316

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M+QE D+FG  +  L++ F+ RTPLMAAMH+D+SP+L EV R+L E L LP V LK+R+L
Sbjct  317   MAQEADIFGDDAYNLSIQFIFRTPLMAAMHEDESPDLREVRRILTENLLLPHVSLKVRRL  376

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             +V VCD+VTRRAARLAAAGIVGILKKIGRDG+GG+A     SG +    +RTVVAIEGGL
Sbjct  377   IVRVCDIVTRRAARLAAAGIVGILKKIGRDGSGGVA-----SGRTKGTPRRTVVAIEGGL  431

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y  Y+ FREYLNEAV EILGEEV+ +V + V+EDGSGIG
Sbjct  432   YAHYSMFREYLNEAVVEILGEEVAQNVVLRVSEDGSGIG  470



>ref|XP_006843448.1| hypothetical protein AMTR_s00053p00173580 [Amborella trichopoda]
 gb|ERN05123.1| hypothetical protein AMTR_s00053p00173580 [Amborella trichopoda]
Length=504

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/454 (68%), Positives = 370/454 (81%), Gaps = 8/454 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ VL E EE C+T   RLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VD LPNG+E
Sbjct  34    WSRVVGVLREFEEGCSTSGHRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGT+FRVLRV L G +   + H V++Q IP HLLTGTSE+LF FIA +LK 
Sbjct  94    KGLYYALDLGGTHFRVLRVHLKGTKQKILDHKVEKQAIPPHLLTGTSEELFGFIALTLKR  153

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++  D E      R LGFTFSFPV+QTSVSSG LIKWT+GF IEDMVG++V+ECLQ+
Sbjct  154   FIEKEGDDFELQPVSRRDLGFTFSFPVRQTSVSSGFLIKWTKGFAIEDMVGKDVAECLQS  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +  GLD+RVAALIND+  TLALGHY+DEDT+ AVI GTGTNACY+ERADAIIKCQGL+
Sbjct  214   ARTMLGLDVRVAALINDSAGTLALGHYHDEDTMVAVIIGTGTNACYIERADAIIKCQGLI  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             + SG MV+NMEWGNFWSSHLPRT YD DLDA+SPNP DQGFEKMISGMYLGDIVRRV+LR
Sbjct  274   SNSGGMVINMEWGNFWSSHLPRTPYDVDLDAESPNPYDQGFEKMISGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M++E D+FG V   L+ PF LRTPLM AMH D+S +L EVAR++ E LE+ ++PL++R+L
Sbjct  334   MAKEADLFGEVGKSLSEPFTLRTPLMCAMHQDESSDLREVARIMEETLEVSNIPLRVRRL  393

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV VCD VTRRAARLAAAGIVGILKKIGRD           S +SS  ++RTVVAIEGGL
Sbjct  394   VVRVCDAVTRRAARLAAAGIVGILKKIGRD------GKGGSSSNSSEGVRRTVVAIEGGL  447

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTED  1357
             Y +Y+ FREY+ +A+ EILGEE+S +V + +++D
Sbjct  448   YENYSLFREYMRDALEEILGEEMSQNVVLRLSQD  481



>ref|XP_009145689.1| PREDICTED: hexokinase-4 [Brassica rapa]
Length=505

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/443 (67%), Positives = 358/443 (81%), Gaps = 6/443 (1%)
 Frame = +2

Query  50    TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRV  229
             TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE GT+YAL LGG+ FR+
Sbjct  50    TPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSYFRI  109

Query  230   LRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ--G  403
             +RV LGGQRS+    D+++  IP  LL  TSE LFDF+ASSL+ FIE++  +S  SQ   
Sbjct  110   IRVHLGGQRSSLEVQDIERHSIPTSLLNSTSEVLFDFLASSLQRFIEKEGHESISSQDVK  169

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A  R+GLDI VAAL+N
Sbjct  170   RELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGAVDRRGLDIHVAALVN  229

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV  L+ GHY+D DT+AAV+FGTG+NACY+ER DAIIKCQ   TTSGSMVVNMEWGNFW
Sbjct  230   DTVGALSYGHYHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFW  289

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMSQE D+FGP+SS L+
Sbjct  290   SSRLPRTSYDIELDAESLNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISSILS  349

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF+LRT  ++AMH+DD+PEL EVA +L   L +P+VPLK+RKLVV++CDVVTRRAARLA
Sbjct  350   TPFVLRTNSVSAMHEDDTPELHEVATILKH-LGVPNVPLKVRKLVVKICDVVTRRAARLA  408

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGI GILKK+GRDG+ G      R  S    M+RTVVA+EGGLY++Y  FREY++EA+ 
Sbjct  409   AAGISGILKKLGRDGSVG---EGRRRSSDKQMMRRTVVAVEGGLYSNYRMFREYMDEALR  465

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             +ILGE+V+  V I   EDGS IG
Sbjct  466   DILGEDVARQVVIKAMEDGSSIG  488



>ref|XP_002883225.1| hexokinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59484.1| hexokinase [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 367/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+V+ +L++LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE
Sbjct  34    WRRVVGILKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR+++V LGGQRS+    DV++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  94    RGTYYALHLGGSYFRIIKVHLGGQRSSLEVQDVERHSIPTSLMNSTSEVLFDFLASSLQR  153

Query  362   FIERDSSDSEHSQ--GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +D   SQ   R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ 
Sbjct  154   FIEKEGNDFNLSQPVKRELAFTFSFPVKQTSISSGVLIKWTKGFAISEMAGEDIAECLQG  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   
Sbjct  214   ALNKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPR  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LR
Sbjct  274   TTSGSMVVNMEWGNFWSSRLPRTSYDLELDAESMNSNDMGFEKMIGGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+SS L+ PF+LRT  ++AMH+DD+ EL EVAR+L + L + +VPLK+RKL
Sbjct  334   MSQESDIFGPISSILSTPFVLRTNSVSAMHEDDTSELQEVARILKD-LGVSEVPLKVRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVV RRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGL
Sbjct  393   VVKICDVVARRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGL  446

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY++EA+ +ILGE+V+ HV +   EDGS IG
Sbjct  447   YLNYRMFREYMDEALRDILGEDVAQHVVVKAMEDGSTIG  485



>dbj|BAD93730.1| hexokinase [Arabidopsis thaliana]
Length=480

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 368/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+V+ +L++LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE
Sbjct  12    WRRVVGLLKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSE  71

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR+++V LGGQRS+    DV++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  72    TGTYYALHLGGSYFRIIKVHLGGQRSSLEVQDVERHSIPTSLMNSTSEVLFDFLASSLQR  131

Query  362   FIERDSSDSEHSQ--GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +D   SQ   R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ 
Sbjct  132   FIEKEGNDFSLSQPLKRELAFTFSFPVKQTSISSGVLIKWTKGFAISEMAGEDIAECLQG  191

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   
Sbjct  192   ALNKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPR  251

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LR
Sbjct  252   TTSGSMVVNMEWGNFWSSRLPRTSYDLELDAESMNSNDMGFEKMIGGMYLGDIVRRVILR  311

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+SS L+ PF+LRT  ++AMH+DD+ EL EVAR+L + L + +VP+K+RKL
Sbjct  312   MSQESDIFGPISSILSTPFVLRTNSVSAMHEDDTSELQEVARILKD-LGVSEVPMKVRKL  370

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGL
Sbjct  371   VVKICDVVTRRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGL  424

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY++EA+ +ILGE+V+ HV +   EDGS IG
Sbjct  425   YLNYRMFREYMDEALRDILGEDVAQHVVVKAMEDGSSIG  463



>gb|EAY77169.1| hypothetical protein OsI_05139 [Oryza sativa Indica Group]
Length=500

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/445 (67%), Positives = 356/445 (80%), Gaps = 11/445 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP+GSEEG +Y++DLGGTN
Sbjct  47    GCATPPARLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPSGSEEGVYYSIDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE-RDSSDSEHS  397
             FRVLRVQ+G   S  +   V+QQPIP+ L  GT+E LF+F+A +LK+F+E  D  D + +
Sbjct  107   FRVLRVQVGAG-SVIVNQKVEQQPIPEELTKGTTEGLFNFVALALKNFLEGEDDQDGKMA  165

Query  398   QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
                 LGFTFSFPV+Q SVSSG LI+WT+GF I D VGR+V++CL  A +  GL++RV AL
Sbjct  166   ----LGFTFSFPVRQISVSSGSLIRWTKGFSIRDTVGRDVAQCLNEALANCGLNVRVTAL  221

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +NDTV TLALGHY DEDTVAAVI G+GTNACY+ER DAIIKCQGLLT SG MVVNMEWGN
Sbjct  222   VNDTVGTLALGHYYDEDTVAAVIIGSGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGN  281

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             FWSSHLPRT YD  LD ++ N NDQGFEKMISGMYLG+I R V  RM+QE DVFG  +  
Sbjct  282   FWSSHLPRTPYDILLDDETHNRNDQGFEKMISGMYLGEIARLVFHRMAQESDVFGDAADS  341

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L+ PF+L TP +AA+ +DDSP+LSEV R+L E L++PD PLK R+LVV+VCD+VTRRAAR
Sbjct  342   LSNPFILSTPFLAAIREDDSPDLSEVRRILQEHLKIPDAPLKTRRLVVKVCDIVTRRAAR  401

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGIVGILKK+GRDG+G  +     SG    + +RTVVAIEGGLY  Y  FREYL+EA
Sbjct  402   LAAAGIVGILKKLGRDGSGAAS-----SGRGRGQPRRTVVAIEGGLYQGYPVFREYLDEA  456

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + EILGEEV+ +VT+ VTEDGSG+G
Sbjct  457   LVEILGEEVARNVTLRVTEDGSGVG  481



>sp|Q2KNB4.1|HXK3_ORYSJ RecName: Full=Hexokinase-3; AltName: Full=Hexokinase-8 [Oryza 
sativa Japonica Group]
 gb|AAX68424.1| hexokinase 8 [Oryza sativa Japonica Group]
 gb|AAZ93620.1| hexokinase 3 [Oryza sativa Japonica Group]
Length=500

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/445 (67%), Positives = 356/445 (80%), Gaps = 11/445 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP+GSEEG +Y++DLGGTN
Sbjct  47    GCATPPARLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPSGSEEGVYYSIDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE-RDSSDSEHS  397
             FRVLRVQ+G   S  +   V+QQPIP+ L  GT+E LF+F+A +LK+F+E  D  D + +
Sbjct  107   FRVLRVQVGAG-SVIVNQKVEQQPIPEELTKGTTEGLFNFVALALKNFLEGEDDQDGKMA  165

Query  398   QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
                 LGFTFSFPV+Q SVSSG LI+WT+GF I D VGR+V++CL  A +  GL++RV AL
Sbjct  166   ----LGFTFSFPVRQISVSSGSLIRWTKGFSIRDTVGRDVAQCLNEALANCGLNVRVTAL  221

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +NDTV TLALGHY DEDTVAAVI G+GTNACY+ER DAIIKCQGLLT SG MVVNMEWGN
Sbjct  222   VNDTVGTLALGHYYDEDTVAAVIIGSGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGN  281

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             FWSSHLPRT YD  LD ++ N NDQGFEKMISGMYLG+I R V  RM+QE DVFG  +  
Sbjct  282   FWSSHLPRTPYDILLDDETHNRNDQGFEKMISGMYLGEIARLVFHRMAQESDVFGDAADS  341

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L+ PF+L TP +AA+ +DDSP+LSEV R+L E L++PD PLK R+LVV+VCD+VTRRAAR
Sbjct  342   LSNPFILSTPFLAAIREDDSPDLSEVRRILREHLKIPDAPLKTRRLVVKVCDIVTRRAAR  401

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGIVGILKK+GRDG+G  +     SG    + +RTVVAIEGGLY  Y  FREYL+EA
Sbjct  402   LAAAGIVGILKKLGRDGSGAAS-----SGRGRGQPRRTVVAIEGGLYQGYPVFREYLDEA  456

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + EILGEEV+ +VT+ VTEDGSG+G
Sbjct  457   LVEILGEEVARNVTLRVTEDGSGVG  481



>ref|NP_188639.2| hexokinase-4 [Arabidopsis thaliana]
 sp|Q56XE8.2|HXK4_ARATH RecName: Full=Hexokinase-4 [Arabidopsis thaliana]
 dbj|BAB01861.1| chloroplast outer envelope hexokinase [Arabidopsis thaliana]
 gb|AEE76323.1| hexokinase-4 [Arabidopsis thaliana]
Length=502

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 368/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WR+V+ +L++LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE
Sbjct  34    WRRVVGLLKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR+++V LGGQRS+    DV++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  94    TGTYYALHLGGSYFRIIKVHLGGQRSSLEVQDVERHSIPTSLMNSTSEVLFDFLASSLQR  153

Query  362   FIERDSSDSEHSQ--GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +D   SQ   R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ 
Sbjct  154   FIEKEGNDFSLSQPLKRELAFTFSFPVKQTSISSGVLIKWTKGFAISEMAGEDIAECLQG  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   
Sbjct  214   ALNKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPR  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LR
Sbjct  274   TTSGSMVVNMEWGNFWSSRLPRTSYDLELDAESMNSNDMGFEKMIGGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+SS L+ PF+LRT  ++AMH+DD+ EL EVAR+L + L + +VP+K+RKL
Sbjct  334   MSQESDIFGPISSILSTPFVLRTNSVSAMHEDDTSELQEVARILKD-LGVSEVPMKVRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGL
Sbjct  393   VVKICDVVTRRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGL  446

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY++EA+ +ILGE+V+ HV +   EDGS IG
Sbjct  447   YLNYRMFREYMDEALRDILGEDVAQHVVVKAMEDGSSIG  485



>ref|XP_010487967.1| PREDICTED: hexokinase-4 [Camelina sativa]
Length=502

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 367/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WRKV+ +L++LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE
Sbjct  34    WRKVVGILKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR++RV LGGQRS     D+++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  94    RGTYYALHLGGSYFRIIRVHLGGQRSTLEVQDIERHSIPTSLMNSTSEVLFDFLASSLQM  153

Query  362   FIERDSSDSEHSQ--GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +    +Q   R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ 
Sbjct  154   FIEKEGNMFNLAQPVKRELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQG  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   
Sbjct  214   ALNKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPR  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LR
Sbjct  274   TTSGSMVVNMEWGNFWSSRLPRTSYDIELDAESMNSNDMGFEKMIGGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+SS L+ PF+LRT  ++AMH+DD+PEL +VAR+L + L + +VPLK+RKL
Sbjct  334   MSQESDIFGPISSILSTPFILRTNSVSAMHEDDTPELLKVARILKD-LGVAEVPLKVRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGL
Sbjct  393   VVKICDVVTRRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGL  446

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY++EA+ +ILGE+V+ HV +   EDGS IG
Sbjct  447   YLNYRMFREYMDEALRDILGEDVAQHVVVKAMEDGSSIG  485



>ref|XP_006297494.1| hypothetical protein CARUB_v10013513mg [Capsella rubella]
 gb|EOA30392.1| hypothetical protein CARUB_v10013513mg [Capsella rubella]
Length=500

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/457 (65%), Positives = 363/457 (79%), Gaps = 7/457 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W+KV+ +L +LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE
Sbjct  34    WKKVVGILRDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR++RV LGGQRS     DV++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  94    TGTYYALHLGGSYFRIIRVHLGGQRSTLEVQDVERHSIPTSLMNSTSEVLFDFLASSLQM  153

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIE++  +      R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A 
Sbjct  154   FIEKEVFNLSQPVKRELAFTFSFPVKQTSISSGVLIKWTKGFAISEMAGEDIAECLQGAL  213

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
             +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   TT
Sbjct  214   NKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTT  273

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMS
Sbjct  274   SGSMVVNMEWGNFWSSRLPRTSYDLELDAESMNSNDMGFEKMIGGMYLGDIVRRVILRMS  333

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             QE D+FGP+SS L+ PF+LRT  ++AMH+DD+PEL EVAR+L + L + +V LK+RKLVV
Sbjct  334   QESDIFGPISSILSTPFVLRTNSVSAMHEDDTPELLEVARILND-LGVAEVALKVRKLVV  392

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
             ++CDVVTRRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGLY 
Sbjct  393   KICDVVTRRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGLYL  446

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +Y  FREY++EA+ +ILGE+V+ HV I   EDGS IG
Sbjct  447   NYRMFREYMDEALRDILGEDVAQHVVIKAMEDGSSIG  483



>emb|CDY24565.1| BnaC05g32490D [Brassica napus]
Length=505

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/443 (67%), Positives = 356/443 (80%), Gaps = 6/443 (1%)
 Frame = +2

Query  50    TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRV  229
             TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE GT+YAL LGG+ FR+
Sbjct  50    TPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSYFRI  109

Query  230   LRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ--G  403
             +RV LGGQRS+    D+++  IP  LL  TSE LFDF+ASSL+ FIE++  +S  SQ   
Sbjct  110   IRVHLGGQRSSLEVQDIERHSIPTSLLNSTSEVLFDFLASSLQRFIEKEGHESISSQDVK  169

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A  R+GLDI VAAL+N
Sbjct  170   RELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGAVDRRGLDIHVAALVN  229

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV  L+ GHY+D DT+AAV+FGTG+NACY+ER DAIIKCQ   TTSGSMVVNMEWGNFW
Sbjct  230   DTVGALSYGHYHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFW  289

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMSQE D+FGP+SS L+
Sbjct  290   SSRLPRTSYDIELDAESLNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISSILS  349

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF+LRT  ++AMH+DD+PEL EVA +L   L +  VPLK+RKLVV++CDVVTRRAARLA
Sbjct  350   TPFVLRTNSVSAMHEDDTPELHEVATILKH-LGVSKVPLKVRKLVVKICDVVTRRAARLA  408

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGI GILKK+GRDG+ G      R  S    M+RTVVA+EGGLY++Y  FREY++EA+ 
Sbjct  409   AAGISGILKKLGRDGSVG---EGRRRSSDKQMMRRTVVAVEGGLYSNYRMFREYMDEALR  465

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             +ILGE+V+  V I   EDGS IG
Sbjct  466   DILGEDVARQVVIKAMEDGSSIG  488



>emb|CDY25373.1| BnaA05g19110D [Brassica napus]
Length=505

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/443 (67%), Positives = 357/443 (81%), Gaps = 6/443 (1%)
 Frame = +2

Query  50    TPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRV  229
             TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE GT+YAL LGG+ FR+
Sbjct  50    TPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSYFRI  109

Query  230   LRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ--G  403
             +RV LGGQRS+    D+++  IP  LL  TSE LFDF+ASSL+ FIE++  +S  SQ   
Sbjct  110   IRVHLGGQRSSLEVQDIERHSIPTSLLNSTSEVLFDFLASSLQRFIEKEGHESISSQDVK  169

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A  R+GLDI VAAL+N
Sbjct  170   RELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGAVDRRGLDIHVAALVN  229

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV  L+ GHY+D DT+AAV+FGTG+NACY+ER DAIIKCQ   TTSGSMVVNMEWGNFW
Sbjct  230   DTVGALSYGHYHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFW  289

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMSQE D+FGP+S  L+
Sbjct  290   SSRLPRTSYDIELDAESLNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISPILS  349

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF+LRT  ++AMH+DD+PEL EVA +L   L +P+VPLK+RKLVV++CDVVTRRAARLA
Sbjct  350   TPFVLRTNSVSAMHEDDTPELHEVATILKH-LGVPNVPLKVRKLVVKICDVVTRRAARLA  408

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGI GILKK+GRDG+ G      R  S    M+RTVVA+EGGLY++Y  FREY++EA+ 
Sbjct  409   AAGISGILKKLGRDGSVG---EGRRRSSDKQMMRRTVVAVEGGLYSNYWMFREYMDEALR  465

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             +ILG++V+  V I   EDGS IG
Sbjct  466   DILGDDVARQVVIKAMEDGSSIG  488



>ref|XP_009382578.1| PREDICTED: hexokinase-3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=497

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 368/452 (81%), Gaps = 5/452 (1%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ V+ + EE C TPV +LRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP+G+E
Sbjct  34    WARVVGVVGQFEEDCVTPVWKLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDTLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDL GT  RVL+VQLGG  S  I H V+QQ IP+ L++GTSE+LFDFIA +LK+
Sbjct  94    DGVYYALDLRGTICRVLKVQLGGSGSKIINHKVEQQRIPEELVSGTSEELFDFIALTLKE  153

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIER+ +       + LGFTFSFP++Q SVSSG+LIKWT+GF IED+VG++VS+CL+ A 
Sbjct  154   FIEREENGQVPGSKKELGFTFSFPIRQLSVSSGVLIKWTKGFTIEDVVGKDVSQCLEEAM  213

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
             S+ GL ++VAAL+ND V TLA+GHY+D DTVAAVI G GTNACYVER+DAIIK QGLLT 
Sbjct  214   SKNGLHMQVAALVNDPVGTLAVGHYDDADTVAAVIIGYGTNACYVERSDAIIKYQGLLTD  273

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG M+VNMEWGNFWSSHLPRT YD  LD +SPN NDQG+EKMISGMYLG+IVRRVL R++
Sbjct  274   SGFMIVNMEWGNFWSSHLPRTCYDIALDDESPNRNDQGYEKMISGMYLGEIVRRVLHRIA  333

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             +  D+FG  +  L++PF+LRTPLMAAMH+DDSP+L EV R+L E L+   + LK + +VV
Sbjct  334   EVSDIFGDSAHHLSVPFILRTPLMAAMHEDDSPDLREVGRILEESLQTSGLSLKAKMIVV  393

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
              VCDVVTRRAARLAAAGI+GILKKIGRDG+GG+A     SG +  + +RTVVAIE GLYT
Sbjct  394   RVCDVVTRRAARLAAAGIIGILKKIGRDGSGGVA-----SGRTKGKPRRTVVAIERGLYT  448

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTED  1357
             +Y+ FR Y+NEA+ +ILG+E++ +V + V+ED
Sbjct  449   NYSMFRVYMNEAITDILGQEIAQNVVLRVSED  480



>ref|XP_010508397.1| PREDICTED: hexokinase-4-like [Camelina sativa]
Length=502

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/459 (64%), Positives = 366/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             WRKV+ +L++LEEAC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNG E
Sbjct  34    WRKVVGILKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGCE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              GT+YAL LGG+ FR++RV LGGQRS     D+++  IP  L+  TSE LFDF+ASSL+ 
Sbjct  94    RGTYYALHLGGSYFRIIRVHLGGQRSTLEVQDIERHSIPTTLMNSTSEVLFDFLASSLQM  153

Query  362   FIERDSSDSEHSQ--GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FIE++ +    +Q   R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ 
Sbjct  154   FIEKEGNMFNLAQPVKRELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQG  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A +++GLDIRVAAL+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   
Sbjct  214   ALNKRGLDIRVAALVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPR  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
             TTSGSMVVNMEWGNFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LR
Sbjct  274   TTSGSMVVNMEWGNFWSSRLPRTSYDIELDAESMNSNDMGFEKMIGGMYLGDIVRRVILR  333

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             MSQE D+FGP+SS L+ PF+LRT  ++AMH+DD+PEL EVAR+L + L + +VPLK+RKL
Sbjct  334   MSQESDIFGPISSILSTPFILRTNSVSAMHEDDTPELLEVARILKD-LGVSEVPLKVRKL  392

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CDVVTRRAARLAAAGI GILKK+      G         S    M+RTVVA+EGGL
Sbjct  393   VVKICDVVTRRAARLAAAGIAGILKKV------GRDGSGGGRRSDKQIMRRTVVAVEGGL  446

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             Y +Y  FREY++EA+ ++LGE+V+ HV +   EDGS IG
Sbjct  447   YLNYRMFREYMDEALRDVLGEDVAQHVVVKAMEDGSSIG  485



>ref|XP_004971218.1| PREDICTED: hexokinase-3-like [Setaria italica]
Length=497

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/443 (66%), Positives = 352/443 (79%), Gaps = 10/443 (2%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP G+EEG +YA+DLGGTNF
Sbjct  48    CATPPARLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPTGNEEGIYYAIDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             R LRV++G     T R    + PIP+ L  GT E+LF+F+A +LKDF+ER+    E    
Sbjct  108   RALRVEVGSGSVVTSRK--VELPIPEELTKGTIEELFNFVAIALKDFVEREDGKDEK---  162

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R+LGFTFSFPV+QTSVSSG LI+WT+GF IE+ VG++V++CL  A +  GL++RV AL+N
Sbjct  163   RALGFTFSFPVRQTSVSSGSLIRWTKGFSIENAVGKDVAQCLNEALAMSGLNVRVTALVN  222

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV TLALGHY+DEDTVAAVI G GTNACY+ER DAIIKCQGLLT SG MVVNMEWGNFW
Sbjct  223   DTVGTLALGHYHDEDTVAAVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFW  282

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SSHLPRT YD  LD ++ N NDQGFEKMISG+YLG+I R VL RM+ E DVFG  +  L+
Sbjct  283   SSHLPRTPYDISLDDETQNRNDQGFEKMISGIYLGEIARLVLHRMALESDVFGDAADNLS  342

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF L TPL+AA+ +DDSP+LSEV R+L E L++PD PLK R+LVV+VCD+VTRRAARLA
Sbjct  343   TPFTLSTPLLAAIREDDSPDLSEVRRILQEHLKIPDTPLKTRRLVVKVCDIVTRRAARLA  402

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGIVGILKK+GRDG+G        SG +  + +R+VVAIEGGLY  Y  FREYL+EA+ 
Sbjct  403   AAGIVGILKKLGRDGSG-----VASSGRTRGQPRRSVVAIEGGLYQGYPVFREYLDEALV  457

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             EILGEEV+  V + VTEDGSG+G
Sbjct  458   EILGEEVARTVALRVTEDGSGVG  480



>ref|XP_010045034.1| PREDICTED: hexokinase-4-like [Eucalyptus grandis]
 gb|KCW87185.1| hypothetical protein EUGRSUZ_B037111 [Eucalyptus grandis]
Length=433

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/413 (70%), Positives = 349/413 (85%), Gaps = 6/413 (1%)
 Frame = +2

Query  140   MLLTYVDKLPNGSEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGT  319
             MLLT+VD LPNG E+G +YALDLGGT+FRVL+VQLGG+RS+ + H V+QQ IPQ L+T T
Sbjct  1     MLLTFVDTLPNGDEKGIYYALDLGGTDFRVLQVQLGGRRSSILPHSVEQQSIPQDLMTST  60

Query  320   SEDLFDFIASSLKDFIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEI  493
             SEDLFDFIA+SLK+F+ER  + S +S  + R LGFT SFPVKQTSVSSGIL++WT+GF I
Sbjct  61    SEDLFDFIATSLKEFVERKENSSGYSPEKRRELGFTVSFPVKQTSVSSGILMRWTRGFAI  120

Query  494   EDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACY  673
              D VG++++E LQ A +R GL++RV  L+NDTV TLALGHY+D DTVA+V+ GTGTNACY
Sbjct  121   HDTVGKDIAESLQLALTRNGLNMRVVVLVNDTVGTLALGHYHDPDTVASVVIGTGTNACY  180

Query  674   VERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMIS  853
             VER DAIIKCQGL+TTSG MVVNMEWG+FWSSHLPRTSYD DLDA+SPNPN+QGFEKMIS
Sbjct  181   VERTDAIIKCQGLVTTSGFMVVNMEWGSFWSSHLPRTSYDIDLDAESPNPNEQGFEKMIS  240

Query  854   GMYLGDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGE  1033
             GMYLG+IVRRV+LRMSQE D+F   SSKL++PF+LRTPLMAAMH+D+SP+L EV     +
Sbjct  241   GMYLGEIVRRVILRMSQESDIFSAFSSKLSIPFILRTPLMAAMHEDNSPDLREVDEKWRQ  300

Query  1034  ILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgsss  1213
             +LE+P+VP K+RKL+V+VCD+VTRRAARLAAAGIVGILKK GRDG G I           
Sbjct  301   MLEVPEVPKKVRKLIVKVCDIVTRRAARLAAAGIVGILKKTGRDG-GSIT---GSRSRGD  356

Query  1214  srmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +RM+RTVVAIEG LYTSYT FREYL+EA+ EILGE+++ H+ + VTEDGSG+G
Sbjct  357   ARMRRTVVAIEGSLYTSYTMFREYLHEALREILGEDIAQHLVLEVTEDGSGLG  409



>ref|XP_010466178.1| PREDICTED: hexokinase-4-like [Camelina sativa]
Length=502

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/446 (65%), Positives = 356/446 (80%), Gaps = 9/446 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE GT+YAL LGG+ 
Sbjct  47    ACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSY  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FR++RV LGGQRS     D+++  IP  L+  TSE LFDF+ASSL+ FIE++ +    +Q
Sbjct  107   FRIIRVHLGGQRSTLEVQDIERHSIPTSLMNSTSEVLFDFLASSLQMFIEKEGNMVNLAQ  166

Query  401   --GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
                R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A +++GLDIRVAA
Sbjct  167   PVKRELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGALNKRGLDIRVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV  L+ GH++D DT+AAV+FGTG+NACY+ER DAIIKCQ   TTSGSMVVNMEWG
Sbjct  227   LVNDTVGALSFGHFHDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMSQE D+FGP+SS
Sbjct  287   NFWSSRLPRTSYDIELDAESMNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
              L+ PF+LRT  ++AMH+DD+PEL EVAR+L + L + +VPLK+RKLVV++CDVVTRRAA
Sbjct  347   ILSTPFILRTNSVSAMHEDDTPELLEVARILKD-LGVAEVPLKVRKLVVKICDVVTRRAA  405

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGI GILKK+GR              S    M+RTVVA+EGGLY +Y  FREY++E
Sbjct  406   RLAAAGIAGILKKVGR------DGSGGGRRSDKQIMRRTVVAVEGGLYLNYRMFREYMDE  459

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ +ILGE+V+ HV +   EDGS IG
Sbjct  460   ALRDILGEDVAQHVVVKAMEDGSSIG  485



>dbj|BAD87613.1| putative hexokinase [Oryza sativa Japonica Group]
Length=497

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/445 (67%), Positives = 354/445 (80%), Gaps = 14/445 (3%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP+GSEEG +Y++DLGGTN
Sbjct  47    GCATPPARLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPSGSEEGVYYSIDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIE-RDSSDSEHS  397
             FRVLRVQ+G   S  +   V+QQPIP+ L  GT+E+   F+A +LK+F+E  D  D + +
Sbjct  107   FRVLRVQVGAG-SVIVNQKVEQQPIPEELTKGTTEN---FVALALKNFLEGEDDQDGKMA  162

Query  398   QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
                 LGFTFSFPV+Q SVSSG LI+WT+GF I D VGR+V++CL  A +  GL++RV AL
Sbjct  163   ----LGFTFSFPVRQISVSSGSLIRWTKGFSIRDTVGRDVAQCLNEALANCGLNVRVTAL  218

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +NDTV TLALGHY DEDTVAAVI G+GTNACY+ER DAIIKCQGLLT SG MVVNMEWGN
Sbjct  219   VNDTVGTLALGHYYDEDTVAAVIIGSGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGN  278

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             FWSSHLPRT YD  LD ++ N NDQGFEKMISGMYLG+I R V  RM+QE DVFG  +  
Sbjct  279   FWSSHLPRTPYDILLDDETHNRNDQGFEKMISGMYLGEIARLVFHRMAQESDVFGDAADS  338

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L+ PF+L TP +AA+ +DDSP+LSEV R+L E L++PD PLK R+LVV+VCD+VTRRAAR
Sbjct  339   LSNPFILSTPFLAAIREDDSPDLSEVRRILREHLKIPDAPLKTRRLVVKVCDIVTRRAAR  398

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGIVGILKK+GRDG+G  +     SG    + +RTVVAIEGGLY  Y  FREYL+EA
Sbjct  399   LAAAGIVGILKKLGRDGSGAAS-----SGRGRGQPRRTVVAIEGGLYQGYPVFREYLDEA  453

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + EILGEEV+ +VT+ VTEDGSG+G
Sbjct  454   LVEILGEEVARNVTLRVTEDGSGVG  478



>emb|CAN74594.1| hypothetical protein VITISV_003476 [Vitis vinifera]
Length=483

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/446 (68%), Positives = 350/446 (78%), Gaps = 44/446 (10%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC T VGRLRQVVDAMAVEMHAGLASEGGSKLKMLLT+VDKLPNG               
Sbjct  47    ACETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDKLPNG---------------  91

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHS-  397
             + +L++ +       I   ++Q                         F+ER++ +SE S 
Sbjct  92    YFLLKLLVLLDLFDFIASSLKQ-------------------------FVEREAQNSEFSP  126

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              + R LGFTFSFPVKQTSVSSGILIKWT+ F ++DMVG++VSECLQ A +R GLD+RVA 
Sbjct  127   VKRRELGFTFSFPVKQTSVSSGILIKWTKRFSVKDMVGKDVSECLQHAMTRNGLDMRVAV  186

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLALGHYND DTVAAVI GTGTNACY+ER DAIIKCQGLLTTSG MVVNMEWG
Sbjct  187   LVNDTVGTLALGHYNDPDTVAAVIIGTGTNACYLERTDAIIKCQGLLTTSGGMVVNMEWG  246

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSSHLPRTSYD DLD DSPNPNDQGFEKMISGMYLGDIVRRV+LRMSQE D+FGPVSS
Sbjct  247   NFWSSHLPRTSYDIDLDGDSPNPNDQGFEKMISGMYLGDIVRRVILRMSQESDIFGPVSS  306

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             +L+MPF+L TP MA MH D+SPEL EVAR+L E L++PDVPLK+RKLVV+VCDVVTRRAA
Sbjct  307   RLSMPFILSTPSMADMHADESPELMEVARILKEDLQIPDVPLKVRKLVVKVCDVVTRRAA  366

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRDG+GG+A    RS  S  +M+RTVVA++G LYT YT F+EYL+E
Sbjct  367   RLAAAGIVGILKKIGRDGSGGVA--SGRSRGSDGKMRRTVVAMDGSLYTRYTMFKEYLHE  424

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ EILGEEV+ +V + VTEDGSGIG
Sbjct  425   ALCEILGEEVAQYVILKVTEDGSGIG  450



>ref|XP_008674565.1| PREDICTED: hexokinase-3 [Zea mays]
 tpg|DAA55877.1| TPA: hypothetical protein ZEAMMB73_538347 [Zea mays]
Length=497

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 353/441 (80%), Gaps = 10/441 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP G+EEGT+Y++DLGGTN
Sbjct  47    GCATPPPRLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPAGNEEGTYYSIDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FRVL+V++G     T R    + PIP+ L+ GT E+LF+F+A +LK+F+E +    E   
Sbjct  107   FRVLKVEVGDGSVVTRRK--VELPIPEELIKGTIEELFNFVAVTLKEFVEAEDGKDEQ--  162

Query  401   GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALI  580
              R+LGFTFSFPV+QTSVSSG LI+WT+GF IED+VG++V++CL  A +R GL++RV AL+
Sbjct  163   -RALGFTFSFPVRQTSVSSGSLIRWTKGFLIEDVVGKDVAQCLNEALARSGLNVRVTALV  221

Query  581   NDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNF  760
             NDTV TLALGHY+DEDTVAAVI G GTNACY+ER DAIIKCQGLLT SG MVVNMEWGNF
Sbjct  222   NDTVGTLALGHYHDEDTVAAVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNF  281

Query  761   WSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKL  940
             WSSHLPRT YD  LD ++ N NDQGFEKMISG+YLG+I R VL RM+ E DVFG  +  L
Sbjct  282   WSSHLPRTPYDISLDDETQNRNDQGFEKMISGIYLGEIARLVLHRMALESDVFGDAADNL  341

Query  941   AMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarl  1120
             + PF L TPL+AA+  DDSP+LSEV R+L + L++PD PLK R+LVV+VCD+VTRRAARL
Sbjct  342   STPFTLSTPLLAAIRKDDSPDLSEVRRILQDHLKIPDTPLKTRRLVVKVCDIVTRRAARL  401

Query  1121  aaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAV  1300
             AAAGIVGILKK+GRDG+G        SG +  +++RTVVAIEGGLY  Y  FREYL+EA+
Sbjct  402   AAAGIVGILKKLGRDGSG-----IASSGRTRGQLRRTVVAIEGGLYEGYPEFREYLDEAL  456

Query  1301  AEILGEEVSSHVTITVTEDGS  1363
              EILGEEV+  VT+ VT DGS
Sbjct  457   VEILGEEVARTVTLEVTVDGS  477



>ref|XP_006406425.1| hypothetical protein EUTSA_v10020562mg [Eutrema salsugineum]
 gb|ESQ47878.1| hypothetical protein EUTSA_v10020562mg [Eutrema salsugineum]
Length=503

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/446 (65%), Positives = 357/446 (80%), Gaps = 8/446 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             +C TP+GRLRQ+VDA+AVEM AGL SEGGSKLKMLLT+VD LPNGSE GT+YAL LGG+ 
Sbjct  47    SCETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSY  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FR++RV LGGQRS+    DV++  IP  LL  TSE LFDF+ASSL+ FIE++  +S  S+
Sbjct  107   FRIIRVYLGGQRSSLHVQDVERHCIPASLLNSTSEVLFDFLASSLQRFIEKEGHESISSR  166

Query  401   --GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
                R L FTFSFPVKQTS+SSG+LIKWT+GF I +M G +++ECLQ A +++GL+I VAA
Sbjct  167   DVKRELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGALNKRGLNIHVAA  226

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV  L+ GHY+D DT+AAV+FGTG+NACY+ER +AIIKCQ   TTSGSMVVNMEWG
Sbjct  227   LVNDTVGALSFGHYHDADTIAAVVFGTGSNACYLERTNAIIKCQNPRTTSGSMVVNMEWG  286

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSS  934
             NFWSS LPRTSYD +LDA+S N ND GFEKMI GMYLGDIVRRV+LRMSQE D+FGP+ S
Sbjct  287   NFWSSRLPRTSYDIELDAESLNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPIPS  346

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
              L+ PF+LRT  ++AMH+DD+P+L EVAR+L   L +  VPLK+RKLVV++CDVVTRRAA
Sbjct  347   ILSTPFVLRTNSVSAMHEDDTPDLQEVARILKH-LGVSKVPLKVRKLVVKICDVVTRRAA  405

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGI GILKK+GR       SG  R  S    M+RTVVA+EGGLY++Y  FREY++E
Sbjct  406   RLAAAGIAGILKKVGR-----DGSGGGRRKSDKQTMRRTVVAVEGGLYSNYKMFREYMDE  460

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
             A+ +ILG+ V+ HV +   EDGS IG
Sbjct  461   ALRDILGDNVAQHVVVKAMEDGSSIG  486



>ref|XP_002459072.1| hypothetical protein SORBIDRAFT_03g045420 [Sorghum bicolor]
 gb|EES04192.1| hypothetical protein SORBIDRAFT_03g045420 [Sorghum bicolor]
Length=497

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/440 (66%), Positives = 349/440 (79%), Gaps = 10/440 (2%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP G+E+GT+Y++DLGGTNF
Sbjct  48    CATPTPRLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPAGNEQGTYYSIDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRV++G     T R    + PIP+ L  GT E+LF+F+A +LK+F+E +    E    
Sbjct  108   RVLRVEVGAVSVVTSRE--VKLPIPEELTKGTIEELFNFVAMTLKEFVETEDVKDEQ---  162

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R+LGFTFSFPV+QTSVSSG LI+WT+GF IED VG++V++CL  A +R GL++RV AL+N
Sbjct  163   RALGFTFSFPVRQTSVSSGSLIRWTKGFLIEDAVGKDVAQCLNEALARSGLNVRVTALVN  222

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV TLALGHY DEDTVAAVI G GTNACY+ER DAIIKCQGLLT SG MVVNMEWGNFW
Sbjct  223   DTVGTLALGHYYDEDTVAAVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFW  282

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SSHLPRT YD  LD ++ N NDQGFEKMISG+YLG+I R VL RM+ E DVFG  +  L+
Sbjct  283   SSHLPRTPYDISLDDETQNRNDQGFEKMISGIYLGEIARLVLHRMALESDVFGDAADHLS  342

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF L TPL+AA+  DDSP+LSEV R+L E L++ D PLK R+LVV+VCD+VTRRAARLA
Sbjct  343   TPFTLSTPLLAAIRKDDSPDLSEVRRILQEHLKIMDTPLKTRRLVVKVCDIVTRRAARLA  402

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGIVGILKK+GRDG+G        SG +  +++RTVVAIEGGLY  Y  FREYL+EA+ 
Sbjct  403   AAGIVGILKKLGRDGSG-----VASSGRTRGQLRRTVVAIEGGLYEGYPVFREYLDEALV  457

Query  1304  EILGEEVSSHVTITVTEDGS  1363
             EILGEEV+  V + VTEDGS
Sbjct  458   EILGEEVAQTVALRVTEDGS  477



>ref|XP_003565048.1| PREDICTED: hexokinase-3 [Brachypodium distachyon]
Length=501

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/443 (65%), Positives = 352/443 (79%), Gaps = 9/443 (2%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLTYVD LPNG+EEG +YA+DLGGT+F
Sbjct  48    CATPTARLRQVVDAMVVEMHAGLASDGGSKLKMLLTYVDALPNGNEEGIYYAIDLGGTSF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRV++G    + I   V+   IP+  + G+SEDLF+ +A +LK+ +ER+    E    
Sbjct  108   RVLRVEVG--MGSVISQKVEDHTIPEEFM-GSSEDLFNLVALALKNIVEREDGKDEK---  161

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             R+LGFTFSFPV+Q SVSSG LI+WT+GF + D VG++V++CL  A +  GL++RV AL+N
Sbjct  162   RALGFTFSFPVRQNSVSSGSLIRWTKGFSVGDTVGKDVAQCLNDALAMCGLNVRVTALVN  221

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV TLALGHY DEDTVAAVI G GTNACY+ER DAIIKCQGLLT SG MVVNMEWGNFW
Sbjct  222   DTVGTLALGHYYDEDTVAAVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFW  281

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SSHLPRTSYD  LD ++ N NDQGFEKMISG+YLG+IVR VL R+++E DVFG  +  L+
Sbjct  282   SSHLPRTSYDISLDDETQNRNDQGFEKMISGIYLGEIVRLVLHRIAEESDVFGDAADSLS  341

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF+L TP +AA+ +DDSP+LSEV R+L E L++P  PLK R+LVV++CD+VTRRAARL+
Sbjct  342   TPFILSTPFLAAIREDDSPDLSEVRRILQEHLKIPSAPLKTRRLVVKICDIVTRRAARLS  401

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGIVGILKK+GRDG+   +     SG +  + K+TVVAIEG LY  Y  FREYL+EA+A
Sbjct  402   AAGIVGILKKLGRDGS---SGPASSSGRTRDQPKKTVVAIEGSLYQDYPVFREYLDEALA  458

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             EILGEEV+  VT+ VTEDGSG G
Sbjct  459   EILGEEVAQTVTLRVTEDGSGSG  481



>ref|XP_006645311.1| PREDICTED: hexokinase-3-like [Oryza brachyantha]
Length=439

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/429 (67%), Positives = 349/429 (81%), Gaps = 9/429 (2%)
 Frame = +2

Query  86    MAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRVLRVQLGGQRSAT  265
             M VEMHAGLAS+GGSKLKMLLT+VD LP+G+EEG +Y++DLGGTNFRVLRV++G   S  
Sbjct  1     MVVEMHAGLASDGGSKLKMLLTFVDALPDGNEEGIYYSIDLGGTNFRVLRVEVGAG-SVI  59

Query  266   IRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQGRSLGFTFSFPVKQT  445
             +   V+QQPIP+ L  GT++DLF+F+A +LK+F+E D  D +    R+LGFTFSFPV+Q 
Sbjct  60    VNQKVEQQPIPEELTKGTTKDLFNFVAMALKNFLE-DEDDQDGK--RALGFTFSFPVRQI  116

Query  446   SVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDE  625
             SVSSG LI+WT+GF I D VGR+V++CL  A +  GL++RV AL+NDTV TLALGHY DE
Sbjct  117   SVSSGSLIRWTKGFSIGDTVGRDVAQCLNEALANCGLNVRVTALVNDTVGTLALGHYYDE  176

Query  626   DTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLD  805
             DTVAAVI G+GTNACY+ER DAIIKCQGLLT SG MVVNMEWGNFWSSHLPRT YD  LD
Sbjct  177   DTVAAVIIGSGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFWSSHLPRTPYDILLD  236

Query  806   ADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMH  985
              ++ N NDQGFEKMISGMYLG+I R VL RM+QE DVFG  +  L+ PF+L TP +AA+ 
Sbjct  237   DETHNRNDQGFEKMISGMYLGEIARLVLHRMAQESDVFGDAADSLSSPFILSTPFLAAIR  296

Query  986   DDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRD  1165
             +DDSP+LSEV R+L E L++PD PLK R+LVV+VCD+VTRRAARLAAAGIVGILKK+GRD
Sbjct  297   EDDSPDLSEVTRILQEHLKIPDAPLKTRRLVVKVCDIVTRRAARLAAAGIVGILKKLGRD  356

Query  1166  GTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTIT  1345
             G+G  +     SG +  +++RTVVAIEGGLY  Y  FREYL+EA+ EILGEEV+ +VT+ 
Sbjct  357   GSGAAS-----SGRARGQLRRTVVAIEGGLYQGYPVFREYLDEALVEILGEEVARNVTLR  411

Query  1346  VTEDGSGIG  1372
             VTEDGSG+G
Sbjct  412   VTEDGSGVG  420



>ref|XP_008656880.1| PREDICTED: hexokinase-3-like [Zea mays]
 gb|AFW83995.1| hypothetical protein ZEAMMB73_545591 [Zea mays]
Length=497

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/441 (66%), Positives = 348/441 (79%), Gaps = 10/441 (2%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
              CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP G+EEGT+Y++DLGGTN
Sbjct  47    GCATPPPRLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPAGNEEGTYYSIDLGGTN  106

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQ  400
             FRVLRV++G     T R    + PIP+ L  GT E+LF+F+A +LK+F+E +  + E   
Sbjct  107   FRVLRVEVGAGSVVTRRK--VELPIPEELTKGTIEELFNFVAMTLKEFVETEDGNDEQ--  162

Query  401   GRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALI  580
              R+LGFTFSFPV+QTSVSSG LI+W +GF IED VG++V++CL  A +R GL++RV AL+
Sbjct  163   -RALGFTFSFPVRQTSVSSGSLIRWNKGFLIEDAVGKDVAQCLNEALARNGLNVRVTALV  221

Query  581   NDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNF  760
             NDTV TLALGHY+DEDTVAAVI G GTNACY+ER DAIIKCQGLLT SG MVVNMEWG+F
Sbjct  222   NDTVGTLALGHYHDEDTVAAVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGSF  281

Query  761   WSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKL  940
             WSSHLPRT YD  LD ++ N NDQGFEKM+SG+YLG+I R VL RM+ E D FG  +  L
Sbjct  282   WSSHLPRTPYDISLDDETQNRNDQGFEKMVSGIYLGEIARLVLHRMALESDFFGDAADNL  341

Query  941   AMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarl  1120
               PF L TPL+AA+  DDSP+LSEV ++L E L++PD PLK R+LVV+VCD+VTRRAARL
Sbjct  342   CTPFTLSTPLLAAIRKDDSPDLSEVRKILQEHLKIPDTPLKTRRLVVKVCDIVTRRAARL  401

Query  1121  aaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAV  1300
             AAAGIVGILKK+GRDG+G        SG +  +M+RTVVAIEGGLY  Y  FREYL+EA+
Sbjct  402   AAAGIVGILKKLGRDGSG-----VASSGRTGGQMRRTVVAIEGGLYEGYPVFREYLDEAL  456

Query  1301  AEILGEEVSSHVTITVTEDGS  1363
              EILGEEV+  V + VT DGS
Sbjct  457   VEILGEEVARTVALRVTVDGS  477



>dbj|BAJ85932.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/443 (64%), Positives = 345/443 (78%), Gaps = 7/443 (2%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LPNG EEG  YA+DLGGTNF
Sbjct  48    CATPAARLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPNGDEEGVCYAIDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRV++       +   V+   IP+ L+ GTSEDLF+F+A +L +F+ER+  D + +Q 
Sbjct  108   RVLRVEIAVGSIPAVTQKVETHNIPEELM-GTSEDLFNFVALTLNNFVERE--DGKDTQ-  163

Query  404   RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALIN  583
             + LGFTFSFPV+Q SVSSG LI+WT+GF + D VG++VS+CL  A +R G ++RV AL+N
Sbjct  164   KPLGFTFSFPVRQNSVSSGSLIRWTKGFSVGDTVGKDVSQCLDEALARCGSNMRVTALVN  223

Query  584   DTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFW  763
             DTV TLALGH+  +DTVAAVI GTGTNACY+ER DAIIKCQGLLT SG MVVNMEWGNFW
Sbjct  224   DTVGTLALGHHYYKDTVAAVIIGTGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFW  283

Query  764   SSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLA  943
             SSHLPRT YD  LD ++ N NDQGFEKMISGMYLG+I R VL RM+QE D+FG  +  L+
Sbjct  284   SSHLPRTPYDISLDDETQNRNDQGFEKMISGMYLGEIARLVLQRMAQESDIFGDGAESLS  343

Query  944   MPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarla  1123
              PF+L TP +AA+ +DDS +LSEV R+L E L++P+ PLK R+LVV++CD+VT RAARLA
Sbjct  344   TPFILSTPYLAAIREDDSQDLSEVRRILQEHLKIPNAPLKTRRLVVKICDIVTHRAARLA  403

Query  1124  aaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVA  1303
             AAGIVGILKK+GRDG+   A     SG +  + K+TVVAIEG LY  Y  F+EYL+EA+ 
Sbjct  404   AAGIVGILKKLGRDGS---AGAASSSGRAREQPKKTVVAIEGSLYQEYPVFKEYLDEALV  460

Query  1304  EILGEEVSSHVTITVTEDGSGIG  1372
             EILGEEV+  VT+ V  DG G G
Sbjct  461   EILGEEVARTVTLRVMVDGPGTG  483



>emb|CDY37134.1| BnaC06g03650D [Brassica napus]
Length=424

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/401 (68%), Positives = 329/401 (82%), Gaps = 6/401 (1%)
 Frame = +2

Query  176   SEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSL  355
             +E+GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A SL
Sbjct  19    TEKGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSL  78

Query  356   KDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECL  529
             + FIE++  D   SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVGR+++ECL
Sbjct  79    ERFIEKEG-DGSSSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGRDIAECL  137

Query  530   QAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQG  709
             Q A + +GLD+ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QG
Sbjct  138   QVALNTRGLDMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQG  197

Query  710   LLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVL  889
             LLTTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S N ND GFEKMI+GMYLGDIVRRV+
Sbjct  198   LLTTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNSNDMGFEKMIAGMYLGDIVRRVI  257

Query  890   LRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             LRMSQE D+FGP SS L+ P++LRT L++AMH+DD+PEL EVAR+L + L + +VPLK+R
Sbjct  258   LRMSQESDIFGPSSSLLSEPYVLRTNLVSAMHEDDTPELQEVARILKD-LGVSEVPLKVR  316

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KLVV+VCDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S +   +RTVVA+EG
Sbjct  317   KLVVKVCDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSETQMQRRTVVAVEG  374

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GLY +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  375   GLYMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  415



>ref|XP_010501937.1| PREDICTED: hexokinase-3-like, partial [Camelina sativa]
Length=462

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/400 (68%), Positives = 326/400 (82%), Gaps = 6/400 (2%)
 Frame = +2

Query  179   EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLK  358
             E+GT+YAL LGGT FR+LRV LG QRS     DV++ PIP HL+  TSE LF+F+A SL+
Sbjct  57    EKGTYYALHLGGTYFRILRVHLGAQRSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLE  116

Query  359   DFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              FIE++ + S+ SQG  R L FTFS+P+K TS+SSG+LIKWT+GFEI +MVG+ ++ECLQ
Sbjct  117   RFIEKEENGSD-SQGVKRELAFTFSYPLKHTSISSGVLIKWTKGFEISEMVGKEIAECLQ  175

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R+GL++ VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIKCQGL
Sbjct  176   DALDRRGLNMHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGL  235

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             LTTSGSMVVNMEWGNFWSSHLPRTSYD+DLDA+S N ND GFEKMISGMYLGDIVRRV+L
Sbjct  236   LTTSGSMVVNMEWGNFWSSHLPRTSYDTDLDAESSNSNDMGFEKMISGMYLGDIVRRVIL  295

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             RMSQE DVFGP +S L+ P++L T  ++AMH+DD+PEL EVAR+L + L +PDVPLK+RK
Sbjct  296   RMSQESDVFGPTTSVLSEPYVLSTNSVSAMHEDDTPELLEVARILKD-LGVPDVPLKVRK  354

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS       KRTVVA+EGG
Sbjct  355   LVVKVCDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRGEIQMQKRTVVAVEGG  412

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY +Y  FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  413   LYMNYVMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  452



>ref|XP_009382579.1| PREDICTED: hexokinase-3-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   531 bits (1367),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 281/452 (62%), Positives = 347/452 (77%), Gaps = 30/452 (7%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ V+ + EE C TPV +LRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP+G+E
Sbjct  34    WARVVGVVGQFEEDCVTPVWKLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDTLPDGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDL GT  RVL+VQLGG  S  I H V+QQ IP+ L++GTSE+LFDFIA +LK+
Sbjct  94    DGVYYALDLRGTICRVLKVQLGGSGSKIINHKVEQQRIPEELVSGTSEELFDFIALTLKE  153

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIER+ +       + LGFTFSFP++Q SVSSG+LIKWT+GF IED+V            
Sbjct  154   FIEREENGQVPGSKKELGFTFSFPIRQLSVSSGVLIKWTKGFTIEDVV------------  201

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
                          ND V TLA+GHY+D DTVAAVI G GTNACYVER+DAIIK QGLLT 
Sbjct  202   -------------NDPVGTLAVGHYDDADTVAAVIIGYGTNACYVERSDAIIKYQGLLTD  248

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG M+VNMEWGNFWSSHLPRT YD  LD +SPN NDQG+EKMISGMYLG+IVRRVL R++
Sbjct  249   SGFMIVNMEWGNFWSSHLPRTCYDIALDDESPNRNDQGYEKMISGMYLGEIVRRVLHRIA  308

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             +  D+FG  +  L++PF+LRTPLMAAMH+DDSP+L EV R+L E L+   + LK + +VV
Sbjct  309   EVSDIFGDSAHHLSVPFILRTPLMAAMHEDDSPDLREVGRILEESLQTSGLSLKAKMIVV  368

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
              VCDVVTRRAARLAAAGI+GILKKIGRDG+GG+A     SG +  + +RTVVAIE GLYT
Sbjct  369   RVCDVVTRRAARLAAAGIIGILKKIGRDGSGGVA-----SGRTKGKPRRTVVAIERGLYT  423

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTED  1357
             +Y+ FR Y+NEA+ +ILG+E++ +V + V+ED
Sbjct  424   NYSMFRVYMNEAITDILGQEIAQNVVLRVSED  455



>emb|CDY68234.1| BnaCnng58160D, partial [Brassica napus]
Length=417

 Score =   526 bits (1354),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 268/401 (67%), Positives = 328/401 (82%), Gaps = 6/401 (1%)
 Frame = +2

Query  176   SEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSL  355
             +E+GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A S+
Sbjct  11    TEKGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMDSTSEVLFNFLAFSM  70

Query  356   KDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECL  529
             + FIE++  +S +SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++V+ECL
Sbjct  71    ERFIEKEGKES-NSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDVAECL  129

Query  530   QAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQG  709
             Q A +R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QG
Sbjct  130   QGAMNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQG  189

Query  710   LLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVL  889
             LLTTSGSMVVNMEWGNFWSSHLPRTSYD DLDA+S NPND GFEKMI+G+YLGDIVRRV+
Sbjct  190   LLTTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVI  249

Query  890   LRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
               MSQ  D+FGP SS L+ P++LRT  ++AMH+DD+PEL +VAR+L + L + DVPLK+R
Sbjct  250   RHMSQVSDIFGPTSSMLSEPYVLRTNSVSAMHEDDTPELQQVARILKD-LGVSDVPLKVR  308

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KLVV++CDVVTRRA RLAAAGI GILKK+GRDG+GGI     RS S     KRTVVA+EG
Sbjct  309   KLVVKICDVVTRRAGRLAAAGIAGILKKVGRDGSGGIT--SGRSRSEMRMQKRTVVAVEG  366

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GLY +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  367   GLYMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  407



>emb|CDY29586.1| BnaA05g15840D, partial [Brassica napus]
Length=407

 Score =   523 bits (1346),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 328/401 (82%), Gaps = 6/401 (1%)
 Frame = +2

Query  176   SEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSL  355
             +E+GT+YAL LGGT FR+LRV LGG+RS     DV++ PIP HL+  TSE LF+F+A S+
Sbjct  1     TEKGTYYALHLGGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSM  60

Query  356   KDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECL  529
             + FIE++  +S +SQG  R L FTFSFPVK +S+SSG+LIKWT+GFEI +MVG++V+ECL
Sbjct  61    ERFIEKEGKES-NSQGVKRELAFTFSFPVKHSSISSGVLIKWTKGFEISEMVGKDVAECL  119

Query  530   QAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQG  709
             Q A +R+GLDI VAAL+NDTV  L+LG+Y+D DTV AV+FGTG+NACY+ER DAIIK QG
Sbjct  120   QGALNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKSQG  179

Query  710   LLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVL  889
             LLTTSGS+VVNMEWGNFWSSHLPRTSYD DLDA+S NPND GFEK+I+G+YLGDIVRRV+
Sbjct  180   LLTTSGSVVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEKIIAGLYLGDIVRRVI  239

Query  890   LRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             LRMSQ  D+FGP S  L+  ++LRT  ++AMH+DD+PEL EVAR+L + L + +VPLK+R
Sbjct  240   LRMSQVSDIFGPTSPMLSELYVLRTNSVSAMHEDDTPELQEVARILKD-LGVSEVPLKVR  298

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KLVV++CDVVTRRA RLAAAGI GILKKIGRDG+GGI     RS S     KRTVVA+EG
Sbjct  299   KLVVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGIT--SGRSRSEMRMQKRTVVAVEG  356

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GLY +YT FREY+ EA+ EILGEEVS +V +   EDGS IG
Sbjct  357   GLYMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIG  397



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score =   520 bits (1339),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 271/460 (59%), Positives = 337/460 (73%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + L +L+E EE C TP+ +L+QV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ S  ++ + ++  IP HL+TG+S+ LFD+IAS+L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDALFDYIASALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     S GR   LGFTFSFPV+QTS+SSG LIKWT+GF I+D VG++V   L  
Sbjct  154   FVATESEGLHVSPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIDDTVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G YN+ D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYNNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD +LDADS NP +Q FEKMISGMYLG+IVRRVL +
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQELDADSLNPGEQIFEKMISGMYLGEIVRRVLYK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V  KL +PF+LRTP M+AMH D SP+L  VA  L +ILE+ +  LK+RK
Sbjct  334   MAEEAEFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLKVVATKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CD+V  R ARL+AAGIVGILKK+GRD                    ++VVA++GG
Sbjct  394   VIVELCDIVATRGARLSAAGIVGILKKLGRD------------IVKDGEKLKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EVS ++ I  + DGSGIG
Sbjct  442   LYEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIG  481



>ref|XP_009388038.1| PREDICTED: hexokinase-3-like, partial [Musa acuminata subsp. 
malaccensis]
Length=408

 Score =   516 bits (1329),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 322/400 (81%), Gaps = 7/400 (2%)
 Frame = +2

Query  179   EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLK  358
             E+G +YALDLG T  +VLR+QLGG+ S  I H V+   IPQ L + TSE+LFDFI+ +LK
Sbjct  2     EDGIYYALDLGATTCQVLRIQLGGRGSKIINHKVELHQIPQELASSTSEELFDFISLTLK  61

Query  359   DFIERDSS--DSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             +F+ER+ +  D    + + LGFTFSFP++Q S+SSG+LIKWT+GF IED+VG++VS CL+
Sbjct  62    EFVEREENGIDQAPDERKELGFTFSFPIRQLSISSGVLIKWTKGFAIEDVVGKDVSRCLE  121

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A SR GL++RV AL+NDTV TLALGHY D+DTVAAVI GTGTNACYVER+DA+IK QGL
Sbjct  122   EAMSRNGLNMRVGALVNDTVGTLALGHYYDKDTVAAVIIGTGTNACYVERSDALIKSQGL  181

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             LT SG MVVNMEWGNFWS+HLP+TSYD  LD +SPN N+QGFEKMISGMYLG+IVRRVL 
Sbjct  182   LTNSGGMVVNMEWGNFWSAHLPKTSYDIALDEESPNRNEQGFEKMISGMYLGEIVRRVLH  241

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             R+++E D+FG  +  L++PF+LRTPLMAAMH+DDSP L EV R+L E  ++P + LK R 
Sbjct  242   RIAEESDIFGESAYHLSVPFILRTPLMAAMHEDDSPNLREVGRILEEQFQMPGISLKARM  301

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV VCD+VTRRAARL AAGI+GILKKIGRDG  G+A     SG +  + KR+VVAIE G
Sbjct  302   LVVRVCDIVTRRAARLTAAGIIGILKKIGRDGISGVA-----SGRAKGKPKRSVVAIERG  356

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LYT+Y+ FREY+NEA+ +ILGEE++ +V + V EDGSGIG
Sbjct  357   LYTNYSIFREYMNEAITDILGEEIAQNVVLRVAEDGSGIG  396



>ref|XP_010673709.1| PREDICTED: hexokinase-3-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   514 bits (1323),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 271/358 (76%), Positives = 309/358 (86%), Gaps = 3/358 (1%)
 Frame = +2

Query  308   LTGTSEDLFDFIASSLKDFI--ERD-SSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWT  478
             +T TSEDLFDFIA+SLKDF   E D SSD      R LGFTFSFPVKQ SVSSGIL+KWT
Sbjct  1     MTSTSEDLFDFIATSLKDFYGQENDKSSDLSPVSRRKLGFTFSFPVKQISVSSGILMKWT  60

Query  479   QGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTG  658
             +GF I DMVG +VSECL  A SR+GLD+ +AAL+ND+V TLALGHYNDEDTVAAVI GTG
Sbjct  61    KGFSIRDMVGSDVSECLHQAMSRQGLDMHIAALVNDSVGTLALGHYNDEDTVAAVIIGTG  120

Query  659   TNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGF  838
             TNACY ERADAIIK QGL T+SG MVVNMEWGNFWSSHLPRTSYD +LDA+SPNPNDQGF
Sbjct  121   TNACYFERADAIIKSQGLPTSSGGMVVNMEWGNFWSSHLPRTSYDIELDAESPNPNDQGF  180

Query  839   EKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVA  1018
             EKMISGMYLG+IVRRV+LRMS+E DVFGP+SS L   F+LRTPLM+ MH+DDSP+L EVA
Sbjct  181   EKMISGMYLGEIVRRVILRMSKESDVFGPISSSLCEAFILRTPLMSTMHEDDSPDLEEVA  240

Query  1019  RVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklr  1198
             R+L E+L + DVPLK+RKLVV VCDVVTRRAARLAAAGIVGILKKIGRDG+GG+AS + +
Sbjct  241   RILEEVLGICDVPLKVRKLVVNVCDVVTRRAARLAAAGIVGILKKIGRDGSGGVASSRAK  300

Query  1199  sgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
               SSS+R+KRTVVA+EGGLY++Y  FREYLN+AVAEILGEE++  V + VTEDGSGIG
Sbjct  301   GSSSSNRLKRTVVAVEGGLYSNYRMFREYLNDAVAEILGEEIAPFVILKVTEDGSGIG  358



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 269/461 (58%), Positives = 332/461 (72%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + L +L E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WARALSILTEFEEKCGTPSSKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRV LGG+ S  ++ + ++  IP HL+TG+S++LFD+IAS+L  
Sbjct  94    KGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPPHLMTGSSDELFDYIASALAK  153

Query  362   FIERDSSDSEH---SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             F+  +S DS+H    + R LGFTFSFPV+QTS+SSG LIKWT+GF +ED VG++V   L 
Sbjct  154   FVATES-DSQHVSPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFAVEDTVGQDVVGELT  212

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAAL+NDTV TLA G YN+ D  AAVI GTGTNA YVERA AI K  GL
Sbjct  213   KAIERAGLDMRVAALVNDTVGTLAGGRYNNPDVAAAVILGTGTNAAYVERAHAIPKWHGL  272

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD  LDA S NP +Q FEKMISGMYLG+IVRRVL 
Sbjct  273   LPKSGEMVINMEWGNFRSSHLPLTEYDQALDAGSLNPGEQIFEKMISGMYLGEIVRRVLC  332

Query  893   RMSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             +M++E  +FG  V  KL +PF+LRTP  +AMH D SP+L  VA  L +ILE+ +  LKLR
Sbjct  333   KMAEEAAIFGDAVPPKLKIPFILRTPHTSAMHHDTSPDLKVVATKLKDILEISNTSLKLR  392

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KL+VEVCD+V  R ARL+AAGI GILKK+GRD                   +++ VA++G
Sbjct  393   KLIVEVCDIVATRGARLSAAGIAGILKKLGRD------------TVKVGEKQKSAVALDG  440

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GLY  YT FR  +   + E+LGEE S ++ +  + DGSGIG
Sbjct  441   GLYEHYTKFRTCMENTLWELLGEEASENIAVEHSMDGSGIG  481



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 334/460 (73%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E+EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+TG+S +LFD+IA++L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELFDYIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      S GR   LGFTFSFPV+QTS++SG LIKWT+GF IED VG +V   L  
Sbjct  154   FVATEGEGFHVSPGRQRELGFTFSFPVRQTSIASGDLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERIGLDMRVAALVNDTIGTLAGGRYHNKDAIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+IVRRVL R
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDEALDTESLNPGEQIFEKIISGMYLGEIVRRVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V  KL +PF+LRTP M+AMH D SP+L  V + L +ILE+ +  LK+RK
Sbjct  334   MAEEANFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLRVVGKKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVVE+CD+V  R ARL+AAGIVGILKK+GRD                   +++V+A++GG
Sbjct  394   LVVELCDIVATRGARLSAAGIVGILKKLGRD------------TVRDGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F   +   V E+LGEEVS  V I  + DGSGIG
Sbjct  442   LFEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGIG  481



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   509 bits (1311),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 268/461 (58%), Positives = 339/461 (74%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W KV  +L++ EE CATP+G+L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTS-EDLFDFIASSLK  358
             EG FYALDLGGTNFRV+RVQLGG     ++H+V++  IPQ+++ G+S E LFDFIA++L 
Sbjct  95    EGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVLFDFIATALA  154

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             +F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF IED+VG++V   L 
Sbjct  155   EFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIEDVVGQDVVGELA  214

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAAL+NDTV TLA G YN+ D +AAVI GTGTNA YVERA AI K  GL
Sbjct  215   KAMERAGLDVRVAALVNDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERAHAIPKWHGL  274

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD +LD +S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  275   LPKSGEMVINMEWGNFLSSHLPVTEYDQNLDVESLNPGEQIYEKMISGMYLGEILRRVLC  334

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E  +FG  V SKL +PF+LRTP MAAMH D+S +L  V   L +ILE+P+  LK+R
Sbjct  335   RMAKEASLFGDYVPSKLKIPFILRTPDMAAMHHDESADLKVVGNKLKDILEVPNSTLKMR  394

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K+VVE+CD++T R ARL+AAGIVGILKK+G+D                   +R+V+A++G
Sbjct  395   KIVVELCDIITSRGARLSAAGIVGILKKLGKD------------TLKDGENQRSVIAVDG  442

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  L E + E+LG+   S + I ++ DGSG+G
Sbjct  443   ALFERYTKFRNCLEETMKELLGDTADS-IVIELSNDGSGVG  482



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score =   509 bits (1311),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 268/461 (58%), Positives = 338/461 (73%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W KV  +L++ EE CATP+G+L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTS-EDLFDFIASSLK  358
             EG FYALDLGGTNFRV+RVQLGG     ++H+V++  IPQ+++ G+S E LFDFIA++L 
Sbjct  95    EGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVLFDFIATALA  154

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             +F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF IED+VG++V   L 
Sbjct  155   EFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIEDVVGQDVVGELA  214

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RV AL+NDTV TLA G YND D +AAVI GTGTNA YVERA AI K  GL
Sbjct  215   KAMERAGLDVRVTALVNDTVGTLAGGRYNDPDVIAAVILGTGTNAAYVERAHAIPKWHGL  274

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD +LD +S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  275   LPKSGEMVINMEWGNFLSSHLPVTEYDQNLDVESLNPGEQIYEKMISGMYLGEILRRVLC  334

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E  +FG  V SKL +PF+LRTP MAAMH D+S +L  V   L +ILE+P+  LK+R
Sbjct  335   RMAKEASLFGDYVPSKLKIPFILRTPDMAAMHHDESADLKVVGNKLKDILEVPNSTLKMR  394

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K+VVE+CD++T R ARL+AAGIVGILKK+G+D                   +R+V+A++G
Sbjct  395   KIVVELCDIITSRGARLSAAGIVGILKKLGKD------------TLKDGENQRSVIAVDG  442

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  L E + E+LG+   S + I ++ DGSG+G
Sbjct  443   ALFERYTKFRNCLEETMKELLGDTADS-IVIELSNDGSGVG  482



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score =   506 bits (1304),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 336/460 (73%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K   +++ELEE C TP+G+LRQV DAMAVEMHAGLASEGGSKLKM++++VD LP G E
Sbjct  34    WAKAAAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +   + + ++  IP HL+ GTS+ LFDFIA++LK 
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDNRVAKQEFEEVSIPPHLMVGTSDALFDFIAAALKK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  DS  S GR   LGFTFSFPVKQ+S+++G LIKWT+GF IED VG++V   L  
Sbjct  154   FVDTEGEDSHLSPGRQRELGFTFSFPVKQSSIAAGTLIKWTKGFSIEDAVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYDNPDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  +D +S NP +Q FEK+ISGMYLG+I+RRVL R
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQAMDVESLNPGEQIFEKLISGMYLGEILRRVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  +  KL +PF+LRTP M+AMH D S +L  V   L +ILE+P+  LK RK
Sbjct  334   MAEEADFFGDTIPPKLKIPFILRTPDMSAMHHDTSSDLRVVGSKLKDILEIPNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             L+VE+CD+++ R ARL+AAGI+GILKK+GRD                   +R+V+A++GG
Sbjct  394   LIVELCDIISIRGARLSAAGILGILKKLGRD------------TVREEEKQRSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FRE +   + E+LG E S  + I  + DGSG+G
Sbjct  442   LYEHYTKFREAMESTLKELLG-EASDTIVIEHSNDGSGVG  480



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   506 bits (1304),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 273/463 (59%), Positives = 330/463 (71%), Gaps = 22/463 (5%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W  V  V++ELEE CATPVG+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WAPVSAVVKELEERCATPVGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+     + + ++  IP HL+ G S++LFDFIAS+L  
Sbjct  95    TGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFEEVSIPPHLMVGGSDELFDFIASALAK  154

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPV+Q S++SG LIKWT+GF I+  VG +V   L  
Sbjct  155   FVASEGEDFHLPVGRQRELGFTFSFPVRQISIASGTLIKWTKGFNIDGTVGEDVVAELTR  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDT+ TLA G Y D D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  215   AMERQGLDMRVSALVNDTIGTLAGGRYYDNDVVAAVILGTGTNAAYVERAHAIPKWHGLL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+I+RRVLLR
Sbjct  275   PKSGEMVINMEWGNFRSSHLPTTDYDQALDNESLNPGEQIFEKLISGMYLGEILRRVLLR  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +S+E   FG  V  KL +PF+LRTP+M+AMH D S +L  V + L E+L +PD  LK RK
Sbjct  335   LSKEASFFGDSVPPKLEVPFILRTPVMSAMHHDTSADLKVVGKKLNEVLGIPDTSLKTRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGT---GGIAsgklrsgssssrmkrTVVAI  1243
             +V+++CD++ +R ARLAAAGIVGILKKIGRD     GG                RTV+A+
Sbjct  395   VVIQICDIIAKRGARLAAAGIVGILKKIGRDNAVKDGG----------------RTVIAM  438

Query  1244  EGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +GGLY  YT F E L   + E+LGEE SS V + +  DGSGIG
Sbjct  439   DGGLYEHYTIFSECLQCTLKEMLGEEASSSVVVKLASDGSGIG  481



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score =   506 bits (1303),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+ G+S+ LFD+IA++L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      S GR   LGFTFSFPV+Q+S+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEGLHVSPGRQRELGFTFSFPVRQSSISSGSLIKWTKGFSIEDAVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y D+D VAAVI GTGTNA YVERA +I K  GLL
Sbjct  214   AMERIGLDMRVSALVNDTIGTLAGGRYYDQDVVAAVILGTGTNAAYVERAQSIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLGDIVRRVL R
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQVLDAESLNPGEQIFEKIISGMYLGDIVRRVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D+FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +IL++P+  LK RK
Sbjct  334   MAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILDIPNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+E+CD+V  R ARL+AAGI+GILKK+GRD                   + +V+A++GG
Sbjct  394   VVIELCDIVATRGARLSAAGILGILKKLGRD------------TMKEGDKQNSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LG EVS ++ I  + DGSGIG
Sbjct  442   LYEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIG  481



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  7     WARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  66

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+ G+S+ LFD+IA++L  
Sbjct  67    KGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYIAAALAK  126

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      S GR   LGFTFSFPV+Q+S++SG LIKWT+GF IED VG++V   L  
Sbjct  127   FVATEGEGLHVSPGRQRELGFTFSFPVRQSSIASGSLIKWTKGFSIEDAVGQDVVGELTK  186

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y D+D VAAVI GTGTNA YVERA +I K  GLL
Sbjct  187   AMERIGLDMRVSALVNDTIGTLAGGRYYDQDVVAAVILGTGTNAAYVERAQSIPKWHGLL  246

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLGDIVRRVL R
Sbjct  247   PKSGDMVINMEWGNFRSSHLPLTEYDQVLDAESLNPGEQIFEKIISGMYLGDIVRRVLCR  306

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D+FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +IL++P+  LK RK
Sbjct  307   MAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILDIPNTSLKTRK  366

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+E+CD+V  R ARL+AAGI+GILKK+GRD                   + +V+A++GG
Sbjct  367   VVIELCDIVATRGARLSAAGILGILKKLGRD------------TMKEGDKQNSVIALDGG  414

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LG EVS ++ I  + DGSGIG
Sbjct  415   LYEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIG  454



>ref|XP_002988103.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
 gb|EFJ10895.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
Length=513

 Score =   506 bits (1303),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 264/468 (56%), Positives = 344/468 (74%), Gaps = 17/468 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++   +++E    C+TP+ RLRQ+VD M VEMHAGLA +GGSKLKM+L+YVD LP G+E
Sbjct  36    WKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYVDNLPTGNE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRVQLGG+    +  + ++  IP  ++ G++EDLFDFIA+ L  
Sbjct  96    EGLFYALDLGGTNFRVLRVQLGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFDFIATELAS  155

Query  362   FIERDSSDSE-----HSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSEC  526
             F+   +S+ E       Q R LGFTFSFPVKQTS++SG L+KWT+GF I + VG++V E 
Sbjct  156   FV---ASEGEGFYLLPGQQRELGFTFSFPVKQTSINSGTLMKWTKGFAIAETVGKDVVEE  212

Query  527   LQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQ  706
             LQ A  R  +D+RVAAL+NDTV TLA G Y D+D + AVI GTG+NACYVERADAI K +
Sbjct  213   LQGAMHRSNVDMRVAALVNDTVGTLAGGRYEDDDVMVAVILGTGSNACYVERADAIPKWR  272

Query  707   GLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRV  886
             G L  SGSMV+NMEWG+F S+HLP+T  D  LDADS NP DQ FEKMISGMYLGDIVRRV
Sbjct  273   GPLPASGSMVINMEWGSFTSAHLPKTEVDDALDADSVNPCDQIFEKMISGMYLGDIVRRV  332

Query  887   LLRMSQEFDVF-GPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLK  1063
             L +++ E   F G V S+L +PF+LRTP ++A+H D SP+L EV RVL  +  +    L+
Sbjct  333   LWKLAAEAAFFGGKVPSRLEVPFILRTPDVSAIHADQSPDLKEVIRVLRVVFGIQSSTLQ  392

Query  1064  LRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDG-----TGGIAsgklrsgssssrmkr  1228
             +RK++V+VCD+V  R ARLA AGIVGILKKIGRDG      GG+   +  S +++   K+
Sbjct  393   MRKMIVDVCDIVAERGARLAGAGIVGILKKIGRDGGSLANNGGL---ENHSYAAAEERKK  449

Query  1229  TVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             TVVA++GGLY  Y  FREYL ++V E++G+E + H+ + +++DGSGIG
Sbjct  450   TVVAMDGGLYEHYPKFREYLKQSVVELIGKEAAEHIELRLSKDGSGIG  497



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   506 bits (1303),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 271/483 (56%), Positives = 337/483 (70%), Gaps = 38/483 (8%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG--  175
             W + L +L+E EE C TP+ +L+QV DAM VEMHAGLASEGGSKLKM+++YVD LP G  
Sbjct  34    WARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGWD  93

Query  176   ---------------------SEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQP  292
                                   E+G FYALDLGGTNFRVLRVQLGG+ S  ++ + ++  
Sbjct  94    VSVVEHCHILISELFVLGIKHDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVS  153

Query  293   IPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGIL  466
             IP HL+TG+S+ LFD+IAS+L  F+  +S     S GR   LGFTFSFPV+QTS+SSG L
Sbjct  154   IPPHLMTGSSDALFDYIASALAKFVATESEGLHVSPGRQRELGFTFSFPVRQTSISSGTL  213

Query  467   IKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVI  646
             IKWT+GF I+D VG++V   L  A  R GLD+RVAAL+NDT+ TLA G YN+ D VAAVI
Sbjct  214   IKWTKGFSIDDTVGQDVVGELTKAMERVGLDMRVAALVNDTIGTLAGGRYNNPDVVAAVI  273

Query  647   FGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPN  826
              GTGTNA YVERA AI K  GLL  SG MV+NMEWGNF SSHLP T YD +LDADS NP 
Sbjct  274   LGTGTNAAYVERAHAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEYDQELDADSLNPG  333

Query  827   DQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPE  1003
             +Q FEKMISGMYLG+IVRRVL +M++E + FG  V  KL +PF+LRTP M+AMH D SP+
Sbjct  334   EQIFEKMISGMYLGEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHMSAMHHDTSPD  393

Query  1004  LSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIA  1183
             L  VA  L +ILE+ +  LK+RK++VE+CD+V  R ARL+AAGIVGILKK+GRD      
Sbjct  394   LKVVATKLKDILEISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKKLGRD------  447

Query  1184  sgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGS  1363
                           ++VVA++GGLY  YT FR  +   + E+LG+EVS ++ I  + DGS
Sbjct  448   ------IVKDGEKLKSVVALDGGLYEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGS  501

Query  1364  GIG  1372
             GIG
Sbjct  502   GIG  504



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score =   504 bits (1299),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ + ++  IP HL+ G+SE LFDFIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVAEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  +  LD+RV AL+NDT+ TLA G Y+D D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMEKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHL  T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL++
Sbjct  274   PKSGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF+LRTP M+AMH D SP+L  VA  L ++LE+ +  LK RK
Sbjct  334   MAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CDVV  R ARL+AAGI+GILKK+GRD                   +++VVA++GG
Sbjct  394   IIVELCDVVATRGARLSAAGILGILKKLGRD------------TIRVGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+++V +  + DGSGIG
Sbjct  442   LYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIG  481



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score =   504 bits (1299),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  38    WARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  97

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ + ++  IP HL+ G+SE LFDFIA +L  
Sbjct  98    KGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAK  157

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  158   FVAEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  217

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  +  LD+RV AL+NDT+ TLA G Y+D D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  218   AMEKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLL  277

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHL  T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL++
Sbjct  278   PKSGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVK  337

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF+LRTP M+AMH D SP+L  VA  L ++LE+ +  LK RK
Sbjct  338   MAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLEISNTSLKTRK  397

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CDVV  R ARL+AAGI+GILKK+GRD                   +++VVA++GG
Sbjct  398   IIVELCDVVATRGARLSAAGILGILKKLGRD------------TIRVGEKQKSVVALDGG  445

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+++V +  + DGSGIG
Sbjct  446   LYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIG  485



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score =   504 bits (1298),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 335/460 (73%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E E+ C TPV +LRQV DAM VEMHAGLAS+GGSKLKML++YVD LP G E
Sbjct  34    WAKAMEILKEFEDKCGTPVSKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRV+LGG     ++ + ++  IP +L+ G SEDLFDFIA  L  
Sbjct  94    TGIFYALDLGGTNFRVLRVKLGG--VGNVKKEFKEVSIPPNLMIGKSEDLFDFIAGELAK  151

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D +   G  R LGFTFSFPVKQ+S++ G L++WT+GF IED VG +V E L  
Sbjct  152   FVATEDEDMQIPPGTQRELGFTFSFPVKQSSIAGGTLVRWTKGFNIEDAVGADVVEELTK  211

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDTV TLA G Y + D +AAVI GTGTNA YVERA+AI K QGLL
Sbjct  212   AMERAGLDMRVSALVNDTVGTLAGGRYGNSDVIAAVILGTGTNAAYVERANAIPKWQGLL  271

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q +EK+ISGMYLG++VRRVLL+
Sbjct  272   PKSGEMVINMEWGNFRSSHLPLTEYDEGLDGDSLNPGEQIYEKLISGMYLGEVVRRVLLK  331

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V SKL  PF+LRTP M+AMH D +P+L  VA  L +ILE+ +  LK+RK
Sbjct  332   MAEEAEFFGDIVPSKLQKPFILRTPDMSAMHHDSTPDLKVVATKLKDILEISNTSLKMRK  391

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VEVCD+V  R ARL+AAGI+GILKKIG+D           +       +++V+A++GG
Sbjct  392   VIVEVCDLVATRGARLSAAGILGILKKIGKD-----------TCKEGEENQKSVIAMDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR+ + + + E+LGEE+S ++ + ++ DGSG+G
Sbjct  441   LFEHYTKFRKTMQDTMNELLGEEISKNIIVELSNDGSGLG  480



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score =   504 bits (1298),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 268/461 (58%), Positives = 339/461 (74%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W KV  +L++ EE CATPV +L+QV DAM VEM AGLASEGGSKLKML++YVD LP G E
Sbjct  35    WGKVEALLKDFEEKCATPVEKLKQVADAMTVEMQAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTS-EDLFDFIASSLK  358
             +G FYALDLGGTNFRV+RVQLGG+    ++H+V++  IPQ+++TG+S E LFDFIA++L 
Sbjct  95    KGLFYALDLGGTNFRVMRVQLGGKEKRIVKHEVKEVSIPQNVMTGSSSEVLFDFIATALA  154

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             +F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF IED+VG++V   L 
Sbjct  155   EFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIEDLVGQDVVGELA  214

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAAL+NDTV TLA G YN+ D +AAVI GTGTNA YVERA AI K  GL
Sbjct  215   KAMERAGLDVRVAALVNDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERAHAIPKWHGL  274

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD +LD +S NP +Q +EK+ISGMYLG+I+RRVL 
Sbjct  275   LPKSGEMVINMEWGNFRSSHLPVTEYDQNLDIESLNPGEQIYEKIISGMYLGEILRRVLC  334

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E  +FG  V SKL +PF+LRTP MAAMH D+S +L  V   L +ILE+P+  LK+R
Sbjct  335   RMAEEASLFGDYVPSKLKVPFVLRTPDMAAMHHDESADLKVVGNKLKDILEVPNSTLKMR  394

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K+VVE+CD++T R ARL+AAGIVGILKK+GRD                   +R+V+A++G
Sbjct  395   KIVVELCDIITSRGARLSAAGIVGILKKLGRD------------TFKDGEKQRSVIAVDG  442

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  L E + E+LG+   S V I ++ DGSG+G
Sbjct  443   ALFEHYTKFRNCLKETMKELLGDAADSTV-IELSNDGSGVG  482



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   503 bits (1296),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+TGTSE LFDFIA +   
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDKHVVKQESEEVSIPPHLMTGTSEGLFDFIAETJAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGLHPAPGRQRELGFTFSFPVRQTSIASGTLIKWTKGFSIEDAVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SVEKIGLDLRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLGDIVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFXSSHLPLTEYDQALDXESLNPGEQIFEKIISGMYLGDIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP+M+AMH D SP+L  V   L +ILE+ +  LK+R 
Sbjct  334   MAEEADFFGDVVPPKLKIPFVLRTPVMSAMHHDSSPDLKVVGNKLKDILEISNTSLKMRX  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V  +CD+V  R ARL+AAGI+G+LKK+GRD                   +++VVA++GG
Sbjct  394   VVXALCDIVXTRGARLSAAGILGVLKKLGRD------------TVKBGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+  ++I ++ DGSGIG
Sbjct  442   LYEHYTEFRTSMEXTLKELLGDEVAEXISIELSSDGSGIG  481



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G+E
Sbjct  34    WARAMAILREFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP HL+TG SE+LFD+IA+ L  
Sbjct  94    RGLFYALDLGGTNFRVLRVQLGGKDGRVVNQEFAEVSIPPHLMTGGSEELFDYIAAELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  D   S GR   LGFTFSFPV+Q S++SG LIKWT+GF IED+VG++V   L  
Sbjct  154   FVKTEGEDFHLSPGRQRELGFTFSFPVRQLSITSGTLIKWTKGFSIEDVVGQDVVLELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RVAAL+NDT+ TLA G Y + D +AAVI GTGTNA YVE A+AI K  GLL
Sbjct  214   ALEKQGLDMRVAALVNDTIGTLAGGRYLNNDVIAAVILGTGTNAAYVECANAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLGDIVRRVLL 
Sbjct  274   PKSGEMVINMEWGNFRSSHLPITEYDHALDVESLNPGEQIFEKIISGMYLGDIVRRVLLS  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  +L +PF+LRTP M+AMH D SP+L  V   L +IL +P+  LK RK
Sbjct  334   MAEEAAFFGDTVPPQLKVPFILRTPDMSAMHHDTSPDLKVVGNKLKDILGIPNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              VVE+C++V  R ARL+AAGI+GILKK+GRD                   +RTV+A++GG
Sbjct  394   AVVELCNIVATRGARLSAAGILGILKKLGRD------------VVKEGEKQRTVLAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LGEEVS++V++  + DGSGIG
Sbjct  442   LYEHYTEFRVCLESTLKELLGEEVSANVSVEHSNDGSGIG  481



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ + ++  IP HL+ G+SE LFDFIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVAEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  +  LD+RV AL+NDT+ TLA G Y+D D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMEKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHL  T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL++
Sbjct  274   PKSGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVK  333

Query  896   MSQEFDVFGPVS-SKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  +  KL +PF+LRTP M+AMH D SP+L  VA  L ++LE+ +  LK RK
Sbjct  334   MAEEATIFGETAPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CDVV  R ARL+AAGI+GILKK+GRD                   +++VVA++GG
Sbjct  394   IIVELCDVVATRGARLSAAGILGILKKLGRD------------TIRVGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+++V +  + DGSGIG
Sbjct  442   LYEHYTEFRTTMENTLKELLGDEVAANVFVEHSNDGSGIG  481



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 331/460 (72%), Gaps = 14/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+ G+S+ LFD+IA++L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      S GR   LGFTFSFPV+Q+S+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEGLHVSPGRQRELGFTFSFPVRQSSISSGSLIKWTKGFSIEDAVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V+AL+NDT+ TLA G Y D+D VAAVI GTGTNA YVERA +I K  GLL
Sbjct  214   AMERIGLDMXVSALVNDTIGTLAGGRYYDQDVVAAVILGTGTNAAYVERAQSIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLGDIVRRVL R
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQVLDAESLNPGEQIFEKIISGMYLGDIVRRVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D+FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +IL++P+  LK RK
Sbjct  334   MAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILDIPNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+E+CD+V  R ARL+AAGI+GILKK+GRD           +       + +V+A++GG
Sbjct  394   VVIELCDIVATRGARLSAAGILGILKKLGRD-----------TMKEGGDKQNSVIALDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LG EVS ++ I  + DGSGIG
Sbjct  443   LYEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIG  482



>ref|XP_002972691.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
 gb|EFJ25912.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
Length=513

 Score =   503 bits (1295),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 344/468 (74%), Gaps = 17/468 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W++   +++E    C+TP+ RLRQ+VD M VEMHAGLA +GGSKLKM+L+YVD LP G+E
Sbjct  36    WKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYVDNLPTGNE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRVQ+GG+    +  + ++  IP  ++ G++EDLFDFIA+ L  
Sbjct  96    EGLFYALDLGGTNFRVLRVQMGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFDFIATELAS  155

Query  362   FIERDSSDSE-----HSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSEC  526
             F+   +S+ E       Q R LGFTFSFPVKQTS++SG L+KWT+GF I + VG++V E 
Sbjct  156   FV---ASEGEGFFLLPGQQRELGFTFSFPVKQTSINSGTLMKWTKGFAIAETVGKDVVEE  212

Query  527   LQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQ  706
             LQ A  R  +D+RVAAL+NDTV TLA G Y D+D + AVI GTG+NACYVERADAI K +
Sbjct  213   LQGAMHRSNVDMRVAALVNDTVGTLAGGRYEDDDVMVAVILGTGSNACYVERADAIPKWR  272

Query  707   GLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRV  886
             G L  SGSMV+NMEWG+F S+HLP+T  D  LDADS NP DQ FEKMISGMYLGDIVRRV
Sbjct  273   GPLPASGSMVINMEWGSFTSAHLPKTEVDDALDADSVNPCDQIFEKMISGMYLGDIVRRV  332

Query  887   LLRMSQEFDVF-GPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLK  1063
             L +++ E   F G V S+L +PF+LRTP ++A+H D SP+L EV RVL  +  +    L+
Sbjct  333   LWKLAAEAAFFGGKVPSRLEVPFILRTPDVSAIHADQSPDLKEVIRVLRVVFGIQSSTLQ  392

Query  1064  LRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDG-----TGGIAsgklrsgssssrmkr  1228
             +RK++++VCD+V  R ARLA AGIVGILKKIGRDG      GG+   +  S +++   K+
Sbjct  393   MRKVIMDVCDIVAERGARLAGAGIVGILKKIGRDGGSLANNGGL---ENHSYAATEERKK  449

Query  1229  TVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             TVVA++GGLY  Y  FREYL ++V E++G+E + H+ + +++DGSGIG
Sbjct  450   TVVAMDGGLYEHYPKFREYLKQSVVELIGKEAAEHIELRLSKDGSGIG  497



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score =   505 bits (1301),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  119   WARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  178

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ + ++  IP HL+ G+SE LFDFIA +L  
Sbjct  179   KGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAK  238

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  239   FVAEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  298

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  +  LD+RV AL+NDT+ TLA G Y+D D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  299   AMEKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLL  358

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHL  T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL++
Sbjct  359   PKSGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVK  418

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF+LRTP M+AMH D SP+L  VA  L ++LE+ +  LK RK
Sbjct  419   MAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLEISNTSLKTRK  478

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CDVV  R ARL+AAGI+GILKK+GRD                   +++VVA++GG
Sbjct  479   IIVELCDVVATRGARLSAAGILGILKKLGRD------------TIRVGEKQKSVVALDGG  526

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+++V +  + DGSGIG
Sbjct  527   LYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIG  566



>ref|XP_004141023.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_004157890.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 330/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ + ++  IP HL+ G+SE LFDFIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVAEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  +  LD+RV AL+NDT+ TLA G Y+D D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMEKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHL  T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL++
Sbjct  274   PKSGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF+LRTP  +AMH D SP+L  VA  L ++LE+ +  LK RK
Sbjct  334   MAEEAAIFGDTVPPKLKIPFILRTPHTSAMHHDTSPDLKVVASKLKDVLEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CDVV  R ARL+AAGI+GILKK+GRD                   +++VVA++GG
Sbjct  394   IIVELCDVVATRGARLSAAGILGILKKLGRD------------TVRVGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+++V +  + DGSGIG
Sbjct  442   LYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIG  481



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + L +++E EE C TP+G+LRQ+ DAM VEMHAGLASEGGSKL ML++YVD LP G E
Sbjct  34    WSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRV LGG+    I  +  +  IP HL+TG+SE LFDFIA++L  
Sbjct  94    EGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEGLFDFIAAALAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +        G  R LGFTFSFPVKQTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVESEPEVFHPPSGKLRELGFTFSFPVKQTSISSGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GL++RVAAL+NDT+ TLA G + D+D +AAVI GTGTNA YVERA AI K +GL+
Sbjct  214   SLEKIGLNMRVAALVNDTIGTLAGGRFYDQDVIAAVILGTGTNAAYVERAHAIPKWKGLI  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLDA+S NP +Q FEK++SGMYLG+IVRRVLL+
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTGYDQDLDAESLNPGEQIFEKLLSGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V  KL +PF+LRTP M+++H D SP+L  V   L +ILE+ +  LK RK
Sbjct  334   MAEEAEFFGDTVPPKLKIPFILRTPDMSSIHHDTSPDLKVVGNKLRDILEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARLAAAGI+GILKKIGRD               +   +++V+A++GG
Sbjct  394   IVVELCDIVATRGARLAAAGILGILKKIGRD------------TVKAGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L E + E+LG+E +  V +    DGSGIG
Sbjct  442   LFEHYTKFRVCLEETLKELLGDEAADTVVVKHANDGSGIG  481



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 272/462 (59%), Positives = 336/462 (73%), Gaps = 17/462 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L+ELEE CATPVG+LRQV DAMAVEMHAGLASEGGSKLKML++YV+ LP G E
Sbjct  34    WARVAALLKELEERCATPVGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVNNLPTGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP  L+ G S++LFDFIAS+L  
Sbjct  94    TGLFYALDLGGTNFRVLRVQLGGKERHVLKQEFEEVSIPPLLMVGGSDELFDFIASALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   +GFTFSFPV+QTS++SG LIKWT+GF I++ VG +V   L  
Sbjct  154   FVASEGEDFHLPVGRQREIGFTFSFPVRQTSIASGTLIKWTKGFNIDETVGEDVVAELTR  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+ALINDTV TLA G Y+D D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AIERQGLDMRVSALINDTVGTLAGGRYHDNDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP++Q FEK+ISGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTDYDQALDNESLNPSEQIFEKLISGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL +PF+LRTP+M+AMH D SP+L  V   L ++L +P+  LK RK
Sbjct  334   LAKEASLFGDSVPPKLEIPFMLRTPVMSAMHHDTSPDLKVVGAKLKDLLGIPNTSLKARK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGT--GGIAsgklrsgssssrmkrTVVAIE  1246
             +VV++CD+V RR ARLAAAG+ GILKK+GRD    GG              + RTVVA++
Sbjct  394   VVVQICDIVARRGARLAAAGVAGILKKVGRDTAVKGG------------ESVPRTVVAMD  441

Query  1247  GGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GGLY  YT FRE L     E+LG E ++ V I +  DGSGIG
Sbjct  442   GGLYEHYTIFRECLQATFEEMLGAEAAASVVIKLANDGSGIG  483



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RVQLGG+    ++ +  +  IP +L+TGTSE LFDFIA +L  
Sbjct  94    QGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALFDFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGFHPAPGRQRELGFTFSFPVWQTSIASGTLIKWTKGFNIEDAVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SVEKIGLDMRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP DQ FEK+ISGMYLGDIVRRVL +
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDAESLNPGDQIFEKIISGMYLGDIVRRVLCK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEASFFGDVVPPKLKVPFILRTPDMSAMHHDTSPDLRVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD+V  R ARL+AAGI+G+LKK+GRD                   +++VVA++GG
Sbjct  394   VVVALCDIVATRGARLSAAGIMGVLKKLGRD------------TVKEGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+ H+++  + DGSGIG
Sbjct  442   LYEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGIG  481



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score =   500 bits (1287),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG+S+ LF FIA++L +
Sbjct  94    NGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALFGFIATALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     S GR   LGFTFSFPV+QTS++SG LIKWT+GF I+D+VG +V   L  
Sbjct  154   FVATESEGLHCSPGRQRELGFTFSFPVRQTSIASGNLIKWTKGFSIDDVVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERIGLDMRVSALVNDTIGTLAGGRYHNPDVIAAVILGTGTNAAYVERAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLD +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQDLDVESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D+S +L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDIVPQKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILEIPHTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +VE+CD+V  R ARL+AAGIVGI+KK+GRD                   +++V+A++GG
Sbjct  394   AIVELCDIVATRGARLSAAGIVGIIKKLGRD------------TVKDGEKQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ F   +   + E+LGEEVS ++ +  + DGSGIG
Sbjct  442   LYEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIG  481



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score =   499 bits (1285),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RVQLGG+    ++ +  +  IP +L+TGTSE LFDFIA +L  
Sbjct  94    QGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALFDFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGFHPAPGRQRELGFTFSFPVWQTSIASGTLIKWTKGFNIEDAVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SVEKIGLDMRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP DQ FEK+ISGMYLGDIVRRVL +
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDAESLNPGDQIFEKIISGMYLGDIVRRVLCK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEASFFGDVVPPKLKVPFILRTPDMSAMHHDTSPDLRVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD+V  R ARL+AAGI+G+LKK+GRD                   +++VVA++GG
Sbjct  394   VVVALCDIVATRGARLSAAGIMGVLKKLGRD------------TVKEGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+ H+++  + DGSGIG
Sbjct  442   LYEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGIG  481



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   499 bits (1284),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 333/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG+S+ LF FIA++L +
Sbjct  94    NGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALFGFIATALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     S GR   LGFTFSFPV+QTS++SG LIKWT+GF I+D+VG++V   L  
Sbjct  154   FVATESEGLHPSPGRQRELGFTFSFPVRQTSIASGNLIKWTKGFLIDDVVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERIGLDMRVSALVNDTIGTLAGGRYHNPDVIAAVILGTGTNAAYVERAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLD +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQDLDVESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D+S +L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDIVPPKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILEIPHTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +VE+CD+V  R ARL+AAGIVGI+KK+GRD                   +++V+A++GG
Sbjct  394   AIVELCDIVATRGARLSAAGIVGIIKKLGRD------------TVKDGEKQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ F   +   + E+LGEEVS ++ +  + DGSGIG
Sbjct  442   LYEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIG  481



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score =   499 bits (1284),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +++E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G+E
Sbjct  34    WVKAMEIVKEFEEKCGTPIWKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ S  +    ++  IP  L+TGTS+ LFD+IA  L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKGSGIVNQQFKEVSIPPSLMTGTSDALFDYIAVELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++ +D + + GR   LGFTFSFPV QTS+SSG L++WT+GF I+D VG++V   L  
Sbjct  154   FVAQEGTDFQLTPGRQRELGFTFSFPVMQTSISSGSLLRWTKGFSIDDTVGQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDTV TLA G Y + D  AAVI GTG+NA YVERA AI K  GLL
Sbjct  214   AMERQGLDMRVSALVNDTVGTLAGGRYTNSDVAAAVILGTGSNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               S  MV+NMEWGNF SSHLP T YD  LDA+S NP +Q +EK+ISGMYLG+IVRRVLLR
Sbjct  274   PKSEEMVINMEWGNFRSSHLPLTEYDHALDAESLNPGEQIYEKIISGMYLGEIVRRVLLR  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP+M+AMH D SP+L  VA  L + LE+ +  +K+RK
Sbjct  334   MAEEAAFFGDIVPPKLKVPFVLRTPVMSAMHQDTSPDLKVVANKLKDTLEISNTSVKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C++V  R ARL+AAGI+GILKK GRD                   +RTV+A++GG
Sbjct  394   VIVELCNIVATRGARLSAAGILGILKKTGRD------------TVKVGEKQRTVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y  FR+ L   ++E+LGEEVS  + +  + DGSGIG
Sbjct  442   LYEHYAEFRKCLENTLSELLGEEVSESIVVEHSNDGSGIG  481



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L++LE+ C TP+G+LRQ+ DAM VEMHAGLASEGGSKLKML+++VD LP G E
Sbjct  34    WARAMAILKDLEDKCGTPIGKLRQIADAMTVEMHAGLASEGGSKLKMLISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGG+NFRVLRV LGG+    ++ + ++  IPQHL+ G+S +LF+FIA++L  
Sbjct  94    KGLFYALDLGGSNFRVLRVLLGGKEGHVVKQEFKEVSIPQHLMVGSSHELFNFIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +        GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVATEGEGLHVPPGRQRELGFTFSFPVRQTSISSGNLIKWTKGFSIEDAVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y+++D VAAVI GTGTNA YVERA AI K QGLL
Sbjct  214   AMERIGLDMRVSALVNDTIGTLAGGRYHNQDVVAAVILGTGTNAAYVERAHAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEKMISGMYLG++VRRVL R
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHALDEESKNPEEQIFEKMISGMYLGEVVRRVLYR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +P++LRTP M+AMH D S +L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEASFFGDAVPPKLKIPYILRTPDMSAMHHDMSSDLKVVGNKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CD+V  R ARL+AAGIVGILKK+GRD                   ++TV+A++GG
Sbjct  394   VIVEICDIVATRGARLSAAGIVGILKKLGRD------------TVRDGEKQKTVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  F   +   + E+LGEEV+ ++ I ++ DGSGIG
Sbjct  442   LFEHYKKFSSCMESTLKELLGEEVAENIVIELSNDGSGIG  481



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 334/460 (73%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + ++ +L+E C TP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G+E
Sbjct  34    WVRAMAIVADLDERCGTPLAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    +  +  +  IPQ L+ G+S+ LFD+IA+ L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDGGIVNQEFAEVSIPQDLMVGSSDTLFDYIAAELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D +   GR   LGFTFSFPV QTS+ SG LIKWT+GF IED+VG++V   L  
Sbjct  154   FVAQEGEDFQLPPGRQRELGFTFSFPVMQTSIDSGTLIKWTKGFNIEDVVGQDVVAELTR  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDTV TLA G YN++D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   ALERQGLDMRVSALVNDTVGTLAGGRYNNKDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVR+VL R
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDAESLNPGEQIFEKLISGMYLGEIVRKVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL +PF+LRTP  +AMH D SP+L  VA  L +ILE+ +  LK RK
Sbjct  334   IAEEASLFGDTVPPKLKVPFILRTPHTSAMHHDTSPDLKVVADKLRDILEITNTSLKERK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV++C++V  R ARLAAAGI+GILKK+GR+               +   ++TV+A++GG
Sbjct  394   LVVQLCNIVATRGARLAAAGILGILKKLGRE------------TLKNGEDQKTVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT +R+ L   + E++GE+VS  + I  + DGSGIG
Sbjct  442   LYEHYTEYRKCLESTLTELIGEKVSESIVIEHSNDGSGIG  481



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TPVG+LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WTRAMAILGEFEEKCGTPVGKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRV LGG+    ++ + ++  IP HL+ G+S+ LFDFIA +LK 
Sbjct  94    KGLFYALDLGGTNFRVLRVLLGGKEDRVVKQEFEEVSIPPHLMIGSSDALFDFIADALKK  153

Query  362   FIERDSSDSEH--SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D      Q R LGFTFSFPV+Q S++SG LIKWT+GF IED VG +V   L  
Sbjct  154   FVATEGEDLHPLPGQQRELGFTFSFPVRQASIASGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y+ +D +A VI GTGTNA YVERA AI K  GLL
Sbjct  214   AMDRVGLDMRVAALVNDTIGTLAGGRYHSQDVIAGVILGTGTNAAYVERAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               S  MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSDEMVINMEWGNFRSSHLPLTEYDEALDIESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E ++FG  V  KL +PF+LRTP+M+AMH D S +L  V   L +ILE+P+  LK RK
Sbjct  334   MAEEANLFGDVVPPKLEIPFILRTPVMSAMHQDTSSDLRVVGSKLKDILEIPNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +V++CD+V  R ARL+AAGIVGILKK+GRD                    ++V+A++GG
Sbjct  394   AIVKLCDIVATRGARLSAAGIVGILKKLGRD------------TIKEREKHKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L   + E+LG+EVS ++ +  + DGSGIG
Sbjct  442   LFEHYTKFRVCLESTIEELLGKEVSENIVVEHSNDGSGIG  481



>gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG+S+ LFD+IA +L  
Sbjct  94    KGLFYALDLGGTNFRVIRVLLGGREDRVVKQEFEEVSIPPHLMTGSSDALFDYIAEALAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      S G  R LGFTFSFPV+QTS++SG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEGLHPSPGQQRELGFTFSFPVRQTSIASGTLIKWTKGFSIEDTVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y D+D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYYDQDVIAAVILGTGTNAAYVERAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               +G MV+NMEWGNF SSHLP T YD  LD DS NP +Q FEK ISGMYLG+IVRRVL+ 
Sbjct  274   PKTGEMVINMEWGNFRSSHLPLTKYDQALDDDSLNPGEQIFEKTISGMYLGEIVRRVLVE  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF+LRTP M+AMH D S +L  V   L +ILE+P+  LK+RK
Sbjct  334   MAEEAAFFGDVVPSKLKIPFILRTPDMSAMHHDTSSDLRVVGSKLKDILEIPNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C +V  R ARL+AAGI G+LKK+GRD                   +R+V+A++GG
Sbjct  394   VIVELCGIVASRGARLSAAGIAGVLKKLGRD------------TVKDGEKQRSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  +   + E+LGEEVS  + I  + DGSGIG
Sbjct  442   LFEHYTKFRVCMESTLKELLGEEVSESIVIEHSNDGSGIG  481



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG+S+ LF FIA+ L +
Sbjct  94    NGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALFGFIATVLAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     S GR   LGFTFSFPV+QTS++SG LIKWT+GF I+D+VG++V   L  
Sbjct  154   FVATESEGLHPSPGRQRELGFTFSFPVRQTSIASGNLIKWTKGFLIDDVVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERIGLDMRVSALVNDTIGTLAGGRYHNPDVIAAVILGTGTNAAYVERAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLD +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQDLDVESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D+S +L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDIVPPKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILEIPHTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +VE+CD+V  R ARL+AAGIVGI+KK+GRD                   +++V+A++GG
Sbjct  394   AIVELCDIVATRGARLSAAGIVGIIKKLGRD------------TVKDGEKQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ F   +   + E+LGEEVS ++ +  + DGSGIG
Sbjct  442   LYEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIG  481



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score =   497 bits (1280),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L ELE+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRV+LGG     ++ +  +  IP HL+TGTSE LFDFIA +L  
Sbjct  94    NGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLFDFIAEALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +      S+ R LGFTFSFPV QTS++SG LI+WT+GF IED V ++V   L  
Sbjct  154   FVATEGEGLHPAPSRQRELGFTFSFPVWQTSIASGTLIRWTKGFNIEDAVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SMEKIGLDMRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDAESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP M+A+H D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDVVPPKLKIPFILRTPEMSAIHHDSSPDLKVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             + V VCD+V  RAARL+AAG++G+LKK+GRD                   +++++A++GG
Sbjct  394   VAVAVCDIVATRAARLSAAGMLGVLKKLGRD------------TVKDGEKQKSMIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+ H+++  + DGSGIG
Sbjct  442   LYEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIG  481



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   497 bits (1279),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 330/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L ELE+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRV+LGG     ++ +  +  IP HL+TGTSE LFDFIA +L  
Sbjct  94    NGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLFDFIAEALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +      S+ R LGFTFSFPV QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGLHPAPSRQRELGFTFSFPVWQTSIASGTLIKWTKGFNIEDAVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SMEKIGLDMRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDAESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF LRTP M+A+H D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDVVPPKLKIPFXLRTPEMSAIHHDSSPDLKVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             + V VCD+V  RAARL+AAG++G+LKK+GRD                   +++++A++GG
Sbjct  394   VXVAVCDIVATRAARLSAAGMLGVLKKLGRD------------TVKDGEKQKSMIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+ H+++  + DGSGIG
Sbjct  442   LYEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIG  481



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score =   496 bits (1278),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 265/460 (58%), Positives = 325/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  36    WARAMAILKEFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG     ++ +  +  IP HL+TG S++LFD+IAS L  
Sbjct  96    KGLFYALDLGGTNFRVLRVQLGGNDGQVLKQEFTEVSIPPHLMTGGSDELFDYIASELAK  155

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPV+Q S++SG LIKWT+GF IED VG++V   L  
Sbjct  156   FVASEGEDFHLPPGRQRELGFTFSFPVRQISIASGNLIKWTKGFNIEDTVGQDVVLELTK  215

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+ LD+RVAAL+NDT+ TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  216   AMERQDLDMRVAALVNDTIGTLAGGRYTNNDVVAAVILGTGTNAAYVERAHAIPKWHGLL  275

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q FEK+ISGMYLGDIVRRVLLR
Sbjct  276   PKSGEMVINMEWGNFRSSHLPLTEYDHALDSESLNPGEQIFEKIISGMYLGDIVRRVLLR  335

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D S +L  V   L +IL + +  LK R+
Sbjct  336   MAEEAAFFGDTVPLKLTVPFILRTPDMSAMHHDTSSDLKVVGSKLKDILGISNTSLKTRR  395

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +VE+C++V  R ARL+AAG++GILKK+GRD                   +RTVVA++GG
Sbjct  396   AIVELCNIVATRGARLSAAGMLGILKKMGRD------------IIKEGEKQRTVVAMDGG  443

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LGEE S  V +  + DGSGIG
Sbjct  444   LYEHYTEFRNCLENTLKELLGEEASESVVVEHSNDGSGIG  483



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   496 bits (1278),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 261/446 (59%), Positives = 315/446 (71%), Gaps = 13/446 (3%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVDKLP G E G FYALDLGGTNF
Sbjct  48    CATPLGKLRQVADAMMVEMHAGLASEGGSKLKMLISYVDKLPTGDETGLFYALDLGGTNF  107

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRVQLGG+    ++ + ++  IP HL+ G S++LFDFIAS+L +F+  +  D     G
Sbjct  108   RVLRVQLGGKEQRVVKKEPKEVSIPPHLMVGGSDELFDFIASALAEFVASEGEDFHIPVG  167

Query  404   RS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
             R   LGFTFSFPV+QTS++SG LIKWT+GF IE  VG +V   L  A  R+ LD+RV+AL
Sbjct  168   RQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEGTVGEDVVAELTRAIERQCLDMRVSAL  227

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +NDT+ TLA   Y D D +  VI GTGTNA YVERA AI K  GLL  SG MV+NMEWGN
Sbjct  228   VNDTIGTLAGARYYDNDVIVGVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGN  287

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVSS  934
             F SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+I+R VLLR++ E  +FG  V  
Sbjct  288   FRSSHLPTTDYDQTLDTESLNPGEQIFEKLISGMYLGEILRNVLLRLANEAALFGDSVPP  347

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL  PF+LRTP+M+AMH D+SP+L  V   L E+L +P+  LK RK+VV+ CD++ +R A
Sbjct  348   KLETPFILRTPVMSAMHHDNSPDLKVVGTKLKELLGIPNTSLKTRKVVVQACDIIAKRGA  407

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAGIVGILKKIGRD                    RTVVAI+GGLY  Y  F E L  
Sbjct  408   RLAAAGIVGILKKIGRDSAA----------KDGGDTPRTVVAIDGGLYEHYNIFSECLRS  457

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
              V E+LGEE S+ V I +  DGS IG
Sbjct  458   TVKEMLGEEASASVVIKLANDGSSIG  483



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 265/460 (58%), Positives = 332/460 (72%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   VL  L+E CA P  RLRQV DA+AVEMHAGLASEGGSKL M+++YVD LP+G E
Sbjct  33    WGRADAVLRGLDERCAAPPARLRQVADAVAVEMHAGLASEGGSKLGMIISYVDSLPSGQE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP HL+TGTS++LFDFIA++L  
Sbjct  93    KGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPAHLMTGTSQELFDFIAAALAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQ+S++SG LIKWT+GF I++ VG +V   L +
Sbjct  153   FVSSEGEDFHLLEGRQRELGFTFSFPVKQSSIASGTLIKWTKGFSIDETVGADVVAELSS  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD++V AL+NDT+ TLA G Y+D D VAAVI GTGTNA YVERA+AI K  GLL
Sbjct  213   ALDRQGLDMKVTALVNDTIGTLAGGRYDDSDVVAAVILGTGTNAAYVERANAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LDA+S NP +Q +EK+ISGMYLG+IVRRVLL+
Sbjct  273   PKSGDMVINMEWGNFRSSHLPLTEFDQALDAESLNPGEQIYEKLISGMYLGEIVRRVLLK  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  +  KL +PF+LRTP M+ MH D SP+L  V   L ++L +    LK R+
Sbjct  333   MTEEASLFGDDIPPKLKIPFILRTPHMSMMHHDTSPDLRTVGAKLKDVLGIQGTSLKTRR  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV VCD+V +R ARLAAAGI G+LKK+GRD               SS   RTV+A++GG
Sbjct  393   LVVAVCDIVAKRGARLAAAGIHGVLKKLGRD-------------IPSSDKHRTVIAMDGG  439

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F E L   + E+LGEEVSS V I +  DGSGIG
Sbjct  440   LYEHYTIFSETLESTLREMLGEEVSSSVVIKLANDGSGIG  479



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score =   496 bits (1278),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + +++ IP HL+TG S++LFDFIA  L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELFDFIAEVLAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     G  R LGFTFSFPVKQTS+SSG LI WT+GF IED VG++V   L  
Sbjct  154   FVATEGEDFHLPPGKQRELGFTFSFPVKQTSLSSGTLINWTKGFSIEDTVGQDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGNKLKDILEVPTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD +                 +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAS------------KDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EV+  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSEAMKSSLKELLGDEVAESVEVILSNDGSGVG  481



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   496 bits (1277),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATPV +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + +++ IP HL+TG S++LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELFDFIVEVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+SSG LI WT+GF I+D VG +V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQTSLSSGTLINWTKGFSIDDAVGEDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDSESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD                   +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAA------------KDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LYEHYTQFSEIMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 335/460 (73%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL +L+  EE CATP+ +LRQV DAM VEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IE+ VG++V   L  
Sbjct  154   FVATECEDFHLPEGRQRELGFTFSFPVKQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+R+AAL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   ALERVGLDMRIAALVNDTVGTLAGGRYYNPDVVAAVILGTGTNAAYVERATAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+++   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD T                ++++V+A++GG
Sbjct  394   VVISLCNIIATRGARLSAAGIYGILKKLGRDTT------------KDEEVQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +T + DGSGIG
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGIG  481



>ref|XP_004287480.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILKEFEEKCDTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    I+ +  +  IP HL+TGTSE LFDFIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKEKRVIKQEFDEVSIPPHLMTGTSEGLFDFIAEALAK  153

Query  362   FIERDSSDSEHSQGR--SLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGFHPAPGRLRELGFTFSFPVWQTSIASGTLIKWTKGFSIEDAVEQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y++   +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   SVEKIGLDMRVTALVNDTIGTLAGGRYHNPHVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLGDIVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPHTEYDQALDAESLNPGEQIFEKIISGMYLGDIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEAAFFGDTVPHKLKIPFVLRTPDMSAMHHDSSPDLRVVGSKLKDILEISNTSLKVRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              VV +CD+V  R ARL+AAGI+G+LKK+GRD                    ++VVA++GG
Sbjct  394   AVVALCDIVATRGARLSAAGILGVLKKLGRD------------TVKDGEKHKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  +   + E+LG++V+ H+++  + DGSGIG
Sbjct  442   LFEHYTEFRVCMESTLDELLGDDVAEHISVEHSNDGSGIG  481



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 270/460 (59%), Positives = 333/460 (72%), Gaps = 18/460 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   VL ELEE CATPV +L +V DAM  EMHAGL SE  SKLKM+++YVDKLP G E
Sbjct  34    WARAAAVLRELEEKCATPVEKLWEVADAMTKEMHAGLESEDVSKLKMIISYVDKLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +R + ++  IP  L+ G S++LFDFIAS+L  
Sbjct  94    RGLFYALDLGGTNFRVLRVQLGGREGRVVRQEAKEVSIPHDLMVGRSDELFDFIASALVK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  +     GR   LGFTFSFPVKQTSV+SG LIKWT+GF I+ MVG +V   L  
Sbjct  154   FVDLEGEEFHLHSGRQRELGFTFSFPVKQTSVASGTLIKWTKGFNIDGMVGEDVVSELNK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD++VAAL+NDTV TLA G Y+D D VAAVI GTGTNA YVERADAI K +G L
Sbjct  214   ALQRQGLDMQVAALVNDTVGTLAGGRYDDTDVVAAVILGTGTNAAYVERADAIKKWKGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG +V+NMEWGNF SSHLP T YD+ LD +S NP DQ FEK+ISGMYLG+IVRRVLLR
Sbjct  274   PGSGEIVINMEWGNFSSSHLPMTEYDTALDVESLNPGDQIFEKLISGMYLGEIVRRVLLR  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             ++ +  +FG  V  +L +PF+LRTP+M+AMH D S +L  V   L E L +    LK RK
Sbjct  334   LAVQTALFGDNVPPQLEIPFVLRTPVMSAMHHDTSADLKVVGAKLKEFLGISSTSLKARK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV++CDVV +R ARLAAAGIVGILKK+GRDG+G               M+RTV+A++GG
Sbjct  394   VVVQICDVVAKRGARLAAAGIVGILKKLGRDGSG---------------MRRTVIAMDGG  438

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FRE L+ A+ E+LG+E SS V + +T DGSG+G
Sbjct  439   LYEHYTVFRECLHGALNEMLGDEASSSVVVNLTNDGSGLG  478



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+EL++ C TP+G+LRQV DAM VEMHAGLASEG SKLKML++YVD LP G E
Sbjct  34    WGRVMAILKELDDNCGTPLGKLRQVADAMTVEMHAGLASEGASKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRV+LGG+    +  +  +  IP  L+ GTSE LFD+IA +L  
Sbjct  94    HGLFYALDLGGTNFRVLRVKLGGKEKRVVEQEFDEVSIPPELMVGTSEQLFDYIAEALAK  153

Query  362   FIERDSS--DSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     E ++ R LGFTFSFPVKQTS++SG LI+WT+GF IED VG +V   L  
Sbjct  154   FVATESEGLHPEPNKQRELGFTFSFPVKQTSIASGTLIRWTKGFNIEDTVGEDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV AL+NDTV TLA G Y  ED +AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMLRKGVDMRVTALVNDTVGTLAGGRYYKEDVIAAVILGTGTNAAYVERASAIHKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SS+LP T YD  LD +S NP +Q FEKMISGMYLG+IVRRVL R
Sbjct  274   PKSGEMVINMEWGNFRSSYLPLTEYDIALDEESLNPGEQIFEKMISGMYLGEIVRRVLYR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+ E  +FG  V SKL  PF+LRTP M+AMH D SP+L  VA  L ++L +P+  LK+RK
Sbjct  334   MADEASLFGDTVPSKLKTPFILRTPDMSAMHHDTSPDLKVVASKLKDVLGIPNSSLKVRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++V+VCDV+  R A ++AAGI+GI+KK+GRD                   +++V+A++GG
Sbjct  394   IIVDVCDVIASRGACISAAGILGIIKKLGRD------------TLKQGENQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  FRE + +++ E+LG+EV+  + I  + DGSGIG
Sbjct  442   LFEHYAKFRECMEDSLKELLGDEVAETIVIEHSNDGSGIG  481



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score =   495 bits (1274),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 334/460 (73%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   VL ELEE CA P GRLRQV DAMAVEMHAGLASEGGSKLKM+++YVD LP+G E
Sbjct  31    WGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISYVDALPSGEE  90

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    I+ +  +  IP HL+TG S +LFDFIASSL  
Sbjct  91    KGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELFDFIASSLAK  150

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D   ++GR   LGFTFSFPVKQTS++SG LI WT+GF I++ VG +V   L  
Sbjct  151   FVASEGEDFHLAEGRQRELGFTFSFPVKQTSIASGTLINWTKGFSIDETVGEDVVTELTK  210

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD++V ALINDT+ TLA G Y+D D +AAVI GTGTNA YVERA+AI K   LL
Sbjct  211   ALERQGLDMKVTALINDTIGTLAGGRYDDNDVIAAVILGTGTNAAYVERANAIPKWHDLL  270

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LDA+S NP +Q +EK+ISGMYLG+IVRRVLL+
Sbjct  271   PKSGDMVINMEWGNFRSSHLPLTEFDQALDAESLNPGEQVYEKLISGMYLGEIVRRVLLK  330

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF++RTP M+ MH D SP+L  V   L +IL + +  LK R+
Sbjct  331   MAEEASLFGDEVPPKLKIPFIIRTPYMSMMHCDRSPDLRTVGAKLKDILGVQNTSLKTRR  390

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCD+V +RAA LAAAGI GILKK+GRD               ++  +RTV+A++GG
Sbjct  391   LVVDVCDIVAKRAAHLAAAGIHGILKKLGRD-------------VPNTDKQRTVIAVDGG  437

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F E +   + ++LGE+VSS + I + +DGSGIG
Sbjct  438   LYEHYTIFAECVESTLRDMLGEDVSSTIVIKLAKDGSGIG  477



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score =   494 bits (1273),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+ LEE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML+++VD LP+G E
Sbjct  34    WGRVIEILKVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISFVDNLPSGHE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+TG S++LFDFIA +L  
Sbjct  94    KGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELFDFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FIATEGEDFHLPEGRQRELGFTFSFPVKQTSLSSGTLIKWTKGFSIEDTVGQDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R G+D+ V AL+NDTV TLA G Y++ D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGVDMNVTALVNDTVGTLAGGRYHNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHSLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF++RTP M+AMH D SP+L  V   L +IL++P   LK+RK
Sbjct  334   MAEEADFFGDTVPPKLRIPFIIRTPHMSAMHSDTSPDLKVVGSKLKDILDVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD T                 +++ +A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKLGRDAT------------KEGETQKSAIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  A+ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESALKELLGDEASESVEVIHSNDGSGVG  481



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score =   494 bits (1272),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 331/460 (72%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   VL ELEE CA P  RLRQV DAMAVEMHAGLASEGGSKLKM+++YVD LP+G E
Sbjct  31    WGRADAVLRELEERCAAPPARLRQVADAMAVEMHAGLASEGGSKLKMIISYVDALPSGEE  90

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    I+ +  +  IP HL+TG S +LFDFIASSL  
Sbjct  91    KGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELFDFIASSLAK  150

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D   ++GR   LGFTFSFPVKQTS++SG LI WT+GF I++ VG +V   L  
Sbjct  151   FVASEGEDFHLAEGRQRELGFTFSFPVKQTSIASGTLINWTKGFSIDETVGEDVVTELTK  210

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD++V ALINDT+ TLA G Y+D D +AAVI GTGTNA YVERA+AI K   LL
Sbjct  211   ALERQGLDMKVTALINDTIGTLAGGRYDDNDVIAAVILGTGTNAAYVERANAIPKWHDLL  270

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LDA+S NP +Q +EK+ISGMYLG+IVRRVLL+
Sbjct  271   PKSGDMVINMEWGNFRSSHLPLTEFDQALDAESLNPGEQVYEKLISGMYLGEIVRRVLLK  330

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL +PF++RTP M+ MH D SP+L  V   L +IL +    LK R+
Sbjct  331   MAEEASLFGDEVPPKLKIPFIIRTPYMSMMHCDRSPDLRTVGAKLKDILGVQSTSLKTRR  390

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCD+V +RAA LAAAGI GILKK+GRD               ++  +RTV+A+ GG
Sbjct  391   LVVDVCDIVAKRAACLAAAGIHGILKKLGRD-------------VPNTDKQRTVIAVNGG  437

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F E +   + ++LGEEVSS + I + +DGSGIG
Sbjct  438   LYEHYTIFAECVESTLRDVLGEEVSSTIVIKLAKDGSGIG  477



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score =   494 bits (1272),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 331/460 (72%), Gaps = 17/460 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K   +L ELEE C TP  +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKAEAILRELEEKCGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RVQLGG +   ++ + ++  IP HL+ G+S +LFDFIA++L  
Sbjct  94    KGLFYALDLGGTNFRVMRVQLGG-KDGIMKQEFEEVSIPPHLMVGSSHELFDFIAAALAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  D     GR   LGFTFSFPV+Q S++SG LIKWT+GF IED VG++V   L  
Sbjct  153   FVDTEGEDFHLLPGRQRELGFTFSFPVRQLSLASGTLIKWTKGFLIEDAVGQDVVGELTK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G YN+ D +AAVI GTGTNA YVERA AI K QGLL
Sbjct  213   AMERLGLDMRVAALVNDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERAHAIPKWQGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVL R
Sbjct  273   PKSGEMVINMEWGNFRSSHLPLTEYDQILDAESLNPGEQIFEKIISGMYLGEIVRRVLCR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL +PF+LRTP M+AMH D SP+L  V   L +ILE+P+  LK+RK
Sbjct  333   MAEEASFFGDTIPPKLKIPFILRTPDMSAMHHDTSPDLKVVGSKLKDILEVPNSSLKMRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CD+V  R ARL+AAGI+GILKK+GRD                   +R+V+A++GG
Sbjct  393   IIVEICDIVATRGARLSAAGILGILKKLGRD------------TVKEGEKQRSVIALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR+ +   + E+LG +V+  + +  + DGSGIG
Sbjct  441   LFEHYTKFRKCMESTLKELLG-DVAEDIVVEHSNDGSGIG  479



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   494 bits (1272),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATPV +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + +++ IP HL+TG S++LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELFDFIVEVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+SSG LI WT+GF I+D VG +V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQTSLSSGTLINWTKGFSIDDTVGEDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDSESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD                   +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAA------------KDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSETMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E  E C TP+G+LRQ+ DAM VEMHAGLASEGGSKL ML++YVD LP G E
Sbjct  34    WTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YALDLGGTNFRVLRV LGG+    I  +  +  IP  L+TG+SE LFDFIA++L  
Sbjct  94    EGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLFDFIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +        GR   LGFTFSFPVKQTS++SG LIKWT+GF I+D VG +V   L  
Sbjct  154   FVESEPEGFHPPPGRQRELGFTFSFPVKQTSIASGTLIKWTKGFSIDDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDT+ TLA G + ++D +AAVI GTGTNA YVE A AI K  GL+
Sbjct  214   SLEKIGLDMRVAALVNDTIGTLAGGRFYNQDVIAAVILGTGTNAAYVEHAHAIPKWHGLM  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLDA+S NP +Q FEK++SGMYLG+IVRR LL+
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQDLDAESLNPGEQIFEKLLSGMYLGEIVRRALLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V  KL +PF+LRTP M++MH D +P+L EV   L +ILE+ +  LK+RK
Sbjct  334   MAEEAEFFGDTVPPKLKIPFILRTPDMSSMHHDTTPDLKEVGSKLRDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARLAAAGI+GILKK+GRD   G               +++V+A++GG
Sbjct  394   IVVELCDIVASRGARLAAAGILGILKKLGRDTVKG------------GEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L + + E+LG+E +  V +    DGSGIG
Sbjct  442   LFEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGIG  481



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +L++ EE C TP+ +L+QV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  65    WAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  124

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRV LGG+    ++ + ++  IP HL+TG+S+ LFD+IA +L  
Sbjct  125   KGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFDYIAEALAK  184

Query  362   FIERDSSDSEHS--QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S     S  + R LGFTFSFPV+QTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  185   FVATESEGLHFSPDRQRELGFTFSFPVRQTSISSGTLIKWTKGFLIEDAVGQDVVGELTK  244

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R  LD+RV AL+NDT+ TLA G YN+ D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  245   AMERIFLDMRVTALVNDTIGTLAGGRYNNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  304

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP + YD  LD +S NP +Q FEK+ISGMYLG++VRRVL +
Sbjct  305   PKSGDMVINMEWGNFRSSHLPISEYDQALDTESLNPGEQIFEKLISGMYLGEVVRRVLYK  364

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+ E   FG  +  KL +PF+LRTP M+AMH D +P+L  VA+ L +ILE+ +  LK+RK
Sbjct  365   MADEAAFFGDTIPEKLKIPFILRTPHMSAMHQDTTPDLKIVAKKLKDILEISNTSLKMRK  424

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CD+V  R ARL+AAGI GILKKIGRD                   +++VV+++GG
Sbjct  425   VIVELCDIVATRGARLSAAGIAGILKKIGRD------------TLKDGEKQKSVVSLDGG  472

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LGEEVS ++ I  + DGSGIG
Sbjct  473   LYEHYTKFRTCMENTLTELLGEEVSENIIIEHSNDGSGIG  512



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE C T   +++Q+ +AMAVEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WSKAMGILKEFEEKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+     R +  +  IP H++TGTSE+LF FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHVMTGTSEELFGFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +        GR   LGFTFSFPV+QTS++SG LIKWT+GF IED VG++V   L  
Sbjct  154   FVEEEGDGYHPVSGRQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEDTVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  + GLD+RVAAL+NDT+ TLA G Y++++ +AAVI GTGTNA YVERA AI K QGLL
Sbjct  214   AMEKIGLDMRVAALVNDTIGTLAGGRYHNDNVIAAVILGTGTNAAYVERAHAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q FEKMISGMYLG+IVRRVL R
Sbjct  274   PQSGEMVINMEWGNFRSSHLPFTEYDQALDSESLNPGEQIFEKMISGMYLGEIVRRVLCR  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL  PF+LRTP M+AMH D SP+L  V   L  ILE+ + PL LRK
Sbjct  334   MAEEAALFGDVVPPKLKKPFILRTPDMSAMHHDTSPDLKVVGTKLNNILEVSNSPLPLRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V E+CD+V  R ARL+AAGI GI+KK+GRD                   +++V+A++GG
Sbjct  394   IVFELCDIVATRGARLSAAGIYGIIKKLGRD------------TPKDGDNQKSVIAVDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L  ++ E+LGE+V+ +  I  + DGSGIG
Sbjct  442   LFEHYTKFRNSLESSLKELLGEQVADNFVIEHSNDGSGIG  481



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATPV +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + +++ IP HL+TG S++LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELFDFIVEVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+SSG LI WT+GF I+D VG +V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQTSLSSGTLINWTKGFSIDDTVGEDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDLESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD                   +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAA------------KDGESQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   493 bits (1269),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + +++ IP HL+TG S +LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSHELFDFIVDVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQ S+S+G LI WT+GF I+D V ++V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQISLSAGTLINWTKGFSIDDAVDKDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDLDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D SP+L  V   L +ILE+P+  LK+RK
Sbjct  334   MAEEAAFFGDIVPPKLKIPFILRTPNMSAMHSDTSPDLKVVGSKLKDILEVPNSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD T                 +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAT------------KDGEAQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score =   493 bits (1268),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L  LEE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILRVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+T  S++LF+FIA +L +
Sbjct  94    HGFFYALDLGGTNFRVMRVLLGGKQGRVVKQEAKEVSIPPHLMTSGSDELFNFIAEALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEDFHLPEGRQRELGFTFSFPVKQTSLSSGTLIKWTKGFSIEDTVGQDVVGALVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+ E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MADEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  394   VVVSLCDIIACRGARLSAAGIYGILKKLGRDAP------------KDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASDSVEVIHSNDGSGVG  481



>ref|XP_001754148.1| hexokinase protein HXK7 [Physcomitrella patens]
 gb|EDQ81049.1| hexokinase protein HXK7 [Physcomitrella patens]
Length=521

 Score =   493 bits (1269),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 322/460 (70%), Gaps = 17/460 (4%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC TP+ RLRQVVDAMAVEMHAGL SEGGSKLKML TY+D+LP+G E G +YA+DLGGTN
Sbjct  49    ACYTPLARLRQVVDAMAVEMHAGLVSEGGSKLKMLPTYIDRLPDGHERGLYYAVDLGGTN  108

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSE-HS  397
             FRVLRVQLGG     I+ + ++  IP  L+ GTSE LFDFIA  L  F+ R+  D   H+
Sbjct  109   FRVLRVQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFVAREGQDFRLHA  168

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              Q R +GFTFSFPVKQT+V+SG L++WT+GF++ D VG +V   LQ    R+G  +R+AA
Sbjct  169   GQNREIGFTFSFPVKQTAVNSGTLLQWTKGFKVNDAVGEDVVAALQRGIERRGYKMRIAA  228

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLA G Y + D +  VI GTGTNACYVERA+A+ K  G +  SG MV+NMEWG
Sbjct  229   LVNDTVGTLAGGRYWNNDVMIGVILGTGTNACYVERAEAVSKWAGDIPKSGEMVINMEWG  288

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVS  931
             NFWSSHLPRT  D  LD +S NP + GFEKMISGMYLGD VRRVL+RM+QE  +FG PV 
Sbjct  289   NFWSSHLPRTYVDESLDNESLNPGEYGFEKMISGMYLGDCVRRVLVRMAQEACIFGTPVP  348

Query  932   SKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrra  1111
              KL   F L TP M+ MH DDS +L  VA VL  +  + +  + +RK+VV VCD V +R 
Sbjct  349   HKLLEAFSLMTPDMSKMHHDDSSDLKVVAEVLKRVYGIQNTTVGIRKIVVAVCDTVCQRG  408

Query  1112  arlaaaGIVGILKKIGRDGTGGIAsgklrsgsss-------------srmkrTVVAIEGG  1252
             ARLAAAGIVGILKKIGRDG+      K  +   S             +   RTVVA++GG
Sbjct  409   ARLAAAGIVGILKKIGRDGSAANGVIKRNTFEQSDMNGFHDEVPVHYTSGGRTVVAMDGG  468

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR Y+ EAV E+LGE  S +V I +++DGSGIG
Sbjct  469   LYEHYTKFRNYMQEAVVELLGEG-SKNVVIELSKDGSGIG  507



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score =   492 bits (1266),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 335/460 (73%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL +L+  EE CATP+ +LRQV DAM VEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IE+ VG++V   L  
Sbjct  154   FVATECEDFHLPEGRQRELGFTFSFPVKQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+R+AAL+NDTV TLA G Y ++D VAAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMERVGLDMRIAALVNDTVGTLAGGRYYNQDVVAAVILGTGTNAAYVERATAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PNSGEMVINMEWGNFRSSHLPLTEFDHSLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+++   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD T                M+++V+A++GG
Sbjct  394   VVLSLCNIIATRGARLSAAGIYGILKKLGRDTT------------KDEEMQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F + +  ++ E+LG+E S  + +T + DGSGIG
Sbjct  442   LFEHYTQFSDCMESSLKELLGDEASGSIEVTHSNDGSGIG  481



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/460 (54%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+EL+E C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILKELDEKCETPLGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRV+LGG+    ++ +  +  IP  L+ GTSE+LFD+IA++L  
Sbjct  94    HGLFYALDLGGTNFRVLRVKLGGKEKGVVQQEFDEVSIPPELMVGTSEELFDYIAAALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +    E ++ R LGFTFSFPVKQTS++SG LI+WT+GF IED VG +V   L  
Sbjct  154   FVATEGEGLHPEPNRQRELGFTFSFPVKQTSIASGTLIRWTKGFSIEDTVGEDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV AL+NDTV TLA G Y   + +AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMKRKGVDMRVTALVNDTVGTLAGGRYTKGNVIAAVILGTGTNAAYVERASAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q +EKMISGMYLG+IVRRVL +
Sbjct  274   PRSGEMVINMEWGNFRSSHLPLTEYDIALDEESLNPGEQIYEKMISGMYLGEIVRRVLCK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL  PF+LRTP M+AMH D SP+L  VA  L ++L +P+  LK+RK
Sbjct  334   MAEEASFFGDTVPPKLKTPFILRTPDMSAMHHDTSPDLKVVASKLKDVLGIPNTSLKVRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++V++CD++  R A L+AAGI+GI+KK+G+D                   +++V+A++GG
Sbjct  394   VIVDICDIIASRGACLSAAGILGIIKKLGKDA------------LKQGENQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  FRE + +++ E+LG+E++  + +  + DGSGIG
Sbjct  442   LFEHYAKFRECMEDSLKELLGDEIADTIVVEHSNDGSGIG  481



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 266/463 (57%), Positives = 328/463 (71%), Gaps = 19/463 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+ELEE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAVAILKELEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP +L+ G S +LFDFIA+ L  
Sbjct  94    TGLFYALDLGGTNFRVLRVQLGGKEGHVVKQEFEEVSIPPNLMVGRSSELFDFIAAELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPVKQTS+SSG LIKWT+GF I+  VG +V   L  
Sbjct  154   FVASEGEEFHLPAGRQRELGFTFSFPVKQTSISSGTLIKWTKGFAIDGTVGEDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDT+ TLA G Y D D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERQGLDMRVSALVNDTIGTLAGGRYYDNDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG++VRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDLESLNPGEQIFEKLISGMYLGELVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL + F+LRTP M+AMH D S +L  V   L EIL + +  LK RK
Sbjct  334   MAEEAALFGDSVPPKLEIQFILRTPDMSAMHHDTSSDLRVVGTKLKEILGISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGT---GGIAsgklrsgssssrmkrTVVAI  1243
             LVVEVCD++ +R ARLAAAGI+G+LKK GRD     GG              M+RTV+A+
Sbjct  394   LVVEVCDIIAKRGARLAAAGILGVLKKQGRDSAARDGG-------------EMQRTVIAM  440

Query  1244  EGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +GGLY  YT F   L   + E++GEE ++ + I +  DGSGIG
Sbjct  441   DGGLYEHYTIFSNCLETTLKEMIGEEAAASIVIKLATDGSGIG  483



>ref|XP_004962258.1| PREDICTED: hexokinase-10-like [Setaria italica]
Length=502

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 264/458 (58%), Positives = 336/458 (73%), Gaps = 8/458 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + V+   EE CATP  RL++VV++++VEM AGLASEG SK++MLLT VD+LP+GSE
Sbjct  36    WNRAVEVVRGFEEGCATPTERLQRVVNSLSVEMFAGLASEGASKVRMLLTCVDELPDGSE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YA+DLGGT+FRV++++LG   S  I   V+ QPIP+ L  G SEDLF+ IAS+LK+
Sbjct  96    EGIYYAIDLGGTSFRVMKLELG-PGSMVINKKVEHQPIPEELTKGASEDLFNLIASALKN  154

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIER+    E   GR+LGFTFSFPV+Q S+SSG LI+WT+ F IE+ VG +V++CL  A 
Sbjct  155   FIEREGGKDE---GRALGFTFSFPVRQISISSGSLIRWTKEFSIEEAVGMDVAQCLNEAL  211

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
              R GL+++V AL+N+ V TLA+GHY DEDTVAAVI G GTNA Y+ER   I KCQGLLT 
Sbjct  212   VRNGLNLQVTALVNNAVGTLAMGHYYDEDTVAAVIIGAGTNASYIERTATITKCQGLLTN  271

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSP-NPNDQGFEKMISGMYLGDIVRRVLLRM  898
             S   VVN+EWG+F    +P T YD   + +   N  DQ FEKMISG+YLG+I R VL  M
Sbjct  272   SDITVVNVEWGSFRPPQIPLTPYDICFNVEKDRNHYDQAFEKMISGVYLGEIARLVLQGM  331

Query  899   SQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             +QE DVFG     L+ PF+  TP +AA+ +DDSP+L  V RVL E L++ DVPLK R+LV
Sbjct  332   AQESDVFGSSVDFLSTPFIFSTPCLAAIREDDSPDLRVVGRVLEEQLKIQDVPLKTRRLV  391

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             V +CD+VTRRAARLAAAGIV +L+KIGRDGT     G         + KR+VVAIEGGLY
Sbjct  392   VRICDIVTRRAARLAAAGIVAVLQKIGRDGT---LCGTSMVRKIRGKPKRSVVAIEGGLY  448

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
               Y+ FREYLNEAV EILG+E++S V++ V E+GSGIG
Sbjct  449   QGYSVFREYLNEAVDEILGDEIASTVSLRVMEEGSGIG  486



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 330/460 (72%), Gaps = 14/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K   +++ELEE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G+E
Sbjct  33    WSKATAIVKELEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGNE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP+ L+ GT+E LFDFIA+ L  
Sbjct  93    KGLFYALDLGGTNFRVLRVQLGGKGRGLVNQEFTEVSIPEGLMVGTTETLFDFIATELAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  + +   GR   LGFTFSFPV+QTS++SG LIKWT+GF I+D VGR+V   L  
Sbjct  153   FVGKEGPEYQLPPGRQRELGFTFSFPVQQTSINSGTLIKWTKGFSIDDTVGRDVVAELSK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RV+AL+NDTV TLA G YN+ D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AIEKQGLDMRVSALVNDTVGTLAGGIYNNNDVVAAVILGTGTNAAYVERAQAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF S+HLP T YD  LD +S NP DQ FEK+ISGMYLG+IVRR L R
Sbjct  273   PKSGDMVINMEWGNFRSAHLPLTDYDHSLDTESLNPGDQIFEKIISGMYLGEIVRRALYR  332

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL +PF+LRTP M+AMH D S +L  V  +L  +LE+ +  LK+RK
Sbjct  333   IAEEASIFGDIVPPKLKVPFILRTPDMSAMHHDTSYDLKVVRDILKNVLEISNTSLKVRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             L+VE+C+ V  R ARLAAAGI+G+LKK+GRD                 + K+TV+A++GG
Sbjct  393   LIVELCNTVATRGARLAAAGILGVLKKLGRD-----------VFRDGEKQKKTVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT + + +   + E+LGEEV + + I  + DGSGIG
Sbjct  442   LFEHYTEYSKCMENTLRELLGEEVGASIVIEHSNDGSGIG  481



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 328/460 (71%), Gaps = 13/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + ++ E E+ C TP+ +LR V DA+ VEMHAGLASEGGSKLKML+T+VD LP+G E
Sbjct  34    WGRAVAIVREFEKQCGTPIAKLRLVADAIDVEMHAGLASEGGSKLKMLITFVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFR LRVQLGG+    +  + ++  IP HL+TG S +LFDFIA+ L  
Sbjct  94    KGLFYALDLGGTNFRTLRVQLGGKEKGVVNLESEEVSIPPHLMTGCSHELFDFIAAKLAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +   + G  R LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVSSEPEEFHPAPGKQRELGFTFSFPVRQTSISSGTLIKWTKGFNIEDAVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDTV T+A   ++++D +A VI GTGTNA YVE A AI K QGLL
Sbjct  214   SLEKIGLDMRVAALVNDTVGTVARARFSNQDVIAGVILGTGTNAAYVESAHAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLD++S NP +Q FEK+ISGMYLGDIVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFHSSHLPLTQYDKDLDSESLNPGEQIFEKIISGMYLGDIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +P +LRTP M+A+H D S +L+ V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDTVPPKLKIPLILRTPDMSAIHHDASSDLNVVGTKLKDILEINNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVVE+CD+V  R ARL+AAGI GILKKIGRD             +   + +++V+A++GG
Sbjct  394   LVVELCDIVATRGARLSAAGIFGILKKIGRD----------TVKAEEKQKQKSVIALDGG  443

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L   + E+LG+E S  V I  + DGSGIG
Sbjct  444   LFEHYTEFRSSLESTLKELLGDEASDSVGIEHSNDGSGIG  483



>ref|XP_006853711.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 332/460 (72%), Gaps = 14/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L+E E+ CATP+ +LRQV DAM VEMHAGLASEGGSKLKM+L+YVD LP G+E
Sbjct  34    WGRVSAILKETEDQCATPIQKLRQVADAMHVEMHAGLASEGGSKLKMILSYVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+     + +  +  IP +L+ GTS +LFD+IA+ L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFTEVSIPPNLMVGTSYELFDYIAAELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  + +   GR   LGFTFSFPVKQTS+SSG LIKWT+GF IED VGR+V   L  
Sbjct  154   FVATEGDEFQLPVGRQRELGFTFSFPVKQTSISSGSLIKWTKGFNIEDAVGRDVVAELTE  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+ LD+RV AL+NDT+ TLA G Y D D   AVI GTGTNA YVERA+AI K  GLL
Sbjct  214   AMERQNLDMRVVALVNDTIGTLAGGRYYDPDVAVAVILGTGTNAAYVERANAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q FEK+ISGMYLGDI+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPVTEYDHALDSESLNPGEQIFEKIISGMYLGDILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V + L++PF+LRTP M+A+H D S +L  V   L +IL +    LK RK
Sbjct  334   MAEEAALFGDTVPANLSIPFVLRTPDMSAIHHDTSSDLRIVGSKLKDILGVTTTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R ARL+AAGI+GILKK+GRD           + SSS   +RTV+A++GG
Sbjct  394   VVVELCEIVASRGARLSAAGILGILKKLGRD-----------TISSSGTKERTVIAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F + L + + E+LGEEV+ HV I    DGSGIG
Sbjct  443   LFEHYTKFSDCLEKTLKELLGEEVAEHVVIVHANDGSGIG  482



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score =   490 bits (1261),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 330/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKM+++YVD LP G+E
Sbjct  33    WARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISYVDNLPTGNE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    I  +  +  IP++L+ GTS+ LFD+IA+ L  
Sbjct  93    KGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFIEVSIPENLMVGTSDALFDYIAAELAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D +   GR   LGFTFSFPV Q+S++SG LIKWT+GF I+D VG++V   L  
Sbjct  153   FVAKEGQDHQLPPGRQRELGFTFSFPVLQSSINSGTLIKWTKGFSIDDAVGQDVVSELSK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDTV TLA G Y ++D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AIERTGLDMRVSALVNDTVGTLAGGRYVNQDVVAAVILGTGTNAAYVERAHAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MVVNMEWGNF S+HLP T YD  LD +S NP DQ FEK+ISGMYLG+IVRRVL R
Sbjct  273   PKSGEMVVNMEWGNFKSAHLPLTEYDHSLDTESLNPGDQIFEKIISGMYLGEIVRRVLCR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL +PF+LRTP M+AMH D S +L  V   L  +LE+ +  LK+RK
Sbjct  333   IAEEASLFGDTVPPKLNVPFILRTPDMSAMHHDASSDLRVVREKLKNVLEISNTSLKVRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C++V  R ARLAAAG++G+LKK+GRD                   ++TVVA++GG
Sbjct  393   VIVELCNIVATRGARLAAAGVLGVLKKLGRDAV------------KDGENQKTVVALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT + + +   + E+LGEEV+  + I  + DGSGIG
Sbjct  441   LYEHYTEYSKCMENTLRELLGEEVAETIIIEHSNDGSGIG  480



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 325/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L  LEE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+T  S++LF+FIA +L +
Sbjct  94    HGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELFNFIAEALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEDFHLPEGRQRELGFTFSFPVKQTSLSSGTLIKWTKGFSIEDTVGQDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+ E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MADEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  394   VVVSLCDIIASRGARLSAAGIYGILKKLGRDAP------------KDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVG  481



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score =   493 bits (1270),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E  E C TP+G+LRQ+ DAM VEMHAGLASEGGSKL ML++YVD LP G E
Sbjct  34    WTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YALDLGGTNFRVLRV LGG+    I  +  +  IP  L+TG+SE LFDFIA++L  
Sbjct  94    EGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLFDFIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +        GR   LGFTFSFPVKQTS++SG LIKWT+GF I+D VG +V   L  
Sbjct  154   FVESEPEGFHPPPGRQRELGFTFSFPVKQTSIASGTLIKWTKGFSIDDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDT+ TLA G + ++D +AAVI GTGTNA YVE A AI K  GL+
Sbjct  214   SLEKIGLDMRVAALVNDTIGTLAGGRFYNQDVIAAVILGTGTNAAYVEHAHAIPKWHGLM  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD DLDA+S NP +Q FEK++SGMYLG+IVRR LL+
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDQDLDAESLNPGEQIFEKLLSGMYLGEIVRRALLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E + FG  V  KL +PF+LRTP M++MH D +P+L EV   L +ILE+ +  LK+RK
Sbjct  334   MAEEAEFFGDTVPPKLKIPFILRTPDMSSMHHDTTPDLKEVGSKLRDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARLAAAGI+GILKK+GRD   G               +++V+A++GG
Sbjct  394   IVVELCDIVASRGARLAAAGILGILKKLGRDTVKG------------GEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L + + E+LG+E +  V +    DGSGIG
Sbjct  442   LFEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGIG  481



>ref|XP_004135675.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 ref|XP_004157285.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score =   489 bits (1259),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E E+ C T   +++Q+ +AMAVEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WSKAMGILKEFEDKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+     R +  +  IP HL+TG+SEDLF FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHLMTGSSEDLFGFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +        GR   LGFTFSFPV+QTS++SG LIKWT+GF IED VG++V   L  
Sbjct  154   FVEEEGDGYHPVSGRQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEDTVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  + GLD+RVAAL+NDT+ TLA G Y++++ +AAVI GTGTNA YVERA AI K QGLL
Sbjct  214   AMEKIGLDMRVAALVNDTIGTLAGGRYHNDNVIAAVILGTGTNAAYVERAHAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEKMISGMYLG+IVRRVL R
Sbjct  274   PQSGEMVINMEWGNFRSSHLPFTEYDQALDLESLNPGEQIFEKMISGMYLGEIVRRVLCR  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL  PF+LRTP M+AMH D SP+L  V   L  ILE+ + PL LRK
Sbjct  334   MAEEAALFGDVVPPKLKKPFILRTPDMSAMHHDTSPDLKVVGSKLNNILEVSNSPLPLRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V  +CD+V  R ARL+AAGI GI+KK+GRD                   +++V+A++GG
Sbjct  394   IVFMLCDIVATRGARLSAAGIYGIIKKLGRD------------TPKDGDNQKSVIAVDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L  ++ E+LG++V+ +  I  + DGSGIG
Sbjct  442   LFEHYTKFRNSLESSLKELLGDQVADNFVIEHSNDGSGIG  481



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 325/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L  LEE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+T  S++LF+FIA +L +
Sbjct  94    HGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELFNFIAEALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEDFHLPEGRQRELGFTFSFPVKQTSLSSGTLIKWTKGFSIEDTVGQDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+ E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MADEAAFFGDSVPPKLRIPFIIRTPDMSAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  394   VVVSLCDIIASRGARLSAAGIYGILKKLGRD------------TPKDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVG  481



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 332/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L ELE+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    ++H+  +  IP HL+TGTSE LFDFIA +L  
Sbjct  94    NGLFYALDLGGTNFRVLRVQLGGKEKHVVKHEFDEVSIPPHLMTGTSEGLFDFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +      + GR   LGFTFSFPV QTS++SG LIKWT+GF IED V ++V   L  
Sbjct  154   FVATEGEGLHPAPGRQRELGFTFSFPVWQTSITSGTLIKWTKGFNIEDTVEQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RV AL+NDT+ TLA G Y+++D +AAVI GTGTNA YVE+A AI K  GLL
Sbjct  214   SMEKIGLDMRVTALVNDTIGTLAGGRYHNQDVIAAVILGTGTNAAYVEKAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA++ NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQALDAETLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+QE D FG  V  KL +PF+LRTP M+A+H D SP+L  V   L +ILE+ +  LK+RK
Sbjct  334   MAQEADFFGDVVPPKLKIPFVLRTPDMSAIHHDSSPDLKVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV VCDVV  R ARL+AAGI+G+LKK+GRD                   +++VVA++GG
Sbjct  394   VVVAVCDVVATRGARLSAAGILGVLKKLGRD------------TVKDGEKQKSVVAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG+EV+ H+++  + DGSGIG
Sbjct  442   LYEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIG  481



>ref|XP_002441001.1| hypothetical protein SORBIDRAFT_09g018720 [Sorghum bicolor]
 gb|EES19431.1| hypothetical protein SORBIDRAFT_09g018720 [Sorghum bicolor]
Length=501

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 264/457 (58%), Positives = 335/457 (73%), Gaps = 7/457 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + V+   EE CATP  RL+++V++++VEM AGLASEG SK++MLLT VD LP+GSE
Sbjct  36    WSRAVAVVRGFEEDCATPTERLQRIVNSLSVEMFAGLASEGASKVRMLLTCVDALPDGSE  95

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +Y++DLGGT+FRV++++LG   S  I   V+ QPIP+ L  GTSEDLF+ IA +LK+
Sbjct  96    EGIYYSVDLGGTSFRVMKLELGSG-SMVINKKVEHQPIPEDLTKGTSEDLFNLIALALKN  154

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIER+    E   GR+LGFTFSFPV+Q S+SSG LI+WT+ F IE+ VGR+V++CL  A 
Sbjct  155   FIEREGGGDE---GRALGFTFSFPVRQVSISSGSLIRWTKEFSIEEAVGRDVAQCLNEAL  211

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
              R GL+++V AL+N+ V TLA+GHY DEDTVAAVI G GTNA Y+ER  AI K QGLLT 
Sbjct  212   VRNGLNLQVTALVNNAVGTLAMGHYYDEDTVAAVIIGAGTNASYIERNAAIPKSQGLLTN  271

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             S   VVN+EWG+F S  +P T YD        N  DQ FEKMISG+YLG+I R V  RM+
Sbjct  272   SDITVVNVEWGSFRSPQIPLTPYDICSSEAERNHYDQAFEKMISGVYLGEIARLVFQRMA  331

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             QE D+FG   + L+ PF+L TP +AA+ +DDSP+L  V +VL E L++ DVPLK R+LVV
Sbjct  332   QESDLFGSFVNCLSTPFILSTPSLAAIREDDSPDLRVVGKVLEEHLKIQDVPLKTRRLVV  391

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
              +CD+VTRRAARLAAAGIV IL+KIGRDGT     G           KR+VVAIEGGLY 
Sbjct  392   RICDIVTRRAARLAAAGIVAILQKIGRDGT---LCGTTFVRKIRGEAKRSVVAIEGGLYQ  448

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              Y+ FREYLNEAV EILGEE++  V++ V E+GSGIG
Sbjct  449   GYSVFREYLNEAVDEILGEELAPTVSLRVMEEGSGIG  485



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score =   488 bits (1256),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 325/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L   EE CATP+ +LRQV DA+ VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG S++LFDFIA +L  
Sbjct  95    KGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELFDFIADALAK  154

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+E +  D   + GR   LGFTFSFPV+QTS+ SG LI WT+GF IED VG++V   L  
Sbjct  155   FVETEGEDFHPAPGRQRELGFTFSFPVRQTSLVSGTLINWTKGFSIEDTVGQDVVGELNK  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G Y   D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  215   AIERVGLDMRVAALVNDTVGTLAGGRYYKPDVMAAVILGTGTNAAYVERAHAIPKWHGLL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q FEK+ISGMYLG+I+RRVLL+
Sbjct  275   PKSGEMVINMEWGNFRSSHLPLTEFDHSLDFESLNPGEQIFEKIISGMYLGEILRRVLLK  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  335   MAEEAAFFGDTVPPKLRIPFIIRTPHMSAMHSDASPDLKVVGSKLKDILEIPTTSLKMRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++VVA++GG
Sbjct  395   VVISLCNIIASRGARLSAAGIYGILKKLGRD------------VPKEGEQQKSVVAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y+ F   +   + E+LG+EVS ++ I  + DGSGIG
Sbjct  443   LFEHYSHFSASMESTLKELLGDEVSDNIEIIHSNDGSGIG  482



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score =   488 bits (1256),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 327/461 (71%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSED-LFDFIASSLK  358
              G FYALDLGGTNFRV+RVQLGG+    ++ +V++  IP++++ G+S D LFDFIA++L 
Sbjct  94    TGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDALFDFIATALV  153

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF I+D VG++V   L 
Sbjct  154   KFVATEDDDFRLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIDDTVGQDVVRELT  213

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAAL+NDTV TLA G YN+ D +AAVI GTGTNA YVERA+ I K  GL
Sbjct  214   KAMERVGLDVRVAALVNDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERANTIPKWHGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  274   LPKSGDMVINMEWGNFRSSHLPVTEYDQSLDTESLNPGEQIYEKMISGMYLGEILRRVLC  333

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E   F   V  KL  PF+LRTP M+AMH D S +L  V   L +ILE+P+   K+R
Sbjct  334   RMAEEASFFDDYVPPKLKTPFILRTPDMSAMHHDKSADLKVVGDKLKDILEVPNSTWKMR  393

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K++VE+CD++T R ARL+AAGIVGILKK+GRD                   +R+V+A++G
Sbjct  394   KIIVELCDIITSRGARLSAAGIVGILKKLGRD------------TLKDGEKQRSVIAVDG  441

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  +   + E+LG+   S + I ++ DGSGIG
Sbjct  442   ALFEHYTKFRNCMEGTIKELLGDAAES-IVIELSNDGSGIG  481



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 325/460 (71%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W KV+ +L+E EE C TP  +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKVMAILKEFEEECGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG     ++ + Q+  IP HL+ G++E LFD+IA +L  
Sbjct  94    RGLFYALDLGGTNFRVLRVQLGGHEKRVVKREFQEVSIPPHLMVGSTEALFDYIAGALAR  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPV+Q SV+SG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEDLCLPPGRQRELGFTFSFPVRQLSVASGTLIKWTKGFSIEDTVGQDVVGELSK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+ND V TLA G YN  D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERIGLDMRVAALVNDAVGTLAGGRYNHPDVMAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVL R
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDQGLDAESLNPGEQIFEKIISGMYLGEIVRRVLCR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+A+H D S +L  V   L +ILE+P+  LK+RK
Sbjct  334   MAEEAAFFGDAVPPKLNIPFILRTPEMSAIHHDTSCDLKVVGAKLKDILEIPNSSLKVRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+CD+V  R ARL+AAG++GILKK+GRD              +    +++VVA++GG
Sbjct  394   VIVEICDIVVSRGARLSAAGVLGILKKLGRD------------TITDGEKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  FR  ++  + E+LG +   +V+I  + DGSGIG
Sbjct  442   LFEHYAKFRNCMDSTLQELLG-DAYENVSIIHSNDGSGIG  480



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 332/460 (72%), Gaps = 12/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L+  EE CATP+ +LRQV DAMAVEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++    + + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S D    +GR   LGFTFSFPV+QTS+SSG LIKWT+GF I++ VG +V   L+ 
Sbjct  154   FVATESEDFHLPEGRQRELGFTFSFPVRQTSLSSGSLIKWTKGFSIDEAVGEDVVGALKK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G Y + D  AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMERVGLDMRVAALVNDTVGTLAGGRYYNPDVAAAVILGTGTNAAYVERATAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +CD++  R ARL+AAGI GILKK+GRD T         S      M+++V+A++GG
Sbjct  394   VVISLCDIIATRGARLSAAGIYGILKKLGRDTT---------SKDKEEEMQKSVIAMDGG  444

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  F E +  ++ E+LG+E S  + +  + DGSGIG
Sbjct  445   LFEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIG  484



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 328/460 (71%), Gaps = 17/460 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +++E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML+TYVD LP+G E
Sbjct  20    WGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITYVDNLPSGDE  79

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFR LRV LGG+    ++ +  +  IP HL+TG+S++LFDFIAS L  
Sbjct  80    KGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELFDFIASKLAK  139

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPV+QTS++SG +IKWT+GF IED VG +V   L  
Sbjct  140   FVSSEPEELHPPPGRQRELGFTFSFPVRQTSIASGNIIKWTKGFNIEDAVGEDVVGELTK  199

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+ VAAL+NDTV T+A   ++++D +A VI GTGTNA YVE A AI K  GLL
Sbjct  200   SLEKIGLDMHVAALVNDTVGTVARARFSNQDVIAGVILGTGTNAAYVECAHAIPKWHGLL  259

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  260   PKSGEMVINMEWGNFRSSHLPLTEYDHALDAESLNPGEQIFEKIISGMYLGEIVRRVLLK  319

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E D FG  V  KL +PF+LRTP M+A+H D S +L  V   L +ILE+ +  LK+RK
Sbjct  320   LAEEVDFFGDTVPPKLRIPFVLRTPDMSAIHQDTSSDLKVVGNKLKDILEINNTSLKMRK  379

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARL+AAGI GILKKIGRD              +    K++VVA++GG
Sbjct  380   IVVELCDIVANRGARLSAAGIFGILKKIGRD--------------TVKDGKKSVVALDGG  425

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L   + E+LG+E +  + I  + DGSGIG
Sbjct  426   LFEHYTKFRSSLESTLKELLGDEAAETIGIEQSNDGSGIG  465



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 332/460 (72%), Gaps = 12/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L+  EE CATP+ +LRQV DAMAVEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++    + + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S D    +GR   LGFTFSFPV+QTS+SSG LIKWT+GF I++ VG +V   L+ 
Sbjct  154   FVATESEDFHLPEGRQRELGFTFSFPVRQTSLSSGSLIKWTKGFSIDEAVGEDVVGALKK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G Y + D  AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMERVGLDMRVAALVNDTVGTLAGGRYYNPDVAAAVILGTGTNAAYVERATAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +CD++  R ARL+AAGI GILKK+GRD T         S      ++++V+A++GG
Sbjct  394   VVISLCDIIATRGARLSAAGIYGILKKLGRDTT---------SKDKEEEVQKSVIAMDGG  444

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  F E +  ++ E+LG+E S  + +  + DGSGIG
Sbjct  445   LFEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIG  484



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score =   486 bits (1252),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE C TP+ +LRQV DAM VEMHAGLASEGGSKL ML+++VD LP G E
Sbjct  34    WSRAMAILKEFEEKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YALDLGGTNFRVLRV LGG+    I  + ++  IP +L+TG+S+ LFDFIA++L  
Sbjct  94    EGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSDALFDFIAAALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +       + R LGFTFSFPV+QTS++SG LIKWT+GF IED VG +V   L  
Sbjct  154   FVGSEPEGFHPPPGRQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEDAVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDT+ TLA G + ++D +AAVI GTGTNA YVERA AI K  GL+
Sbjct  214   SMEKIGLDMRVAALVNDTIGTLAGGRFYNQDVIAAVILGTGTNAAYVERAHAIPKWHGLI  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA S NP +Q FEK+ISGMYLG++VRR LL+
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDLALDAQSLNPGEQIFEKLISGMYLGEVVRRALLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARLAAAGI+GILKKIGRD                   +++V+A++GG
Sbjct  394   IVVELCDIVATRGARLAAAGILGILKKIGRD------------TVKVGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FRE L  A+ E+LG+E +  + I    DGSGIG
Sbjct  442   LFEHYTKFRECLESALKELLGDEAAETIVIEHANDGSGIG  481



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   486 bits (1252),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E E+ C TP+ +LRQV DAM VEMHAGLASEGGSKL ML+++VD LP G E
Sbjct  34    WSRAMAILKEFEDKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YALDLGGTNFRVLRV LGG+    I  + ++  IP +L+TG+SE LFDFIA++L  
Sbjct  94    EGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSEALFDFIAAALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +       + R LGFTFSFPV+QTS++SG LIKWT+GF IED+VG +V   L  
Sbjct  154   FVGSEPEGFHPPPGRQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEDVVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDT+ TLA G + ++D VAAVI GTGTNA YVERA AI K  GL+
Sbjct  214   SMEKIGLDMRVAALVNDTIGTLAGGRFYNQDVVAAVILGTGTNAAYVERAHAIPKWHGLI  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRR L +
Sbjct  274   PKSGDMVINMEWGNFRSSHLPLTEYDLALDAESLNPGEQIFEKLISGMYLGEIVRRALFK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARLAAAGI+GILKKIGRD                   +++V+A++GG
Sbjct  394   IVVELCDIVATRGARLAAAGILGILKKIGRD------------TVKVGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FRE L   + E+LG+E +  + I    DGSGIG
Sbjct  442   LFEHYTKFRECLEGTLKELLGDEAAETIVIEHANDGSGIG  481



>ref|XP_010536106.1| PREDICTED: hexokinase-4-like [Tarenaya hassleriana]
Length=465

 Score =   485 bits (1248),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 255/451 (57%), Positives = 325/451 (72%), Gaps = 18/451 (4%)
 Frame = +2

Query  17    RVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFY  196
             R+  ELE AC   V  LR++  AMA EM  GL SE  +K+KML+++V  LP+ + +G FY
Sbjct  11    RLTAELEAACDADVDTLRKLAAAMAEEMEKGLRSEDEAKIKMLISFVHALPDWNAKGIFY  70

Query  197   ALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERD  376
             ALD+GGTNFR+LRV LGG+RS+    D+ +Q IPQ L+ GTSE  FDF+ASS++ F+ ++
Sbjct  71    ALDVGGTNFRILRVSLGGERSSLEVQDMDRQHIPQDLMKGTSEAFFDFLASSIERFVGKE  130

Query  377   SSDSEHSQG-RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKG  553
               D+    G R LGFTFSFPVKQTSVSSG LI+WT+GF I+D V   VS  LQAA  ++ 
Sbjct  131   GKDAVSDSGKRRLGFTFSFPVKQTSVSSGNLIRWTKGFAIKDAVHEEVSGLLQAALDKRR  190

Query  554   LDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSM  733
             ++++V AL+NDTV +LAL HY+D+DTVAAVI GTGTNA YVE+ + I K  GLLT SG M
Sbjct  191   VNMQVTALVNDTVGSLALAHYHDQDTVAAVIIGTGTNAAYVEKTENITKSPGLLTPSGQM  250

Query  734   VVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFD  913
             V+N EWGNF+SSHLPRTSYD +LDA+S NPN+  +EKMISGMYLG+IVRRVLLR+SQE D
Sbjct  251   VINTEWGNFFSSHLPRTSYDIELDAESLNPNEMAYEKMISGMYLGEIVRRVLLRISQESD  310

Query  914   VFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCD  1093
              F   +  L+ P +L  P + AMH D S EL EV R+L ++L++ DVPL++R++VV VCD
Sbjct  311   EFRQAADMLSRPSILSAPYITAMHQDKSSELKEVERILRDLLQIKDVPLRMRRIVVRVCD  370

Query  1094  VVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTS  1273
              VTRRA RL AAGI GILKK+GR+                    R+VVAIEGGLY SY  
Sbjct  371   AVTRRAGRLGAAGIAGILKKMGRE----------------EGNSRSVVAIEGGLYASYKK  414

Query  1274  FREYLNEAVAEILGEE-VSSHVTITVTEDGS  1363
             FREYL E + EILG + V+ +V + +TEDGS
Sbjct  415   FREYLKEGLEEILGRDFVARNVVLKITEDGS  445



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score =   486 bits (1251),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL +L+  EE CATP+ +L+QV DAM VEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVLAILKAFEEDCATPISKLKQVADAMTVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+T  S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTSGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPV QTS+SSG LIKWT+GF IE+ VG++V   L  
Sbjct  154   FVATEGEDFHLPAGRQRELGFTFSFPVWQTSLSSGTLIKWTKGFSIEEAVGQDVVGELNK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G Y ++D  AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERAGLDMRVAALVNDTVGTLAGGRYYNQDVTAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILELP   LK+RK
Sbjct  334   MAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDASPDLKIVGSKMKDILELPSTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD             +    ++++V+A++GG
Sbjct  394   VVITLCNIIATRGARLSAAGIYGILKKLGRD------------TNKDEPIQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  + +  + DGSGIG
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSIEVIHSNDGSGIG  481



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   486 bits (1251),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 328/460 (71%), Gaps = 17/460 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +++E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML+TYVD LP+G E
Sbjct  34    WGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFR LRV LGG+    ++ +  +  IP HL+TG+S++LFDFIAS L  
Sbjct  94    KGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELFDFIASKLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPV+QTS++SG +IKWT+GF IED VG +V   L  
Sbjct  154   FVSSEPEELHPPPGRQRELGFTFSFPVRQTSIASGNIIKWTKGFNIEDAVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+ VAAL+NDTV T+A   ++++D +A VI GTGTNA YVE A AI K  GLL
Sbjct  214   SLEKIGLDMHVAALVNDTVGTVARARFSNQDVIAGVILGTGTNAAYVECAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHALDAESLNPGEQIFEKIISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E D FG  V  KL +PF+LRTP M+A+H D S +L  V   L +ILE+ +  LK+RK
Sbjct  334   LAEEVDFFGDTVPPKLRIPFVLRTPDMSAIHQDTSSDLKVVGNKLKDILEINNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARL+AAGI GILKKIGRD              +    K++VVA++GG
Sbjct  394   IVVELCDIVANRGARLSAAGIFGILKKIGRD--------------TVKDGKKSVVALDGG  439

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  L   + E+LG+E +  + I  + DGSGIG
Sbjct  440   LFEHYTKFRSSLESTLKELLGDEAAETIGIEQSNDGSGIG  479



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L+  EE CATP+ +LRQV DAMAVEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++    + + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPV+QTS+SSG LIKWT+GF I++ VG +V   L+ 
Sbjct  154   FVATEGEDFHLPEGRQRELGFTFSFPVRQTSLSSGSLIKWTKGFSIDEAVGEDVVGALKK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDTV TLA G Y + D  AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMERVGLDMRVAALVNDTVGTLAGGRYYNPDVAAAVILGTGTNAAYVERATAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF++RTP M+AMH+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +CD++  R ARL+AAGI GILKK+GRD T            S   ++++V+A++GG
Sbjct  394   VVISLCDIIATRGARLSAAGIYGILKKLGRDTT------------SKEEVQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  F E +  ++ E+LG+E S  + +  + DGSGIG
Sbjct  442   LFEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIG  481



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+ LEE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    HGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG++V   L  
Sbjct  154   FVATEGEDFHLPAGRQRELGFTFSFPVRQTSLSSGTLIKWTKGFSIEDTVGQDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNPDVVAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GR+                   +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKLGRE------------TPKDGETQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVG  481



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 329/460 (72%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ +  +  IP +L+ GTS+ LFDFIA +LK 
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLFDFIAEALKK  153

Query  362   FIERDSSDSE--HSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  D      + R LGFTFSFPVKQTS++SG LIKWT+GF IE+ VG++V   L  
Sbjct  154   FVDTEGKDFHLPPDRQRELGFTFSFPVKQTSIASGALIKWTKGFSIEEAVGQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AIERVGLDMRVAALVNDTIGTLAGGRYSNPDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP+T YD  LDA+S NP +Q FEKMISGMYLG+I+R VL +
Sbjct  274   PKSGDMVINMEWGNFRSSHLPQTEYDQALDAESLNPGEQIFEKMISGMYLGEILRVVLCK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D S +L  V   L ++LE+ +  LK RK
Sbjct  334   MAEEAAFFGDTVPPKLKVPFILRTPHMSAMHHDTSSDLRVVGSKLKDVLEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+++ R ARLAAAGI+GILKK+GRD                   +R+V+A++GG
Sbjct  394   VVVELCDIISFRGARLAAAGILGILKKLGRD------------TLREGEKQRSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG E S  + I  + DGSGIG
Sbjct  442   LYEHYTKFRNAMEGTLKELLG-EASGTIVIEHSNDGSGIG  480



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 322/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + +++ IP HL+TG S +LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELFDFIVDVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQ S+SSG LI WT+GF I+D V ++V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQLSLSSGTLINWTKGFSIDDTVDKDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ VAAL+NDT+ TLA G Y + D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMLVAALVNDTIGTLAGGRYTNPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDVDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+    LK+RK
Sbjct  334   MAEEAAFFGDIVPPKLKIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVQTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD T                 +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAT------------KDGEAQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 329/460 (72%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE C TP+ +LRQV DAM VEMHAGLASEGGSKLKM+++YVD LP G E
Sbjct  34    WSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+ +  ++ +  +  IP +L+ GTS+ LFDFIA +LK 
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLFDFIAEALKK  153

Query  362   FIERDSSDSE--HSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F++ +  D      + R LGFTFSFPVKQTS++SG LIKWT+GF IE+ VG++V   L  
Sbjct  154   FVDTEGEDFHLPPDRQRELGFTFSFPVKQTSIASGALIKWTKGFSIEEAVGQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y++ D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AIERVGLDMRVAALVNDTIGTLAGGRYSNPDVIAAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP+T YD  LDA+S NP +Q FEKMISGMYLG+I+R VL +
Sbjct  274   PKSGDMVINMEWGNFRSSHLPQTEYDQALDAESLNPGEQIFEKMISGMYLGEILRVVLCK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP M+AMH D S +L  V   L ++LE+ +  LK RK
Sbjct  334   MAEEAAFFGDTVPPKLKVPFILRTPHMSAMHHDTSSDLRVVGSKLKDVLEISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+++ R ARLAAAGI+GILKK+GRD                   +R+V+A++GG
Sbjct  394   VVVELCDIISFRGARLAAAGILGILKKLGRD------------TLREGEKQRSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  +   + E+LG E S  + I  + DGSGIG
Sbjct  442   LYEHYTKFRNAMEGTLKELLG-EASGTIVIEHSNDGSGIG  480



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 327/461 (71%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSED-LFDFIASSLK  358
              G FYALDLGGTNFRV+RVQLGG+    ++ +V++  IP++++ G+S D LFDFIA++L 
Sbjct  94    TGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDALFDFIATALV  153

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             +F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF I+D V ++V   L 
Sbjct  154   EFVATEDDDFRLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIDDTVDQDVVRELT  213

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAAL+NDTV TLA G YN+ D +AAVI GTGTNA YVERA+ I K  GL
Sbjct  214   KAMERVGLDVRVAALVNDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERANTIPKWHGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  274   LPKSGDMVINMEWGNFRSSHLPVTEYDQSLDTESLNPGEQIYEKMISGMYLGEILRRVLC  333

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E   F   V  KL  PF+LRTP M+AMH D S +L  V   L +ILE+P+   K+R
Sbjct  334   RMAEEASFFDDYVPPKLKTPFILRTPDMSAMHHDKSADLKVVGDKLKDILEVPNSTWKMR  393

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K++VE+CD++T R ARL+AAGIVGILKK+GRD                   +R+V+A++G
Sbjct  394   KIIVELCDIITSRGARLSAAGIVGILKKLGRD------------TLKDGEKQRSVIAVDG  441

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  +   + E+LG+   S + I ++ DGSG+G
Sbjct  442   ALFEHYTKFRNCMEGTIKELLGDAAES-IVIELSNDGSGVG  481



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 323/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   + +ELEE C TP+ +LRQV DA+ VEMHAGLASEGG KLKML+TYVD LP+G E
Sbjct  34    WGRATAIAKELEEQCWTPISKLRQVADALDVEMHAGLASEGGCKLKMLITYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFR LRV LGG+    ++ + ++  IP HL+TG+S++LFDFIAS L  
Sbjct  94    KGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESEEVSIPPHLMTGSSQELFDFIASKLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPVKQTS++SG LIKWT+GF IED VG +V   L  
Sbjct  154   FVSSEPEELHPPPGRQRELGFTFSFPVKQTSIASGTLIKWTKGFNIEDAVGEDVVGGLTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+RVAAL+NDTV T+A   ++++D +A VI GTGTNA YVE A AI K QGLL
Sbjct  214   SLEKIGLDMRVAALVNDTVGTVARARFSNQDVIAGVILGTGTNAAYVECAHAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK++SGMYLGDIVRRVLL+
Sbjct  274   PKSGEMVINMEWGNFCSSHLPLTEYDQALDAESLNPGEQIFEKIVSGMYLGDIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK RK
Sbjct  334   MAEEVDFFGDTVPPKLRIPFVLRTPDMSAMHHDTSSDLKVVGNKLKDILEINNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARL+AAGI  ILKKIGRD                 + +++VVA++GG
Sbjct  394   IVVELCDIVATRGARLSAAGIFSILKKIGRD------------TVKDGKKQKSVVALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  FR  L   + E+LG+E    V I  + DGSGIG
Sbjct  442   LFEHYAKFRSSLESTLKELLGDEADETVGIEHSNDGSGIG  481



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score =   485 bits (1248),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 330/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TP+G+LRQV DAMAVEMHAGLASEGGSKLKM+++YVD LP G+E
Sbjct  33    WARATAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISYVDNLPTGTE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    I  +  +  IP++L+ GTS+ LFD+IA+ L  
Sbjct  93    KGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALFDYIAAELAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D +   GR   LGFTFSFPV Q+S++SG LIKWT+GF I+D VG++V   L  
Sbjct  153   FVAKEGQDYQLPPGRQRELGFTFSFPVLQSSINSGTLIKWTKGFSIDDAVGQDVVAELSK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RV+AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AIEKQGLDMRVSALVNDTVGTLAGGRYVNGDVVAAVILGTGTNAAYVERAHAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWG+F S+HLP T YD  LD +S NP DQ FEK+ISGMYLG+IVRRVL +
Sbjct  273   PKSGDMVINMEWGSFKSAHLPLTEYDHSLDTESLNPGDQIFEKLISGMYLGEIVRRVLCK  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL +PF+LRTP M+AMH D S +L  V  +L  +LE+ +   K+RK
Sbjct  333   IAEEASLFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVRDILKNVLEISNTSRKIRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R ARLAAAGI+G+LKK+G+D                   +RTVVA++GG
Sbjct  393   VVVELCNIVATRGARLAAAGILGVLKKVGKDA------------FKDGEKQRTVVALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y  + + +   + E+LGEEVS  + I  + DGSGIG
Sbjct  441   LYEHYNEYSKCMENTLRELLGEEVSESIVIEHSNDGSGIG  480



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score =   485 bits (1248),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 327/460 (71%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   VL ELEE CA    RLRQV DA+AVEMHAGLASEGGSKL M++++V+ LP+G E
Sbjct  31    WARAAAVLRELEERCAATPARLRQVADAVAVEMHAGLASEGGSKLGMIISHVESLPSGQE  90

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP +L+TG S DLFDFIA++L  
Sbjct  91    KGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPTNLMTGNSHDLFDFIAAALAK  150

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D    +GR   LGFTFSFPVKQ+S+SSG LIKWT+GF I D VG +V   L  
Sbjct  151   FVASEGEDFHLPEGRQRELGFTFSFPVKQSSISSGTLIKWTKGFAINDTVGEDVVAELSR  210

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD++V AL+NDT+ TLA G Y+D D V AVI GTGTNA YVERA+AI K  GLL
Sbjct  211   ALDRQGLDMKVTALVNDTIGTLAGGRYDDNDVVVAVILGTGTNAAYVERANAIPKWHGLL  270

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LDA+S NP +Q +EK+ISGMYLG+IVRR+LL+
Sbjct  271   PKSGDMVINMEWGNFRSSHLPLTEFDQALDAESLNPGEQIYEKLISGMYLGEIVRRILLK  330

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+QE  +FG  +  KL +P++L TP M+ MH D S +L  V   L +IL + +  LK R+
Sbjct  331   MTQEASLFGDDIPPKLKIPYILTTPHMSMMHHDGSSDLRTVGAQLRDILGIQNTSLKTRR  390

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV VCD+V +R +RLAAAGI GILKK+GRD               SS  +RTV+A++GG
Sbjct  391   LVVAVCDIVAKRGSRLAAAGIHGILKKLGRD-------------IPSSDKQRTVIAMDGG  437

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F E L   + EILGEEVSS V I +  DGSGIG
Sbjct  438   LYEHYTIFSESLESTLQEILGEEVSSSVVIKLANDGSGIG  477



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score =   485 bits (1249),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 329/460 (72%), Gaps = 17/460 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +++ELEE CATP+G L+QV +AMA+EM AGLASEG SKLKML++YVD LP+G E
Sbjct  34    WARAVEIVKELEERCATPIGLLKQVANAMAMEMQAGLASEGDSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    ++ +  +  IPQHL+ G+S +LF+FIA+ L  
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGKERHVVKQESTEVSIPQHLMVGSSAELFEFIAAELSK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D   S G  R +GFTFSFPVKQ+S++SG L+KWT+GF I++MVG++V   L  
Sbjct  154   FVASEGDDFHLSVGSQREIGFTFSFPVKQSSIASGTLVKWTKGFSIDEMVGKDVVVELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RVAAL+NDTV TLA G Y D+D   AVI GTGTNA YVE A  I K  GLL
Sbjct  214   AIEKQGLDMRVAALVNDTVGTLAGGRYYDKDVAVAVILGTGTNAAYVEHAREIPKWNGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNFWS+HLP T YD DLD +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGDMVINMEWGNFWSAHLPITEYDQDLDLESLNPGEQIFEKLISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V SKL  PF+LRTP M+AMH D + +L  V   L  IL + D  LK RK
Sbjct  334   LAEETYLFGDTVPSKLRTPFILRTPEMSAMHHDATSDLRIVGSKLNNILGITDTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+ CD++ +R ARLAAAG+ G+LKK GRD  GG               +RTVVA++GG
Sbjct  394   LVVKTCDIIAKRGARLAAAGVAGVLKKQGRDTAGG-------------GKQRTVVAMDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F + L+  + E+LG E S  V I +  DGSGIG
Sbjct  441   LFEHYTIFSKSLDSTLRELLG-EASPSVVIKLANDGSGIG  479



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score =   486 bits (1250),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 263/488 (54%), Positives = 331/488 (68%), Gaps = 43/488 (9%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + L +++E EE C TP+G+LRQ+ DAM VEMHAGLASEGGSKL ML++YVD LP G E
Sbjct  34    WSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSE------------  325
             EG FYALDLGGTNFRVLRV LGG+    I  +  +  IP HL+TG+SE            
Sbjct  94    EGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEVSVLRENHYRAI  153

Query  326   ----------------DLFDFIASSLKDFIERDSSDSEHSQG--RSLGFTFSFPVKQTSV  451
                              LFDFIA++L  F+E +        G  R LGFTFSFPVKQTS+
Sbjct  154   ESANTLIYKLFQCLLQGLFDFIAAALAKFVESEPEVFHPPSGKLRELGFTFSFPVKQTSI  213

Query  452   SSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDT  631
             SSG LIKWT+GF IED VG +V   L  +  + GL++RVAAL+NDT+ TLA G + D+D 
Sbjct  214   SSGTLIKWTKGFSIEDTVGEDVVGELTKSLEKIGLNMRVAALVNDTIGTLAGGRFYDQDV  273

Query  632   VAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDAD  811
             +AAVI GTGTNA YVERA AI K +GL+  SG MV+NMEWGNF SSHLP T YD DLDA+
Sbjct  274   IAAVILGTGTNAAYVERAHAIPKWKGLIPKSGDMVINMEWGNFRSSHLPLTGYDQDLDAE  333

Query  812   SPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHD  988
             S NP +Q FEK++SGMYLG+IVRRVLL+M++E + FG  V  KL +PF+LRTP M+++H 
Sbjct  334   SLNPGEQIFEKLLSGMYLGEIVRRVLLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSIHH  393

Query  989   DDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDG  1168
             D SP+L  V   L +ILE+ +  LK RK+VVE+CD+V  R ARLAAAGI+GILKKIGRD 
Sbjct  394   DTSPDLKVVGNKLRDILEISNTSLKTRKIVVELCDIVATRGARLAAAGILGILKKIGRD-  452

Query  1169  TGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITV  1348
                           +   +++V+A++GGL+  YT FR  L E + E+LG+E +  V +  
Sbjct  453   -----------TVKAGEKQKSVIALDGGLFEHYTKFRVCLEETLKELLGDEAADTVVVKH  501

Query  1349  TEDGSGIG  1372
               DGSGIG
Sbjct  502   ANDGSGIG  509



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score =   485 bits (1248),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 321/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRV+RV LGG+    ++ + +++ IP HL+TG S +LFDFI   L  
Sbjct  94    TGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELFDFIVDVLAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQ S+SSG LI WT+GF I+D V ++V   L  
Sbjct  154   FVATEGEDFHLPPGRQRELGFTFSFPVKQLSLSSGTLINWTKGFSIDDTVDKDVVGELVK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ VAAL+NDT+ TLA G Y   D V AVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMLVAALVNDTIGTLAGGRYTSPDVVVAVILGTGTNAAYVERAHAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHSLDVDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+    LK+RK
Sbjct  334   MAEEAAFFGDIVPPKLKIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILEVQTSSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKKIGRD T                 +++V+A++GG
Sbjct  394   VVISLCNIIASRGARLSAAGIYGILKKIGRDAT------------KDGEAQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+EVS  V + ++ DGSG+G
Sbjct  442   LFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVG  481



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score =   484 bits (1247),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 328/461 (71%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKAMDMLKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSED-LFDFIASSLK  358
              G FYALDLGGTNFRV+RVQLGG+    ++ +V++  IP++++ G+S D LFDFIA++L 
Sbjct  94    TGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDALFDFIATTLV  153

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF I+D VG++V   L 
Sbjct  154   KFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIDDAVGQDVVRELT  213

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAALINDTV TLA G YN+ D +AAVI GTGTNA YVERA+ I K  GL
Sbjct  214   KAMERVGLDVRVAALINDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERANTIPKWHGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  274   LPKSGDMVINMEWGNFRSSHLPVTEYDQSLDAESLNPGEQIYEKMISGMYLGEILRRVLC  333

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E   F   V  KL  PF+LRT  M+AMH D S +L  V   L +ILE+P+   K+R
Sbjct  334   RMAEEASFFDDYVPPKLKTPFILRTQDMSAMHHDKSADLKVVGDKLKDILEVPNSTWKMR  393

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K++VE+CD++T R ARL+AAGIVGILKK+GRD                   +R+V+A++G
Sbjct  394   KIIVELCDIITSRGARLSAAGIVGILKKLGRD------------TLKDGEKQRSVIAVDG  441

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  +   + E+LG + + ++ + ++ DGSG+G
Sbjct  442   ALFEHYTKFRNCMEGTIKELLG-DAAENIVVKLSNDGSGVG  481



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score =   484 bits (1247),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 328/461 (71%), Gaps = 17/461 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSED-LFDFIASSLK  358
              G FYALDLGGTNFRV+RVQLGG+    ++ +V++  IP++++ G+S D LFDFIA++L 
Sbjct  94    TGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDALFDFIATTLV  153

Query  359   DFIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF I+D VG++V   L 
Sbjct  154   KFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIDDAVGQDVVRELT  213

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GLD+RVAALINDTV TLA G YN+ D +AAVI GTGTNA YVERA+ I K  GL
Sbjct  214   KAMERVGLDVRVAALINDTVGTLAGGRYNNPDVIAAVILGTGTNAAYVERANTIPKWHGL  273

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q +EKMISGMYLG+I+RRVL 
Sbjct  274   LPKSGDMVINMEWGNFRSSHLPVTEYDQSLDAESLNPGEQIYEKMISGMYLGEILRRVLC  333

Query  893   RMSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             RM++E   F   V  KL  PF+LRT  M+AMH D S +L  V   L +ILE+P+   K+R
Sbjct  334   RMAEEASFFDDYVPPKLKTPFILRTQDMSAMHHDKSADLKVVGDKLKDILEVPNSTWKMR  393

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             K++VE+CD++T R ARL+AAGIVGILKK+GRD                   +R+V+A++G
Sbjct  394   KIIVELCDIITSRGARLSAAGIVGILKKLGRD------------TLKDGEKQRSVIAVDG  441

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              L+  YT FR  +   + E+LG + + ++ + ++ DGSG+G
Sbjct  442   ALFEHYTKFRNCMEGTIKELLG-DAAENIVVKLSYDGSGVG  481



>ref|XP_001752229.1| hexokinase protein HXK8 [Physcomitrella patens]
 gb|EDQ82962.1| hexokinase protein HXK8 [Physcomitrella patens]
Length=517

 Score =   485 bits (1249),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 256/458 (56%), Positives = 325/458 (71%), Gaps = 17/458 (4%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC TP+ RLRQVVDAMAVEMHAGL SEGGSKLKML T++D LP+G+E+G +YA+DLGGTN
Sbjct  49    ACETPLPRLRQVVDAMAVEMHAGLVSEGGSKLKMLPTFIDHLPDGNEKGLYYAVDLGGTN  108

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDS--EH  394
             FRVLR QLGG     I+ + ++  IP  L+ GTSE LFDFIA  L  F+ R+  D     
Sbjct  109   FRVLRTQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFVAREGEDFRLHE  168

Query  395   SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              Q R +GFTFSFP KQT+V+SG L++WT+GF++ D +G++V   LQ +  R+G  +R+AA
Sbjct  169   GQSREIGFTFSFPCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQGSIERRGYKMRIAA  228

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLA G Y + D + AVI GTGTNACYVERA++I K  G L  SG MV+NMEWG
Sbjct  229   LVNDTVGTLAGGRYWNNDVMIAVILGTGTNACYVERAESISKWGGELPKSGQMVINMEWG  288

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGP-VS  931
             NFWSSHLPRT  D  LD +S NP + GFEKMISGMYLGD VRRVL+RM+Q+  +FGP V 
Sbjct  289   NFWSSHLPRTYVDELLDNESLNPGEYGFEKMISGMYLGDCVRRVLVRMAQQAGIFGPHVP  348

Query  932   SKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrra  1111
              KL   F L+TP M+ MH DDS +L  VA VL  +  + +  L +RK+V+ VCD+V +R 
Sbjct  349   HKLLEAFTLQTPDMSKMHHDDSSDLKMVAEVLKTVYGIHNTTLGIRKIVLAVCDIVCQRG  408

Query  1112  arlaaaGIVGILKKIGRDGT-----------GGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             ARLAAAGIVGILKKIGRDG+            GI      + +S     +TVVA++GGLY
Sbjct  409   ARLAAAGIVGILKKIGRDGSTANGFIRRNDVNGI--HDELTVNSIGGSGKTVVAMDGGLY  466

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
               Y+ FR Y+ +AV E+LG + + +V I +++DGSGIG
Sbjct  467   EHYSKFRNYMQQAVRELLG-DAAKNVFIELSKDGSGIG  503



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   484 bits (1246),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 328/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKM+++YVD LP G+E
Sbjct  33    WARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISYVDNLPTGNE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RVQLGG+    I  +  +  IP++L+ GTS+ LFD+IA+ L  
Sbjct  93    KGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALFDYIAAELAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D +   GR   LGFTFSFPV Q+S++SG LIKWT+GF I+D VG++V   L  
Sbjct  153   FVAKEGQDYQLPPGRQRELGFTFSFPVLQSSINSGTLIKWTKGFSIDDAVGQDVVAELSK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV+AL+NDTV TLA G Y ++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AIERTGLDMRVSALVNDTVGTLAGGRYVNQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MVVNMEWGNF S+HLP T YD  LD +S N  DQ FEK+ISGMYLG+IVRRVL R
Sbjct  273   PKSGEMVVNMEWGNFKSAHLPLTEYDHSLDTESLNRGDQIFEKIISGMYLGEIVRRVLCR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             ++ E  +FG  V  KL +PF+LRTP M+AMH D S +L  V   L  +LE+ +  LK+RK
Sbjct  333   IADEASLFGDTVPPKLNVPFILRTPDMSAMHHDASSDLRVVREKLKNVLEISNTSLKVRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C++V  R ARLAAAG++G+LKK+GRD                   ++TVVA++GG
Sbjct  393   VIVELCNIVATRGARLAAAGVLGVLKKLGRDAV------------KDGENQKTVVALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT + + +   + E+LGEEV+  + I  + DGSGIG
Sbjct  441   LYEHYTEYSKCMENTLRELLGEEVAETIVIEHSNDGSGIG  480



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score =   484 bits (1247),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 325/459 (71%), Gaps = 14/459 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TPV +LRQV +AM VEMHAGLAS+GGSKLKML++YVD LP G E
Sbjct  49    WERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDE  108

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFR+LRV LGG+    I+ + ++  IP HL+TG+S +LFDFIA +L  
Sbjct  109   KGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAMALAK  168

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  DS    GR   LGFTFSFPV+Q+S++SG LIKWT+GF IED VG +V   L  
Sbjct  169   FVATEGEDSHLYPGRQRELGFTFSFPVRQSSIASGTLIKWTKGFSIEDAVGEDVVSELSK  228

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ T+A G YND D VAAVI GTGTNA YVE+  AI K  G L
Sbjct  229   AMERVGLDMRVAALVNDTIGTMAGGRYNDPDVVAAVILGTGTNAAYVEQIHAIPKWHGPL  288

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+N EWGNF S HLP T YD  LD +S NP +Q +EK+ISGMYLG+IVR  LLR
Sbjct  289   PKSGEMVINTEWGNFQSPHLPLTEYDKTLDDESLNPGEQAYEKLISGMYLGEIVRIALLR  348

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M++E  +FG +  KL +PF+LRTP M+AMH D SP+L+ V + L ++LE+ D  L+ RK+
Sbjct  349   MAEESALFGDIPLKLKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLEISDTSLRTRKV  408

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++CD+VT RAARLAAAGI GILKK+GRD                   +R+V+A++GGL
Sbjct  409   VVDLCDIVTTRAARLAAAGIFGILKKLGRD------------TLRDGEKQRSVIALDGGL  456

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +  Y  FR  +   + E+LG EV+    I ++ DGSGIG
Sbjct  457   FEHYAKFRNCVEATLRELLGPEVAESTLIVLSNDGSGIG  495



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score =   484 bits (1245),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKMLL+YVD LP G E
Sbjct  34    WARAMAILREFEDKCGTPLGKLRQVADAMTVEMHAGLASEGGSKLKMLLSYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+ G+S+ LFD+IA +L  
Sbjct  94    KGLFYALDLGGTNFRVIRVVLGGKDDRVVKQEFEEVSIPPHLMIGSSDALFDYIAEALAK  153

Query  362   FI--ERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  E +       Q R LGFTFSFPV+QTS++SG LIKWT+GF IED VG +V   L  
Sbjct  154   FVATEDEGLHPLPGQQRELGFTFSFPVRQTSIASGTLIKWTKGFSIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ TLA G Y ++D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  214   AMERVGLDMRVAALVNDTIGTLAGGRYYNKDVIAAVILGTGTNAAYVERAQAIPKWNGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q FEK+ISGMYLG+IVRRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDQALDVESLNPGEQIFEKLISGMYLGEIVRRVLLR  333

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M+QE   FG  V  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK+RK
Sbjct  334   MAQEAAFFGDVVPPKLEIPFILRTPHMSAMHHDTSSDLKVVGSKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
              +VE+CD+V  R ARL+AAGI+GILKK+GRD                   +++V+A++GG
Sbjct  394   AIVELCDIVATRGARLSAAGIMGILKKLGRDAV------------KDGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  +   + E+LGEE+S  + I  + DGSGIG
Sbjct  442   LFEHYTKFRSSMESTLKELLGEEISESIIIEHSNDGSGIG  481



>gb|EMT24694.1| Hexokinase-10 [Aegilops tauschii]
Length=500

 Score =   484 bits (1245),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 342/460 (74%), Gaps = 12/460 (3%)
 Frame = +2

Query  2     WRKVLR---VleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPN  172
             WR+ LR   VL ++EE+ ATP  RL++VV+++AVEM AGLASE  SK++MLLT VD LP+
Sbjct  34    WRRWLRAMAVLRDVEESFATPTERLQRVVNSLAVEMFAGLASEDASKVRMLLTCVDSLPD  93

Query  173   GSEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASS  352
             GSEEG +YA+D+GGT FR L+VQLG   S  I   +++QP+ + L+ GTSED F+ IAS+
Sbjct  94    GSEEGIYYAVDIGGTGFRFLKVQLG-PGSTIINQKIERQPVKKELMEGTSEDFFNSIAST  152

Query  353   LKDFIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
             LK+FIER     E  +GR+LGFTFSFPV+Q S++SG LI+WT+ F IED +G++V++CL 
Sbjct  153   LKNFIER-----EGDEGRALGFTFSFPVRQFSITSGSLIRWTKEFSIEDAIGQDVAQCLN  207

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R GL+++V AL+N+TV TLALGHY DEDT+AAVI G GTNACY+ER +AI KCQ L
Sbjct  208   EALERNGLNLKVNALMNNTVGTLALGHYYDEDTIAAVIIGAGTNACYIERNEAITKCQCL  267

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             LT SG  VVN+EWG+F    +P T YD     ++ N  DQGFEKMISG+YLG+I R V  
Sbjct  268   LTNSGQTVVNVEWGSFRPPQIPLTPYDICFYNETTNYYDQGFEKMISGVYLGEIARLVFH  327

Query  893   RMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +M+QE DVFG     LA+PF+L TP +AA+ +DDS +L EV  +L E L++ +VPLK R+
Sbjct  328   KMAQESDVFGTDVDGLAIPFILSTPCLAAIREDDSLDLKEVGSILEEQLKIHNVPLKTRR  387

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LV  VCD++T+RAARLAAAGIV IL+K+GRDGT     G  R  S +   KR+ +AI+G 
Sbjct  388   LVQRVCDIITQRAARLAAAGIVAILQKLGRDGT---LCGTTRVRSMTGVPKRSAIAIDGC  444

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ FREYLNEAV EILGEE+++ V + V E+GSG+G
Sbjct  445   LYQEYSVFREYLNEAVLEILGEEIAATVVLKVVEEGSGMG  484



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score =   484 bits (1246),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 325/459 (71%), Gaps = 14/459 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TPV +LRQV +AM VEMHAGLAS+GGSKLKML++YVD LP G E
Sbjct  47    WERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDE  106

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G +YALDLGGTNFR+LRV LGG+    I+ + ++  IP HL+TG+S +LFDFIA +L  
Sbjct  107   KGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAMALAK  166

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  DS    GR   LGFTFSFPV+Q+S++SG LIKWT+GF IED VG +V   L  
Sbjct  167   FVATEGEDSHLYPGRQRELGFTFSFPVRQSSIASGTLIKWTKGFSIEDAVGEDVVSELSK  226

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RVAAL+NDT+ T+A G YND D VAAVI GTGTNA YVE+  AI K  G L
Sbjct  227   AMERVGLDMRVAALVNDTIGTMAGGRYNDPDVVAAVILGTGTNAAYVEQIHAIPKWHGPL  286

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+N EWGNF S HLP T YD  LD +S NP +Q +EK+ISGMYLG+IVR  LLR
Sbjct  287   PKSGEMVINTEWGNFQSPHLPLTEYDKTLDDESLNPGEQAYEKLISGMYLGEIVRIALLR  346

Query  896   MSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKL  1075
             M++E  +FG +  KL +PF+LRTP M+AMH D SP+L+ V + L ++LE+ D  L+ RK+
Sbjct  347   MAEESALFGDIPLKLKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLEISDTSLRTRKV  406

Query  1076  VVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGL  1255
             VV++C++V  RAARLAAAGI GILKK+GRD                   +R+V+A++GGL
Sbjct  407   VVDLCNIVATRAARLAAAGIFGILKKLGRD------------TLRDGEKQRSVIALDGGL  454

Query  1256  YTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             +  Y  FR  +   + E+LG EV+ +  I ++ DGSGIG
Sbjct  455   FEHYAKFRNCVEATLRELLGPEVAENTVIVLSNDGSGIG  493



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 327/460 (71%), Gaps = 13/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+ELEE CATP+G+LRQV DAM VEM AGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISYVDNLPKGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    ++ + ++  IP +L+ G+S +LFDFIA++L  
Sbjct  94    TGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELFDFIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPVKQTS+SSG LIKWT+GF I   VG +V   L  
Sbjct  154   FVASEGEEFHLPVGRQRELGFTFSFPVKQTSISSGTLIKWTKGFAINGTVGEDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV AL+NDT+ TLA G Y D D VAAVI GTGTNA YVE A AI K  GLL
Sbjct  214   AIERQGLDMRVTALVNDTIGTLAGGRYYDNDVVAAVILGTGTNAAYVEHAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  274   PKSGKMVINMEWGNFRSSHLPITEYDQALDAESLNPGEQIFEKLISGMYLGEIVRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  +  KL + F+LRTP M+AMH D S +L  V   L +IL + +  LK RK
Sbjct  334   MAEEAALFGDSIPPKLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILGISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCD++ +R ARLAAAGI+G+LKK GRD           +    S M+RTV+A++GG
Sbjct  394   LVVKVCDIIAKRGARLAAAGILGVLKKQGRD----------TALRDGSDMQRTVIAMDGG  443

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT F   L   + E+LGEE ++ + I +  DGSGIG
Sbjct  444   LYEHYTIFSNCLETTLREMLGEEATASIVIKLASDGSGIG  483



>ref|XP_001784334.1| hexokinase protein HXK3 [Physcomitrella patens]
 gb|EDQ50852.1| hexokinase protein HXK3 [Physcomitrella patens]
Length=517

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 259/458 (57%), Positives = 324/458 (71%), Gaps = 17/458 (4%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC TP+ RLRQVVDAMAVEMHAGL SEGGSKLKML T++D+LPNGSE+G +YA+DLGGTN
Sbjct  49    ACETPLPRLRQVVDAMAVEMHAGLVSEGGSKLKMLPTFIDRLPNGSEKGLYYAVDLGGTN  108

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSE--H  394
             FRVLRVQLGG     I+ + ++  IP  L+ GTSE LF FIA  L  F+ R+  +     
Sbjct  109   FRVLRVQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFHFIAKELAGFVAREGEEFRLGD  168

Query  395   SQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              Q R +GFTFSFP KQT+V+SG L++WT+GF++ D +G++V   LQ    R G  +R+AA
Sbjct  169   GQSREIGFTFSFPCKQTAVNSGTLLQWTKGFKVNDAIGQDVVAALQKCIERLGCKMRIAA  228

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             L+NDTV TLA G Y + D + AVI GTGTNACYVERA++I K  G L  SG MV+NMEWG
Sbjct  229   LVNDTVGTLAGGRYWNNDVMIAVILGTGTNACYVERAESISKWTGELPKSGQMVINMEWG  288

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGP-VS  931
             NFWSSHLPRT  D  LD++S +P + GFEKMISGMYLGD VRRVL+RM+QE  +FGP V 
Sbjct  289   NFWSSHLPRTYVDELLDSESLHPGEYGFEKMISGMYLGDCVRRVLVRMAQEAGIFGPHVP  348

Query  932   SKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrra  1111
               L   F L+TP M+ MH DDS +L  VA VL  +  + +  + +RK+VV VCD   +R 
Sbjct  349   HTLLESFSLQTPEMSRMHHDDSSDLKVVAEVLKRLYGIQNTTVGIRKIVVAVCDTTCQRG  408

Query  1112  arlaaaGIVGILKKIGRDG-----------TGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             ARLAAAGIVGILKKIGRDG           T GI      S +S+    +TVVA++GGLY
Sbjct  409   ARLAAAGIVGILKKIGRDGSTANGLMRRNDTNGI--HDELSVNSTPGSGKTVVAMDGGLY  466

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
               Y+ FR Y+ EAV E+LG + S +V+I +++DGSGIG
Sbjct  467   EHYSKFRNYMQEAVRELLG-DASKNVSIELSKDGSGIG  503



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +VL +L+  EE CATP+ +LRQV DAM VEMHAGLAS+GGSKLKML++YVD LP+G E
Sbjct  34    WGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG+     + + ++  IP HL+TG S++LF+FIA +L  
Sbjct  94    KGLFYALDLGGTNFRVMRVLLGGKEERVAKQEFEEVSIPPHLMTGGSDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +    +GR   LGFTFSFPVKQTS+SSG LIKWT+GF I++ VG++V   L+ 
Sbjct  154   FVATECEEFRLPEGRQRELGFTFSFPVKQTSLSSGALIKWTKGFSIDEAVGQDVVGALKK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R  LD+RVAAL+NDTV TLA G Y + D  AAVI GTGTNA YVERA AI K  G L
Sbjct  214   AMERVNLDMRVAALVNDTVGTLAGGRYYNPDVAAAVILGTGTNAAYVERATAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEFDHSLDFESLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF++RTP M+A+H+D SP+L  V   + +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDTVPSKLRIPFIIRTPHMSAIHNDTSPDLKIVGSKIKDILEVPTTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +CD++  R ARL+AAGI GILKK+GRD             +    M+++VVA++GG
Sbjct  394   VVISLCDIIATRGARLSAAGIYGILKKLGRD------------TNKEEEMQKSVVAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG E S  + +  + DGSGIG
Sbjct  442   LFEHYTQFSECMERSLKELLGNEASGSIEVIHSNDGSGIG  481



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score =   481 bits (1239),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 316/445 (71%), Gaps = 14/445 (3%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             C TPV +LRQV +AM VEMHAGLAS+GGSKLKML++YVD LP G E+G +YALDLGGTNF
Sbjct  9     CGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDEKGLYYALDLGGTNF  68

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             R+LRV LGG+    I+ + ++  IP HL+TG+S +LFDFIA +L  F+  +  DS    G
Sbjct  69    RILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAMALAKFVATEGEDSHLYPG  128

Query  404   RS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
             R   LGFTFSFPV+Q+S++SG LIKWT+GF IED VG +V   L  A  R GLD+RVAAL
Sbjct  129   RQRELGFTFSFPVRQSSIASGTLIKWTKGFSIEDAVGEDVVSELSKAMERVGLDMRVAAL  188

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +NDT+ T+A G YND D VAAVI GTGTNA YVE+  AI K  G L  SG MV+N EWGN
Sbjct  189   VNDTIGTMAGGRYNDPDVVAAVILGTGTNAAYVEQIHAIPKWHGPLPKSGEMVINTEWGN  248

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSK  937
             F S HLP T YD  LD +S NP +Q +EK+ISGMYLG+IVR  LLRM++E  +FG +  K
Sbjct  249   FQSPHLPLTEYDKTLDDESLNPGEQAYEKLISGMYLGEIVRIALLRMAEESALFGDIPLK  308

Query  938   LAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraar  1117
             L +PF+LRTP M+AMH D SP+L+ V + L ++LE+ D  L+ RK+VV++CD+VT RAAR
Sbjct  309   LKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLEISDTSLRTRKVVVDLCDIVTTRAAR  368

Query  1118  laaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEA  1297
             LAAAGI GILKK+GRD                   +R+V+A++GGL+  Y  FR  +   
Sbjct  369   LAAAGIFGILKKLGRD------------TLRDGEKQRSVIALDGGLFEHYAKFRNCVEAT  416

Query  1298  VAEILGEEVSSHVTITVTEDGSGIG  1372
             + E+LG EV+    I ++ DGSGIG
Sbjct  417   LRELLGPEVAESTLIVLSNDGSGIG  441



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score =   483 bits (1242),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 329/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +++ELEE CATP+G+L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WARVMEIVKELEEKCATPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G +YALDLGGTNFRVLRV LGG+    I  +  + PIP +L+TGTS+ LFD+IA+ L  
Sbjct  95    NGYYYALDLGGTNFRVLRVHLGGKDGGLINQEFAEVPIPPNLMTGTSDALFDYIAAELVK  154

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI ++S +     G  R LGFTFSFPV QTS++SG L++WT+GF I+D VG++V   L  
Sbjct  155   FISQESEEFHPPPGKKRELGFTFSFPVIQTSIASGTLVRWTKGFSIDDAVGQDVVAKLTK  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  R G+D+ V+AL+NDTV TLA G Y ++D VAAVI GTGTNA YVERA AI K  G L
Sbjct  215   SMERMGVDMHVSALVNDTVGTLAGGKYFNKDVVAAVILGTGTNAAYVERAQAIPKWHGPL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+I+RRVLL+
Sbjct  275   PHSGEMVINMEWGNFRSSHLPLTEYDHALDVESLNPGEQIFEKIISGMYLGEIIRRVLLK  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  +  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK RK
Sbjct  335   MAEEAALFGDTIPLKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILEISNTSLKTRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R ARLAAAGI+GILKK+G+D                   ++TV+A++GG
Sbjct  395   VVVELCNIVATRGARLAAAGILGILKKMGKD------------TVKEGDTQKTVIAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ + + +   + E+LGE+V   + I  + DGSGIG
Sbjct  443   LYEHYSEYSKCMENTLNELLGEDVPKSIEIVHSNDGSGIG  482



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score =   483 bits (1242),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 322/460 (70%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V  +L++ EE CATP G+LR V DAM VEMHAGLASEGGSKLK+L+++VD LP G E
Sbjct  34    WARVTEILKDFEEKCATPDGKLRHVADAMTVEMHAGLASEGGSKLKILISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG     I+ + Q+  IP HL+T TSE LFD IA +L +
Sbjct  94    KGLFYALDLGGTNFRVLRVQLGGXDQRVIKQEFQEVSIPPHLMTETSEALFDNIAKALAN  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +  H  GR   LGFTFSFPV+Q S+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVATED-EGVHPPGRQRELGFTFSFPVRQLSLSSGTLIKWTKGFNIEDAVGEDVVGELTK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  + GLD+ V AL+NDT+ TLA G Y+D+D +AAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AMEKIGLDMHVTALVNDTIGTLAGGRYSDQDVIAAVILGTGTNAAYVERAHAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEKMISGMYLG IVRRVL R
Sbjct  273   PKSGEMVINMEWGNFRSSHLPLTEYDQALDLESLNPGEQIFEKMISGMYLGGIVRRVLCR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D+FG  V  KL +PF+LRT  M+AMH D S +L  V   L +ILE+    LK RK
Sbjct  333   MAEEADLFGDSVPPKLKIPFILRTLDMSAMHHDTSSDLRVVGSKLKDILEISSTSLKARK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++ EVCD+V  R ARL+AAG++GILKK+GRD                   +R+V+A++GG
Sbjct  393   VIAEVCDIVATRGARLSAAGMLGILKKLGRD------------TVRDGEKQRSVIALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y  FR  +   + E+LGEEV+ ++ +  + DGSGIG
Sbjct  441   LYEHYNKFRTCMKSTLNELLGEEVAGNIVVEHSNDGSGIG  480



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score =   483 bits (1242),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 324/460 (70%), Gaps = 14/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E E+ C TP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G+E
Sbjct  35    WARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    +  + ++  IP +L+ G+SE LF++IA +L  
Sbjct  95    QGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALFNYIAEALAK  154

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S  S    GR   LGFTFSFPV+Q S+SSG LIKWT+GF IED VG +V   L  
Sbjct  155   FVATESEGSHPYPGRQRELGFTFSFPVRQVSISSGTLIKWTKGFSIEDAVGEDVVGELTK  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  + GL +RV AL+NDT+ TLA G + + D +AAVI GTGTNA YVERA AI K  G L
Sbjct  215   AMEKIGLHMRVTALVNDTIGTLAGGRFYNSDVIAAVILGTGTNAAYVERAQAIPKWHGPL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD++S NP +Q FEK ISGMYLG++VRRVLL+
Sbjct  275   PKSGEMVINMEWGNFRSSHLPLTEYDQALDSESLNPGEQIFEKTISGMYLGEVVRRVLLK  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL + F+LRTP M+AMH D S +L  V   L +ILE+ +  LK+RK
Sbjct  335   MAEEASFFGDNVPPKLRISFILRTPDMSAMHHDTSSDLKVVGNKLRDILEISNTTLKMRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+CD+V  R ARL+AAGIVGILKK+GRD                +  +++V+A++GG
Sbjct  395   VVVELCDIVATRGARLSAAGIVGILKKLGRDSA-----------KEGAEQQKSVIALDGG  443

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  F   +   + E++GEEV+ ++ I  + DGSGIG
Sbjct  444   LFEHYKKFSACMESTLKELIGEEVAQNIVIEHSNDGSGIG  483



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP  L+TG S++LF+FIA +L  
Sbjct  94    QGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+ SG LI WT+GF IED +G++V   L  
Sbjct  154   FVATEGEDFHLPAGRQRELGFTFSFPVKQTSLCSGTLISWTKGFSIEDALGQDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA+AI K QGLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNSDVVAAVILGTGTNAAYVERANAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILEVPTT-LKMRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  393   VVISLCNIIATRGARLSAAGIYGILKKLGRDAP-----------KDGETTQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVG  481



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP  L+TG S++LF+FIA +L  
Sbjct  94    QGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+ SG LI WT+GF IED +G++V   L  
Sbjct  154   FVATEGEDFHLQAGRQRELGFTFSFPVKQTSLCSGTLINWTKGFSIEDALGKDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K QGLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNSDVVAAVILGTGTNAAYVERASAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILEVPTT-LKMRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  393   VVISLCNIIATRGARLSAAGIYGILKKLGRDAP-----------KDGEATQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVG  481



>emb|CBI27996.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   480 bits (1235),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 312/432 (72%), Gaps = 15/432 (3%)
 Frame = +2

Query  86    MAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRVLRVQLGGQRSAT  265
             M VEMHAGLASEGGSKLKM+++YVD LP G E+G FYALDLGGTNFRVLRVQLGG+    
Sbjct  1     MTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRV  60

Query  266   IRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQGRS--LGFTFSFPVK  439
             ++ + ++  IP HL+ G+S+ LFD+IA++L  F+  +      S GR   LGFTFSFPV+
Sbjct  61    VKQEFEEVSIPPHLMVGSSDALFDYIAAALAKFVATEGEGLHVSPGRQRELGFTFSFPVR  120

Query  440   QTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYN  619
             Q+S+SSG LIKWT+GF IED VG++V   L  A  R GLD+RV+AL+NDT+ TLA G Y 
Sbjct  121   QSSISSGSLIKWTKGFSIEDAVGQDVVGELTKAMERIGLDMRVSALVNDTIGTLAGGRYY  180

Query  620   DEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSD  799
             D+D VAAVI GTGTNA YVERA +I K  GLL  SG MV+NMEWGNF SSHLP T YD  
Sbjct  181   DQDVVAAVILGTGTNAAYVERAQSIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEYDQV  240

Query  800   LDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVSSKLAMPFLLRTPLMA  976
             LDA+S NP +Q FEK+ISGMYLGDIVRRVL RM++E D+FG  V  KL +PF+LRTP M+
Sbjct  241   LDAESLNPGEQIFEKIISGMYLGDIVRRVLCRMAEEADLFGDTVPPKLKIPFILRTPDMS  300

Query  977   AMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKI  1156
             AMH D SP+L  V   L +IL++P+  LK RK+V+E+CD+V  R ARL+AAGI+GILKK+
Sbjct  301   AMHHDTSPDLRVVGSKLKDILDIPNTSLKTRKVVIELCDIVATRGARLSAAGILGILKKL  360

Query  1157  GRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHV  1336
             GRD                   + +V+A++GGLY  YT FR  L   + E+LG EVS ++
Sbjct  361   GRD------------TMKEGDKQNSVIALDGGLYEHYTEFRTCLESTLKELLGAEVSDNI  408

Query  1337  TITVTEDGSGIG  1372
              I  + DGSGIG
Sbjct  409   VIKHSNDGSGIG  420



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score =   482 bits (1240),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP  L+TG S++LF+FIA +L  
Sbjct  94    QGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELFNFIAEALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+ SG LI WT+GF IED +G++V   L  
Sbjct  154   FVATEGEDFHLQAGRQRELGFTFSFPVKQTSLCSGTLINWTKGFSIEDALGQDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA AI K QGLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNSDVVAAVILGTGTNAAYVERASAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILEVPTT-LKMRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  393   VVISLCNIIATRGARLSAAGIYGILKKLGRDAP-----------KDGETTQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVG  481



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score =   482 bits (1240),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 253/460 (55%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +V+ +L+  EE CATP+G+LRQV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  34    WGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG++   ++ + ++  IP  L+TG S++LF+FIA +L  
Sbjct  94    QGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELFNFIAEALAR  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQTS+ SG LI WT+GF IED +G++V   L  
Sbjct  154   FVATEGEDFHLPAGRQRELGFTFSFPVKQTSLCSGTLISWTKGFSIEDALGQDVVGELIK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V AL+NDTV TLA G Y + D VAAVI GTGTNA YVERA+AI K QGLL
Sbjct  214   AMERVGLDMNVTALVNDTVGTLAGGRYYNSDVVAAVILGTGTNAAYVERANAIPKWQGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD DS NP +Q  EK+ISGMYLG+I+RRVLL+
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHLLDFDSLNPGEQILEKIISGMYLGEILRRVLLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  334   MAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILEVPTT-LKMRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++V+A++GG
Sbjct  393   VVISLCNIIATRGARLSAAGIYGILKKLGRDAP-----------KDGETTQKSVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT F E +  ++ E+LG+E S  V +  + DGSG+G
Sbjct  442   LFEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVG  481



>sp|Q2KNB5.1|HXK10_ORYSJ RecName: Full=Hexokinase-10; AltName: Full=Hexokinase-7 [Oryza 
sativa Japonica Group]
 gb|AAX68423.1| hexokinase 7 [Oryza sativa Japonica Group]
 gb|AAZ93627.1| hexokinase 10 [Oryza sativa Japonica Group]
Length=504

 Score =   482 bits (1240),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 262/457 (57%), Positives = 344/457 (75%), Gaps = 7/457 (2%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + V+ +LEE CATP   L++VV+++A+EM AGLAS+GGSK++MLLT VD LP+GSE
Sbjct  38    WNRAVAVVRDLEERCATPAELLQRVVNSLAIEMFAGLASDGGSKVRMLLTCVDALPDGSE  97

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG  YA+DLGGT+FRVL+V+LG   S  I   V+ QPIP++L  GTS+DLF+FIAS+LK+
Sbjct  98    EGISYAIDLGGTSFRVLKVELGAG-STIINRKVEHQPIPENLTKGTSDDLFNFIASALKN  156

Query  362   FIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
             FIER+  + E   GR+LGFTFSFPV+QTS+SSG LI+WT+ F IE+ VG++V++CL  A 
Sbjct  157   FIEREGGEVE---GRALGFTFSFPVRQTSISSGTLIRWTKEFSIEEAVGKDVAQCLNEAL  213

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
             +R GL+++V  L+N+TV TLALGHY D+DTVAAVI G GTNACY+ER DAIIK  G +T 
Sbjct  214   ARNGLNMKVNVLVNNTVGTLALGHYYDDDTVAAVIIGAGTNACYIERNDAIIKSLGRVTN  273

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             S   VVN+EWG+F    +  T YD   + ++ N  DQGFEKMISG+YLG+I R V  +M+
Sbjct  274   SERTVVNVEWGSFRPPQIELTPYDICFNNETWNYYDQGFEKMISGVYLGEIARLVFQKMA  333

Query  902   QEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVV  1081
             +E D+FG     L+ PF+L TP +AA+ +DDSP+L EV ++L E L+LPDVPLK RKLV 
Sbjct  334   EESDIFGTAVDGLSTPFVLSTPNLAAIREDDSPDLREVGKILEEHLKLPDVPLKTRKLVA  393

Query  1082  EVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYT  1261
              V D++TRRAARLAAA IV IL+KIG DGT     G  +  +     +RTVVAIEGGL+ 
Sbjct  394   RVSDIITRRAARLAAAAIVAILQKIGCDGT---LCGSTQVRTMRGVRRRTVVAIEGGLFE  450

Query  1262  SYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
              Y+ FREYLNEA+ EILGEE+++ V++ V E+GSG G
Sbjct  451   GYSVFREYLNEALVEILGEEIAATVSLRVMEEGSGTG  487



>gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 326/458 (71%), Gaps = 15/458 (3%)
 Frame = +2

Query  8     KVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEG  187
             K + +++EL+E CATP+ +L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E G
Sbjct  37    KAMEIVKELKEQCATPIAKLKQVGDAMVVEMHAGLASEGGSKLKMLISYVDNLPTGDENG  96

Query  188   TFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFI  367
              FYALDLGGTNFRVLRV LGG+    +  +  + PIP +L+TGTS+ LFD+IA+ L  F+
Sbjct  97    LFYALDLGGTNFRVLRVHLGGKDGRLVNQEFAEVPIPPNLMTGTSDALFDYIAAELAKFV  156

Query  368   ERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAF  541
              ++    +   G  R LGFTFSFPV QTS++SG L++WT+GF I+D VG++V   L  A 
Sbjct  157   AQEDEKFQLPPGKKRELGFTFSFPVTQTSIASGNLVRWTKGFSIDDAVGQDVVVALTKAM  216

Query  542   SRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTT  721
              RKG+ + V+AL+NDTV TLA G Y ++D VAAVI GTGTNA YVERA AI K  G L  
Sbjct  217   ERKGVHMHVSALVNDTVGTLAGGKYFNKDVVAAVILGTGTNAAYVERAQAIPKWHGALPE  276

Query  722   SGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMS  901
             SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVLLRM+
Sbjct  277   SGEMVINMEWGNFRSSHLPLTKYDLALDAESLNPGEQIFEKIISGMYLGEIVRRVLLRMA  336

Query  902   QEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLV  1078
             +E   FG  V  KL +PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK RK+V
Sbjct  337   EEASFFGDAVPPKLRVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILEISNTSLKTRKVV  396

Query  1079  VEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLY  1258
             +E+C++V  R A+LAAAGI+ ILKK+G+D                   ++TV+A++GGLY
Sbjct  397   IELCNIVASRGAQLAAAGILSILKKMGKD------------TVKEGDKQKTVIALDGGLY  444

Query  1259  TSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
               Y+ + + +   + E+LGEEVS ++ I  + DGSGIG
Sbjct  445   EHYSEYSKCMENTLNELLGEEVSKNIEIVHSNDGSGIG  482



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 262/460 (57%), Positives = 322/460 (70%), Gaps = 13/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L++LEE CATP+G+LRQV DAM VEM AGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +R + ++  IP +L+ G+S +LFDFIA++L  
Sbjct  94    TGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELFDFIAAALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  +     GR   LGFTFSFPVKQTS+SSG LIKWT+GF I   VG +V   L  
Sbjct  154   FVASEGEEFHLPVGRQRELGFTFSFPVKQTSISSGTLIKWTKGFAINGTVGEDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GLD+RV AL+NDT+ TLA G Y D D VAAVI GTGTNA YVE A AI K  GLL
Sbjct  214   AMEKQGLDMRVTALVNDTIGTLAGGRYYDNDVVAAVILGTGTNAAYVEHAQAIPKWHGLL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP +Q FEK+ISGMYLG+IVRRVLLR
Sbjct  274   PKSGKMVINMEWGNFRSSHLPITEYDQALDVESLNPGEQIFEKLISGMYLGEIVRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V   L + F+LRTP M+AMH D S +L  V   L +IL + +  LK RK
Sbjct  334   MAEEAALFGDSVPPNLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILGISNTSLKTRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVV+VCD++  R ARLAAAGI+G+LKK  RD                S M+RTV+A++GG
Sbjct  394   LVVKVCDIIASRGARLAAAGILGVLKKQDRDNAA----------RDGSDMQRTVIAMDGG  443

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FR  L   + E+LGEE +  + I +  DGSGIG
Sbjct  444   LYEHYTRFRNCLETTLREMLGEEAAPSIVIKLASDGSGIG  483



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score =   480 bits (1235),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +++E++E C TP+G+L+QV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  35    WAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISYVDNLPSGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTS+ LFD+IA+ L  
Sbjct  95    KGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALFDYIAAELAK  154

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI ++  + E   G  R LGFTFSFPV QTS++SG L++WT+GF I+D VG++V   L  
Sbjct  155   FIAQEGEEFELPPGKQRELGFTFSFPVMQTSIASGTLVRWTKGFSIDDAVGQDVVAELTR  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDTV TLA G Y+ +D VAAVI GTG+NA YVE A AI K  G L
Sbjct  215   AMKRQGLDMRVSALVNDTVGTLAGGKYSYKDVVAAVILGTGSNAAYVEHAQAIPKWHGDL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  +D +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  275   PKSGEMVINMEWGNFRSSHLPLTEYDHAMDNESLNPGEQIFEKLISGMYLGEIVRRVLLK  334

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP ++AMH D S +L  V + L +ILE+ +  L+ RK
Sbjct  335   MAEEAAFFGDIVPPKLKIPFILRTPDLSAMHHDSSSDLILVDKKLKDILEISNASLQTRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R +RLAAAGI+GILKKIGRD    +              ++TV+A++GG
Sbjct  395   VVVELCNIVATRGSRLAAAGILGILKKIGRDTVKDM------------DEQKTVIAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y+ + + L   + E+LGEEVS  ++I    DGSG+G
Sbjct  443   LFEHYSEYSKCLENTLNELLGEEVSKTISIEHANDGSGLG  482



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 331/460 (72%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +++E++E C TP+G+L+QV DAM VEMHAGLASEGGSKLKML++YVD LP+G E
Sbjct  35    WAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISYVDNLPSGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTS+ LFD+IA+ L  
Sbjct  95    KGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALFDYIAAELAK  154

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             FI ++  + E   G  R LGFTFSFPV QTS++SG L++WT+GF I+D VG++V   L  
Sbjct  155   FIAQEGQEFELPPGKQRELGFTFSFPVMQTSIASGTLVRWTKGFSIDDAVGQDVVAELTR  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+RV+AL+NDTV TLA G Y+ +D VAAVI GTG+NA YVE A AI K  G L
Sbjct  215   AMKRQGLDMRVSALVNDTVGTLAGGKYSYKDVVAAVILGTGSNAAYVEHAQAIPKWHGDL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  +D +S NP +Q FEK+ISGMYLG+IVRRVLL+
Sbjct  275   PKSGEMVINMEWGNFRSSHLPLTEYDHAMDNESLNPGEQIFEKLISGMYLGEIVRRVLLK  334

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+LRTP ++AMH D S +L  V + L +ILE+ +  L+ RK
Sbjct  335   MAEEAAFFGDIVPPKLKIPFILRTPDLSAMHHDTSSDLIVVDKKLKDILEVSNASLQTRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R +RLAAAGI+GILKKIGRD    +              ++TV+A++GG
Sbjct  395   VVVELCNIVATRGSRLAAAGILGILKKIGRDTVKDM------------DEQKTVIAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y+ + + L   + E+LGEEVS  ++I    DGSG+G
Sbjct  443   LFEHYSEYSKCLENTLNELLGEEVSKTISIEHANDGSGLG  482



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 322/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L   EE CATP+ +LRQV DA+ VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV LGG+    ++ + ++  IP HL+TG S++LF FIA +L  
Sbjct  95    KGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELFSFIAEALAK  154

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D   + GR   LGFTFSFPV+QTS+ SG LIKWT+GF IED VG++V   L  
Sbjct  155   FVATEGEDFHPAPGRQRELGFTFSFPVRQTSLVSGTLIKWTKGFSIEDTVGQDVVGELNK  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ VAAL+NDTV TLA G Y   +  AAVI GTGTNA YVERA AI K  GLL
Sbjct  215   AMERVGLDMCVAALVNDTVGTLAGGRYYRPEVTAAVILGTGTNAAYVERAHAIPKWHGLL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T +D  LD +S NP +Q FEK+ISGMYLG+I+RRVLL+
Sbjct  275   PKSGEMVINMEWGNFRSSHLPLTEFDHSLDFESLNPGEQIFEKIISGMYLGEILRRVLLK  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF++RTP M+AMH D SP+L  V   L +ILE+P   LK+RK
Sbjct  335   MAEEAAFFGDTVPPKLRIPFIIRTPHMSAMHCDTSPDLKVVGSKLKDILEVPTTSLKMRK  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +V+ +C+++  R ARL+AAGI GILKK+GRD                   +++VVA++GG
Sbjct  395   VVISLCNIIASRGARLSAAGIYGILKKLGRD------------VPKEGEQQKSVVAMDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y+ F   +   + E+LGEEVS ++ I  + DGSGIG
Sbjct  443   LFEHYSQFSASMESTLKELLGEEVSDNIEIIHSNDGSGIG  482



>gb|ABR18277.1| unknown [Picea sitchensis]
Length=551

 Score =   481 bits (1239),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 326/461 (71%), Gaps = 16/461 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKL-KMLLTYVDKLPNGS  178
             W++   +++ELE  C+TP+ RLR+VVDAMA E+  GLASE  S L KM+++YVD LP G 
Sbjct  88    WKRAEGIVKELERQCSTPISRLREVVDAMAEELRVGLASEAKSNLLKMVISYVDTLPTGD  147

Query  179   EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLK  358
             E+G FYALDLGGTNFRVLRVQLGG+    I  +  +  IP +L+ GT ++LFD+IAS L 
Sbjct  148   EKGLFYALDLGGTNFRVLRVQLGGKEGRVIDKEFTEVTIPANLMVGTEKELFDYIASELA  207

Query  359   DFIERDSSDS--EHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQ  532
              F+  +  +   E  + R LGFTFSFPV QT+++SG LIKW++GF + +MVG++V   L+
Sbjct  208   KFVTSEGKNFYLEPGRQRELGFTFSFPVHQTAIASGTLIKWSKGFSVSEMVGKDVVVALK  267

Query  533   AAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGL  712
              A  R+GLD+ V+AL+NDTV TLA G Y DED + AVI GTGTNACYVE ADAI KCQGL
Sbjct  268   EAMERQGLDMHVSALVNDTVGTLAGGRYRDEDVMIAVILGTGTNACYVEHADAIPKCQGL  327

Query  713   LTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLL  892
             L  SG MV+N EWGNFWSSHLP T +D  LDA+S NP D  FEK+ISGMYLG+IVRR+LL
Sbjct  328   LPKSGYMVINTEWGNFWSSHLPVTEFDKALDAESINPGDHIFEKLISGMYLGEIVRRLLL  387

Query  893   RMSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLR  1069
             +++++  +FG  + S+L  P++L TP ++AMH D SP+L  V   L  +  +  +PL+ R
Sbjct  388   KLAEDAALFGDNIPSRLREPYVLTTPNISAMHQDTSPDLKVVENTLKNVFGISHIPLRTR  447

Query  1070  KLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEG  1249
             KLVVE+C +V  RAARLA AGIVGILKK+GRD  G                 RTVVAI+G
Sbjct  448   KLVVELCGIVAVRAARLAGAGIVGILKKLGRDVIGDTG------------KMRTVVAIDG  495

Query  1250  GLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GLY  Y+ FR+ +  AV E+LG EVS  V + ++ DGSGIG
Sbjct  496   GLYEHYSFFRQNMQSAVKELLGSEVSETVVLELSSDGSGIG  536



>ref|XP_001784630.1| hexokinase protein HXK2 [Physcomitrella patens]
 gb|EDQ50562.1| hexokinase protein HXK2 [Physcomitrella patens]
Length=521

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 321/460 (70%), Gaps = 17/460 (4%)
 Frame = +2

Query  41    ACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTN  220
             AC T + RLR VVDAMA EMHAGL SEGGS LKML TY+D+LP+G+E G +YA+DLGGTN
Sbjct  49    ACDTSLLRLRMVVDAMAAEMHAGLVSEGGSTLKMLPTYIDRLPDGNERGLYYAVDLGGTN  108

Query  221   FRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSE-HS  397
             FRVLRVQLGG     I  + ++ PIP H++ GTS+ LFDFIA  L  F+ R+  D   H+
Sbjct  109   FRVLRVQLGGLEGRVINQEYEEVPIPPHVMLGTSKQLFDFIAKELVSFVAREGQDFRLHA  168

Query  398   -QGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAA  574
              Q R +GFTFSFPV QT+V+SG L++WT+GF++ D +G++V   LQ +    G  +R++A
Sbjct  169   GQQREIGFTFSFPVDQTAVNSGKLLQWTKGFKVNDAIGQDVVAALQRSIESLGHKMRISA  228

Query  575   LINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWG  754
             LINDTV TLA G Y + D +  VI GTGTNACYVERA+A+ K  G +  SG MV+NMEWG
Sbjct  229   LINDTVGTLAGGRYWNNDVMIGVILGTGTNACYVERAEAVSKWGGEIPKSGQMVINMEWG  288

Query  755   NFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGP-VS  931
             NFWSSHLPRT  D  LD +S NP + GFEKMISGMYLGD VRRVL+RM+Q+  +FGP V 
Sbjct  289   NFWSSHLPRTYVDESLDNESLNPGEYGFEKMISGMYLGDCVRRVLVRMAQQAGIFGPRVP  348

Query  932   SKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrra  1111
              +L   F L+TP M+ MH D++ +L  V  +L  + ++ +  L +RK+VVEVCDVV +R 
Sbjct  349   HRLLEAFSLKTPDMSKMHQDNNNDLRVVGEILNSVYQIQNTTLGIRKIVVEVCDVVCKRG  408

Query  1112  arlaaaGIVGILKKIGRDGTGG-------------IAsgklrsgssssrmkrTVVAIEGG  1252
             ARLA AGIVGILKKIGRDG+               +           +   +TVVAI+GG
Sbjct  409   ARLAGAGIVGILKKIGRDGSAANGVIKRNLFEQSDMNGYHDDDPMQYTSDVKTVVAIDGG  468

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT FREY+ +AV E+LG E S +V+I +++DGSGIG
Sbjct  469   LYEHYTKFREYMQDAVFELLG-EASKNVSIQLSKDGSGIG  507



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score =   478 bits (1229),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 329/460 (72%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +L+E EE CATP  +L+QV DAM VEMHAGLAS+GGSKLKML+++VD LP G+E
Sbjct  34    WGKAIAILKEFEEKCATPTLKLKQVADAMTVEMHAGLASDGGSKLKMLISFVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRVQLGG +   +  +  +  IP +L+ GTS +LFD+IA+ L  
Sbjct  94    EGLFYALDLGGTNFRVLRVQLGG-KDGVVGQEFTEVSIPPNLMVGTSHELFDYIAAELSK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +S D +   GR   LGFTFSFPVKQTS+SSG LI WT+GF+I+D VG++V   L+ 
Sbjct  153   FVNEESEDFKVPPGRKRELGFTFSFPVKQTSISSGDLINWTKGFKIDDAVGQDVVAELRK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+GLD+ + AL+NDTV TLA G + ++D +AAVI GTGTNA YVE A AI K  G L
Sbjct  213   AIERQGLDMNITALVNDTVGTLAGGRHTNKDVIAAVILGTGTNAAYVESAQAIPKWHGDL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LDA+S NP +Q FEK+ISGMYLG+IVRRVL +
Sbjct  273   PKSGEMVINMEWGNFRSSHLPLTEYDYSLDAESLNPGEQTFEKIISGMYLGEIVRRVLYK  332

Query  896   MSQEFDVFGP-VSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF+LRTP M+AMH D S +L+ V   L EILE+ D  L++RK
Sbjct  333   MAEEAWFFGETVPSKLKVPFILRTPDMSAMHHDSSADLNVVKTKLKEILEISDTSLEVRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +C++V  R ARL+AAGIVGILKK+G+D              ++   ++ V+A++GG
Sbjct  393   VVVALCNIVATRGARLSAAGIVGILKKLGKD------------TITNGEGQKNVIAMDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT +R+ L   + E+LGE VS  V +  + DGSG G
Sbjct  441   LYEHYTEYRKCLENTLKELLGEGVSDSVIVEHSNDGSGTG  480



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score =   478 bits (1229),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 325/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +++++EE CATP+G+L+Q+ DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  35    WAKAIEIVKDMEEKCATPIGKLKQIADAMVVEMHAGLASEGGSKLKMLISYVDNLPTGDE  94

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +  +  + PIP +L+TGTSE LFD+IA+ L  
Sbjct  95    NGLFYALDLGGTNFRVLRVQLGGKDGRLVNQEFAEVPIPPNLMTGTSEVLFDYIAAELAK  154

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  +     G  R LGFTFSFPV QTS++SG L++WT+GF I+D VG++V   L  
Sbjct  155   FVAQEGEELRLPPGKMRELGFTFSFPVIQTSIASGTLVRWTKGFSIDDTVGQDVVMELTK  214

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R+G+ + V+AL+NDTV TLA G Y  +D +AAVI GTGTNA YVE A AI K  G L
Sbjct  215   AMERQGVHMHVSALVNDTVGTLAGGRYFHKDVIAAVILGTGTNAAYVESAQAIPKWHGAL  274

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S N  +Q FEK+ISGMYLG+IVRRVLL 
Sbjct  275   PESGEMVINMEWGNFRSSHLPLTDYDLALDVESLNAGEQIFEKVISGMYLGEIVRRVLLN  334

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V SKL +PF+LRTP M+AMH D S +L  V   L +ILE+P+  LK  +
Sbjct  335   MAEEAAFFGDTVPSKLKIPFILRTPDMSAMHHDTSSDLKVVGNKLKDILEIPNTSLKAIR  394

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVE+C++V  R A+LAAAGI+GILKK+G+D                    RTV+A++GG
Sbjct  395   VVVELCNIVATRGAQLAAAGILGILKKMGKD------------TVKEGDKNRTVIALDGG  442

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  Y+ + + + + + E+LGEEVS  + I  + DGSGIG
Sbjct  443   LYEHYSEYSKCMEDTLNELLGEEVSKSIEIVHSNDGSGIG  482



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score =   477 bits (1228),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 327/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +++ELEE C TP  +LRQV DAMAVEMHAGLASEGGSKLK++++YVD LP G+E
Sbjct  33    WARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKVIISYVDNLPTGNE  92

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLRV+LGG+    +  +  +  IP++L+ GTS+ LFD+IA+ L  
Sbjct  93    KGLFYALDLGGTNFRVLRVRLGGKGRGIVSQEFIEVSIPENLMVGTSDALFDYIAAELAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D +   GR   LGFTFSFPV Q+S++SG L+KWT+GF I+D VG++V   L  
Sbjct  153   FVAKEGQDHQPPPGRQRELGFTFSFPVLQSSINSGTLLKWTKGFSIDDAVGQDVVAALSK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+ V+AL+NDT+ TLA G Y ++D VAAVI GTGTNA YVERA AI K  GLL
Sbjct  213   AIERTGLDMCVSALVNDTIGTLAGGRYINQDVVAAVILGTGTNAAYVERAQAIPKWHGLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF S+HLP T YD  LD +S NP DQ FEK+ISGMYLG+IVRRVL R
Sbjct  273   PKSGEMVINMEWGNFKSAHLPLTEYDHSLDTESLNPGDQIFEKIISGMYLGEIVRRVLCR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  +  KL +PF LRTP M+AMH D S +L  V   L  +LE+ +  LK+RK
Sbjct  333   IAEEASLFGDTIPPKLKVPFNLRTPDMSAMHQDASSDLRVVREKLKNVLEISNTSLKVRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C++V  R ARLAAAG++G+LKK+GRD                   K+TVVA++GG
Sbjct  393   VIVELCNIVATRGARLAAAGVLGVLKKLGRDAV------------KDGENKKTVVALDGG  440

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT + + +   + E+LGEEV+  V I  + DGSGIG
Sbjct  441   LYEHYTEYSKCMENTLRELLGEEVAETVVIEHSNDGSGIG  480



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score =   477 bits (1227),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 318/446 (71%), Gaps = 17/446 (4%)
 Frame = +2

Query  44    CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNF  223
             CATP+G L++V +AMA+EM AGLASEG SKLKMLL+YVD LP+G E+G FYALDLGGTNF
Sbjct  44    CATPIGLLKEVANAMAMEMQAGLASEGDSKLKMLLSYVDSLPSGDEKGLFYALDLGGTNF  103

Query  224   RVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQG  403
             RVLRVQLGG+    ++ +  +  IP HL+ G S +LF+FIA+ L  F+  +  D   S G
Sbjct  104   RVLRVQLGGKERHVVKRESTEVSIPPHLMVGNSAELFEFIAAELAKFVASEGDDFHLSVG  163

Query  404   --RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAAL  577
               R +GFTFSFPVKQ+S++SG L+KWT+GF I++MVG++V   L  A  ++GLD+RVAAL
Sbjct  164   SQREIGFTFSFPVKQSSITSGTLVKWTKGFSIDEMVGKDVVVELTKAIEKQGLDMRVAAL  223

Query  578   INDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGN  757
             +ND V TLA G Y D+D V AVI GTGTNA YVE A AI K  GLL  SG MV+NMEWGN
Sbjct  224   VNDAVGTLAGGRYYDKDVVVAVILGTGTNAAYVEHAHAIPKWNGLLPKSGDMVINMEWGN  283

Query  758   FWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLRMSQEFDVFG-PVSS  934
             FWS+HLP T YD DLD +S NP +Q FEK+ISGMYLG+IVRRVL+++++E  +FG  V S
Sbjct  284   FWSAHLPITEYDQDLDFESLNPGEQIFEKLISGMYLGEIVRRVLVKLAEETSLFGDTVPS  343

Query  935   KLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraa  1114
             KL  PF+LRTP M+AMH D + +L  V   L +IL +    ++ RKLVVE+CD++ +R A
Sbjct  344   KLRTPFILRTPEMSAMHHDATSDLRIVGNKLNDILGIASTSMETRKLVVEICDIIAKRGA  403

Query  1115  rlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNE  1294
             RLAAAG+VG+LKK GRD   G               +RTVVA++GGL+  Y  F E L+ 
Sbjct  404   RLAAAGVVGVLKKQGRDAACG-------------GKQRTVVAMDGGLFEHYKIFSECLDG  450

Query  1295  AVAEILGEEVSSHVTITVTEDGSGIG  1372
              + E+LG E S  V I +  DGSGIG
Sbjct  451   TLRELLG-EASQSVVIKLANDGSGIG  475



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score =   476 bits (1226),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 320/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE   TP+ +LRQV DAM VEMHAGLASEGGSKL ML+++VD LP G E
Sbjct  34    WSRAIAILKEFEEKSGTPLAKLRQVADAMDVEMHAGLASEGGSKLNMLISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG +YALDLGGTNFRVLRV LGG+    I  +  +  IP  L+TGTSE LFDFIAS+L  
Sbjct  94    EGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFAEVSIPPQLMTGTSEALFDFIASALAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +        GR   LGFTFSFPV+QTS+SSG LIKWT+GF IED VG +V   L  
Sbjct  154   FVAAEPEGFHPPPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFNIEDTVGEDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             +  + GLD+R+AAL+NDT+ TLA G + ++D +AAVI GTGTNA YVERA AI K  GL+
Sbjct  214   SMEKIGLDMRIAALVNDTIGTLAGGRFYNQDVIAAVILGTGTNAAYVERAHAIPKWHGLI  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SS+L  T YD  LDA+S NP +Q FEK+ISGMYLG+IVRR LL+
Sbjct  274   PKSGDMVINMEWGNFRSSYLSLTEYDLALDAESLNPGEQIFEKLISGMYLGEIVRRALLK  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E D FG  V  KL +PF+LRTP M+AMH D + +L  V   L +ILE+ +  LK+RK
Sbjct  334   MAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTTSDLKVVGNKLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VV +CD+V  R ARLAAAGI+GILKK+GRD                   +++V+A++GG
Sbjct  394   IVVALCDIVATRGARLAAAGILGILKKLGRD------------TVKVGEKQKSVIALDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  Y  FRE L   + E+LGEE +  + I    DGSGIG
Sbjct  442   LFEHYAKFRECLESTLKELLGEEAAETIVIEHANDGSGIG  481



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 326/460 (71%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K + +++E EE CATP+ +LRQV DAM VEMHAGLASEGGSKLKML++YVD LP G+E
Sbjct  34    WEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDNLPTGNE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRVLR+ LGG+    +    ++  IP+ L+TGTS+ LFDFI + L  
Sbjct  94    KGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFIVAELAK  153

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D E   GR   LGFTFSFPV Q+S+SSG L++WT+GF IE+ VGR+V   L  
Sbjct  154   FVAQEGMDFELRPGRQRELGFTFSFPVLQSSISSGTLVRWTKGFSIEETVGRDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  ++GL++RV+A +ND V TLA G + + D VAAVI GTG+NA YVERA AI K  GL 
Sbjct  214   AMEKQGLNMRVSAFVNDPVGTLAGGRFTNNDVVAAVILGTGSNAAYVERAHAIPKWHGLP  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+N EWGNF SSHLP T YD +LDA++ +P +Q +EK+ SGMYLG+IVR+VL R
Sbjct  274   LKSGEMVINTEWGNFKSSHLPLTEYDHELDAETLHPGEQIYEKVTSGMYLGEIVRKVLRR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL +PF+L TP+++AMH D SP+L  VA  L +ILE+ +  LK+RK
Sbjct  334   MAEEAAFFGDTVPPKLKVPFILGTPIISAMHQDTSPDLKVVANRLKDILEISNTSLKMRK  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++VE+C++V  R ARL+AAGI+ ILKK+GRD                   +RTV+A++GG
Sbjct  394   VIVELCNIVATRGARLSAAGILSILKKMGRD------------TMREGEKQRTVIAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT +R  L   + E++G+EVS  V + +  DGSGIG
Sbjct  442   LYEHYTEYRNCLENTLNELVGKEVSETVVLELANDGSGIG  481



>gb|AFW83994.1| hypothetical protein ZEAMMB73_545591 [Zea mays]
Length=732

 Score =   483 bits (1243),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 317/419 (76%), Gaps = 10/419 (2%)
 Frame = +2

Query  107   GLASEGGSKLKMLLTYVDKLPNGSEEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQ  286
             G    G   L M +  +  +   +EEGT+Y++DLGGTNFRVLRV++G   S   R  V+ 
Sbjct  160   GNHCSGRHHLLMRIAKLVGIEKRNEEGTYYSIDLGGTNFRVLRVEVGAG-SVVTRRKVEL  218

Query  287   QPIPQHLLTGTSEDLFDFIASSLKDFIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGIL  466
              PIP+ L  GT E+LF+F+A +LK+F+E +  + E    R+LGFTFSFPV+QTSVSSG L
Sbjct  219   -PIPEELTKGTIEELFNFVAMTLKEFVETEDGNDEQ---RALGFTFSFPVRQTSVSSGSL  274

Query  467   IKWTQGFEIEDMVGRNVSECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVI  646
             I+W +GF IED VG++V++CL  A +R GL++RV AL+NDTV TLALGHY+DEDTVAAVI
Sbjct  275   IRWNKGFLIEDAVGKDVAQCLNEALARNGLNVRVTALVNDTVGTLALGHYHDEDTVAAVI  334

Query  647   FGTGTNACYVERADAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPN  826
              G GTNACY+ER DAIIKCQGLLT SG MVVNMEWG+FWSSHLPRT YD  LD ++ N N
Sbjct  335   IGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGSFWSSHLPRTPYDISLDDETQNRN  394

Query  827   DQGFEKMISGMYLGDIVRRVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPEL  1006
             DQGFEKM+SG+YLG+I R VL RM+ E D FG  +  L  PF L TPL+AA+  DDSP+L
Sbjct  395   DQGFEKMVSGIYLGEIARLVLHRMALESDFFGDAADNLCTPFTLSTPLLAAIRKDDSPDL  454

Query  1007  SEVARVLGEILELPDVPLKLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAs  1186
             SEV ++L E L++PD PLK R+LVV+VCD+VTRRAARLAAAGIVGILKK+GRDG+G    
Sbjct  455   SEVRKILQEHLKIPDTPLKTRRLVVKVCDIVTRRAARLAAAGIVGILKKLGRDGSG----  510

Query  1187  gklrsgssssrmkrTVVAIEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGS  1363
                 SG +  +M+RTVVAIEGGLY  Y  FREYL+EA+ EILGEEV+  V + VT DGS
Sbjct  511   -VASSGRTGGQMRRTVVAIEGGLYEGYPVFREYLDEALVEILGEEVARTVALRVTVDGS  568


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  44   CATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNG  175
            CATP  RLRQVVDAM VEMHAGLAS+GGSKLKMLLT+VD LP G
Sbjct  48   CATPPPRLRQVVDAMVVEMHAGLASDGGSKLKMLLTFVDALPAG  91



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score =   475 bits (1222),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 317/462 (69%), Gaps = 19/462 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKML+TYVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    I  +  +  IP +L+ GTSE+LFD+IA+ L  
Sbjct  94    AGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEELFDYIAAELAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +    +   G  R LGFTFSFPV QTS++SG +++WT+GF I+D VG++V   L  
Sbjct  154   FVAEEEEKFQQPPGKQRELGFTFSFPVMQTSINSGTIMRWTKGFSIDDAVGQDVVGELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV+AL+NDTV TLA G Y   D   AVI GTGTNA YVER  AI K  G +
Sbjct  214   AMKRKGVDMRVSALVNDTVGTLAGGKYTHNDVAVAVILGTGTNAAYVERVQAIPKWHGPM  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP DQ FEKM SGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTQYDHALDTNSLNPGDQIFEKMTSGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL  PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK R+
Sbjct  334   MAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDTSSDLRVVGDKLKDILEISNTSLKTRR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDG--TGGIAsgklrsgssssrmkrTVVAIE  1246
             LVVE+C++V  R ARLAAAG++GILKK+GRD    GG               ++ VVA++
Sbjct  394   LVVELCNIVATRGARLAAAGVLGILKKMGRDTPRQGG--------------PQKMVVAMD  439

Query  1247  GGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GGLY  Y  +R  L   + E+LG+E+++ +    + DGSGIG
Sbjct  440   GGLYEHYAEYRTCLENTLKELLGDELATSIVFEHSNDGSGIG  481



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score =   474 bits (1221),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 319/462 (69%), Gaps = 19/462 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKML+TYVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTSE LFD+IA+ L  
Sbjct  94    AGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFDYIAAELAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +    +   G  R LGFTFSFPV QTS++SG +++WT+GF I+D VG++V   L  
Sbjct  154   FVNEEGEKFQQPPGKQRELGFTFSFPVMQTSINSGTIMRWTKGFSIDDAVGQDVVGELAK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV+AL+NDTV TLA G Y   D   AVI GTGTNA YVER  AI K  G +
Sbjct  214   AMKRKGVDMRVSALVNDTVGTLAGGKYTHNDVAVAVILGTGTNAAYVERVQAIPKWHGPV  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP DQ FEKM SGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTQYDHALDTNSLNPGDQIFEKMTSGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL  PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK R+
Sbjct  334   VAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDASSDLRVVGDKLKDILEISNTSLKTRR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDG--TGGIAsgklrsgssssrmkrTVVAIE  1246
             LV+E+C++V  R ARLAAAG++GILKK+GRD    GG+              ++TVVA++
Sbjct  394   LVIELCNIVATRGARLAAAGVLGILKKMGRDTPRQGGL--------------EKTVVAMD  439

Query  1247  GGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GGLY  YT +R  L   + E+LG+E+++ +    + DGSGIG
Sbjct  440   GGLYEHYTEYRTCLENTLKELLGDELATSIVFEHSNDGSGIG  481



>gb|AAT01343.1| putative hexokinase [Oryza sativa Japonica Group]
Length=511

 Score =   475 bits (1222),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 262/464 (56%), Positives = 344/464 (74%), Gaps = 14/464 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS-  178
             W + + V+ +LEE CATP   L++VV+++A+EM AGLAS+GGSK++MLLT VD LP+GS 
Sbjct  38    WNRAVAVVRDLEERCATPAELLQRVVNSLAIEMFAGLASDGGSKVRMLLTCVDALPDGSS  97

Query  179   ------EEGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDF  340
                   EEG  YA+DLGGT+FRVL+V+LG   S  I   V+ QPIP++L  GTS+DLF+F
Sbjct  98    HDMTRSEEGISYAIDLGGTSFRVLKVELGAG-STIINRKVEHQPIPENLTKGTSDDLFNF  156

Query  341   IASSLKDFIERDSSDSEHSQGRSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVS  520
             IAS+LK+FIER+  + E   GR+LGFTFSFPV+QTS+SSG LI+WT+ F IE+ VG++V+
Sbjct  157   IASALKNFIEREGGEVE---GRALGFTFSFPVRQTSISSGTLIRWTKEFSIEEAVGKDVA  213

Query  521   ECLQAAFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIK  700
             +CL  A +R GL+++V  L+N+TV TLALGHY D+DTVAAVI G GTNACY+ER DAIIK
Sbjct  214   QCLNEALARNGLNMKVNVLVNNTVGTLALGHYYDDDTVAAVIIGAGTNACYIERNDAIIK  273

Query  701   CQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVR  880
               G +T S   VVN+EWG+F    +  T YD   + ++ N  DQGFEKMISG+YLG+I R
Sbjct  274   SLGRVTNSERTVVNVEWGSFRPPQIELTPYDICFNNETWNYYDQGFEKMISGVYLGEIAR  333

Query  881   RVLLRMSQEFDVFGPVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPL  1060
              V  +M++E D+FG     L+ PF+L TP +AA+ +DDSP+L EV ++L E L+LPDVPL
Sbjct  334   LVFQKMAEESDIFGTAVDGLSTPFVLSTPNLAAIREDDSPDLREVGKILEEHLKLPDVPL  393

Query  1061  KLRKLVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVA  1240
             K RKLV  V D++TRRAARLAAA IV IL+KIG DGT     G  +  +     +RTVVA
Sbjct  394   KTRKLVARVSDIITRRAARLAAAAIVAILQKIGCDGT---LCGSTQVRTMRGVRRRTVVA  450

Query  1241  IEGGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             IEGGL+  Y+ FREYLNEA+ EILGEE+++ V++ V E+GSG G
Sbjct  451   IEGGLFEGYSVFREYLNEALVEILGEEIAATVSLRVMEEGSGTG  494



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score =   474 bits (1220),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 315/460 (68%), Gaps = 24/460 (5%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K   +  ELE+ C TP  +LRQV DAMAVEMHAG+AS+GGSKLKML+++VD LP G E
Sbjct  34    WAKAEAIFRELEDKCGTPTAKLRQVADAMAVEMHAGVASDGGSKLKMLISFVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RVQLGG    TI+ + +Q  IP H + G+S +LFDFIA  +  
Sbjct  94    KGLFYALDLGGTNFRVMRVQLGG----TIKQECEQVSIPPHFMVGSSHELFDFIAGVVAK  149

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+ ++  D     GR   LGFTFSFPV+Q+S++SG LIKWT+GF IED VG +V   L  
Sbjct  150   FVAKEGEDFHLPPGRQRELGFTFSFPVRQSSLASGTLIKWTKGFFIEDAVGEDVVGELTK  209

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  + GLD+RV ALINDTV TLA G Y D D VAAVI GTGTNA YVERA AI K +G L
Sbjct  210   AMEKVGLDMRVTALINDTVGTLARGRYTDPDVVAAVILGTGTNAAYVERAQAIPKLEGDL  269

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF  SHLP T YD  LD +S NP +Q FEK+ISGMYLG+IVRRVLLR
Sbjct  270   PKSGEMVINMEWGNFRCSHLPLTEYDQSLDDESLNPGEQIFEKIISGMYLGEIVRRVLLR  329

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  +  KL + F+LRTP M+AMH D S +L  V + L +ILE+    LK+R+
Sbjct  330   MAEEASFFGDSIPPKLKISFILRTPDMSAMHHDTSSDLKVVGKKLKDILEVTSSSLKMRR  389

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             +VVEVCDVV  R ARLA AGIVGILKK+ R                    +R+V+A++G 
Sbjct  390   MVVEVCDVVASRGARLATAGIVGILKKLERG-----------------EKERSVIAVDGA  432

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR  +   + E+LGE  S  V +  + DGSGIG
Sbjct  433   LFVHYTEFRNCMKSTLKELLGEAASDRVILEHSNDGSGIG  472



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score =   474 bits (1221),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 319/462 (69%), Gaps = 19/462 (4%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKML+TYVD LP G E
Sbjct  34    WARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
              G FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTSE LFD+IA+ L  
Sbjct  94    AGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFDYIAAELAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +    +   G  R LGFTFSFPV QTS++SG +++WT+GF I+D VG++V   L  
Sbjct  154   FVNEEGEKFQQPPGKQRELGFTFSFPVMQTSINSGTIMRWTKGFSIDDAVGQDVVGELAK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV+AL+NDTV TLA G Y   D   AVI GTGTNA YVER  AI K  G +
Sbjct  214   AMKRKGVDMRVSALVNDTVGTLAGGKYTHNDVAVAVILGTGTNAAYVERVQAIPKWHGPV  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  LD +S NP DQ FEKM SGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTQYDHALDTNSLNPGDQIFEKMTSGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             +++E  +FG  V  KL  PF+LRTP M+AMH D S +L  V   L +ILE+ +  LK R+
Sbjct  334   VAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDASSDLRVVGDKLKDILEISNTSLKTRR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDG--TGGIAsgklrsgssssrmkrTVVAIE  1246
             LV+E+C++V  R ARLAAAG++GILKK+GRD    GG+              ++TVVA++
Sbjct  394   LVIELCNIVATRGARLAAAGVLGILKKMGRDTPRQGGL--------------EKTVVAMD  439

Query  1247  GGLYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             GGLY  YT +R  L   + E+LG+E+++ +    + DGSGIG
Sbjct  440   GGLYEHYTEYRMCLENTLKELLGDELATSIVFEHSNDGSGIG  481



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score =   474 bits (1219),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 320/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W + + +L+E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARAMAILKEFEEKCRTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTSE LFD+IA+ L  
Sbjct  94    EGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFDYIAAELAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +        G  R LGFTFSFP+ QTS++SG LI+WT+GF I+D VG++V   L  
Sbjct  154   FVAEEEERFHQPPGKQRELGFTFSFPIMQTSINSGTLIRWTKGFSIDDTVGQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV+AL+NDTV TLA G ++++D   AVI GTGTNA YVERA AI K  G L
Sbjct  214   AMQRKGIDMRVSALVNDTVGTLAGGRFSNKDVCIAVILGTGTNAAYVERAQAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  +D DS NP +Q FEK+ SGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHAMDTDSLNPGEQIFEKICSGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E  +FG  V  KL   F+LRTP M+AMH D S +L  V   L +ILE+ +  LK R+
Sbjct  334   MAEEAGIFGDEVPPKLKNQFILRTPEMSAMHHDTSSDLRVVGDKLKDILEISNTSLKTRR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVVE+C++V  R ARLAAAG++GI+KK+GRD                S  ++ VVA++GG
Sbjct  394   LVVELCNIVATRGARLAAAGVLGIVKKMGRD------------TPRESGQEKIVVAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT +R+ L   + E+LGEE+++ +      DGSGIG
Sbjct  442   LYEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGIG  481



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score =   473 bits (1218),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 319/460 (69%), Gaps = 15/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W +   +L+E EE C TP  +L+QV DAM VEMHAGLASEGGSKLKML++YVD LP G E
Sbjct  34    WARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             EG FYALDLGGTNFRVLRVQLGG+    +  +  +  IP +L+ GTSE LFD+IA+ L  
Sbjct  94    EGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALFDYIAAELAK  153

Query  362   FIERDSSDSEHSQG--RSLGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +        G  R LGFTFSFP+ QTS++SG LI+WT+GF I+D VG++V   L  
Sbjct  154   FVAEEEEKFHQPPGKQRELGFTFSFPIMQTSINSGTLIRWTKGFSIDDTVGQDVVAELTK  213

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  RKG+D+RV+AL+NDTV TLA G ++++D   AVI GTGTNA YVERA AI K  G L
Sbjct  214   AMQRKGVDMRVSALVNDTVGTLAGGRFSNKDVSIAVILGTGTNAAYVERAQAIPKWHGPL  273

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  +D DS NP +Q FEK+ SGMYLG+I+RRVLLR
Sbjct  274   PKSGEMVINMEWGNFRSSHLPLTEYDHAMDTDSLNPGEQIFEKICSGMYLGEILRRVLLR  333

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             MS+E  +FG  V  KL   F+LRTP M+AMH D S +L  V   L +ILE+ +  LK R+
Sbjct  334   MSEEAAIFGDEVPPKLKNQFILRTPEMSAMHHDTSSDLRVVGDKLKDILEISNTSLKTRR  393

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             LVVE+C++V  R ARLAAAG++GI+KK+GRD                S  ++ VVA++GG
Sbjct  394   LVVELCNIVATRGARLAAAGVLGIVKKMGRD------------TPRESGQEKIVVAMDGG  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             LY  YT +R+ L   + E+LGEE+++ +      DGSGIG
Sbjct  442   LYEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGIG  481



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 321/460 (70%), Gaps = 16/460 (3%)
 Frame = +2

Query  2     WRKVLRVleeleeACATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGSE  181
             W K L +LEELEE CAT   +L+Q+ DAM VEMHAGLASEGGSKLKML+TYVD LP G E
Sbjct  34    WGKALEILEELEENCATSTWKLKQIADAMTVEMHAGLASEGGSKLKMLITYVDNLPTGEE  93

Query  182   EGTFYALDLGGTNFRVLRVQLGGQRSATIRHDVQQQPIPQHLLTGTSEDLFDFIASSLKD  361
             +G FYALDLGGTNFRV+RV  G      +  +V    IP HL+ GTS+ LFDFIAS+L  
Sbjct  94    KGVFYALDLGGTNFRVMRVHFGEAEEQIVNEEVHTS-IPLHLMVGTSDALFDFIASTLAK  152

Query  362   FIERDSSDSEHSQGRS--LGFTFSFPVKQTSVSSGILIKWTQGFEIEDMVGRNVSECLQA  535
             F+  +  D     GR   LGFTFSFPVKQ S++SG LIKWT+GF IED +G+++   L  
Sbjct  153   FVAEEGEDVHLPAGRQRELGFTFSFPVKQLSIASGTLIKWTKGFSIEDAIGQDIVGELTK  212

Query  536   AFSRKGLDIRVAALINDTVATLALGHYNDEDTVAAVIFGTGTNACYVERADAIIKCQGLL  715
             A  R GLD+RV AL+NDTV TLA  HY++ D VAAVI GTGTNA YVERA+AI K Q LL
Sbjct  213   ALERIGLDMRVTALVNDTVGTLARAHYDNPDVVAAVILGTGTNAAYVERANAIPKWQDLL  272

Query  716   TTSGSMVVNMEWGNFWSSHLPRTSYDSDLDADSPNPNDQGFEKMISGMYLGDIVRRVLLR  895
               SG MV+NMEWGNF SSHLP T YD  L+A+S NP +Q FEKMISGMYLG+IVR +LLR
Sbjct  273   PNSGEMVINMEWGNFRSSHLPLTEYDESLNAESLNPGEQIFEKMISGMYLGEIVRIILLR  332

Query  896   MSQEFDVFG-PVSSKLAMPFLLRTPLMAAMHDDDSPELSEVARVLGEILELPDVPLKLRK  1072
             M++E   FG  V  KL  PF+LR+P M+AMH DDS +L  V   L ++LE+P+  LK+RK
Sbjct  333   MAEEAAFFGDTVPPKLRTPFILRSPDMSAMHHDDSSDLKVVDSKLRDVLEIPNSSLKIRK  392

Query  1073  LVVEVCDVVTrraarlaaaGIVGILKKIGRDGTGGIAsgklrsgssssrmkrTVVAIEGG  1252
             ++V++CD+V  R ARL+AAG VGILKK+GRD +                 + +V+AI+G 
Sbjct  393   VMVKLCDIVASRGARLSAAGTVGILKKLGRDKS-----------RKEGEKQTSVIAIDGA  441

Query  1253  LYTSYTSFREYLNEAVAEILGEEVSSHVTITVTEDGSGIG  1372
             L+  YT FR+     + E+LG +V   +++  + DGSGIG
Sbjct  442   LFEHYTKFRQCFEGTLEELLG-DVYETISVVQSHDGSGIG  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5050657640886