BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14900_g1_i1 len=1312 path=[1290:0-258 @1549@!:259-723 2014:724-867
2158:868-1311]

Length=1312
                                                                      Score     E

ref|XP_006342033.1|  PREDICTED: cytokinin riboside 5'-monophospha...    414   1e-140   
ref|XP_004238344.1|  PREDICTED: cytokinin riboside 5'-monophospha...    414   1e-140   
ref|XP_009783018.1|  PREDICTED: cytokinin riboside 5'-monophospha...    412   7e-140   
dbj|BAK52670.1|  cytokinin riboside 5'-monophosphate phosphoriboh...    410   2e-139   
ref|XP_009610925.1|  PREDICTED: cytokinin riboside 5'-monophospha...    407   3e-138   
ref|XP_011074666.1|  PREDICTED: cytokinin riboside 5'-monophospha...    399   7e-135   
ref|XP_002276775.1|  PREDICTED: probable cytokinin riboside 5'-mo...    398   1e-134   Vitis vinifera
ref|XP_002510515.1|  carboxy-lyase, putative                            392   2e-132   Ricinus communis
gb|KDP36940.1|  hypothetical protein JCGZ_08231                         392   2e-132   
ref|XP_010104436.1|  hypothetical protein L484_016035                   391   6e-132   
ref|XP_009607694.1|  PREDICTED: cytokinin riboside 5'-monophospha...    390   2e-131   
gb|EYU38838.1|  hypothetical protein MIMGU_mgv1a013512mg                389   3e-131   
emb|CDP07413.1|  unnamed protein product                                388   1e-130   
ref|XP_010667386.1|  PREDICTED: probable cytokinin riboside 5'-mo...    386   8e-130   
ref|XP_006473638.1|  PREDICTED: probable cytokinin riboside 5'-mo...    385   1e-129   
gb|EYU36778.1|  hypothetical protein MIMGU_mgv1a013395mg                385   2e-129   
ref|XP_009779808.1|  PREDICTED: cytokinin riboside 5'-monophospha...    385   2e-129   
ref|XP_006435156.1|  hypothetical protein CICLE_v10002383mg             384   4e-129   
ref|XP_010060231.1|  PREDICTED: probable cytokinin riboside 5'-mo...    382   3e-128   
ref|XP_008444787.1|  PREDICTED: cytokinin riboside 5'-monophospha...    381   1e-127   
ref|XP_011028989.1|  PREDICTED: cytokinin riboside 5'-monophospha...    380   1e-127   
ref|XP_002306920.1|  hypothetical protein POPTR_0005s25880g             378   9e-127   Populus trichocarpa [western balsam poplar]
ref|XP_007017774.1|  Lysine decarboxylase family protein                379   9e-127   
ref|XP_006386178.1|  hypothetical protein POPTR_0002s02560g             377   2e-126   
ref|XP_010255159.1|  PREDICTED: cytokinin riboside 5'-monophospha...    377   2e-126   
ref|XP_011083519.1|  PREDICTED: cytokinin riboside 5'-monophospha...    377   3e-126   
ref|XP_004152760.1|  PREDICTED: cytokinin riboside 5'-monophospha...    376   9e-126   
ref|XP_008221287.1|  PREDICTED: cytokinin riboside 5'-monophospha...    375   1e-125   
ref|XP_004172206.1|  PREDICTED: cytokinin riboside 5'-monophospha...    375   2e-125   
ref|XP_004500949.1|  PREDICTED: cytokinin riboside 5'-monophospha...    374   4e-125   
ref|XP_003527691.1|  PREDICTED: cytokinin riboside 5'-monophospha...    374   5e-125   
ref|XP_003523551.1|  PREDICTED: cytokinin riboside 5'-monophospha...    373   1e-124   
ref|XP_008785140.1|  PREDICTED: cytokinin riboside 5'-monophospha...    373   1e-124   
ref|XP_010941274.1|  PREDICTED: cytokinin riboside 5'-monophospha...    372   2e-124   
ref|XP_007225794.1|  hypothetical protein PRUPE_ppa011245mg             372   2e-124   
ref|XP_003603739.1|  Carboxy-lyase                                      372   3e-124   
ref|NP_001239732.1|  uncharacterized protein LOC100814612               369   2e-123   
ref|XP_010061042.1|  PREDICTED: cytokinin riboside 5'-monophospha...    370   2e-123   
ref|XP_010910906.1|  PREDICTED: cytokinin riboside 5'-monophospha...    369   3e-123   
ref|XP_007160679.1|  hypothetical protein PHAVU_001G007800g             368   8e-123   
ref|XP_007136081.1|  hypothetical protein PHAVU_009G016000g             368   8e-123   
gb|KHN45916.1|  Putative cytokinin riboside 5'-monophosphate phos...    367   2e-122   
ref|XP_010920269.1|  PREDICTED: cytokinin riboside 5'-monophospha...    366   5e-122   
ref|XP_010935044.1|  PREDICTED: cytokinin riboside 5'-monophospha...    366   7e-122   
ref|XP_006600223.1|  PREDICTED: uncharacterized protein LOC100814...    365   1e-121   
ref|XP_011077347.1|  PREDICTED: cytokinin riboside 5'-monophospha...    364   2e-121   
ref|XP_011045113.1|  PREDICTED: cytokinin riboside 5'-monophospha...    363   4e-121   
ref|XP_010244087.1|  PREDICTED: probable cytokinin riboside 5'-mo...    362   1e-120   
ref|XP_010530287.1|  PREDICTED: cytokinin riboside 5'-monophospha...    361   2e-120   
ref|XP_008807568.1|  PREDICTED: cytokinin riboside 5'-monophospha...    359   2e-119   
ref|XP_006846812.1|  hypothetical protein AMTR_s00148p00076970          359   2e-119   
ref|XP_004497512.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   5e-119   
ref|XP_003554380.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   5e-119   
gb|KHN02336.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    360   6e-119   
ref|XP_009413755.1|  PREDICTED: cytokinin riboside 5'-monophospha...    358   1e-118   
ref|XP_003590484.1|  hypothetical protein MTR_1g064260                  357   2e-118   
ref|NP_001241195.1|  uncharacterized protein LOC100787375               356   4e-118   
ref|NP_001241594.1|  uncharacterized protein LOC100785143               355   9e-118   
ref|XP_007162751.1|  hypothetical protein PHAVU_001G177400g             355   1e-117   
ref|XP_009335163.1|  PREDICTED: cytokinin riboside 5'-monophospha...    354   1e-117   
ref|XP_007144351.1|  hypothetical protein PHAVU_007G148800g             354   1e-117   
ref|XP_004493974.1|  PREDICTED: cytokinin riboside 5'-monophospha...    354   2e-117   
ref|XP_009380387.1|  PREDICTED: cytokinin riboside 5'-monophospha...    354   2e-117   
gb|KHN39436.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    353   3e-117   
ref|XP_008369688.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   3e-117   
ref|NP_001240198.1|  uncharacterized protein LOC100791145               353   3e-117   
gb|KEH17130.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    353   4e-117   
ref|XP_009342948.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   4e-117   
ref|XP_002285246.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   5e-117   Vitis vinifera
ref|XP_010557341.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   6e-117   
emb|CBI16329.3|  unnamed protein product                                352   7e-117   
ref|XP_010253716.1|  PREDICTED: cytokinin riboside 5'-monophospha...    353   7e-117   
ref|XP_003625636.1|  hypothetical protein MTR_7g101290                  354   8e-117   
emb|CDP06745.1|  unnamed protein product                                352   1e-116   
ref|XP_011094655.1|  PREDICTED: cytokinin riboside 5'-monophospha...    352   2e-116   
ref|XP_007206768.1|  hypothetical protein PRUPE_ppa025305mg             352   2e-116   
ref|XP_009610234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    352   2e-116   
ref|XP_008807508.1|  PREDICTED: cytokinin riboside 5'-monophospha...    352   2e-116   
gb|KHN09504.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    352   2e-116   
ref|NP_001244911.1|  cytokinin riboside 5'-monophosphate phosphor...    351   3e-116   
ref|XP_002276279.2|  PREDICTED: cytokinin riboside 5'-monophospha...    351   3e-116   Vitis vinifera
ref|XP_009373527.1|  PREDICTED: cytokinin riboside 5'-monophospha...    351   3e-116   
ref|XP_008805210.1|  PREDICTED: cytokinin riboside 5'-monophospha...    351   4e-116   
ref|XP_008359648.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin ri...    351   4e-116   
ref|XP_006595550.1|  PREDICTED: uncharacterized protein LOC100785...    350   5e-116   
ref|XP_006595551.1|  PREDICTED: uncharacterized protein LOC100785...    349   9e-116   
gb|KHG02823.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    350   1e-115   
ref|XP_007027342.1|  Lysine decarboxylase family protein isoform 2      350   1e-115   
ref|XP_009596604.1|  PREDICTED: cytokinin riboside 5'-monophospha...    349   1e-115   
gb|EPS64496.1|  hypothetical protein M569_10285                         349   1e-115   
ref|XP_002529933.1|  carboxy-lyase, putative                            349   2e-115   Ricinus communis
gb|AFK40158.1|  unknown                                                 349   2e-115   
ref|XP_007016779.1|  Lysine decarboxylase family protein, putativ...    349   2e-115   
ref|XP_009781791.1|  PREDICTED: cytokinin riboside 5'-monophospha...    349   2e-115   
ref|XP_011048543.1|  PREDICTED: cytokinin riboside 5'-monophospha...    349   3e-115   
ref|XP_009788908.1|  PREDICTED: cytokinin riboside 5'-monophospha...    348   3e-115   
ref|XP_006381447.1|  hypothetical protein POPTR_0006s12920g             348   5e-115   
ref|XP_010107529.1|  hypothetical protein L484_024382                   348   6e-115   
ref|XP_010906515.1|  PREDICTED: cytokinin riboside 5'-monophospha...    348   6e-115   
gb|KDP44034.1|  hypothetical protein JCGZ_05501                         347   7e-115   
ref|XP_004291375.1|  PREDICTED: probable cytokinin riboside 5'-mo...    348   7e-115   
ref|XP_008225924.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   8e-115   
ref|XP_002880937.1|  hypothetical protein ARALYDRAFT_481677             347   1e-114   
ref|XP_010264655.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   1e-114   
ref|XP_010935881.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   2e-114   
ref|NP_565668.1|  cytokinin riboside 5'-monophosphate phosphoribo...    347   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246656.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   2e-114   
ref|XP_010089966.1|  hypothetical protein L484_008044                   347   2e-114   
ref|XP_002323469.2|  hypothetical protein POPTR_0016s09180g             347   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_006428773.1|  hypothetical protein CICLE_v10012707mg             346   3e-114   
ref|XP_006354329.1|  PREDICTED: cytokinin riboside 5'-monophospha...    346   3e-114   
ref|XP_002314282.2|  hypothetical protein POPTR_0009s01600g             346   3e-114   Populus trichocarpa [western balsam poplar]
gb|KHG18498.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    346   3e-114   
gb|KFK27249.1|  hypothetical protein AALP_AA8G357400                    346   3e-114   
gb|AII20186.1|  riboside 5'-monophosphate phosphoribohydrolase          346   3e-114   
ref|XP_004291703.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   4e-114   
ref|XP_009407199.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   4e-114   
ref|XP_008364933.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   6e-114   
ref|XP_009367053.1|  PREDICTED: cytokinin riboside 5'-monophospha...    347   8e-114   
ref|XP_006294984.1|  hypothetical protein CARUB_v10024052mg             345   8e-114   
ref|XP_011044403.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   9e-114   
gb|AAK32797.1|AF361629_1  T3B23.2/T3B23.2                               345   9e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920460.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   1e-113   
ref|XP_010414556.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   1e-113   
ref|XP_004145748.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   1e-113   
gb|KHN05674.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    344   1e-113   
ref|XP_010510645.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   2e-113   
gb|AFK33887.1|  unknown                                                 344   2e-113   
ref|XP_003539768.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   3e-113   
ref|XP_009396585.1|  PREDICTED: cytokinin riboside 5'-monophospha...    344   3e-113   
ref|XP_006339070.1|  PREDICTED: cytokinin riboside 5'-monophospha...    343   3e-113   
ref|XP_008385326.1|  PREDICTED: cytokinin riboside 5'-monophospha...    345   4e-113   
ref|NP_181258.2|  cytokinin riboside 5'-monophosphate phosphoribo...    342   7e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132270.1|  hypothetical protein PHAVU_011G080600g             343   9e-113   
ref|XP_006384915.1|  hypothetical protein POPTR_0004s22210g             342   1e-112   
ref|XP_010509365.1|  PREDICTED: cytokinin riboside 5'-monophospha...    342   1e-112   
ref|XP_010505298.1|  PREDICTED: cytokinin riboside 5'-monophospha...    342   1e-112   
ref|XP_002881496.1|  hypothetical protein ARALYDRAFT_482713             342   1e-112   
ref|XP_006409853.1|  hypothetical protein EUTSA_v10017171mg             342   2e-112   
gb|EYU34458.1|  hypothetical protein MIMGU_mgv1a013457mg                341   2e-112   
ref|XP_008442685.1|  PREDICTED: cytokinin riboside 5'-monophospha...    341   3e-112   
ref|XP_011013920.1|  PREDICTED: cytokinin riboside 5'-monophospha...    341   3e-112   
ref|XP_004137827.1|  PREDICTED: cytokinin riboside 5'-monophospha...    341   3e-112   
ref|XP_006293523.1|  hypothetical protein CARUB_v10024039mg             341   3e-112   
ref|XP_011040899.1|  PREDICTED: cytokinin riboside 5'-monophospha...    340   4e-112   
gb|KGN58962.1|  hypothetical protein Csa_3G739570                       340   5e-112   
ref|XP_002519528.1|  carboxy-lyase, putative                            340   8e-112   Ricinus communis
emb|CDX77168.1|  BnaC04g39630D                                          339   9e-112   
ref|XP_007027341.1|  Lysine decarboxylase family protein isoform 1      340   1e-111   
emb|CDX71364.1|  BnaC04g15990D                                          339   1e-111   
gb|KDP29120.1|  hypothetical protein JCGZ_16509                         340   1e-111   
emb|CDY04551.1|  BnaA07g13770D                                          339   1e-111   
ref|XP_009801432.1|  PREDICTED: cytokinin riboside 5'-monophospha...    339   2e-111   
ref|XP_009103669.1|  PREDICTED: cytokinin riboside 5'-monophospha...    340   2e-111   
ref|XP_003538177.1|  PREDICTED: cytokinin riboside 5'-monophospha...    339   2e-111   
gb|ACU19348.1|  unknown                                                 339   2e-111   Glycine max [soybeans]
ref|XP_009140853.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   2e-111   
gb|KFK34594.1|  hypothetical protein AALP_AA5G166100                    338   3e-111   
ref|XP_009141638.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   3e-111   
ref|NP_001053328.1|  Os04g0518800                                       340   3e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AGE00883.1|  lysine decarboxylase                                    338   3e-111   
ref|XP_010043764.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   3e-111   
ref|XP_009611816.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   4e-111   
ref|XP_010031982.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   4e-111   
ref|XP_002275414.1|  PREDICTED: cytokinin riboside 5'-monophospha...    338   4e-111   Vitis vinifera
ref|XP_008791568.1|  PREDICTED: probable cytokinin riboside 5'-mo...    338   5e-111   
ref|XP_006403687.1|  hypothetical protein EUTSA_v10010644mg             338   5e-111   
emb|CAE05626.1|  OSJNBb0061C13.8                                        338   5e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008391958.1|  PREDICTED: cytokinin riboside 5'-monophospha...    337   8e-111   
ref|XP_006403688.1|  hypothetical protein EUTSA_v10010644mg             338   9e-111   
emb|CDY52759.1|  BnaA07g37740D                                          337   1e-110   
ref|XP_006424548.1|  hypothetical protein CICLE_v10029235mg             337   1e-110   
gb|KEH39342.1|  lysine decarboxylase family protein                     337   1e-110   
ref|XP_006653604.1|  PREDICTED: probable cytokinin riboside 5'-mo...    338   1e-110   
ref|XP_004487095.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   1e-110   
ref|XP_002301983.1|  hypothetical protein POPTR_0002s02560g             336   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_006592704.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   2e-110   
ref|XP_009133130.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   2e-110   
ref|XP_002877920.1|  hypothetical protein ARALYDRAFT_348439             336   2e-110   
ref|XP_003543475.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   2e-110   
ref|XP_010529748.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   2e-110   
ref|XP_006488072.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   2e-110   
ref|XP_003606367.1|  hypothetical protein MTR_4g058740                  335   3e-110   
ref|XP_010262960.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   3e-110   
gb|KFK36610.1|  hypothetical protein AALP_AA4G145900                    336   3e-110   
ref|XP_009103862.1|  PREDICTED: cytokinin riboside 5'-monophospha...    336   3e-110   
ref|XP_010046628.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   4e-110   
ref|XP_009349185.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   6e-110   
ref|XP_009764788.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   6e-110   
ref|XP_009587160.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   6e-110   
emb|CDY30875.1|  BnaC04g27300D                                          335   6e-110   
ref|XP_009116037.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   7e-110   
emb|CDX91344.1|  BnaC04g08060D                                          334   8e-110   
ref|XP_004976245.1|  PREDICTED: probable cytokinin riboside 5'-mo...    336   9e-110   
emb|CDX79722.1|  BnaC03g20580D                                          334   1e-109   
ref|XP_010104785.1|  hypothetical protein L484_018839                   334   1e-109   
ref|XP_004251148.1|  PREDICTED: cytokinin riboside 5'-monophospha...    335   1e-109   
ref|XP_007027931.1|  Lysine decarboxylase family protein, putative      334   1e-109   
ref|XP_006399100.1|  hypothetical protein EUTSA_v10014650mg             334   1e-109   
ref|XP_009392159.1|  PREDICTED: cytokinin riboside 5'-monophospha...    334   1e-109   
ref|XP_009372569.1|  PREDICTED: cytokinin riboside 5'-monophospha...    334   2e-109   
dbj|BAG70979.1|  putative lysine decarboxylase                          334   2e-109   Musa balbisiana [starchy banana]
ref|XP_006292903.1|  hypothetical protein CARUB_v10019168mg             333   2e-109   
ref|XP_007150188.1|  hypothetical protein PHAVU_005G134000g             333   3e-109   
ref|XP_002446792.1|  hypothetical protein SORBIDRAFT_06g022780          335   3e-109   Sorghum bicolor [broomcorn]
ref|XP_002873247.1|  carboxy-lyase                                      333   5e-109   
ref|XP_006288643.1|  hypothetical protein CARUB_v10001948mg             332   5e-109   
ref|XP_003581433.2|  PREDICTED: cytokinin riboside 5'-monophospha...    334   5e-109   
ref|XP_006348482.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   6e-109   
ref|XP_009139409.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   8e-109   
ref|NP_196248.3|  cytokinin riboside 5'-monophosphate phosphoribo...    332   9e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006340180.1|  PREDICTED: cytokinin riboside 5'-monophospha...    332   1e-108   
ref|XP_002467072.1|  hypothetical protein SORBIDRAFT_01g019170          331   1e-108   Sorghum bicolor [broomcorn]
ref|NP_190913.1|  cytokinin riboside 5'-monophosphate phosphoribo...    332   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016778.1|  Lysine decarboxylase family protein isoform 1      333   1e-108   
ref|XP_010246703.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   1e-108   
sp|B9F166.1|LOGL2_ORYSJ  RecName: Full=Probable cytokinin ribosid...    332   2e-108   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86771.1|  hypothetical protein OsI_08151                          334   2e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_011094223.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   2e-108   
ref|XP_006854693.1|  hypothetical protein AMTR_s00030p00225360          331   2e-108   
ref|XP_004136507.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   2e-108   
ref|XP_008669155.1|  PREDICTED: probable cytokinin riboside 5'-mo...    332   3e-108   
ref|XP_010515835.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   3e-108   
ref|XP_006828986.1|  hypothetical protein AMTR_s00001p00242250          330   3e-108   
ref|XP_002530151.1|  carboxy-lyase, putative                            330   4e-108   Ricinus communis
ref|XP_003521489.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   4e-108   
ref|XP_010534395.1|  PREDICTED: cytokinin riboside 5'-monophospha...    331   5e-108   
ref|XP_004304438.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   5e-108   
ref|XP_006410901.1|  hypothetical protein EUTSA_v10017236mg             330   5e-108   
ref|XP_010504107.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   6e-108   
ref|XP_010426993.1|  PREDICTED: cytokinin riboside 5'-monophospha...    330   7e-108   
ref|XP_010558001.1|  PREDICTED: cytokinin riboside 5'-monophospha...    329   9e-108   
ref|XP_004953163.1|  PREDICTED: probable cytokinin riboside 5'-mo...    330   1e-107   
gb|EYU18134.1|  hypothetical protein MIMGU_mgv1a023227mg                329   1e-107   
ref|XP_009143522.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   1e-107   
ref|XP_006430086.1|  hypothetical protein CICLE_v10013759mg             328   2e-107   
ref|NP_001169307.1|  hypothetical protein                               328   2e-107   Zea mays [maize]
ref|XP_009122236.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   3e-107   
ref|XP_011046883.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   3e-107   
emb|CDY14086.1|  BnaC02g02030D                                          328   4e-107   
ref|XP_009125642.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   4e-107   
ref|XP_011013919.1|  PREDICTED: cytokinin riboside 5'-monophospha...    329   4e-107   
ref|XP_004982851.1|  PREDICTED: probable cytokinin riboside 5'-mo...    327   4e-107   
ref|XP_008788743.1|  PREDICTED: cytokinin riboside 5'-monophospha...    328   4e-107   
ref|XP_006647546.1|  PREDICTED: probable cytokinin riboside 5'-mo...    329   4e-107   
ref|XP_003575405.1|  PREDICTED: probable cytokinin riboside 5'-mo...    328   4e-107   
ref|XP_003553618.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   4e-107   
ref|XP_010906513.1|  PREDICTED: cytokinin riboside 5'-monophospha...    329   4e-107   
ref|NP_001189696.1|  cytokinin riboside 5'-monophosphate phosphor...    328   5e-107   
ref|XP_010543825.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   7e-107   
ref|XP_009381994.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   7e-107   
gb|KHN33166.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    327   8e-107   
ref|XP_002452481.1|  hypothetical protein SORBIDRAFT_04g026590          328   1e-106   Sorghum bicolor [broomcorn]
ref|XP_006661863.1|  PREDICTED: probable cytokinin riboside 5'-mo...    326   1e-106   
ref|XP_006828985.1|  hypothetical protein AMTR_s00001p00241960          326   1e-106   
ref|XP_008243464.1|  PREDICTED: cytokinin riboside 5'-monophospha...    326   1e-106   
ref|XP_007162957.1|  hypothetical protein PHAVU_001G194400g             326   1e-106   
ref|XP_002308442.1|  hypothetical protein POPTR_0006s22120g             326   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010470104.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   2e-106   
ref|NP_001148891.1|  carboxy-lyase                                      326   2e-106   Zea mays [maize]
ref|XP_010414555.1|  PREDICTED: cytokinin riboside 5'-monophospha...    327   2e-106   
gb|AHZ89694.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    326   2e-106   
ref|NP_001244910.1|  cytokinin riboside 5'-monophosphate phosphor...    326   2e-106   
ref|XP_006339321.1|  PREDICTED: cytokinin riboside 5'-monophospha...    326   2e-106   
ref|XP_006481574.1|  PREDICTED: cytokinin riboside 5'-monophospha...    325   3e-106   
ref|NP_001064868.1|  Os10g0479500                                       325   3e-106   Oryza sativa Japonica Group [Japonica rice]
gb|AES73991.2|  cytokinin riboside 5'-monophosphate phosphoribohy...    326   4e-106   
ref|XP_007202920.1|  hypothetical protein PRUPE_ppa016229mg             325   4e-106   
ref|XP_004303504.1|  PREDICTED: cytokinin riboside 5'-monophospha...    325   4e-106   
gb|KDP36133.1|  hypothetical protein JCGZ_08777                         325   7e-106   
gb|KHN08726.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    324   8e-106   
ref|XP_008350520.1|  PREDICTED: cytokinin riboside 5'-monophospha...    324   1e-105   
emb|CDP10616.1|  unnamed protein product                                324   1e-105   
ref|XP_003574067.1|  PREDICTED: probable cytokinin riboside 5'-mo...    323   2e-105   
emb|CDP07095.1|  unnamed protein product                                324   2e-105   
emb|CDX78180.1|  BnaA09g33750D                                          324   3e-105   
ref|XP_006604650.1|  PREDICTED: cytokinin riboside 5'-monophospha...    323   3e-105   
ref|XP_003519126.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   4e-105   
ref|XP_006649247.1|  PREDICTED: probable cytokinin riboside 5'-mo...    322   7e-105   
ref|XP_010426991.1|  PREDICTED: cytokinin riboside 5'-monophospha...    322   7e-105   
gb|AFW58873.1|  hypothetical protein ZEAMMB73_274984                    323   1e-104   
emb|CDX74979.1|  BnaA05g07250D                                          322   1e-104   
gb|EEC67178.1|  hypothetical protein OsI_34046                          326   1e-104   
ref|XP_010266115.1|  PREDICTED: cytokinin riboside 5'-monophospha...    321   2e-104   
ref|NP_001048706.1|  Os03g0109300                                       320   2e-104   
ref|XP_009766234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   2e-104   
ref|XP_010920270.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   5e-104   
gb|KEH41891.1|  lysine decarboxylase family protein                     320   5e-104   
ref|XP_008799432.1|  PREDICTED: cytokinin riboside 5'-monophospha...    320   5e-104   
ref|XP_007041671.1|  Lysine decarboxylase family protein                320   8e-104   
ref|XP_009611418.1|  PREDICTED: cytokinin riboside 5'-monophospha...    319   1e-103   
ref|XP_010558160.1|  PREDICTED: probable cytokinin riboside 5'-mo...    319   1e-103   
ref|XP_011099535.1|  PREDICTED: probable cytokinin riboside 5'-mo...    319   1e-103   
ref|XP_007017980.1|  Lysine decarboxylase family protein, putativ...    318   1e-103   
ref|XP_010242845.1|  PREDICTED: cytokinin riboside 5'-monophospha...    319   1e-103   
ref|XP_010664090.1|  PREDICTED: cytokinin riboside 5'-monophospha...    318   2e-103   
ref|XP_007145804.1|  hypothetical protein PHAVU_007G269400g             318   2e-103   
emb|CAN74076.1|  hypothetical protein VITISV_000977                     318   2e-103   
emb|CBI18877.3|  unnamed protein product                                318   2e-103   
emb|CDP07311.1|  unnamed protein product                                318   2e-103   
ref|XP_009394077.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   4e-103   
ref|XP_010103315.1|  hypothetical protein L484_014355                   318   6e-103   
ref|XP_011034907.1|  PREDICTED: cytokinin riboside 5'-monophospha...    317   1e-102   
ref|XP_011044028.1|  PREDICTED: cytokinin riboside 5'-monophospha...    316   1e-102   
ref|XP_006435320.1|  hypothetical protein CICLE_v10002405mg             316   2e-102   
gb|KGN60024.1|  hypothetical protein Csa_3G872060                       315   2e-102   
ref|XP_008466494.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   2e-102   
ref|XP_009383528.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   3e-102   
ref|XP_009386166.1|  PREDICTED: cytokinin riboside 5'-monophospha...    315   4e-102   
ref|XP_004980976.1|  PREDICTED: probable cytokinin riboside 5'-mo...    315   4e-102   
ref|XP_006422478.1|  hypothetical protein CICLE_v10029210mg             315   5e-102   
ref|XP_007017981.1|  Lysine decarboxylase family protein isoform 2      314   1e-101   
ref|XP_009125489.1|  PREDICTED: probable cytokinin riboside 5'-mo...    313   1e-101   
gb|EPS70976.1|  hypothetical protein M569_03783                         313   1e-101   
gb|KDP36835.1|  hypothetical protein JCGZ_08126                         314   1e-101   
ref|XP_002306969.1|  hypothetical protein POPTR_0005s27030g             313   2e-101   
ref|XP_004167905.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   2e-101   
ref|XP_010683613.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   2e-101   
ref|XP_008382467.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   2e-101   
emb|CDY44352.1|  BnaC02g03250D                                          312   3e-101   
ref|XP_004293594.1|  PREDICTED: cytokinin riboside 5'-monophospha...    312   3e-101   
ref|XP_008350210.1|  PREDICTED: cytokinin riboside 5'-monophospha...    312   3e-101   
gb|ACU19659.1|  unknown                                                 313   3e-101   
gb|KHN09096.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    318   4e-101   
gb|EMT28819.1|  hypothetical protein F775_05789                         313   4e-101   
ref|XP_008236109.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   4e-101   
ref|XP_010066319.1|  PREDICTED: cytokinin riboside 5'-monophospha...    313   5e-101   
ref|XP_007201230.1|  hypothetical protein PRUPE_ppa010459mg             313   5e-101   
ref|XP_004144285.1|  PREDICTED: cytokinin riboside 5'-monophospha...    312   5e-101   
ref|XP_004143250.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   7e-101   
ref|XP_010452197.1|  PREDICTED: probable cytokinin riboside 5'-mo...    311   8e-101   
ref|XP_008813587.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   9e-101   
ref|XP_002510643.1|  carboxy-lyase, putative                            311   1e-100   
ref|XP_004497673.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   1e-100   
ref|XP_010094594.1|  hypothetical protein L484_024891                   311   1e-100   
ref|XP_008464873.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   1e-100   
ref|XP_009341551.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   2e-100   
ref|XP_008348520.1|  PREDICTED: cytokinin riboside 5'-monophospha...    311   2e-100   
ref|XP_006288686.1|  hypothetical protein CARUB_v10001996mg             310   2e-100   
ref|XP_006296315.1|  hypothetical protein CARUB_v10025487mg             310   2e-100   
emb|CDX73553.1|  BnaC08g24500D                                          309   4e-100   
ref|XP_002281839.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   4e-100   
ref|XP_010935234.1|  PREDICTED: cytokinin riboside 5'-monophospha...    310   5e-100   
gb|AAD18138.2|  hypothetical protein                                    308   7e-100   
ref|XP_011041266.1|  PREDICTED: cytokinin riboside 5'-monophospha...    309   7e-100   
ref|XP_010423742.1|  PREDICTED: probable cytokinin riboside 5'-mo...    308   7e-100   
ref|XP_010558159.1|  PREDICTED: probable cytokinin riboside 5'-mo...    309   1e-99    
pdb|2A33|A  Chain A, X-Ray Structure Of A Lysine Decarboxylase-Li...    308   1e-99    
gb|KHG23597.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    309   1e-99    
ref|XP_002305546.2|  hypothetical protein POPTR_0004s18850g             309   1e-99    
gb|KFK36493.1|  cytokinin riboside 5 -monophosphate phosphoribohy...    308   2e-99    
ref|XP_011046303.1|  PREDICTED: cytokinin riboside 5'-monophospha...    308   2e-99    
ref|NP_181143.3|  cytokinin riboside 5'-monophosphate phosphoribo...    308   3e-99    
ref|XP_011045291.1|  PREDICTED: cytokinin riboside 5'-monophospha...    308   3e-99    
ref|XP_010505124.1|  PREDICTED: cytokinin riboside 5'-monophospha...    307   4e-99    
ref|XP_009631261.1|  PREDICTED: cytokinin riboside 5'-monophospha...    307   4e-99    
emb|CDY40411.1|  BnaA04g21060D                                          307   4e-99    
gb|KFK24779.1|  hypothetical protein AALP_AA8G023700                    307   5e-99    
ref|XP_010935882.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   6e-99    
ref|XP_004961025.1|  PREDICTED: probable cytokinin riboside 5'-mo...    308   1e-98    
ref|XP_008447883.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   1e-98    
ref|XP_008781256.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   1e-98    
ref|XP_004957551.1|  PREDICTED: probable cytokinin riboside 5'-mo...    306   1e-98    
ref|XP_009141550.1|  PREDICTED: cytokinin riboside 5'-monophospha...    306   1e-98    
gb|EAY88228.1|  hypothetical protein OsI_09680                          306   1e-98    
sp|Q0DFG8.3|LOGL8_ORYSJ  RecName: Full=Probable cytokinin ribosid...    308   2e-98    
gb|AAT68738.1|  hypothetical protein At2g35990                          305   2e-98    
gb|EAY99248.1|  hypothetical protein OsI_21209                          308   2e-98    
emb|CDX69118.1|  BnaC01g03350D                                          306   2e-98    
tpg|DAA36911.1|  TPA: hypothetical protein ZEAMMB73_838524              309   2e-98    
ref|XP_010941408.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   3e-98    
ref|XP_010037306.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   3e-98    
ref|XP_002525737.1|  carboxy-lyase, putative                            305   3e-98    
ref|XP_009775949.1|  PREDICTED: cytokinin riboside 5'-monophospha...    305   4e-98    
ref|XP_002879587.1|  hypothetical protein ARALYDRAFT_482570             304   5e-98    
ref|XP_010509527.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   5e-98    
ref|XP_004144937.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   6e-98    
gb|KFK30159.1|  hypothetical protein AALP_AA7G224700                    304   7e-98    
ref|XP_009788914.1|  PREDICTED: cytokinin riboside 5'-monophospha...    303   7e-98    
sp|Q9LYV8.2|LOG6_ARATH  RecName: Full=Probable cytokinin riboside...    303   1e-97    
ref|XP_010906514.1|  PREDICTED: cytokinin riboside 5'-monophospha...    304   1e-97    
ref|XP_004982850.1|  PREDICTED: probable cytokinin riboside 5'-mo...    304   1e-97    
ref|XP_002301929.1|  hypothetical protein POPTR_0002s01390g             304   1e-97    
gb|KDP40447.1|  hypothetical protein JCGZ_03947                         304   1e-97    
ref|XP_006410772.1|  hypothetical protein EUTSA_v10017792mg             303   2e-97    
emb|CDY32063.1|  BnaC04g45030D                                          302   3e-97    
ref|XP_009596603.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   3e-97    
ref|XP_002460610.1|  hypothetical protein SORBIDRAFT_02g031870          303   3e-97    
ref|XP_010935233.1|  PREDICTED: cytokinin riboside 5'-monophospha...    302   5e-97    
ref|XP_003565812.2|  PREDICTED: cytokinin riboside 5'-monophospha...    305   5e-97    
ref|XP_002274747.1|  PREDICTED: probable cytokinin riboside 5'-mo...    301   7e-97    
ref|XP_010924975.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   7e-97    
ref|XP_002458070.1|  hypothetical protein SORBIDRAFT_03g026430          303   8e-97    
ref|XP_002517820.1|  carboxy-lyase, putative                            301   1e-96    
ref|XP_002313681.2|  hypothetical protein POPTR_0009s14360g             301   1e-96    
gb|EMS59424.1|  hypothetical protein TRIUR3_18970                       302   1e-96    
ref|XP_009389480.1|  PREDICTED: cytokinin riboside 5'-monophospha...    301   2e-96    
ref|XP_006853880.1|  hypothetical protein AMTR_s00036p00139830          300   2e-96    
ref|XP_003576800.1|  PREDICTED: probable cytokinin riboside 5'-mo...    301   3e-96    
ref|XP_010908963.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   3e-96    
ref|XP_009105030.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   3e-96    
ref|XP_010241256.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   3e-96    
ref|NP_001244912.1|  cytokinin riboside 5'-monophosphate phosphor...    299   4e-96    
ref|XP_002966818.1|  hypothetical protein SELMODRAFT_230940             300   4e-96    
ref|NP_001140786.1|  uncharacterized protein LOC100272861               300   4e-96    
emb|CDP14518.1|  unnamed protein product                                300   4e-96    
ref|XP_004969036.1|  PREDICTED: cytokinin riboside 5'-monophospha...    300   5e-96    
ref|XP_006655653.1|  PREDICTED: probable cytokinin riboside 5'-mo...    300   6e-96    
ref|XP_010432315.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   7e-96    
ref|XP_008775914.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   7e-96    
emb|CDY62895.1|  BnaAnng18400D                                          298   7e-96    
ref|XP_011025445.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   8e-96    
ref|XP_010437508.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   8e-96    
gb|KDP43483.1|  hypothetical protein JCGZ_16770                         299   8e-96    
ref|XP_010109647.1|  hypothetical protein L484_000785                   299   8e-96    
ref|XP_010446965.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   9e-96    
gb|ACN35675.1|  unknown                                                 300   1e-95    
ref|XP_003588965.1|  Lysine decarboxylase-like protein                  298   1e-95    
ref|XP_009412390.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   1e-95    
emb|CDY52642.1|  BnaAnng11570D                                          299   1e-95    
ref|XP_010242268.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   1e-95    
ref|XP_010063111.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   1e-95    
ref|NP_001056491.2|  Os05g0591600                                       300   2e-95    
ref|XP_007012319.1|  Lysine decarboxylase family protein, putative      298   2e-95    
ref|NP_001149622.1|  carboxy-lyase                                      300   2e-95    
ref|XP_007223924.1|  hypothetical protein PRUPE_ppa011032mg             298   2e-95    
ref|XP_002961184.1|  hypothetical protein SELMODRAFT_73749              298   2e-95    
emb|CDX76318.1|  BnaA08g10820D                                          298   2e-95    
ref|XP_008806983.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   2e-95    
ref|XP_008808561.1|  PREDICTED: cytokinin riboside 5'-monophospha...    299   2e-95    
gb|EEC77653.1|  hypothetical protein OsI_16664                          299   2e-95    
ref|XP_008220500.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   2e-95    
ref|XP_009108627.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   2e-95    
tpg|DAA62658.1|  TPA: hypothetical protein ZEAMMB73_249913              301   2e-95    
gb|EYU29348.1|  hypothetical protein MIMGU_mgv1a013575mg                297   3e-95    
ref|XP_004498871.1|  PREDICTED: cytokinin riboside 5'-monophospha...    297   3e-95    
ref|XP_009386165.1|  PREDICTED: cytokinin riboside 5'-monophospha...    298   4e-95    
emb|CAN82966.1|  hypothetical protein VITISV_021855                     301   4e-95    
ref|XP_002871020.1|  predicted protein                                  296   4e-95    
ref|NP_567978.1|  cytokinin riboside 5'-monophosphate phosphoribo...    297   5e-95    
gb|ACG40715.1|  carboxy-lyase                                           298   6e-95    
ref|XP_002869102.1|  hypothetical protein ARALYDRAFT_912862             297   7e-95    
ref|NP_001132578.1|  carboxy-lyase                                      298   7e-95    
ref|NP_001235198.1|  uncharacterized protein LOC100306704               296   9e-95    
gb|AFG28179.1|  lysine decarboxylase 1                                  296   9e-95    
ref|XP_002278305.1|  PREDICTED: cytokinin riboside 5'-monophospha...    296   1e-94    
gb|EMS48449.1|  hypothetical protein TRIUR3_21353                       296   1e-94    
gb|KHG18078.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    295   2e-94    
emb|CDP08287.1|  unnamed protein product                                295   2e-94    
ref|XP_011019416.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   2e-94    
ref|NP_001130253.1|  carboxy-lyase                                      297   2e-94    
ref|XP_002277852.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   2e-94    
ref|XP_008452737.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   2e-94    
ref|XP_008808563.1|  PREDICTED: cytokinin riboside 5'-monophospha...    296   2e-94    
ref|XP_011099349.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   3e-94    
ref|XP_010529749.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   4e-94    
ref|XP_010067863.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   4e-94    
gb|AGU16436.1|  L-lysine decarboxylase                                  295   4e-94    
ref|XP_011088679.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   4e-94    
ref|XP_009408737.1|  PREDICTED: probable cytokinin riboside 5'-mo...    294   5e-94    
ref|XP_010088222.1|  hypothetical protein L484_012503                   295   5e-94    
ref|XP_007052516.1|  Lysine decarboxylase family protein isoform 2      294   5e-94    
ref|XP_006284478.1|  hypothetical protein CARUB_v10005664mg             295   5e-94    
dbj|BAM93477.1|  cytokinin riboside monophosphate phosphoribohydr...    292   5e-94    
ref|XP_010690268.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   6e-94    
ref|XP_009757154.1|  PREDICTED: cytokinin riboside 5'-monophospha...    294   6e-94    
ref|XP_009362170.1|  PREDICTED: cytokinin riboside 5'-monophospha...    294   7e-94    
ref|XP_009139410.1|  PREDICTED: cytokinin riboside 5'-monophospha...    292   7e-94    
ref|XP_010063110.1|  PREDICTED: cytokinin riboside 5'-monophospha...    294   7e-94    
ref|NP_001043439.1|  Os01g0588900                                       294   1e-93    
ref|XP_010646149.1|  PREDICTED: cytokinin riboside 5'-monophospha...    295   1e-93    
ref|NP_001151257.1|  carboxy-lyase                                      295   1e-93    
ref|XP_002516089.1|  carboxy-lyase, putative                            293   1e-93    
gb|AHZ89695.1|  cytokinin riboside 5'-monophosphate phosphoribohy...    293   1e-93    
ref|XP_004139951.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   1e-93    
dbj|BAJ96076.1|  predicted protein                                      294   2e-93    
ref|XP_009389464.1|  PREDICTED: probable cytokinin riboside 5'-mo...    293   2e-93    
ref|XP_002309490.1|  lysine decarboxylase family protein                293   2e-93    
ref|XP_010548131.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   2e-93    
ref|XP_006453074.1|  hypothetical protein CICLE_v10009446mg             293   2e-93    
gb|KHN32200.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    293   2e-93    
ref|XP_006474423.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   2e-93    
ref|XP_009604763.1|  PREDICTED: cytokinin riboside 5'-monophospha...    292   2e-93    
gb|AAT44296.1|  hypothetical protein                                    295   2e-93    
gb|AER10505.1|  DNA recombination-mediator protein A                    295   3e-93    
ref|XP_006661503.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyt...    295   3e-93    
ref|XP_003569282.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   3e-93    
ref|XP_004141324.1|  PREDICTED: cytokinin riboside 5'-monophospha...    292   3e-93    
ref|XP_008222754.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   3e-93    
ref|XP_004139950.1|  PREDICTED: cytokinin riboside 5'-monophospha...    293   4e-93    
emb|CAN79419.1|  hypothetical protein VITISV_025067                     293   5e-93    
ref|XP_002313309.1|  hypothetical protein POPTR_0009s06510g             291   6e-93    
gb|KHG23061.1|  Cytokinin riboside 5'-monophosphate phosphoribohy...    291   6e-93    
ref|XP_007207870.1|  hypothetical protein PRUPE_ppa022354mg             291   7e-93    
ref|XP_009139411.1|  PREDICTED: cytokinin riboside 5'-monophospha...    290   8e-93    
ref|XP_010669375.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   8e-93    
ref|XP_008393617.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   9e-93    
ref|XP_010520696.1|  PREDICTED: cytokinin riboside 5'-monophospha...    291   9e-93    
ref|NP_001051958.1|  Os03g0857900                                       291   1e-92    
ref|XP_009611420.1|  PREDICTED: cytokinin riboside 5'-monophospha...    289   1e-92    



>ref|XP_006342033.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Solanum tuberosum]
Length=225

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK PSYQLAAIQL NQLVERNIDLVYGGGS+GLMGLVSQ+V+NGGRHV
Sbjct  17   FKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQSVFNGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI++SAPTAQELMS+LEDYV
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAQELMSKLEDYV  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVAPKLSWEMEQQLGYTTTK EIAR
Sbjct  197  PKHNGVAPKLSWEMEQQLGYTTTKLEIAR  225



>ref|XP_004238344.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Solanum lycopersicum]
Length=225

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK PSYQLAAIQL NQLVERNIDLVYGGGS+GLMGLVSQ+V+NGGRHV
Sbjct  17   FKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQSVFNGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI++SAPTAQELMS+LEDYV
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAQELMSKLEDYV  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVAPKLSWEMEQQLGYTTTK EIAR
Sbjct  197  PKHNGVAPKLSWEMEQQLGYTTTKLEIAR  225



>ref|XP_009783018.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana sylvestris]
Length=229

 Score =   412 bits (1058),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG  PSYQLAAIQLANQLVERNIDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  21   FKRICVFCGSSPGNKPSYQLAAIQLANQLVERNIDLVYGGGSVGLMGLVSQAVFNGGRHV  80

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  81   LGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  140

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI++SAPTA ELMS+LEDYV
Sbjct  141  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAHELMSKLEDYV  200

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVAPKLSWEMEQQLGYTTTK EIAR
Sbjct  201  PKHNGVAPKLSWEMEQQLGYTTTKLEIAR  229



>dbj|BAK52670.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Petunia 
x hybrida]
Length=224

 Score =   410 bits (1055),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK PSYQLAAIQL NQLVERNIDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  16   FKRICVFCGSSPGKKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQAVFNGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  76   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  135

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI+VSAPTA ELMS+LEDYV
Sbjct  136  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIVSAPTAHELMSKLEDYV  195

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVAPKLSWEMEQQLGY TTK EIAR
Sbjct  196  PKHNGVAPKLSWEMEQQLGYNTTKLEIAR  224



>ref|XP_009610925.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=229

 Score =   407 bits (1047),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG  PSYQLAAIQL NQLVERNIDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  21   FKRICVFCGSSPGNKPSYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLVSQAVFNGGRHV  80

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  81   LGVIPKTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  140

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI++SAPTA ELMS+LEDYV
Sbjct  141  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIISAPTAHELMSKLEDYV  200

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+HNGVAPKLSWEMEQQLGYTTTK EIAR
Sbjct  201  PEHNGVAPKLSWEMEQQLGYTTTKLEIAR  229



>ref|XP_011074666.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Sesamum indicum]
Length=223

 Score =   399 bits (1025),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAAIQL  QLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV
Sbjct  15   FKRICVFCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   LGVIPRTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITPSARHI+VSA TA ELMS+LE+YV
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIIVSAQTAHELMSKLEEYV  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+HNGVAPKLSWEMEQQLGY TT+S+IAR
Sbjct  195  PEHNGVAPKLSWEMEQQLGY-TTRSDIAR  222



>ref|XP_002276775.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Vitis vinifera]
 emb|CBI19842.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   398 bits (1022),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGKNPSYQLAAIQLANQLVER IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  9    FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERKIDLVYGGGSIGLMGLVSQAVYDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFIT +AR I+VSAPTAQEL+ +LE+YV
Sbjct  129  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITAAARQIIVSAPTAQELLCKLEEYV  188

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+GVAPKLSWEMEQQLGY  TKS+IAR
Sbjct  189  PKHSGVAPKLSWEMEQQLGY-ATKSDIAR  216



>ref|XP_002510515.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF52702.1| carboxy-lyase, putative [Ricinus communis]
Length=224

 Score =   392 bits (1008),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSSPGKNPSYQLAAIQL +QLVE+NIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  17   FSRVCVFCGSSPGKNPSYQLAAIQLGHQLVEKNIDLVYGGGSIGLMGLVSQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TP+ARHI+VSA TA ELMS+LE+YV
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAQTANELMSKLEEYV  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H+GVAPKLSWEMEQQLGY T K++IAR
Sbjct  197  PRHSGVAPKLSWEMEQQLGY-TLKTDIAR  224



>gb|KDP36940.1| hypothetical protein JCGZ_08231 [Jatropha curcas]
Length=222

 Score =   392 bits (1008),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 200/209 (96%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSSPGKNPSYQLAAIQL +QLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FSRVCVFCGSSPGKNPSYQLAAIQLGHQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE VGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   LGVIPKTLMPREITGEPVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITPSARHI+VSAPTAQELMS+LE+Y 
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIIVSAPTAQELMSKLEEYE  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H+GVA KL+WEMEQQLGY T KSEIAR
Sbjct  195  PRHSGVASKLTWEMEQQLGY-TIKSEIAR  222



>ref|XP_010104436.1| hypothetical protein L484_016035 [Morus notabilis]
 gb|EXC00969.1| hypothetical protein L484_016035 [Morus notabilis]
Length=226

 Score =   391 bits (1005),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 201/209 (96%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGK+PSYQLAAIQL  +LVERNIDLVYGGGSIGLMGLVSQAVY GGRHV
Sbjct  19   FRRVCVFCGSSPGKSPSYQLAAIQLGKELVERNIDLVYGGGSIGLMGLVSQAVYEGGRHV  78

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  79   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  138

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV+EGFITP+ARHI+VSA TAQELM +LE+YV
Sbjct  139  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSAQTAQELMCKLEEYV  198

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+GVAPKLSWEMEQQLGY T K++IAR
Sbjct  199  PKHSGVAPKLSWEMEQQLGY-TVKADIAR  226



>ref|XP_009607694.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=235

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG  P+YQLAAIQL NQLVERNIDLVYGGGS+GLMGL+++AV+NGGRHV
Sbjct  27   FKRICVFCGSSPGNKPTYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLIAKAVFNGGRHV  86

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPK LMPREITGE +GEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  87   LGVIPKCLMPREITGEKIGEVRAVSSMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  146

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLLCFIDKAV EGFITPSA HI+VSAPTA+ELMS+LEDYV
Sbjct  147  AQLGIHDKPVGLLNVEGYYNSLLCFIDKAVEEGFITPSAHHIIVSAPTARELMSKLEDYV  206

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNG+APK SWEMEQQLGYTTT  +IAR
Sbjct  207  PKHNGIAPKPSWEMEQQLGYTTTIPKIAR  235



>gb|EYU38838.1| hypothetical protein MIMGU_mgv1a013512mg [Erythranthe guttata]
Length=218

 Score =   389 bits (1000),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 199/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAA+ LA QLVE NIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  11   FKRICVFCGSSPGKNPSYQLAALHLAKQLVECNIDLVYGGGSIGLMGLVSQAVFDGGRHV  70

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  71   LGVIPRTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  130

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLLCFIDKAV+EGFITPSARHI+VSA TAQEL+S+LEDYV
Sbjct  131  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVDEGFITPSARHIIVSAQTAQELISKLEDYV  190

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P HN   PKL+WEMEQQLGY TTKS+IAR
Sbjct  191  PIHNEATPKLTWEMEQQLGY-TTKSDIAR  218



>emb|CDP07413.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 199/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGKNPSYQLAAI LANQLVERNIDLVYGGGSIGLMGLVSQAV+NGGRHV
Sbjct  18   FKRVCVFCGSSPGKNPSYQLAAIHLANQLVERNIDLVYGGGSIGLMGLVSQAVFNGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGETVGEVR V+GMHQRKAEMA+ +DAFIALPGGYGTLEELLEVITW
Sbjct  78   LGVIPITLMPREITGETVGEVRPVTGMHQRKAEMARLADAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI+PSARHI+VSA TA EL+S+LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFISPSARHIIVSAQTAHELISKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVA KLSWEMEQQL Y TTKS+IAR
Sbjct  198  PKHNGVASKLSWEMEQQLVY-TTKSDIAR  225



>ref|XP_010667386.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAA+QLANQL+ER IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  20   FKRICVFCGSSPGKNPSYQLAALQLANQLIERKIDLVYGGGSIGLMGLVSQAVYDGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMP+EI GETVGEVR VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  80   LGVIPKTLMPKEIIGETVGEVRPVSSMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+E F+TP+AR+I+VSAPTAQELMS+LEDYV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEDFVTPAARNIIVSAPTAQELMSKLEDYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H    PKLSWEMEQQL Y T K+EI+R
Sbjct  200  PRHYETTPKLSWEMEQQLEYGTAKTEISR  228



>ref|XP_006473638.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Citrus sinensis]
Length=225

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK+PSYQLAAIQL  QLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  18   FKRVCVFCGSSPGKSPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEV+AVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  78   LGVIPKTLMPREITGETVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+AR+I+VSA TA ELM +LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARYIIVSAQTAHELMCKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+GVA  LSWEMEQQLGY T KS+IAR
Sbjct  198  PKHSGVASNLSWEMEQQLGY-TNKSDIAR  225



>gb|EYU36778.1| hypothetical protein MIMGU_mgv1a013395mg [Erythranthe guttata]
Length=221

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAA+QL  QLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV
Sbjct  14   FKRICVFCGSSPGKNPSYQLAAVQLGAQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGE VGEVRAVSGMHQRKAEM +Q+DAFIALPGGYGTLEELLEVITW
Sbjct  74   LGVIPTTLMPREITGEPVGEVRAVSGMHQRKAEMNRQADAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFITPSARHI++SAPTA ELMS+LEDY+
Sbjct  134  AQLGIHHKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIILSAPTAHELMSKLEDYI  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+HN V  KLSWEMEQQLG+TT  S+IAR
Sbjct  194  PEHNEVTSKLSWEMEQQLGFTTI-SDIAR  221



>ref|XP_009779808.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Nicotiana sylvestris]
Length=226

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG  P+YQLAAIQL NQLVERNIDLVYGGGS+GLMGL+S+ V+NGGRHV
Sbjct  19   FKRICVFCGSSPGNKPTYQLAAIQLGNQLVERNIDLVYGGGSVGLMGLISKTVFNGGRHV  78

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPK+LMPREITGE +GEVR VSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  79   LGVIPKSLMPREITGEKIGEVRTVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  138

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKP+GLLNV+GYYNSLLCFIDKAV EGFITPSA HI+VSAPTA ELMS+LEDYV
Sbjct  139  AQLGIHDKPIGLLNVEGYYNSLLCFIDKAVEEGFITPSAHHIIVSAPTAHELMSKLEDYV  198

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKHNGVAPKLSWEMEQQLGYT    EI R
Sbjct  199  PKHNGVAPKLSWEMEQQLGYTAI-PEIGR  226



>ref|XP_006435156.1| hypothetical protein CICLE_v10002383mg [Citrus clementina]
 gb|ESR48396.1| hypothetical protein CICLE_v10002383mg [Citrus clementina]
Length=227

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK+PSYQLAAIQL  QLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  20   FKRVCVFCGSSPGKSPSYQLAAIQLGTQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITG+TVGEV+AVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  80   LGVIPKTLMPREITGDTVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+AR+I+VSA TA ELM +LE+YV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARYIIVSAQTAHELMCKLEEYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+GVA  LSWEMEQQLGY T KS+IAR
Sbjct  200  PKHSGVASNLSWEMEQQLGY-TNKSDIAR  227



>ref|XP_010060231.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Eucalyptus grandis]
 gb|KCW66840.1| hypothetical protein EUGRSUZ_F00602 [Eucalyptus grandis]
Length=220

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSSPGK+PSYQLAAIQL  QLVER+IDLVYGGGSIGLMGLVSQ VY+GGRHV
Sbjct  13   FSRVCVFCGSSPGKSPSYQLAAIQLGKQLVERDIDLVYGGGSIGLMGLVSQVVYDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEVR VSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  73   LGVIPKTLMPREITGETIGEVRPVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TPSARHI+VSAPTA EL+++LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPSARHIIVSAPTAHELLTKLEEYE  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+GVA KL+WEMEQQLG+  TKS+IAR
Sbjct  193  PKHSGVASKLTWEMEQQLGH-CTKSDIAR  220



>ref|XP_008444787.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cucumis melo]
Length=232

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 199/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GKNPSYQ+AAIQL NQLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  25   FRRICVFCGSSSGKNPSYQIAAIQLGNQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  84

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPK+LMP+EITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  85   LGVIPKSLMPKEITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  144

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV+EGF++P+AR I+VSAPTA  L+++LE+YV
Sbjct  145  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPAARSIIVSAPTAHALITKLEEYV  204

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+ VA KLSWEMEQQLG+ T KS+IAR
Sbjct  205  PKHSSVASKLSWEMEQQLGF-TVKSDIAR  232



>ref|XP_011028989.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Populus euphratica]
Length=224

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 197/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNP+YQ AA+QL  QLVERNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  17   FRRVCVFCGSSPGKNPNYQHAAVQLGKQLVERNIDLVYGGGSIGLMGLISQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TP+ARHI+VSA TA ELM +LEDY 
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAHTAHELMCKLEDYE  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
             +H+GVA KLSWEMEQQLGY T KS+I+R
Sbjct  197  AEHSGVASKLSWEMEQQLGY-TIKSDISR  224



>ref|XP_002306920.1| hypothetical protein POPTR_0005s25880g [Populus trichocarpa]
 gb|EEE93916.1| hypothetical protein POPTR_0005s25880g [Populus trichocarpa]
Length=222

 Score =   378 bits (971),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNP+YQ AAIQL  QLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FRRVCVFCGSSPGKNPNYQHAAIQLGKQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITG+TVGEV+AVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   LGVIPKTLMPREITGDTVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITP+ARHI+VSA TAQELM  LEDY 
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSANTAQELMCLLEDYE  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
             +H+GVA KLSWEM QQLGY T KS+I+R
Sbjct  195  AEHSGVASKLSWEMGQQLGY-TVKSDISR  222



>ref|XP_007017774.1| Lysine decarboxylase family protein [Theobroma cacao]
 gb|EOY14999.1| Lysine decarboxylase family protein [Theobroma cacao]
Length=240

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNPSYQL+AIQL  QLVERNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  33   FRRVCVFCGSSPGKNPSYQLSAIQLGQQLVERNIDLVYGGGSIGLMGLVSQAVFDGGRHV  92

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  93   LGVIPKTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  152

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+AR I+VSA TAQELM +LE+Y 
Sbjct  153  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARDIIVSAQTAQELMCKLEEYE  212

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+ VA KLSWEMEQQLG+ T KS+IAR
Sbjct  213  PKHSEVASKLSWEMEQQLGF-TAKSDIAR  240



>ref|XP_006386178.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
 gb|ERP63975.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
Length=224

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNP+YQ AA+QL  QLVERNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  17   FRRVCVFCGSSPGKNPNYQHAAVQLGKQLVERNIDLVYGGGSIGLMGLISQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TP+ARHI+VSA TA ELM +LEDY 
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAHTAHELMCKLEDYE  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
             +H+GVA KLSWEMEQQLGY   KS+I+R
Sbjct  197  AEHSGVASKLSWEMEQQLGY-PIKSDISR  224



>ref|XP_010255159.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nelumbo nucifera]
Length=220

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 196/209 (94%), Gaps = 3/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK PSYQLAAIQL N+LVERNIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  15   FKRICVFCGSSPGKKPSYQLAAIQLGNELVERNIDLVYGGGSVGLMGLISQAVYDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTL  REITG TVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTL--REITGVTVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITP+ARHI+VSA TA ELM +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSAQTAHELMCKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH GVA KLSWEMEQQLGY  TKS+IAR
Sbjct  193  PKHCGVASKLSWEMEQQLGY-PTKSDIAR  220



>ref|XP_011083519.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Sesamum indicum]
Length=234

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNP+Y+LAAI LA QLVER IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  27   FKRICVFCGSSPGKNPTYRLAAIHLAKQLVERQIDLVYGGGSIGLMGLVSQAVYDGGRHV  86

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREI+GE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  87   LGVIPTTLMPREISGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  146

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITPSARHI+VSA TA +L+S+LEDY 
Sbjct  147  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPSARHIIVSAQTAHDLISKLEDYN  206

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P HN  A KLSWEMEQQLGY T KS+IAR
Sbjct  207  PMHNESATKLSWEMEQQLGY-TAKSDIAR  234



>ref|XP_004152760.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
 gb|KGN62667.1| hypothetical protein Csa_2G367210 [Cucumis sativus]
Length=232

 Score =   376 bits (965),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GKNPSYQ+AAIQL NQLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  25   FRRICVFCGSSSGKNPSYQIAAIQLGNQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  84

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPK+LMP+EITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  85   LGVIPKSLMPKEITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  144

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV+EGF++P+AR I+VSAPT   L+++LE+YV
Sbjct  145  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPAARSIIVSAPTPHALITKLEEYV  204

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+ VA KLSWE+EQQLG+ T KS+IAR
Sbjct  205  PKHSSVASKLSWEIEQQLGF-TVKSDIAR  232



>ref|XP_008221287.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Prunus mume]
Length=220

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 194/209 (93%), Gaps = 5/209 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAAIQL  QLVERNIDLVYGGGSIGLMG VSQAVY+GGRHV
Sbjct  17   FKRICVFCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGQVSQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPRTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI+VSA TAQELM +LEDY+
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIDPAARHIIVSAQTAQELMCKLEDYI  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+G    LSWEMEQQL Y T KS+IAR
Sbjct  197  PKHSG----LSWEMEQQLEY-TAKSDIAR  220



>ref|XP_004172206.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
Length=232

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GKNPSYQ+AAIQL NQLVERNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  25   FRRICVFCGSSSGKNPSYQIAAIQLGNQLVERNIDLVYGGGSIGLMGLVSQAVYDGGRHV  84

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPK+LMP+EITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  85   LGVIPKSLMPKEITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  144

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV+EGF++P+AR I+VSAPT   L+++LE+YV
Sbjct  145  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPAARSIIVSAPTPHALITKLEEYV  204

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+ VA KLSWE+EQQLG+ T KS+IAR
Sbjct  205  PKHSSVASKLSWEIEQQLGF-TVKSDIAR  232



>ref|XP_004500949.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cicer arietinum]
Length=219

 Score =   374 bits (959),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CV+CGSSPGKNPSYQ+AAIQL  QLVERNIDLVYGGGSIGLMGL+SQ VY+GGRHV
Sbjct  12   FTRICVYCGSSPGKNPSYQIAAIQLGKQLVERNIDLVYGGGSIGLMGLISQVVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  72   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEIITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TA +LM +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAQTALDLMCKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH G  PKLSWEMEQQL   T KS+I+R
Sbjct  192  PKHCGEGPKLSWEMEQQL-VNTAKSDISR  219



>ref|XP_003527691.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Glycine max]
Length=221

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CV+CGSSPGKNPSYQLAAIQL  QLVERNIDLVYGGGSIGLMGL+SQ VY+GGRHV
Sbjct  14   FRRICVYCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLISQVVYDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TL  REITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  74   LGVIPETLNAREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEIITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TAQELM +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAHTAQELMCKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVAPKLSWEMEQQL   T KS+I+R
Sbjct  194  PEHCGVAPKLSWEMEQQL-VNTAKSDISR  221



>ref|XP_003523551.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Glycine max]
Length=221

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CV+CGSSPGKNPSYQLAAIQL  QLVERNIDLVYGGGSIGLMGL+SQ VY+GGRHV
Sbjct  14   FRRICVYCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLISQVVYDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTL  +EITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  74   LGVIPKTLNAKEITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEIITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TAQ+LM +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAHTAQDLMCKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVAPKLSWEMEQQL   T KS+I+R
Sbjct  194  PEHCGVAPKLSWEMEQQL-VNTAKSDISR  221



>ref|XP_008785140.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Phoenix dactylifera]
Length=228

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 197/209 (94%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPG  PSYQLAAIQL ++LVERNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  22   FRRVCVFCGSSPGNKPSYQLAAIQLGHELVERNIDLVYGGGSVGLMGLVSQAVYDGGRHV  81

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+ +DAFIALPGGYGTLEELLEVITW
Sbjct  82   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARHADAFIALPGGYGTLEELLEVITW  141

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TP+ARHI++SA TA EL+ +LE+Y+
Sbjct  142  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIISAQTAHELLYKLEEYM  201

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+GVAPKLSWEME QLG+ + KSEIAR
Sbjct  202  PMHDGVAPKLSWEME-QLGH-SPKSEIAR  228



>ref|XP_010941274.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Elaeis guineensis]
Length=226

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPG   SYQLAAIQL N+LVERNIDLVYGGGSIGLMGLVS AVYNGGRHV
Sbjct  20   FRRVCVFCGSSPGNKASYQLAAIQLGNELVERNIDLVYGGGSIGLMGLVSHAVYNGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  80   IGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI++SA  A EL+S+LE+YV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARHIIISAQNAHELLSKLEEYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+H GVAPKLSWEME QLG+ + KSEIA
Sbjct  200  PEHEGVAPKLSWEME-QLGH-SRKSEIA  225



>ref|XP_007225794.1| hypothetical protein PRUPE_ppa011245mg [Prunus persica]
 gb|EMJ26993.1| hypothetical protein PRUPE_ppa011245mg [Prunus persica]
Length=217

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 5/209 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGKNPSYQLAAIQL  QLVERNIDLVYGGGSIGLMG VSQAVY+GGRHV
Sbjct  14   FKRLCVFCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGQVSQAVYDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  74   LGVIPRTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI+VSA TAQELM +LE+Y+
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIDPAARHIIVSAQTAQELMCKLEEYI  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+G    LSWEMEQQL + T KS+IAR
Sbjct  194  PKHSG----LSWEMEQQLEF-TAKSDIAR  217



>ref|XP_003603739.1| Carboxy-lyase [Medicago truncatula]
 gb|AES73990.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
Length=221

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CV+CGS+PGKNPSYQ+AAIQL  QLVERNIDLVYGGGSIGLMG +SQ VY+GGRHV
Sbjct  14   FKRICVYCGSTPGKNPSYQIAAIQLGKQLVERNIDLVYGGGSIGLMGRISQVVYDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLM REITGETVGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  74   LGVIPKTLMLREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEIITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TAQ+LM +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAHTAQDLMCKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH GVAPKLSWEMEQQL   T K +I+R
Sbjct  194  PKHCGVAPKLSWEMEQQL-VNTAKLDISR  221



>ref|NP_001239732.1| uncharacterized protein LOC100814612 [Glycine max]
 gb|ACU23883.1| unknown [Glycine max]
 gb|KHN12650.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=215

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCG+SPGKNPSYQLAAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  18   FRRICVFCGTSPGKNPSYQLAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  78   LGVIPTTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+D AV+EGFITP+ARHI+VSA TAQ+LM +LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFMDNAVDEGFITPAARHIIVSAQTAQDLMCKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQQL  932
            PKH GVAPK SWEM QQL
Sbjct  198  PKHCGVAPKQSWEMNQQL  215



>ref|XP_010061042.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Eucalyptus grandis]
 gb|KCW67942.1| hypothetical protein EUGRSUZ_F01639 [Eucalyptus grandis]
Length=225

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGKNPSYQLAAIQL +QLVER IDLVYGGGSIGLMGLVSQ V++GGRHV
Sbjct  17   FKRVCVFCGSSPGKNPSYQLAAIQLGHQLVERCIDLVYGGGSIGLMGLVSQVVFDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGET+GEVR V GMHQRKAEMA+ +DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPRTLMPREITGETIGEVRPVCGMHQRKAEMARHADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL F+DKAV+EGF++PSARHI+VSAPT  ELMS+LE+YV
Sbjct  137  AQLGIHDKPVGLLNVEGYYNSLLSFLDKAVDEGFVSPSARHIIVSAPTPHELMSKLEEYV  196

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H+GVA K  WE EQQ GY  TKS+I R
Sbjct  197  PEHSGVASKQCWEKEQQAGYYCTKSDIVR  225



>ref|XP_010910906.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Elaeis guineensis]
Length=228

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 197/209 (94%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGK PSYQL+AIQL ++LVERNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  22   FRRVCVFCGSSPGKKPSYQLSAIQLGHELVERNIDLVYGGGSVGLMGLVSQAVYDGGRHV  81

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+ LMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  82   LGVIPRFLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  141

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV+EGFITP+ARHI++SA TA EL+ +LE+YV
Sbjct  142  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIISAQTAHELLCKLEEYV  201

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P  +GVAPKLSWEME QLG+ + KSEIAR
Sbjct  202  PMDDGVAPKLSWEME-QLGH-SPKSEIAR  228



>ref|XP_007160679.1| hypothetical protein PHAVU_001G007800g [Phaseolus vulgaris]
 gb|ESW32673.1| hypothetical protein PHAVU_001G007800g [Phaseolus vulgaris]
Length=212

 Score =   368 bits (944),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCG+SPGKNPSYQLAA+QL  QLVE+NIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  15   FRRICVFCGTSPGKNPSYQLAAVQLGKQLVEKNIDLVYGGGSIGLMGLISQVVFDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   LGVIPTTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+D AV+EGFITP ARHI+VSA TAQ+L+S LE+YV
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFMDNAVDEGFITPPARHIIVSAQTAQDLISNLEEYV  194

Query  879  PKHNGVAPKLSWEMEQQL  932
            PKH+GVAPK SWEMEQQL
Sbjct  195  PKHSGVAPKQSWEMEQQL  212



>ref|XP_007136081.1| hypothetical protein PHAVU_009G016000g [Phaseolus vulgaris]
 gb|ESW08075.1| hypothetical protein PHAVU_009G016000g [Phaseolus vulgaris]
Length=221

 Score =   368 bits (945),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CV+CGSSPG++PSYQLAA+QL  QLVER IDLVYGGGSIGLMGL+SQ VY+GGRHV
Sbjct  14   FRRICVYCGSSPGRSPSYQLAAVQLGKQLVERKIDLVYGGGSIGLMGLISQVVYDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTL  REITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  74   LGVIPKTLNAREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEIITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TAQ+LM +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAQTAQDLMCKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVAPKLSWEMEQQL   T KS+I+R
Sbjct  194  PEHCGVAPKLSWEMEQQL-VNTAKSDISR  221



>gb|KHN45916.1| Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6 [Glycine soja]
Length=225

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 196/213 (92%), Gaps = 5/213 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQL----VERNIDLVYGGGSIGLMGLVSQAVYNG  506
            F+R+CV+CGSSPGKNPSYQLAAIQL  QL    VERNIDLVYGGGSIGLMGL+SQ VY+G
Sbjct  14   FRRICVYCGSSPGKNPSYQLAAIQLGKQLASIYVERNIDLVYGGGSIGLMGLISQVVYDG  73

Query  507  GRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLE  686
            GRHVLGVIPKTL  +EITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE
Sbjct  74   GRHVLGVIPKTLNAKEITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLE  133

Query  687  VITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRL  866
            +ITWAQLGIHDKPVGLLNVDGYYNSLL F+DKAV+EGF+TP+ARHI+VSA TAQ+LM +L
Sbjct  134  IITWAQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAHTAQDLMCKL  193

Query  867  EDYVPKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            E+YVP+H GVAPKLSWEMEQQL   T KS+I+R
Sbjct  194  EEYVPEHCGVAPKLSWEMEQQL-VNTAKSDISR  225



>ref|XP_010920269.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Elaeis guineensis]
Length=219

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 195/209 (93%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSS GK  SYQLAAIQL ++LVERNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  13   FGRVCVFCGSSRGKKLSYQLAAIQLGHELVERNIDLVYGGGSVGLMGLVSQAVYDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  73   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FIDKAV+EGFITP+ARHI++SA TA EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNYLLSFIDKAVDEGFITPAARHIIISAQTAHELLCKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+GVAP+LSWEME QLG+ + +SEIAR
Sbjct  193  PMHDGVAPQLSWEME-QLGH-SPRSEIAR  219



>ref|XP_010935044.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Elaeis guineensis]
Length=226

 Score =   366 bits (939),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 193/209 (92%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGK  SYQLAAIQL N+LVERNIDLVYGGGS+GLMG VSQA +NGG HV
Sbjct  20   FRRVCVFCGSSPGKKASYQLAAIQLGNELVERNIDLVYGGGSVGLMGFVSQAAHNGGCHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  80   LGVIPRTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+LL FIDKAV+EGFI P+ARHI++SA TA EL+S+LE+YV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNTLLSFIDKAVDEGFIAPAARHIIISAQTANELLSKLEEYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVAPKL WEME QLG+ + K +IAR
Sbjct  200  PRHEGVAPKLKWEME-QLGH-SRKPDIAR  226



>ref|XP_006600223.1| PREDICTED: uncharacterized protein LOC100814612 isoform X1 [Glycine 
max]
Length=216

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCG+SPGKNPSYQLAAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  18   FRRICVFCGTSPGKNPSYQLAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGE+VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  78   LGVIPTTLMPREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKP-VGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDY  875
            AQLGIHDKP VGLLNVDGYYNSLL F+D AV+EGFITP+ARHI+VSA TAQ+LM +LE+Y
Sbjct  138  AQLGIHDKPQVGLLNVDGYYNSLLSFMDNAVDEGFITPAARHIIVSAQTAQDLMCKLEEY  197

Query  876  VPKHNGVAPKLSWEMEQQL  932
            VPKH GVAPK SWEM QQL
Sbjct  198  VPKHCGVAPKQSWEMNQQL  216



>ref|XP_011077347.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Sesamum indicum]
Length=219

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA+QL N LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQEAAVQLGNVLVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTATELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPKLSWEMEQQLGY + K +I+R
Sbjct  192  PRHERVAPKLSWEMEQQLGY-SQKYDISR  219



>ref|XP_011045113.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Populus euphratica]
Length=222

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNP+YQ AAIQL  QLVER IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FRRVCVFCGSSPGKNPNYQHAAIQLGKQLVERKIDLVYGGGSIGLMGLVSQAVYDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEV+AVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   LGVIPKTLMPREITGETVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFITP+ARHI+VSA TAQELM  LEDY 
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFITPAARHIIVSAHTAQELMCLLEDYE  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
             +  GVA KLS EM Q LGY T KS+I+R
Sbjct  195  AERPGVASKLSGEMGQPLGY-TVKSDISR  222



>ref|XP_010244087.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Nelumbo nucifera]
Length=220

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 192/209 (92%), Gaps = 3/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK PSYQ+AA QL  +LVER+IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FKRVCVFCGSSPGKKPSYQIAANQLGKELVERSIDLVYGGGSIGLMGLVSQAVYDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTL  +E+TG TVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTL--KEVTGTTVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+ P+ARHI+VSA TA ELM +LE YV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVAPAARHIIVSAQTAHELMCKLEVYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH GVA KLSWEMEQQLGY  +KS+IAR
Sbjct  193  PKHCGVASKLSWEMEQQLGY-PSKSDIAR  220



>ref|XP_010530287.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Tarenaya hassleriana]
Length=214

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GKN SYQLAAIQL   LVERNIDLVYGGGSIGLMGLVS+AVY+GGRHV
Sbjct  7    FKRICVFCGSSVGKNLSYQLAAIQLGKLLVERNIDLVYGGGSIGLMGLVSRAVYSGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVR VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  67   LGVIPKTLMPREITGETVGEVRPVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYY+SLL FIDKAV+EGF+ P+ARHI++SA TA ELM +LE+YV
Sbjct  127  AQLGIHQKPVGLLNVDGYYDSLLSFIDKAVDEGFVAPAARHIIISASTAHELMCKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+ + V PKLSWEMEQQLGY +TKS++ R
Sbjct  187  PETD-VGPKLSWEMEQQLGYNSTKSDMYR  214



>ref|XP_008807568.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Phoenix dactylifera]
Length=219

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 194/209 (93%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSS GK  SYQ AAIQL ++LVERNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  13   FGRVCVFCGSSRGKKLSYQFAAIQLGHELVERNIDLVYGGGSVGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  73   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYN LL FIDKAV+EGFITP+ARHI++SAPTA EL+ +LE+YV
Sbjct  133  AQLGIHGKPVGLLNVDGYYNYLLSFIDKAVDEGFITPAARHIIISAPTAHELLCKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+GVAP+LSWEME QLG+ + +SEI+R
Sbjct  193  PMHDGVAPQLSWEME-QLGH-SPRSEISR  219



>ref|XP_006846812.1| hypothetical protein AMTR_s00148p00076970 [Amborella trichopoda]
 gb|ERN08393.1| hypothetical protein AMTR_s00148p00076970 [Amborella trichopoda]
Length=218

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L N+LV  NIDLVYGGGS+GLMGLVSQAV+ GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQAAAVELGNELVSMNIDLVYGGGSVGLMGLVSQAVHEGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPAARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVA KLSWEME QLGY +TK EI+R
Sbjct  192  PRHEGVASKLSWEME-QLGY-STKCEISR  218



>ref|XP_004497512.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cicer arietinum]
Length=220

 Score =   358 bits (919),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK  SYQ AAIQL N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRVCVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPT++EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW+MEQQL +
Sbjct  193  PCHEGVASKLSWQMEQQLAF  212



>ref|XP_003554380.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Glycine max]
Length=219

 Score =   358 bits (919),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SYQ AAIQL N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW++EQQL Y
Sbjct  192  PCHEGVASKLSWQIEQQLAY  211



>gb|KHN02336.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=267

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SYQ AAIQL N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW++EQQL Y
Sbjct  192  PCHEGVASKLSWQIEQQLAY  211



>ref|XP_009413755.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Musa acuminata subsp. malaccensis]
Length=224

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 191/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPG+ PSYQLAAIQL ++LV RNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  18   FRRVCVFCGSSPGRKPSYQLAAIQLGHELVRRNIDLVYGGGSVGLMGLVSQAVHDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITG+TVGEVRAVSGMHQRKAEMA Q+DAFIALPGGYGTLEELLEVITW
Sbjct  78   LGVIPRTLMPREITGDTVGEVRAVSGMHQRKAEMASQADAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYY+SLL FIDKAV+EGFI P+ARHI++SA T+ EL+S LEDY 
Sbjct  138  AQLGIHDKPVGLLNVDGYYDSLLSFIDKAVDEGFIAPAARHIIISAQTSHELLSELEDYQ  197

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+GVAP+LSWE E +LG  + KS I R
Sbjct  198  PMHDGVAPQLSWERE-RLG-QSPKSNIGR  224



>ref|XP_003590484.1| hypothetical protein MTR_1g064260 [Medicago truncatula]
 gb|AES60735.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
Length=219

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRVCVFCGSSPGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPT++EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW+MEQ+L Y
Sbjct  192  PCHEGVASKLSWQMEQELAY  211



>ref|NP_001241195.1| uncharacterized protein LOC100787375 [Glycine max]
 gb|ACU18655.1| unknown [Glycine max]
Length=219

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  +YQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSPGKKSTYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW++EQQL Y
Sbjct  192  PCHEGVASKLSWQIEQQLAY  211



>ref|NP_001241594.1| uncharacterized protein LOC100785143 [Glycine max]
 gb|ACU22743.1| unknown [Glycine max]
Length=213

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFC +S GKNPSYQ AAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  16   FRRICVFCDTSHGKNPSYQHAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMP EITGE+VGEVRAVSGMHQRKAEMA+++DAFIALPGGYGTLEELLEVITW
Sbjct  76   LGVIPTTLMPIEITGESVGEVRAVSGMHQRKAEMAREADAFIALPGGYGTLEELLEVITW  135

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+D AV++GFITP+ARHI+VSA TAQ+L+S+LE+YV
Sbjct  136  AQLGIHDKPVGLLNVDGYYNSLLSFMDNAVDQGFITPAARHIIVSAQTAQDLISKLEEYV  195

Query  879  PKHNGVAPKLSWEMEQQL  932
            PKH GVAPK SWEM QQL
Sbjct  196  PKHCGVAPKQSWEMNQQL  213



>ref|XP_007162751.1| hypothetical protein PHAVU_001G177400g [Phaseolus vulgaris]
 gb|ESW34745.1| hypothetical protein PHAVU_001G177400g [Phaseolus vulgaris]
Length=219

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSSPGK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FNRICVFCGSSPGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW++EQQL Y
Sbjct  192  PCHEGVASKLSWQIEQQLAY  211



>ref|XP_009335163.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Pyrus x bretschneideri]
Length=216

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 186/209 (89%), Gaps = 5/209 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GKNPSYQLAAI+L  +LVER+IDLVYGGGSIGLMG VSQ VY+GGRHV
Sbjct  13   FSRICVFCGSSAGKNPSYQLAAIKLGKELVERSIDLVYGGGSIGLMGQVSQVVYDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGE VGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  73   LGVIPTTLMPREITGEPVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI+VSA T  ELM +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIDPAARHIIVSAETPHELMCKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH G    LSWEMEQQL Y T KS+IAR
Sbjct  193  PKHCG----LSWEMEQQLEY-TAKSDIAR  216



>ref|XP_007144351.1| hypothetical protein PHAVU_007G148800g [Phaseolus vulgaris]
 gb|ESW16345.1| hypothetical protein PHAVU_007G148800g [Phaseolus vulgaris]
Length=219

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRVCVFCGSSPGKKRSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPT++EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA KLSW+MEQQL Y
Sbjct  192  PCHESVASKLSWQMEQQLTY  211



>ref|XP_004493974.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Cicer arietinum]
Length=220

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAIQL N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW+MEQQL Y
Sbjct  193  PCHEGVASKLSWQMEQQLAY  212



>ref|XP_009380387.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Musa acuminata subsp. malaccensis]
Length=224

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 192/209 (92%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F RVCVFCGSSPGK  SYQLAA QL ++LV+RNIDLVYGGGSIGLMGLVS+AV++GGRHV
Sbjct  18   FGRVCVFCGSSPGKKASYQLAATQLGHELVQRNIDLVYGGGSIGLMGLVSRAVHDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGE+R VSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLE ITW
Sbjct  78   LGVIPRTLMPREITGETVGELRPVSGMHQRKAEMARQADAFIALPGGYGTLEELLEAITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI++S+ TA EL+S+LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIAPAARHIIISSQTAHELLSKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+G APKLSWEME QLG+ + K +I+R
Sbjct  198  PTHDGGAPKLSWEME-QLGH-SPKLDISR  224



>gb|KHN39436.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=203

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFC +S GKNPSYQ AAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  6    FRRICVFCDTSHGKNPSYQHAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  65

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMP EITGE+VGEVRAVSGMHQRKAEMA+++DAFIALPGGYGTLEELLEVITW
Sbjct  66   LGVIPTTLMPIEITGESVGEVRAVSGMHQRKAEMAREADAFIALPGGYGTLEELLEVITW  125

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+D AV++GFITP+ARHI+VSA TAQ+L+S+LE+YV
Sbjct  126  AQLGIHDKPVGLLNVDGYYNSLLSFMDNAVDQGFITPAARHIIVSAQTAQDLISKLEEYV  185

Query  879  PKHNGVAPKLSWEMEQQL  932
            PKH GVAPK SWEM QQL
Sbjct  186  PKHCGVAPKQSWEMNQQL  203



>ref|XP_008369688.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Malus domestica]
Length=219

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSARHI++SAPTA+EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISAPTAKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VAPKL+WE+E QLGYT
Sbjct  193  PCHERVAPKLNWEIE-QLGYT  212



>ref|NP_001240198.1| uncharacterized protein LOC100791145 [Glycine max]
 gb|ACU18068.1| unknown [Glycine max]
 gb|KHN39072.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
 gb|KHN48287.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=219

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRVCVFCGSSPGKKRSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPT++EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTSKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA KLSW++EQQL Y
Sbjct  192  PCHESVASKLSWQIEQQLTY  211



>gb|KEH17130.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
 gb|AES81854.2| cytokinin riboside 5'-monophosphate phosphoribohydrolase [Medicago 
truncatula]
Length=220

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  +YQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSPGKKTTYQDAAMNLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW+MEQQL Y
Sbjct  193  PCHEGVASKLSWQMEQQLAY  212



>ref|XP_009342948.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Pyrus x bretschneideri]
 ref|XP_009350718.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Pyrus x bretschneideri]
Length=219

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSARHI++SAPTA+EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISAPTAKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KL+WEME QLGY T + +I+R
Sbjct  193  PCHERVASKLNWEME-QLGY-TQECDISR  219



>ref|XP_002285246.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Vitis vinifera]
Length=218

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+PSARHI+VSAPTA+ELM +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEDFISPSARHIIVSAPTARELMKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVA KLSWE E QLGY + K E++R
Sbjct  192  PRHEGVASKLSWETE-QLGY-SPKCELSR  218



>ref|XP_010557341.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Tarenaya hassleriana]
Length=213

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AA++L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSPGKKTSYRDAAVELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MH+RKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSARHI+VSAP A++L+ ++E+YV
Sbjct  127  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPNAKDLVKKMEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVA KLSWEME Q+G+   K E++R
Sbjct  187  PRHEGVASKLSWEME-QIGF-NPKCEVSR  213



>emb|CBI16329.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  6    FKRICVFCGSSQGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYDGGRHV  65

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  66   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  125

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+PSARHI+VSAPTA+ELM +LE+Y 
Sbjct  126  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEDFISPSARHIIVSAPTARELMKKLEEYF  185

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVA KLSWE E QLGY + K E++R
Sbjct  186  PRHEGVASKLSWETE-QLGY-SPKCELSR  212



>ref|XP_010253716.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X1 [Nelumbo nucifera]
Length=218

 Score =   353 bits (905),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  12   FKRICVFCGSSNGKKSSYQDAAIELGRELVSRNIDLVYGGGSVGLMGLVSQAVYNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI GETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREICGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL F+DKAV EGFI+PSARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFVDKAVEEGFISPSARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA +LSWEME QLGY ++  +I+R
Sbjct  192  PRHEKVASQLSWEME-QLGY-SSDCDISR  218



>ref|XP_003625636.1| hypothetical protein MTR_7g101290 [Medicago truncatula]
 gb|ABD32794.1| Conserved hypothetical protein 730 [Medicago truncatula]
Length=260

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  +YQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSPGKKTTYQDAAMNLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW+MEQQL Y
Sbjct  193  PCHEGVASKLSWQMEQQLAY  212



>emb|CDP06745.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV+NGGRHV
Sbjct  12   FGRICVFCGSSQGKKTSYQDAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVHNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPRE+TGE VGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   LGVIPKTLMPRELTGEPVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSARHI+VSAPTAQEL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAQELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P+H GVA KLSWEME QLGY  T
Sbjct  192  PRHEGVASKLSWEME-QLGYPPT  213



>ref|XP_011094655.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Sesamum indicum]
Length=218

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L   LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKTSYQEAAIELGKVLVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPKLSWEME QLGY + K +++R
Sbjct  192  PRHERVAPKLSWEME-QLGY-SQKYDMSR  218



>ref|XP_007206768.1| hypothetical protein PRUPE_ppa025305mg [Prunus persica]
 ref|XP_008243947.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Prunus mume]
 gb|EMJ07967.1| hypothetical protein PRUPE_ppa025305mg [Prunus persica]
Length=218

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 184/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FGRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSARHI++SAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIISAPTARELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KL+WEME QLGYT
Sbjct  192  PCHERVASKLNWEME-QLGYT  211



>ref|XP_009610234.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Nicotiana tomentosiformis]
Length=219

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAIQL  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPT +EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSAPTPKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KLSWEME QLGY   + EIAR
Sbjct  193  PCHERVASKLSWEME-QLGYPQAQ-EIAR  219



>ref|XP_008807508.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Phoenix dactylifera]
Length=218

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 191/209 (91%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAVELGKELVSRNIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAF+ALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFMALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H GVA KL+WEME +LGY ++K EI+R
Sbjct  192  PRHEGVASKLNWEME-RLGY-SSKHEISR  218



>gb|KHN09504.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Glycine soja]
Length=219

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  +YQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQ V++GG HV
Sbjct  12   FKRICVFCGSSPGKKSTYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQDVHDGGHHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL+NVDGY+NSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LEDYV
Sbjct  132  AQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYV  191

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H GVA KLSW++EQQL Y
Sbjct  192  PCHEGVASKLSWQIEQQLAY  211



>ref|NP_001244911.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG6 
[Solanum lycopersicum]
 dbj|BAM09001.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase-like 
[Solanum lycopersicum]
Length=220

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAP+++EL+ +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPSSKELVKKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H GVA KL+WE E QLGY   + EI+R
Sbjct  194  PSHEGVASKLNWETE-QLGYPQAQ-EISR  220



>ref|XP_002276279.2| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Vitis vinifera]
 emb|CBI32740.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAIQL  +LV RNIDLVYGGGSIGLMGLVSQAV+NGGRHV
Sbjct  12   FKRICVFCGSSQGKKTSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVSQAVHNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TG TVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  72   IGVIPKTLMPRELTGVTVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSARHI+VSAPTA+EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAEELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P H GVA KLSWEMEQ
Sbjct  192  PSHQGVASKLSWEMEQ  207



>ref|XP_009373527.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Pyrus x bretschneideri]
Length=219

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSARHI++SAPTA+EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISAPTAKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VAPKL+W++E QLGYT
Sbjct  193  PCHERVAPKLNWDVE-QLGYT  212



>ref|XP_008805210.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Phoenix dactylifera]
Length=218

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQDAAVELGKELVSRNIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPGARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KL+WEME QLGY ++K EI+R
Sbjct  192  PCHERVASKLNWEME-QLGY-SSKREISR  218



>ref|XP_008359648.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin riboside 5'-monophosphate 
phosphoribohydrolase LOG3-like [Malus domestica]
Length=219

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 184/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMAK SDAF ALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMAKHSDAFXALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSARHI++SAPTA+EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIISAPTAKELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KL+WEME QLGYT
Sbjct  193  PCHERVASKLNWEME-QLGYT  212



>ref|XP_006595550.1| PREDICTED: uncharacterized protein LOC100785143 isoform X1 [Glycine 
max]
Length=214

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFC +S GKNPSYQ AAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  16   FRRICVFCDTSHGKNPSYQHAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMP EITGE+VGEVRAVSGMHQRKAEMA+++DAFIALPGGYGTLEELLEVITW
Sbjct  76   LGVIPTTLMPIEITGESVGEVRAVSGMHQRKAEMAREADAFIALPGGYGTLEELLEVITW  135

Query  699  AQLGIHDKP-VGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDY  875
            AQLGIHDKP VGLLNVDGYYNSLL F+D AV++GFITP+ARHI+VSA TAQ+L+S+LE+Y
Sbjct  136  AQLGIHDKPQVGLLNVDGYYNSLLSFMDNAVDQGFITPAARHIIVSAQTAQDLISKLEEY  195

Query  876  VPKHNGVAPKLSWEMEQQL  932
            VPKH GVAPK SWEM QQL
Sbjct  196  VPKHCGVAPKQSWEMNQQL  214



>ref|XP_006595551.1| PREDICTED: uncharacterized protein LOC100785143 isoform X2 [Glycine 
max]
 ref|XP_006595552.1| PREDICTED: uncharacterized protein LOC100785143 isoform X3 [Glycine 
max]
Length=207

 Score =   349 bits (896),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFC +S GKNPSYQ AAIQLA QLVERNIDLVYGGGSIGLMGL+SQ V++GGRHV
Sbjct  9    FRRICVFCDTSHGKNPSYQHAAIQLAKQLVERNIDLVYGGGSIGLMGLISQVVFDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMP EITGE+VGEVRAVSGMHQRKAEMA+++DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPTTLMPIEITGESVGEVRAVSGMHQRKAEMAREADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKP-VGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDY  875
            AQLGIHDKP VGLLNVDGYYNSLL F+D AV++GFITP+ARHI+VSA TAQ+L+S+LE+Y
Sbjct  129  AQLGIHDKPQVGLLNVDGYYNSLLSFMDNAVDQGFITPAARHIIVSAQTAQDLISKLEEY  188

Query  876  VPKHNGVAPKLSWEMEQQL  932
            VPKH GVAPK SWEM QQL
Sbjct  189  VPKHCGVAPKQSWEMNQQL  207



>gb|KHG02823.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
-like protein [Gossypium arboreum]
Length=218

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  12   FKRICVFCGSSPGKKNSYREAAIDLGRELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AVS MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVSDMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI++SAPTAQ+L+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIILSAPTAQDLVKYMEEYE  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPKL+WE+E QLGY   K E++R
Sbjct  192  PQHERVAPKLNWEIE-QLGY-PAKYEVSR  218



>ref|XP_007027342.1| Lysine decarboxylase family protein isoform 2 [Theobroma cacao]
 gb|EOY07844.1| Lysine decarboxylase family protein isoform 2 [Theobroma cacao]
Length=218

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FRRICVFCGSSQGKKSSYQDAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I+VSAPTA+EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTAKELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P H  VA KLSWEME QLGY+ T
Sbjct  192  PCHERVASKLSWEME-QLGYSKT  213



>ref|XP_009596604.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X2 [Nicotiana tomentosiformis]
Length=221

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  15   FKRICVFCGSSQGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LE+YV
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSAPTAKELVKKLEEYV  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KLSWEME QLGY   + E+AR
Sbjct  195  PCHEQVASKLSWEME-QLGYPQAE-EMAR  221



>gb|EPS64496.1| hypothetical protein M569_10285, partial [Genlisea aurea]
Length=212

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CV+CGS+ G+NPS++LAA++LA +LV+R IDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  5    FKRICVYCGSTSGRNPSFRLAAVELAKELVDRKIDLVYGGGSIGLMGLVSQAVYDGGRHV  64

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLM REI+GE VGEV+AVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  65   LGVIPRTLMSREISGEPVGEVKAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  124

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDG+YNSLL FIDKAV+EGFIT +ARHI+VSA +A+ELMS+LE+YV
Sbjct  125  AQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFITLAARHIIVSAYSARELMSKLEEYV  184

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H+ +  +L WEMEQQLGY T  S++AR
Sbjct  185  PCHDEITERLRWEMEQQLGYKTI-SDMAR  212



>ref|XP_002529933.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF32441.1| carboxy-lyase, putative [Ricinus communis]
Length=218

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY GGRHV
Sbjct  12   FKRICVFCGSSPGKKTSYKDAAIELGKELVARNIDLVYGGGSIGLMGLISQAVYEGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+LL FIDKAV EGFI P+ARHI+VSAPT +EL+ ++E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNTLLSFIDKAVEEGFINPTARHIIVSAPTPKELVKKMEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPKL+WE E QLGY + K EI+R
Sbjct  192  PRHEIVAPKLNWENE-QLGY-SPKYEISR  218



>gb|AFK40158.1| unknown [Lotus japonicus]
Length=222

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGK  SYQ AAI+L N+LV R+IDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  15   FKRVCVFCGSSPGKKRSYQDAAIELGNELVSRSIDLVYGGGSIGLMGLVSQAVHDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGL++VDGY+NSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LEDYV
Sbjct  135  AQLGIHDKPVGLVDVDGYFNSLLSFIDKAVEEGFISPNARDIIVSAPTAKELVKKLEDYV  194

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H G A KLSW+MEQQL Y
Sbjct  195  PCHEGDALKLSWQMEQQLAY  214



>ref|XP_007016779.1| Lysine decarboxylase family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY34398.1| Lysine decarboxylase family protein, putative isoform 2 [Theobroma 
cacao]
Length=220

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK +CVFCGSSPGK  SY+ A I+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  14   FKSICVFCGSSPGKKSSYREATIELGRELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPTA+EL+ ++E+Y 
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSAPTAKELVKKMEEYE  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWEME QLGY   K EI+R
Sbjct  194  PQHERVASKLSWEME-QLGY-PAKCEISR  220



>ref|XP_009781791.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Nicotiana sylvestris]
Length=221

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  15   FKRICVFCGSSQGKKSSYQDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LE+YV
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSAPTAKELVKKLEEYV  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KLSWEME QLGY   + E+AR
Sbjct  195  PCHERVASKLSWEME-QLGYPQAQ-EMAR  221



>ref|XP_011048543.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Populus euphratica]
Length=226

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ+AAI L N+LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  20   FKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLISQAVHDGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  80   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR+I++SAPTA+EL+ +LE+YV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARNIILSAPTAKELVKKLEEYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KLSWE+E QLGY+
Sbjct  200  PCHERVASKLSWEIE-QLGYS  219



>ref|XP_009788908.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Nicotiana sylvestris]
Length=219

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAIQL  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPT +EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPNARHIIVSAPTPKELVKKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KLSWEME QLGY   + E+AR
Sbjct  193  PCHERVASKLSWEME-QLGYPQAQ-EMAR  219



>ref|XP_006381447.1| hypothetical protein POPTR_0006s12920g [Populus trichocarpa]
 gb|ERP59244.1| hypothetical protein POPTR_0006s12920g [Populus trichocarpa]
Length=226

 Score =   348 bits (894),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ+AAI L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  20   FKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  80   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSAR+I++SAPTA+EL+ +LE+YV
Sbjct  140  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARNIILSAPTAKELVKKLEEYV  199

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KLSWE+E QLGY+
Sbjct  200  PCHERVASKLSWEIE-QLGYS  219



>ref|XP_010107529.1| hypothetical protein L484_024382 [Morus notabilis]
 gb|EXC16211.1| hypothetical protein L484_024382 [Morus notabilis]
Length=218

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FRRICVFCGSSQGKKTSYQEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSARHI+VSAPTA+EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAKELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P H  VA KLSWE E QLGY  T
Sbjct  192  PCHESVASKLSWETE-QLGYPQT  213



>ref|XP_010906515.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X3 [Elaeis guineensis]
Length=218

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LV  NIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAVELGKELVSGNIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPNARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WEME +LGY ++K EI+R
Sbjct  192  PRHERVASKLNWEME-RLGY-SSKHEISR  218



>gb|KDP44034.1| hypothetical protein JCGZ_05501 [Jatropha curcas]
Length=216

 Score =   347 bits (891),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAPT +EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFINPTARHIIVSAPTPKELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE+E QL Y + K EI+R
Sbjct  190  PRHEIVASKLSWEIE-QLEY-SPKCEISR  216



>ref|XP_004291375.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6-like isoform 1 [Fragaria vesca subsp. 
vesca]
Length=223

 Score =   348 bits (892),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 186/209 (89%), Gaps = 6/209 (3%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSSPGKNPSYQLAA++L  QLVERNIDLVYGGGSIGLMG VS+AVY+GGRHV
Sbjct  21   FKRVCVFCGSSPGKNPSYQLAAVELGKQLVERNIDLVYGGGSIGLMGQVSKAVYDGGRHV  80

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGV+P TLMPREITG+ VGEVRAVSGMHQRKAEMA+Q+DAF+ALPGGYGTLEELLEVI W
Sbjct  81   LGVMPLTLMPREITGDPVGEVRAVSGMHQRKAEMARQADAFVALPGGYGTLEELLEVIAW  140

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYN LL FID +VNEGFI PSARHI+VSAPTA ELM +LE+Y 
Sbjct  141  AQLGIHHKPVGLLNVDGYYNFLLTFIDNSVNEGFIDPSARHIIVSAPTAHELMCKLEEYT  200

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            PKH+G    LSWE E QL Y T KS+IAR
Sbjct  201  PKHSG----LSWEKE-QLEY-TAKSDIAR  223



>ref|XP_008225924.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Prunus mume]
Length=216

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV +NIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQAVYDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDG+YNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGFYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE+E QL Y T   +I+R
Sbjct  190  PRHERVASKLSWEIE-QLSYPTI-CDISR  216



>ref|XP_002880937.1| hypothetical protein ARALYDRAFT_481677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57196.1| hypothetical protein ARALYDRAFT_481677 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKSSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFI+P+ARHIVVSAP+A+EL+ +LEDYV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIVVSAPSAKELVKKLEDYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_010264655.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Nelumbo nucifera]
Length=217

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  12   FKRICVFCGSSHGKKSSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQAVYNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP EI GETVGEV+AV+ MHQRKAEMA++SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPPEICGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P+H  VA +LSWEME QLGY++
Sbjct  192  PRHEKVASQLSWEME-QLGYSS  212



>ref|XP_010935881.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Elaeis guineensis]
Length=218

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAVELGQELVSRNIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA++SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPGARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KL+WEME  LGY ++K EI+R
Sbjct  192  PCHERVASKLNWEME-HLGY-SSKREISR  218



>ref|NP_565668.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Arabidopsis thaliana]
 sp|Q8RUN2.1|LOG1_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1; AltName: Full=Protein LONELY GUY 1 [Arabidopsis 
thaliana]
 gb|AAM15149.1| expressed protein [Arabidopsis thaliana]
 gb|AAM15229.1| expressed protein [Arabidopsis thaliana]
 gb|AAM64338.1| unknown [Arabidopsis thaliana]
 gb|AEC08102.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Arabidopsis thaliana]
Length=213

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKVSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFI+P+ARHI+VSAP+A+EL+ +LEDYV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLEDYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_004246656.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Solanum lycopersicum]
Length=218

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIVSAPTATELVEKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KL+WE E QLGY   + EIAR
Sbjct  192  PCHESVASKLNWETE-QLGYPQVQ-EIAR  218



>ref|XP_010089966.1| hypothetical protein L484_008044 [Morus notabilis]
 gb|EXB38680.1| hypothetical protein L484_008044 [Morus notabilis]
Length=218

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  12   FKRICVFCGSSPGKKTSYKEAAIELGKELVARNIDLVYGGGSVGLMGLISQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VS+P+A+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFICPSARHIIVSSPSAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWE+E QLGY + K +I+R
Sbjct  192  PRHERVASKQSWEIE-QLGY-SPKLDISR  218



>ref|XP_002323469.2| hypothetical protein POPTR_0016s09180g [Populus trichocarpa]
 gb|EEF05230.2| hypothetical protein POPTR_0016s09180g [Populus trichocarpa]
Length=224

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ+AAI L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  18   FKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  78   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSAR+I+VSAPTA+EL+ +LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARNIIVSAPTAKELVKKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQ  926
            P H  VA KLSWE+EQ
Sbjct  198  PCHERVASKLSWEIEQ  213



>ref|XP_006428773.1| hypothetical protein CICLE_v10012707mg [Citrus clementina]
 ref|XP_006481499.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Citrus sinensis]
 gb|ESR42013.1| hypothetical protein CICLE_v10012707mg [Citrus clementina]
 gb|KDO50694.1| hypothetical protein CISIN_1g027662mg [Citrus sinensis]
Length=220

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I+VSAPT +EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTVKELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KL+WEME QLGYT
Sbjct  192  PCHERVASKLNWEME-QLGYT  211



>ref|XP_006354329.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=218

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIVSAPTATELVEKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KL+WE E QLGY   + EIAR
Sbjct  192  PCHESVASKLNWETE-QLGYPQVQ-EIAR  218



>ref|XP_002314282.2| hypothetical protein POPTR_0009s01600g [Populus trichocarpa]
 gb|EEE88237.2| hypothetical protein POPTR_0009s01600g [Populus trichocarpa]
Length=216

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPT +EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE+E QLGY   + +IAR
Sbjct  190  PRHEIVASKLSWEIE-QLGY-PPQCDIAR  216



>gb|KHG18498.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
-like protein [Gossypium arboreum]
Length=218

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ + I+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  12   FKRICVFCGSSPGKKSSYKESTIELGRELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVENMEEYE  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WEME QL Y   K EI+R
Sbjct  192  PQHERVASKLNWEME-QLSY-PAKCEISR  218



>gb|KFK27249.1| hypothetical protein AALP_AA8G357400 [Arabis alpina]
Length=213

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  7    FKRICVFCGSSAGNKTSYRDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVYNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+ARHI+VSAP+A+EL+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIIPTARHIIVSAPSAKELVKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>gb|AII20186.1| riboside 5'-monophosphate phosphoribohydrolase [Nicotiana tabacum]
Length=219

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAIQL  +LV RNIDLVYGGGSIGLM LVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAIQLGKELVSRNIDLVYGGGSIGLMVLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI P+ARHI+VSAPT +EL+ +LE+YV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFICPNARHIIVSAPTPKELVKKLEEYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H  VA KLSWEME QLGY   + E+AR
Sbjct  193  PCHERVASKLSWEME-QLGYPQAQ-EMAR  219



>ref|XP_004291703.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Fragaria vesca subsp. vesca]
Length=216

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SYQ AAI+L  +LV ++IDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYQDAAIELGQELVSKDIDLVYGGGSIGLMGLISQAVYDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MH RKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHSRKAEMAKHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FID AV EGFI+P ARHI+VSAPTA+EL+ ++E+YV
Sbjct  130  AQLGIHDKPVGLLNVDGYYNFLLSFIDTAVEEGFISPDARHIIVSAPTAKELVKKMEEYV  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE E QLGY + K +I+R
Sbjct  190  PRHERVASKLSWERE-QLGY-SPKCDISR  216



>ref|XP_009407199.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Musa acuminata subsp. malaccensis]
Length=217

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 3/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FTRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
             GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA++SDAFIALPGGYGTLEELLEVITW
Sbjct  72   TGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++P+ARHI++SAPTA+ELM +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPNARHIILSAPTAKELMKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WE E QLGY  +K EI+R
Sbjct  192  PRHERVASKLNWETE-QLGY--SKYEISR  217



>ref|XP_008364933.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Malus domestica]
Length=216

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 5/209 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GKNPSYQLAA+QL  +LVE++IDLVYGGGSIGLMG +SQ VY+GGRHV
Sbjct  13   FRRICVFCGSSAGKNPSYQLAAVQLGKELVEKHIDLVYGGGSIGLMGQISQVVYDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP TLMPREITGE+VGE+RAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLE+ITW
Sbjct  73   LGVIPTTLMPREITGESVGEIRAVSSMHQRKAEMARQADAFIALPGGYGTLEELLEMITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGFI  +ARHI+VSA T  ELM +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFIDLAARHIIVSAETPCELMCKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H+G    LSWEMEQQL Y   KS+IAR
Sbjct  193  PEHSG----LSWEMEQQLEY-KAKSDIAR  216



>ref|XP_009367053.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Pyrus x bretschneideri]
Length=274

 Score =   347 bits (890),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV +NIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  68   FKRICVFCGSSPGNKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQAVYDGGRHV  127

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  128  IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  187

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ ++E+Y 
Sbjct  188  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKELVKKMEEYF  247

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE+E QLGY T   +I+R
Sbjct  248  PRHERVASKLSWEIE-QLGYPTI-CDISR  274



>ref|XP_006294984.1| hypothetical protein CARUB_v10024052mg [Capsella rubella]
 gb|EOA27882.1| hypothetical protein CARUB_v10024052mg [Capsella rubella]
Length=213

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKTSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFI+P+ARHI+VSAP+A+EL+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_011044403.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Populus euphratica]
Length=216

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAF+ALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFMALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPT +EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE+E QLGY   + +IAR
Sbjct  190  PRHEIVASKLSWEIE-QLGY-PPQCDIAR  216



>gb|AAK32797.1|AF361629_1 T3B23.2/T3B23.2 [Arabidopsis thaliana]
 gb|AAL87406.1| T3B23.2/T3B23.2 [Arabidopsis thaliana]
Length=213

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKVSYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNV+GYYNSLL FIDKAV EGFI+P+ARHI+VSAP+A+EL+ +LEDYV
Sbjct  127  AQLGIHNKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKELVKKLEDYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_010920460.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Elaeis guineensis]
Length=218

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP EITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  72   IGVIPKTLMPPEITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPTA+EL+ +LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIKPSARHIIVSAPTAKELVKKLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPK +WEME QLG+   K +++R
Sbjct  192  PRHERVAPKPNWEME-QLGH-CQKCDVSR  218



>ref|XP_010414556.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X2 [Camelina sativa]
 ref|XP_010470105.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform X2 [Camelina sativa]
Length=213

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKASYKDAAIELGTELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID AV EGFI+P+ARHI+VSAP+A+EL+ +LEDYV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDTAVEEGFISPTARHIIVSAPSAKELVKKLEDYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_004145748.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cucumis sativus]
 ref|XP_008463955.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Cucumis melo]
 gb|KGN46845.1| hypothetical protein Csa_6G141420 [Cucumis sativus]
Length=218

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV R+IDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  12   FKRICVFCGSSPGKKTSYKDAAIELGKELVSRDIDLVYGGGSVGLMGLVSQAVHNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA++SDAFIALPGGYGTLEELLEVITW
Sbjct  72   VGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FID+AV EGFI+PSARHI+VSAP A+EL+ ++E+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDQAVEEGFISPSARHIIVSAPNAKELVKKMEEYV  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWE+E QLGY   K +I+R
Sbjct  192  PRHERVASKHSWEIE-QLGY-PPKCDISR  218



>gb|KHN05674.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=220

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAVY GGRHV
Sbjct  14   FKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLLCFIDKAV EGFI+P ARHI+VSAP+ +EL+ ++E+Y 
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVEEGFISPKARHIIVSAPSTKELVKKMEEYF  193

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  194  PQHERVASKLSWETEQ  209



>ref|XP_010510645.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Camelina sativa]
Length=213

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  7    FKRICVFCGSSAGNKASYKDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVFNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID AV EGFI+P+ARHI+VSAP+A+EL+ +LEDYV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDTAVEEGFISPTARHIIVSAPSAKELVKKLEDYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>gb|AFK33887.1| unknown [Lotus japonicus]
Length=218

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  12   FKRICVFCGSSPGNKSSYKEAAIELGMELVSRNIDLVYGGGSIGLMGLVSQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIP+TLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPRTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VSAP+ +EL+ ++E+Y+
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPQARHIIVSAPSTKELVKKMEEYI  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P+H  VA KLSWE E QL Y++ 
Sbjct  192  PQHERVASKLSWENE-QLDYSSN  213



>ref|XP_003539768.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Glycine max]
Length=233

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAVY GGRHV
Sbjct  27   FKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEGGRHV  86

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  87   IGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  146

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLLCFIDKAV EGFI+P ARHI+VSAP+ +EL+ ++E+Y 
Sbjct  147  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVEEGFISPKARHIIVSAPSTKELVKKMEEYF  206

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  207  PQHERVASKLSWETEQ  222



>ref|XP_009396585.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Musa acuminata subsp. malaccensis]
Length=237

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSS GK   YQLAAIQL  +LVERNIDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  31   FKRVCVFCGSSTGKKKGYQLAAIQLGKELVERNIDLVYGGGSVGLMGLVSQAVFDGGRHV  90

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LG+IP+TLMP+EITGET+GEV+ V+GMHQRKAEMA+Q+DAF+ALPGGYGTLEELLEVITW
Sbjct  91   LGIIPRTLMPKEITGETIGEVQPVAGMHQRKAEMARQADAFVALPGGYGTLEELLEVITW  150

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYN+LL FIDKAV+EGFI+P ARHI++SA TA EL+S+LE+Y 
Sbjct  151  AQLGIHDKPVGLLNVEGYYNTLLSFIDKAVDEGFISPDARHIIISAQTAHELLSKLEEYE  210

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL WEME +LG+   KS IAR
Sbjct  211  PRHERVASKLRWEME-KLGH-PPKSYIAR  237



>ref|XP_006339070.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=220

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+GMHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPRELTGETVGEVKAVAGMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI++SAP+ +EL+ +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARHIIISAPSPKELVKKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P H GVA KL WE E QLGY     EI+R
Sbjct  194  PCHEGVASKLIWETE-QLGYPQAH-EISR  220



>ref|XP_008385326.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Malus domestica]
Length=255

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV +NIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  53   FKRICVFCGSSPGNKSSYKEAAIELGEELVSKNIDLVYGGGSVGLMGLISQAVYDGGRHV  112

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITG+TVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  113  IGVIPKTLMPREITGDTVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  172

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ ++E+Y 
Sbjct  173  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARHIIVSAPTAKELVKKMEEYF  232

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+H  VA KLSWE+E QLGY
Sbjct  233  PRHERVASKLSWEIE-QLGY  251



>ref|NP_181258.2| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Arabidopsis thaliana]
 sp|Q8L8B8.1|LOG3_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3; AltName: Full=Protein LONELY GUY 3 [Arabidopsis 
thaliana]
 gb|AAM76759.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAX55144.1| hypothetical protein At2g37210 [Arabidopsis thaliana]
 gb|AEC09367.1| protein LONELY GUY 3 [Arabidopsis thaliana]
Length=215

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHERVATKLCWEME-RIGYSS  213



>ref|XP_007132270.1| hypothetical protein PHAVU_011G080600g [Phaseolus vulgaris]
 gb|ESW04264.1| hypothetical protein PHAVU_011G080600g [Phaseolus vulgaris]
Length=232

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SYQ AAI+LA +LV RNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  26   FKRICVFCGSSPGNKSSYQDAAIELAKELVSRNIDLVYGGGSIGLMGLVSQAVYDGGRHV  85

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV AV+ MHQRKAEMA+ SDAFIALPGGYGTLEE+LEVITW
Sbjct  86   IGVIPKTLMPREITGETVGEVMAVADMHQRKAEMARHSDAFIALPGGYGTLEEVLEVITW  145

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VS+P+++EL+ ++E+Y 
Sbjct  146  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSSPSSKELVKKMEEYF  205

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KLSWE E Q+ Y+++  E++R
Sbjct  206  PQHERVASKLSWETE-QIEYSSS-CEMSR  232



>ref|XP_006384915.1| hypothetical protein POPTR_0004s22210g [Populus trichocarpa]
 gb|ERP62712.1| hypothetical protein POPTR_0004s22210g [Populus trichocarpa]
Length=216

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV  NIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKDAAIELGKELVSSNIDLVYGGGSIGLMGLISQAVFDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPT +EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K+SWE+E QLGY + + +I+R
Sbjct  190  PRHEIVASKVSWEIE-QLGY-SPQCDISR  216



>ref|XP_010509365.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Camelina sativa]
 ref|XP_010516980.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Camelina sativa]
Length=215

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+  LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKMLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHESVATKLCWEME-RIGYSS  213



>ref|XP_010505298.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Camelina sativa]
Length=215

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+  LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKMLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHESVATKLCWEME-RIGYSS  213



>ref|XP_002881496.1| hypothetical protein ARALYDRAFT_482713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57755.1| hypothetical protein ARALYDRAFT_482713 [Arabidopsis lyrata subsp. 
lyrata]
Length=215

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VS+PTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNAREIIVSSPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHESVATKLCWEME-RIGYSS  213



>ref|XP_006409853.1| hypothetical protein EUTSA_v10017171mg [Eutrema salsugineum]
 gb|ESQ51306.1| hypothetical protein EUTSA_v10017171mg [Eutrema salsugineum]
Length=241

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  35   FKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGGRHV  94

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  95   IGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  154

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFI+P+ARHI+VSAP+A++L+ +LE+YV
Sbjct  155  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFISPTARHIIVSAPSAKDLVKKLEEYV  214

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  215  PRHEKVASKKSWEME-QIGLSPT-CEISR  241



>gb|EYU34458.1| hypothetical protein MIMGU_mgv1a013457mg [Erythranthe guttata]
Length=220

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L   LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FKRICVFCGSSHGKKTSYQDAAIELGKVLVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+E+TG+TVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  74   MGVIPKTLMPQELTGQTVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVD YYNSLL FIDKAV EGFI+P+ARHI+VSAPTA+EL+ +LE+Y 
Sbjct  134  AQLGIHDKPVGLLNVDDYYNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEEYT  193

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  194  PRHERVASKLSWETEQ  209



>ref|XP_008442685.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis melo]
Length=222

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ +AI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  16   FRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  76   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  135

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I+VSAPTA+ELM +LE+YV
Sbjct  136  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTAKELMKKLEEYV  195

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA +LSWE+E QLGY
Sbjct  196  PCHERVASQLSWEIE-QLGY  214



>ref|XP_011013920.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X2 [Populus euphratica]
Length=224

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ+AAI L N+LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  18   FKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLISQAVHDGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLM  E+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  78   IGVIPKTLMRPELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR+I+VSAPTA+EL+ +LE+YV
Sbjct  138  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARNIIVSAPTAKELVKKLEEYV  197

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KLSWE+E QLG++
Sbjct  198  PCHERVASKLSWEIE-QLGHS  217



>ref|XP_004137827.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Cucumis sativus]
Length=213

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ +AI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  7    FRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSAR I+VSAPTA+ELM +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA +LSWE+E QLGY
Sbjct  187  PCHERVASQLSWEIE-QLGY  205



>ref|XP_006293523.1| hypothetical protein CARUB_v10024039mg [Capsella rubella]
 gb|EOA26421.1| hypothetical protein CARUB_v10024039mg [Capsella rubella]
Length=215

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTAREIIVSAPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHESVATKLCWEME-RIGYSS  213



>ref|XP_011040899.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Populus euphratica]
Length=216

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  10   FKRICVFCGSSPGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPT +EL+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSAPTPRELVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA K+SWE EQ
Sbjct  190  PRHEIVASKVSWESEQ  205



>gb|KGN58962.1| hypothetical protein Csa_3G739570 [Cucumis sativus]
Length=222

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ +AI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  16   FRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  76   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  135

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSAR I+VSAPTA+ELM +LE+YV
Sbjct  136  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEEYV  195

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA +LSWE+E QLGY
Sbjct  196  PCHERVASQLSWEIE-QLGY  214



>ref|XP_002519528.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF42942.1| carboxy-lyase, putative [Ricinus communis]
Length=220

 Score =   340 bits (871),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+LA +LV + IDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FKRICVFCGSSQGKKSSYQDAAIELAKELVSKKIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TG+TVGE++AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  74   IGVIPKTLMPRELTGQTVGELKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSAR+I+ SAPTA+EL+ +LE+YV
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIDPSARNIIASAPTAKELVMKLEEYV  193

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H GVAPKLSWE++ QL Y+
Sbjct  194  PCHEGVAPKLSWEID-QLDYS  213



>emb|CDX77168.1| BnaC04g39630D [Brassica napus]
Length=213

 Score =   339 bits (870),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  7    FKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID AV EGFI+P+ARHI+VSAP+A++L+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDNAVEEGFISPTARHIIVSAPSAKDLVMKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWEME Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEME-QIGLSPT-CEISR  213



>ref|XP_007027341.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
 gb|EOY07843.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
Length=233

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 184/218 (84%), Gaps = 16/218 (7%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQL---------------VERNIDLVYGGGSIGL  473
            F+R+CVFCGSS GK  SYQ AAI+L  +L               V RNIDLVYGGGSIGL
Sbjct  12   FRRICVFCGSSQGKKSSYQDAAIELGRELETLMVFQFFSMPIQEVSRNIDLVYGGGSIGL  71

Query  474  MGLVSQAVYNGGRHVLGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALP  653
            MGLVSQAV++GGRHV+GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALP
Sbjct  72   MGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALP  131

Query  654  GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVS  833
            GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I+VS
Sbjct  132  GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVS  191

Query  834  APTAQELMSRLEDYVPKHNGVAPKLSWEMEQQLGYTTT  947
            APTA+EL+ +LE+YVP H  VA KLSWEME QLGY+ T
Sbjct  192  APTAKELVKKLEEYVPCHERVASKLSWEME-QLGYSKT  228



>emb|CDX71364.1| BnaC04g15990D [Brassica napus]
Length=213

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK++CVFCGSS G   SY+ AAI+L  +LV +NIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  7    FKKICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLISQAVYNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFITP+ARHI+VSAP+A++L+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAKDLVKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA K SWEMEQ
Sbjct  187  PRHEKVASKKSWEMEQ  202



>gb|KDP29120.1| hypothetical protein JCGZ_16509 [Jatropha curcas]
Length=221

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  15   FKRICVFCGSSQGKKSSYQDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  75   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR+I  SAPTA+EL+ +LE+YV
Sbjct  135  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARNIFASAPTAKELVKKLEEYV  194

Query  879  PKHNGVAPKLSWEMEQ  926
            P H  VA KLSWE++Q
Sbjct  195  PCHERVASKLSWEIDQ  210



>emb|CDY04551.1| BnaA07g13770D [Brassica napus]
Length=213

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV +NIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  7    FKRICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLISQAVYNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MH+RKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPKEITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFITP+ARHI+VSAP+A++L+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAKDLVKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA K SWEMEQ
Sbjct  187  PRHEKVASKKSWEMEQ  202



>ref|XP_009801432.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Nicotiana sylvestris]
Length=219

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AAI+L  QLVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  10   FKRICVFCGSSSGKKPTYQEAAIELGKQLVEREIDLVYGGGSVGLMGLVSQAVHDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  70   LGVIPRTLMPREITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNV+GYYNSLL F+DKAV+EGFI+P+AR I+VSAPTAQ+L+  LE++V
Sbjct  130  AQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPTARRIIVSAPTAQQLVRELEEHV  189

Query  879  PKHNGVAPKLSWEME-QQLGYTTTKS  953
            P+ + +  KL WE E Q+  YT T+S
Sbjct  190  PETDEITSKLIWEEEVQRFNYTPTES  215



>ref|XP_009103669.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Brassica rapa]
Length=247

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV +NIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  41   FKRICVFCGSSAGNKTSYRDAAIELGAELVSKNIDLVYGGGSIGLMGLISQAVYNGGRHV  100

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MH+RKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  101  IGVIPKTLMPKEITGETVGEVKAVADMHERKAEMAKHSDAFIALPGGYGTLEELLEVITW  160

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FIDKAV EGFITP+ARHI+VSAP+A++L+ +LE+YV
Sbjct  161  AQLGIHDKPVGLLNVEGYYNSLLSFIDKAVEEGFITPTARHIIVSAPSAKDLVKKLEEYV  220

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA K SWEMEQ
Sbjct  221  PRHEKVASKKSWEMEQ  236



>ref|XP_003538177.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 isoform 1 [Glycine max]
 gb|KHN38755.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=220

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAVY GGRHV
Sbjct  14   FKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPREITGETVGEVMAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VSAP+ +EL+  +E+Y 
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSAPSTKELVKEMEEYF  193

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  194  PQHERVASKLSWETEQ  209



>gb|ACU19348.1| unknown [Glycine max]
Length=233

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAVY GGRHV
Sbjct  27   FKRICVFCGSSPGNKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVYEGGRHV  86

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  87   IGVIPKTLMPREITGETVGEVMAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  146

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLLCFI KAV EGFI+P ARHI+VSAP+ +EL+ ++E+Y 
Sbjct  147  AQLGIHDKPVGLLNVDGYYNSLLCFIGKAVEEGFISPKARHIIVSAPSTKELVKKMEEYF  206

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  207  PQHERVAFKLSWETEQ  222



>ref|XP_009140853.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Brassica rapa]
 emb|CDY30498.1| BnaA04g16350D [Brassica napus]
Length=213

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVYNGGRHV
Sbjct  7    FKRICVFCGSSAGNKTSYRDAAIELGAELVSRNIDLVYGGGSIGLMGLISQAVYNGGRHV  66

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+EITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  67   IGVIPKTLMPKEITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  126

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID AV EGFI+P+ARHI+VSAP+A++L+ +LE+YV
Sbjct  127  AQLGIHDKPVGLLNVEGYYNSLLSFIDNAVEEGFISPTARHIIVSAPSAKDLVKKLEEYV  186

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA K SWE+E Q+G + T  EI+R
Sbjct  187  PRHEKVASKKSWEIE-QIGLSPT-CEISR  213



>gb|KFK34594.1| hypothetical protein AALP_AA5G166100 [Arabis alpina]
Length=215

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA++L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKTSYQDAAVELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHESVATKLCWEIE-RIGYSS  213



>ref|XP_009141638.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Brassica rapa]
Length=210

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA+ L N+LV R IDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAVDLGNELVSRKIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VS PTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSEPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQ  926
            P H  VA KL WEME+
Sbjct  193  PCHESVASKLCWEMER  208



>ref|NP_001053328.1| Os04g0518800 [Oryza sativa Japonica Group]
 sp|Q0JBP5.1|LOGL6_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6; AltName: Full=Protein LONELY GUY-like 
6 [Oryza sativa Japonica Group]
 dbj|BAF15242.1| Os04g0518800 [Oryza sativa Japonica Group]
Length=250

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  27   FRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQAVYNGGRHV  86

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  87   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  146

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+PSARHI+V APT +EL+ +LE Y 
Sbjct  147  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKELLEKLEAYS  206

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H+ V PK+ WEME+
Sbjct  207  PRHDKVVPKMQWEMEK  222



>gb|AGE00883.1| lysine decarboxylase [Cucumis sativus]
Length=215

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ +AI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  16   FRRICVFCGSSQGKKRSYQDSAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  75

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGT EELLEVITW
Sbjct  76   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTPEELLEVITW  135

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++PSAR I+VSAPTA+ELM +LE+YV
Sbjct  136  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSPSARQIIVSAPTAKELMKKLEEYV  195

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H  VA +LSWE+E QLGY
Sbjct  196  PCHERVASQLSWEIE-QLGY  214



>ref|XP_010043764.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Eucalyptus grandis]
 gb|KCW85757.1| hypothetical protein EUGRSUZ_B02514 [Eucalyptus grandis]
Length=215

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK +CVFCGSS GK  SY+ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQ VYNGGRHV
Sbjct  9    FKSICVFCGSSQGKKSSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLVSQVVYNGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP EITGETVGEV+AV+ MH+RKAEMA++SDAFIALPGGYGTLEELLEVITW
Sbjct  69   IGVIPKTLMPPEITGETVGEVKAVADMHERKAEMARRSDAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVG+LNVDGYYN LL FIDKAV EGFI P+ARHI+V+AP A++L+ R+E+Y 
Sbjct  129  AQLGIHDKPVGMLNVDGYYNPLLQFIDKAVEEGFIRPNARHIIVTAPNAKDLIKRMEEYY  188

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPKLSWEME QL Y+T   EI+R
Sbjct  189  PRHERVAPKLSWEME-QLTYSTA-CEISR  215



>ref|XP_009611816.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Nicotiana tomentosiformis]
Length=219

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AAI+L  QLVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  10   FKRICVFCGSSSGKKPTYQDAAIELGKQLVERGIDLVYGGGSVGLMGLVSQAVHDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  70   LGVIPRTLMPREITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNV+G+YNSLL F+DKAV+EGFI+P+AR I+VSAPTAQ+L+  LE++V
Sbjct  130  AQLGIHRKPVGLLNVEGFYNSLLSFLDKAVDEGFISPTARRIIVSAPTAQQLVRELEEHV  189

Query  879  PKHNGVAPKLSWEME-QQLGYTTTKS  953
            P+ + ++ KL WE E Q+  YT T+S
Sbjct  190  PETDEISSKLIWEEEVQRFNYTPTES  215



>ref|XP_010031982.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1 [Eucalyptus grandis]
 gb|KCW51376.1| hypothetical protein EUGRSUZ_J00920 [Eucalyptus grandis]
Length=216

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 185/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY  AA++L  +LV RNIDLVYGGGSIGLMGLVS+AVYNGGRHV
Sbjct  10   FKRICVFCGSSQGKKSSYTDAALELGRELVSRNIDLVYGGGSIGLMGLVSRAVYNGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+ V+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  70   IGVIPKTLMPRELTGETVGEVKPVANMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VS+P+A++L+ ++E+Y 
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARHIIVSSPSAKDLVKKMEEYF  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WE E QLG+ T K +I+R
Sbjct  190  PRHERVASKLNWETE-QLGH-TPKCDISR  216



>ref|XP_002275414.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Vitis vinifera]
 emb|CAN67407.1| hypothetical protein VITISV_025618 [Vitis vinifera]
 emb|CBI30371.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   338 bits (866),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVRAVS MH+RKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRTLMPREITGETVGEVRAVSHMHERKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGF++P+AR I+VSAPTA+EL+  LE+YV
Sbjct  128  AQLGIHKKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPTARRIIVSAPTAKELVRELEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+H+ V  KL WE  + + Y + K  +A
Sbjct  188  PEHDEVTSKLIWEEVEIISYASEKPGVA  215



>ref|XP_008791568.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10 [Phoenix dactylifera]
Length=218

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 183/209 (88%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAIELGKELVSRNIDLVYGGGSVGLMGLVSQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP EITGETVGEV+ V+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  72   IGVIPKTLMPPEITGETVGEVKPVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI PSARHI+VSAPTA+EL+ +LE Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIMPSARHIIVSAPTAKELVKKLEVYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VAPK +WEME  LG+   K +++R
Sbjct  192  PRHERVAPKPNWEME-HLGH-CQKCDVSR  218



>ref|XP_006403687.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
 gb|ESQ45140.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
Length=215

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHESVASKLCWEIE-RIGYSS  213



>emb|CAE05626.1| OSJNBb0061C13.8 [Oryza sativa Japonica Group]
 gb|EEE61351.1| hypothetical protein OsJ_15484 [Oryza sativa Japonica Group]
Length=231

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  8    FRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQAVYNGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  68   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+PSARHI+V APT +EL+ +LE Y 
Sbjct  128  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKELLEKLEAYS  187

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H+ V PK+ WEME+
Sbjct  188  PRHDKVVPKMQWEMEK  203



>ref|XP_008391958.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Malus domestica]
Length=215

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMP EITGETVGEVR VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRTLMPXEITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLLCFIDKAV+EGFI+P+ARHI+VSAPTA++L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLCFIDKAVDEGFISPTARHIIVSAPTAKQLVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P+H+ V  KL WE   ++ Y +
Sbjct  188  PEHDEVTSKLVWEEVDRISYVS  209



>ref|XP_006403688.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
 gb|ESQ45141.1| hypothetical protein EUTSA_v10010644mg [Eutrema salsugineum]
Length=260

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  58   FGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  117

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  118  IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  177

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  178  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPTAKELVKKLEEYS  237

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  238  PCHESVASKLCWEIE-RIGYSS  258



>emb|CDY52759.1| BnaA07g37740D [Brassica napus]
Length=215

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHERVASKLCWEIE-RIGYSS  213



>ref|XP_006424548.1| hypothetical protein CICLE_v10029235mg [Citrus clementina]
 gb|ESR37788.1| hypothetical protein CICLE_v10029235mg [Citrus clementina]
Length=223

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  +Y+ AAI+L+ +LV RNIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  17   FNRICVFCGSSAGKKSTYKDAAIELSKELVARNIDLVYGGGSVGLMGLISQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+ V+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  77   IGVIPKTLMPREITGETVGEVKPVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAP A+ELM+++E+Y 
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPNARHIIVSAPNAKELMNKMEEYF  196

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  197  PQHERVASKLSWENEQ  212



>gb|KEH39342.1| lysine decarboxylase family protein [Medicago truncatula]
Length=209

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  12   FKRICVFCGSSPGNKTSYKDAAIELGKELVSRNIDLVYGGGSIGLMGLISQAVYDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEM++ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMSRNSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNS L FIDKAV EGFI+P+ARHI+VSAPT +EL+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSFLTFIDKAVEEGFISPTARHIIVSAPTPKELVKNMEEYF  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  192  PQHERVASKLSWENEQ  207



>ref|XP_006653604.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6-like [Oryza brachyantha]
Length=252

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 179/203 (88%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  29   FRRICVFCGSSQGKKKSYQDAAVELGKELVARNIDLVYGGGSVGLMGLVSQAVYNGGRHV  88

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  89   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  148

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+PSARHI+V APT +EL+ +LE Y 
Sbjct  149  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPSARHIIVLAPTPKELVEKLEAYS  208

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P+H+ V PK+ WEME +L Y  +
Sbjct  209  PRHDEVVPKMQWEME-KLSYCKS  230



>ref|XP_004487095.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Cicer arietinum]
Length=209

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAV+NGGRHV
Sbjct  12   FKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVHNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNS L FIDKAV EGFI+P+ARHI+VSAPT ++L+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSFLSFIDKAVEEGFISPTARHIIVSAPTPKDLVKNMEEYF  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  192  PQHERVASKLSWESEQ  207



>ref|XP_002301983.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
 gb|EEE81256.1| hypothetical protein POPTR_0002s02560g [Populus trichocarpa]
Length=202

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGKNP+YQ AA+QL  QLVERNIDLVYGGGSIGLMGL+SQAVY+GGRHV
Sbjct  17   FRRVCVFCGSSPGKNPNYQHAAVQLGKQLVERNIDLVYGGGSIGLMGLISQAVYDGGRHV  76

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  77   LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  136

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV+EGF+TP+ARHI+VSA TA ELM +LE + 
Sbjct  137  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDEGFVTPAARHIIVSAHTAHELMCKLESFT  196

Query  879  PKHN  890
             + +
Sbjct  197  SEFD  200



>ref|XP_006592704.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Glycine max]
 gb|KHN11222.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=209

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY GGRHV
Sbjct  12   FKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYEGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
             GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK+SDAFIALPGGYGTLEELLEVITW
Sbjct  72   TGVIPKTLMPRELTGETVGEVKAVANMHQRKAEMAKRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+ L FIDKAV EGFI+P+ARHI+VSAPT +EL+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPKELVKEMEEYF  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V  KLSWE EQ
Sbjct  192  PQHERVVSKLSWESEQ  207



>ref|XP_009133130.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133131.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133132.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 ref|XP_009133133.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Brassica rapa]
 emb|CDY46763.1| BnaA03g17070D [Brassica napus]
Length=206

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+E+TGETVGEVRAV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPKELTGETVGEVRAVTGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAP A+EL+ +LE+Y 
Sbjct  133  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPNAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEM  920
            P H  V  KL WEM
Sbjct  193  PCHESVTSKLCWEM  206



>ref|XP_002877920.1| hypothetical protein ARALYDRAFT_348439 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54179.1| hypothetical protein ARALYDRAFT_348439 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+GMHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPRELTGETVGEVRAVAGMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I++SAPTA+EL+ +LE+Y 
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNARQIIISAPTAKELVKKLEEYS  193

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  194  PCHESVATKLCWEIE-RIGYSS  214



>ref|XP_003543475.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Glycine max]
 gb|KHN21508.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 
[Glycine soja]
Length=209

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY GGRHV
Sbjct  12   FKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYEGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
             GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK+SDAFIALPGGYGTLEELLEVITW
Sbjct  72   TGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+ L FIDKAV EGFI+P+ARHI+VSAPT +EL+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPKELVKEMEEYF  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V  KLSWE EQ
Sbjct  192  PQHERVVSKLSWESEQ  207



>ref|XP_010529748.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Tarenaya hassleriana]
Length=215

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKRSYQDAAVDLGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF++ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFVSTNARQIIVSAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY +
Sbjct  193  PCHERVASKLCWEME-RIGYAS  213



>ref|XP_006488072.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Citrus sinensis]
 gb|KDO73335.1| hypothetical protein CISIN_1g027287mg [Citrus sinensis]
Length=225

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  +Y+ AAI+L  +LV RNIDLVYGGGS+GLMGL+SQAVY+GGRHV
Sbjct  19   FNRICVFCGSSAGKKSTYKDAAIELGKELVARNIDLVYGGGSVGLMGLISQAVYDGGRHV  78

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+ V+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  79   IGVIPKTLMPREITGETVGEVKPVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  138

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+ARHI+VSAP A+ELM+++E+Y 
Sbjct  139  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFISPNARHIIVSAPNAKELMNKMEEYF  198

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  VA KLSWE EQ
Sbjct  199  PQHERVASKLSWENEQ  214



>ref|XP_003606367.1| hypothetical protein MTR_4g058740 [Medicago truncatula]
 gb|AES88564.1| lysine decarboxylase family protein [Medicago truncatula]
Length=209

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   SY+ AAI+L N+LV RNIDLVYGGGSIGLMGLVSQAV +GGRHV
Sbjct  12   FKRICVFCGSSPGNKSSYKDAAIELGNELVSRNIDLVYGGGSIGLMGLVSQAVSDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIP+TLMPREITGETVGEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPRTLMPREITGETVGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P ARHI+VSAP+ +EL+ ++E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSAPSTKELVKKMEEYS  191

Query  879  PKHNGVAPKLSWE  917
            P+H  VA K SWE
Sbjct  192  PQHERVASKQSWE  204



>ref|XP_010262960.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 isoform X1 [Nelumbo nucifera]
Length=214

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPGK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSPGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P+AR I+VSAPTA++L+  LE+YV
Sbjct  128  AQLGIHQKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARCIIVSAPTAKQLVRELEEYV  187

Query  879  PKHNGVAPKLSWEMEQ  926
            P ++ +  KL WE+E+
Sbjct  188  PHYDEITSKLVWEVER  203



>gb|KFK36610.1| hypothetical protein AALP_AA4G145900 [Arabis alpina]
Length=215

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AAI L N+LV ++IDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAIDLGNELVSKSIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNAREIIVSAPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WEME ++GY++
Sbjct  193  PCHEMVATKLCWEME-RIGYSS  213



>ref|XP_009103862.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4 [Brassica rapa]
Length=215

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAP+A+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPNARQIIISAPSAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHERVASKLCWEIE-RIGYSS  213



>ref|XP_010046628.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Eucalyptus grandis]
 gb|KCW88810.1| hypothetical protein EUGRSUZ_A01146 [Eucalyptus grandis]
Length=218

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  12   FGRICVFCGSSQGKKSSYQDAAIELGRELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I+VSAPTA+EL+ +LE+YV
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIVSAPTAKELVKKLEEYV  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P H     KL+WE+EQ
Sbjct  192  PCHERAISKLNWEVEQ  207



>ref|XP_009349185.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Pyrus x bretschneideri]
Length=215

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ +A++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FNRICVFCGSSSGKKASYQESAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVR VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRTLMPREITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLLCFIDKAV+EGFI+P+ARHI+VSAPTA++L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLCFIDKAVDEGFISPTARHIIVSAPTAKQLVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P+ + V  KL WE   ++ Y +
Sbjct  188  PELDEVTSKLVWEEMDRISYVS  209



>ref|XP_009764788.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like isoform X1 [Nicotiana sylvestris]
Length=219

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK++CVFCGSSPGK  SY+ AA++L  +LV RNIDLVYGGGSIGLMGLVSQAVYNGGRHV
Sbjct  12   FKKICVFCGSSPGKKSSYKDAAVELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  72   LGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF+ P+AR I VSAPTA+ELM++LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFVCPNARQIFVSAPTAKELMNKLEEYS  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P    +A KL+WE E+
Sbjct  192  PSQENIASKLNWEKEE  207



>ref|XP_009587160.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Nicotiana tomentosiformis]
Length=219

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK++CVFCGSSPGK  SY+ AA++L  +LV RNIDLVYGGGSIGLMGLVSQAVYNGGRHV
Sbjct  12   FKKICVFCGSSPGKKSSYKDAAVELGKELVSRNIDLVYGGGSIGLMGLVSQAVYNGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  72   LGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGF+ P+AR I VSAPTA+ELM++LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNSLLTFIDKAVEEGFVCPNARQIFVSAPTAKELMNKLEEYS  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P    +A KL+WE E+
Sbjct  192  PSQENIASKLNWEKEE  207



>emb|CDY30875.1| BnaC04g27300D [Brassica napus]
Length=215

 Score =   335 bits (858),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMG+VSQ V++GGRHV
Sbjct  13   FERICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGIVSQVVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYY+SLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYSSLLSFIDKAVEEGFISPTARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHESVASKLCWEIE-RIGYSS  213



>ref|XP_009116037.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like [Brassica rapa]
Length=216

 Score =   335 bits (858),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSI LMG VSQAV++GGRHV
Sbjct  14   FGRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIVLMGFVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PSAR I++SAPTA+EL+ +LE+Y 
Sbjct  134  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARQIIISAPTAKELVKKLEEYS  193

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  194  PCHESVASKLCWEIE-RIGYSS  214



>emb|CDX91344.1| BnaC04g08060D [Brassica napus]
Length=199

 Score =   334 bits (856),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  6    FKRICVFCGSSQGKKSSYQDAAVELGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  65

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMP+E+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  66   IGIIPKTLMPKELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  125

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LE+Y 
Sbjct  126  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEEYA  185

Query  879  PKHNGVAPKLSWE  917
            P H  VA KL WE
Sbjct  186  PCHESVASKLCWE  198



>ref|XP_004976245.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6-like [Setaria italica]
Length=255

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 179/203 (88%), Gaps = 1/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVS+AVYNGGRHV
Sbjct  32   FRRICVFCGSSQGKKKSYQDAAVELGEELVSRNIDLVYGGGSVGLMGLVSRAVYNGGRHV  91

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  92   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  151

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+P+ARHI+V APT +EL+ +LE+Y 
Sbjct  152  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPKELLDKLEEYS  211

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P+H  V PK+ WE+E QL Y  +
Sbjct  212  PRHEKVVPKMKWEVE-QLSYCKS  233



>emb|CDX79722.1| BnaC03g20580D [Brassica napus]
Length=206

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWEM  920
            P    V  KL WEM
Sbjct  193  PCRESVTSKLCWEM  206



>ref|XP_010104785.1| hypothetical protein L484_018839 [Morus notabilis]
 gb|EXC01926.1| hypothetical protein L484_018839 [Morus notabilis]
Length=217

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  10   FQRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEVR VS MHQRKAEM +Q+DAFIALPGGYGTLEELLEVITW
Sbjct  70   LGVIPKTLMPREITGETVGEVRTVSDMHQRKAEMTRQADAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P+AR I+VSAPTA++L+  LE+YV
Sbjct  130  AQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLVRLLEEYV  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+++ V  KL WE  ++L Y   +SE+A
Sbjct  190  PEYDEVTSKLVWEEVERLNY-VAESEVA  216



>ref|XP_004251148.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 [Solanum lycopersicum]
Length=234

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK++CVFCGSSPGK  SY+ AA++L  +LV RNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FKKICVFCGSSPGKKSSYKEAAVELGEELVSRNIDLVYGGGSIGLMGLVSQAVYSGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  75   LGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            +QLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+AR I VSAPTA ELM++LE+Y 
Sbjct  135  SQLGIHDKPVGLLNVDGYYNSLLAFIDKAVEEGFICPNARQIFVSAPTANELMNKLEEYS  194

Query  879  PKHNGVAPKLSWEMEQQLGYTTT  947
            P    VA KL+WE E+   Y  T
Sbjct  195  PSQENVASKLNWEKEELEEYIPT  217



>ref|XP_007027931.1| Lysine decarboxylase family protein, putative [Theobroma cacao]
 gb|EOY08433.1| Lysine decarboxylase family protein, putative [Theobroma cacao]
Length=215

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRTLMPREITGETVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P+AR I+VSAPTA++L+ +LEDY 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLVRQLEDYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ V  KL W+   +L Y
Sbjct  188  PEYDEVTSKLVWDEVDRLSY  207



>ref|XP_006399100.1| hypothetical protein EUTSA_v10014650mg [Eutrema salsugineum]
 gb|ESQ40553.1| hypothetical protein EUTSA_v10014650mg [Eutrema salsugineum]
Length=215

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEVRAV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVRAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ + +  KL W+   +L Y    SE+A
Sbjct  188  PEFDEITSKLVWDEVDRLSYVPG-SEVA  214



>ref|XP_009392159.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 185/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV R+IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FRRICVFCGSSQGKKRSYQDAAVELGKELVSRSIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIP+ LMP EI+GETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPRILMPPEISGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID+AV EGFI+PSARHIVVSAPT +EL+  LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVEGYYNSLLSFIDQAVEEGFISPSARHIVVSAPTVKELVKMLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WEME QLGY + K EI+R
Sbjct  192  PRHERVASKLNWEME-QLGY-SPKREISR  218



>ref|XP_009372569.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Pyrus x bretschneideri]
Length=215

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FNRICVFCGSSSGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVR VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRTLMPREITGETVGEVRTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGF++P+ARHI+VSAPTA++L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLSFIDKAVDEGFVSPTARHIIVSAPTAKQLVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P+H+ +  KL WE   ++ Y +
Sbjct  188  PEHDEITSKLVWEEVGRISYVS  209



>dbj|BAG70979.1| putative lysine decarboxylase [Musa balbisiana]
Length=218

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 185/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV R+IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  12   FRRICVFCGSSQGKKRSYQDAAVELGKELVSRSIDLVYGGGSVGLMGLVSQAVHDGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIP+ LMP EI+GETVGEV+AV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPRILMPPEISGETVGEVKAVADMHQRKAEMARNSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNV+GYYNSLL FID+AV EGFI+PSARHIVVSAPT +EL+  LE+Y 
Sbjct  132  AQLGIHDKPVGLLNVEGYYNSLLSFIDQAVEEGFISPSARHIVVSAPTVKELVKMLEEYF  191

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P+H  VA KL+WEME QLGY + K EI+R
Sbjct  192  PRHERVASKLNWEME-QLGY-SPKREISR  218



>ref|XP_006292903.1| hypothetical protein CARUB_v10019168mg [Capsella rubella]
 gb|EOA25801.1| hypothetical protein CARUB_v10019168mg [Capsella rubella]
Length=215

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA++L+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARKIIISAPTAKDLVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA KL WE+E ++GY+
Sbjct  193  PCHESVATKLCWEIE-RIGYS  212



>ref|XP_007150188.1| hypothetical protein PHAVU_005G134000g [Phaseolus vulgaris]
 gb|ESW22182.1| hypothetical protein PHAVU_005G134000g [Phaseolus vulgaris]
Length=209

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSSPG   +Y+ AAI+L  +LV RNIDLVYGGGSIGLMGL+SQAVY GGRHV
Sbjct  12   FKRICVFCGSSPGNKTTYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYEGGRHV  71

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEV+AV+ MHQRKAEMAK+SDAFIALPGGYGTLEELLEVITW
Sbjct  72   IGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKRSDAFIALPGGYGTLEELLEVITW  131

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+ L FIDKAV EGFI+P+ARHI+VSAPT +EL+  +E+Y 
Sbjct  132  AQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPKELVKEMEEYF  191

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V  K+SWE E+
Sbjct  192  PQHERVVSKVSWESEK  207



>ref|XP_002446792.1| hypothetical protein SORBIDRAFT_06g022780 [Sorghum bicolor]
 gb|EES11120.1| hypothetical protein SORBIDRAFT_06g022780 [Sorghum bicolor]
Length=259

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  +YQ AA++L  +LV RNIDLVYGGGS+GLMGLVS+AVYNGGRHV
Sbjct  35   FRRICVFCGSSQGKKKTYQDAAVELGQELVSRNIDLVYGGGSVGLMGLVSRAVYNGGRHV  94

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  95   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  154

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+P+ARHI+V APT +EL+ +LE+Y 
Sbjct  155  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPKELLDKLEEYS  214

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V PK  WEMEQ
Sbjct  215  PQHEKVVPKTKWEMEQ  230



>ref|XP_002873247.1| carboxy-lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49506.1| carboxy-lyase [Arabidopsis lyrata subsp. lyrata]
Length=217

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ + +  KL W+   +L Y    SE+A
Sbjct  188  PEFDEITSKLVWDEVDRLSYVPG-SEVA  214



>ref|XP_006288643.1| hypothetical protein CARUB_v10001948mg [Capsella rubella]
 ref|XP_010423360.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 ref|XP_010452555.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 ref|XP_010491186.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Camelina sativa]
 gb|EOA21541.1| hypothetical protein CARUB_v10001948mg [Capsella rubella]
 gb|KFK25030.1| hypothetical protein AALP_AA8G057900 [Arabis alpina]
Length=215

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ + +  KL W+   +L Y    SE+A
Sbjct  188  PEFDEITSKLVWDEVDRLSYVPG-SEVA  214



>ref|XP_003581433.2| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Brachypodium distachyon]
Length=253

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVSQAVY+GGRHV
Sbjct  28   FRRICVFCGSSKGKKTSYQDAAVELGQELVARNIDLVYGGGSVGLMGLVSQAVYSGGRHV  87

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+ V  MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  88   IGVIPKTLMPREITGETVGEVKEVGDMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  147

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN+LL FIDKAV EGFI P+ARHI+V APT +EL+++LE+Y 
Sbjct  148  AQLGIHDKPVGLLNVDGYYNALLSFIDKAVEEGFIKPTARHIIVLAPTPKELLNKLEEYS  207

Query  879  PKHNGVAPKLSWEMEQQL  932
            P+H  V PK+ WE E QL
Sbjct  208  PRHEEVVPKMKWETELQL  225



>ref|XP_006348482.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Solanum tuberosum]
Length=218

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 185/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AA +L  QLVE+ IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  9    FKRICVFCGSSSGKKPTYQEAATELGKQLVEKGIDLVYGGGSVGLMGLVSQAVHDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGET+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPRTLMPREITGETIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNV+GYYNSLL F+DKAV+EGFI+P AR I+VSA TAQ+L+ +LE+++
Sbjct  129  AQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPIARKIIVSAQTAQQLVKQLEEHI  188

Query  879  PKHNGVAPKLSW-EMEQQLGYTTTKSEIA  962
            P+ + +   L W E  Q+  YTTT+SE++
Sbjct  189  PETDEITSNLIWDEGIQRFNYTTTESEVS  217



>ref|XP_009139409.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X1 [Brassica rapa]
Length=215

 Score =   332 bits (851),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMG+VSQ V++GGRHV
Sbjct  13   FGRICVFCGSSQGKKGSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGIVSQVVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYY+SLL FIDKAV EGFI+P+AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYSSLLSFIDKAVEEGFISPNARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHESVASKLCWEIE-RIGYSS  213



>ref|NP_196248.3| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Arabidopsis thaliana]
 sp|Q8GW29.2|LOG7_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7; AltName: Full=Protein LONELY GUY 7 [Arabidopsis 
thaliana]
 dbj|BAB08952.1| lysine decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED91000.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 
[Arabidopsis thaliana]
Length=217

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ + +  KL W+   ++ Y    SE+A
Sbjct  188  PEFDEITSKLVWDEVDRISYVPG-SEVA  214



>ref|XP_006340180.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Solanum tuberosum]
Length=228

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK++CVFCGSSPGK   Y+ AA++L  +LV RNIDLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  15   FKKICVFCGSSPGKKSGYKEAAVELGKELVSRNIDLVYGGGSIGLMGLVSQAVYSGGRHV  74

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEV+AV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  75   LGVIPRTLMPREITGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  134

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            +QLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI P+AR I VSAPTA+EL+++LEDY 
Sbjct  135  SQLGIHDKPVGLLNVDGYYNSLLAFIDKAVEEGFICPNARQIFVSAPTAKELINKLEDYF  194

Query  879  PKHNGVAPKLSWEMEQ  926
            P    VA KL+WE E+
Sbjct  195  PSQENVASKLNWEKEE  210



>ref|XP_002467072.1| hypothetical protein SORBIDRAFT_01g019170 [Sorghum bicolor]
 gb|EER94070.1| hypothetical protein SORBIDRAFT_01g019170 [Sorghum bicolor]
Length=207

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY  AAI+L N+LV R++DLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  8    FKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVYDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLM  EI+GETVGEVR V+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  68   IGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV EGFI PSAR I+V APTAQELM +LE+Y 
Sbjct  128  AQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMDKLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H+ VA  L+WEM  QLGY
Sbjct  188  PYHDRVASTLNWEMGHQLGY  207



>ref|NP_190913.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG4 
[Arabidopsis thaliana]
 sp|Q9LFH3.1|LOG4_ARATH RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4; AltName: Full=Protein LONELY GUY 4 [Arabidopsis 
thaliana]
 emb|CAB67652.1| putative protein [Arabidopsis thaliana]
 gb|AEE79088.1| molybdenum cofactor binding protein [Arabidopsis thaliana]
Length=215

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I++SAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISTNARQIIISAPTAKELVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQ  926
            P H  VA KL WE+E+
Sbjct  193  PCHESVATKLCWEIER  208



>ref|XP_007016778.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
 gb|EOY34397.1| Lysine decarboxylase family protein isoform 1 [Theobroma cacao]
Length=250

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/239 (70%), Positives = 187/239 (78%), Gaps = 32/239 (13%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FK +CVFCGSSPGK  SY+ A I+L  +LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  14   FKSICVFCGSSPGKKSSYREATIELGRELVSRNIDLVYGGGSIGLMGLISQAVFDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALP---------------  653
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALP               
Sbjct  74   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGWYKTPKVLLFINLS  133

Query  654  ---------------GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAV  788
                           GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLL FIDKAV
Sbjct  134  MGTLRLGAFSWTTSVGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAV  193

Query  789  NEGFITPSARHIVVSAPTAQELMSRLEDYVPKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
             EGFI P+ARHI+VSAPTA+EL+ ++E+Y P+H  VA KLSWEME QLGY   K EI+R
Sbjct  194  EEGFICPNARHIIVSAPTAKELVKKMEEYEPQHERVASKLSWEME-QLGY-PAKCEISR  250



>ref|XP_010246703.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 isoform X1 [Nelumbo nucifera]
Length=215

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK   YQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  9    FRRICVFCGSSSGKKARYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGETVGEVRAVS MHQRKAEM++Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPRTLMPREITGETVGEVRAVSDMHQRKAEMSRQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+PSAR I++SAPTA++L+  LE+YV
Sbjct  129  AQLGIHKKPVGLLNVDGYYNSLLSFIDKAVDEGFISPSARRIIISAPTAKQLVRELEEYV  188

Query  879  PKHNGVAPKLSWEMEQ  926
            P+++ +  KL WE+E+
Sbjct  189  PEYDEITSKLVWEVER  204



>sp|B9F166.1|LOGL2_ORYSJ RecName: Full=Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2; AltName: Full=Protein LONELY GUY-like 
2 [Oryza sativa Japonica Group]
 gb|EEE57408.1| hypothetical protein OsJ_07599 [Oryza sativa Japonica Group]
Length=244

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSS GK   YQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  20   FRRVCVFCGSSHGKKKIYQDAAIELGKELVARNIDLVYGGGSVGLMGLVSQAVHNGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI+GETVGEV+AVS MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  80   IGVIPKTLMPREISGETVGEVKAVSDMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FIDKAV EGFI PSARHI+V APT +EL+ +LE+Y 
Sbjct  140  AQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAPTPKELIEKLEEYS  199

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V  K+ WEMEQ
Sbjct  200  PQHEKVVSKMKWEMEQ  215



>gb|EAY86771.1| hypothetical protein OsI_08151 [Oryza sativa Indica Group]
Length=289

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSS GK   YQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAV+NGGRHV
Sbjct  20   FRRVCVFCGSSHGKKKIYQDAAIELGKELVARNIDLVYGGGSVGLMGLVSQAVHNGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI+GETVGEV+AVS MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  80   IGVIPKTLMPREISGETVGEVKAVSDMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FIDKAV EGFI PSARHI+V APT +EL+ +LE+Y 
Sbjct  140  AQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAPTPKELIEKLEEYS  199

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V  K+ WEMEQ
Sbjct  200  PQHEKVVSKMKWEMEQ  215



>ref|XP_011094223.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Sesamum indicum]
Length=216

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  9    FKRICVFCGSSSGKKPSYQEAAVELGRELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMPREITGET+GEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPRTLMPREITGETIGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNV+GYYNSLL F+DKAV+EGFI+P+AR I+VSAPTA++L+  LE+++
Sbjct  129  AQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPTARRIIVSAPTAKQLVRELEEHI  188

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ +  KL WE  ++L Y
Sbjct  189  PEYDEITSKLIWEEVERLNY  208



>ref|XP_006854693.1| hypothetical protein AMTR_s00030p00225360 [Amborella trichopoda]
 gb|ERN16160.1| hypothetical protein AMTR_s00030p00225360 [Amborella trichopoda]
Length=218

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+RVCVFCGSSPGK  SYQ AA+QL  +LVER+IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  11   FRRVCVFCGSSPGKKSSYQEAAVQLGKELVERDIDLVYGGGSVGLMGLVSQAVHDGGRHV  70

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITG+ VGEVRAVS MHQRKAEMA+++DAFIALPGGYGTLEELLEVITW
Sbjct  71   LGVIPKTLMPREITGKPVGEVRAVSDMHQRKAEMARRADAFIALPGGYGTLEELLEVITW  130

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL F+D+AV+EGFI+P AR I+VSAPTA +L  +LE+YV
Sbjct  131  AQLGIHTKPVGLLNVDGYYNSLLSFVDQAVDEGFISPDARDIIVSAPTANDLFRKLEEYV  190

Query  879  PKHNGVAPKLSWEMEQ  926
            PK +  A +L WE+E+
Sbjct  191  PKRDDRASQLIWEIEE  206



>ref|XP_004136507.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Cucumis sativus]
 ref|XP_004164603.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Cucumis sativus]
 gb|KGN59187.1| hypothetical protein Csa_3G778430 [Cucumis sativus]
Length=215

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAI+L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQSAAIELGQELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LG+IP+TLMP EITGETVGEV+ VS MHQRKAEM +Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGIIPRTLMPVEITGETVGEVKPVSDMHQRKAEMTRQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLLCFIDKAV+EGF++P+AR I+VSAPTA+ L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLCFIDKAVDEGFVSPTARRIIVSAPTAKALVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+++ +  +L WE  ++  Y   +SEIA
Sbjct  188  PEYDEITSQLVWEDVERRSY-VAESEIA  214



>ref|XP_008669155.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL6 [Zea mays]
Length=249

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS G+  SYQ AA++L  +LV RNIDLVYGGGS+GLMGLVS+AVYNGGRHV
Sbjct  23   FRRICVFCGSSQGRKKSYQDAAVELGEELVSRNIDLVYGGGSVGLMGLVSRAVYNGGRHV  82

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  83   IGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  142

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV E FI+P+ARHI+V APT  EL+ +LE+Y 
Sbjct  143  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEEFISPTARHIIVLAPTPNELLDKLEEYS  202

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  V PK  WE EQ
Sbjct  203  PRHEEVVPKTKWETEQ  218



>ref|XP_010515835.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4 [Camelina sativa]
Length=215

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGKKSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMP+E+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPKELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA++L+ +LE+Y 
Sbjct  133  AQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISAPTAKDLVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHEIVATKLCWEIE-RIGYSS  213



>ref|XP_006828986.1| hypothetical protein AMTR_s00001p00242250 [Amborella trichopoda]
 gb|ERM96402.1| hypothetical protein AMTR_s00001p00242250 [Amborella trichopoda]
Length=218

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSS GK   Y+ AA++LA +LV R +DLVYGGGS+GLMGLVSQAV+ GG HV
Sbjct  10   FKRVCVFCGSSTGKRNCYRDAAVELAEELVSRKMDLVYGGGSVGLMGLVSQAVHRGGGHV  69

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LG+IPKTLM +EITGETVG+VR V+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  70   LGIIPKTLMCKEITGETVGDVRVVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  129

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FIDKAV++GFI P  RHI VSAP+A+EL+ +LEDYV
Sbjct  130  AQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDDGFIKPCQRHIFVSAPSAKELVQKLEDYV  189

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            P HNGV PK  WE+EQ    +  ++EIAR
Sbjct  190  PVHNGVVPKARWEVEQVEYNSLLQAEIAR  218



>ref|XP_002530151.1| carboxy-lyase, putative [Ricinus communis]
 gb|EEF32206.1| carboxy-lyase, putative [Ricinus communis]
Length=216

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSTGKKASYQEAAVELGKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGV+P+TLMPREI G+TVGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVVPRTLMPREIIGQTVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDG+YNSLLCFIDKAV+EGFI+P+AR I+VSAPTA++L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGFYNSLLCFIDKAVDEGFISPTARRIIVSAPTAKQLVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ +  KL WE    L Y
Sbjct  188  PEYDEITSKLVWEEVDILNY  207



>ref|XP_003521489.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Glycine max]
Length=213

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 3/208 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AA+QL  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPTYQEAAVQLGRELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP +LMPREITG+ +GEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPTSLMPREITGDPIGEVRAVSSMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDG+YNSLL FIDKAV+EGFI+P AR I+VSAPTA++LM  LE++V
Sbjct  128  AQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFISPKARRIIVSAPTAKQLMLELEEHV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ +  A KL W  E++L Y  T+SE+A
Sbjct  188  PEQDEFASKLVW--EERLNY-VTESEVA  212



>ref|XP_010534395.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Tarenaya hassleriana]
Length=239

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  9    FKRICVFCGSSSGKKPSYQEAAIQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPKTLMPREITGETVGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVD YY+SLL FIDKAV+EGFI+P+AR I+VSAPTA+EL+ +LE Y 
Sbjct  129  AQLGIHRKPVGLLNVDEYYDSLLSFIDKAVDEGFISPTARRIIVSAPTAKELVRKLEKYE  188

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ V  KL W+   ++ Y
Sbjct  189  PEYDEVTSKLVWDEVDRINY  208



>ref|XP_004304438.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Fragaria vesca subsp. vesca]
Length=219

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA +L  +LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKTSYQDAATELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TG T GEV+AV+GMHQRKAEMAK SDAFIALPGGYGTLEELLEVI W
Sbjct  73   IGVIPKTLMPRELTGVTPGEVKAVAGMHQRKAEMAKHSDAFIALPGGYGTLEELLEVIAW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYNSLL FID AV EGFI+P ARHI++SAPTA EL+ +LEDYV
Sbjct  133  AQLGIHDKPVGLLNVDGYYNSLLSFIDSAVEEGFISPDARHIIISAPTAMELVKKLEDYV  192

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P H  VA K +WEM  QLG T
Sbjct  193  PCHERVASKSNWEM-AQLGNT  212



>ref|XP_006410901.1| hypothetical protein EUTSA_v10017236mg [Eutrema salsugineum]
 gb|ESQ52354.1| hypothetical protein EUTSA_v10017236mg [Eutrema salsugineum]
Length=210

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 175/196 (89%), Gaps = 2/196 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  14   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  73

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  74   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  133

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  134  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTARKIIVSAPTAKELVKKLEEYA  193

Query  879  PKHNGVAPKLSWEMEQ  926
            P H  V  KL WEME+
Sbjct  194  PCHESV--KLCWEMER  207



>ref|XP_010504107.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like [Camelina sativa]
Length=215

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS G   SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGNRSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA++L+ +LE+Y 
Sbjct  133  AQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISAPTAKDLVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHEIVATKLCWEIE-RIGYSS  213



>ref|XP_010426993.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG4-like isoform X2 [Camelina sativa]
Length=215

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS G   SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FGRICVFCGSSQGNRSSYQDAAVDLGNELVLRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPRE+TGETVGEVRAV+ MHQRKAEMA+ SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGVIPKTLMPRELTGETVGEVRAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+P+AR I++SAPTA++L+ +LE+Y 
Sbjct  133  AQLGIHNKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARQIIISAPTAKDLVKKLEEYS  192

Query  879  PKHNGVAPKLSWEMEQQLGYTT  944
            P H  VA KL WE+E ++GY++
Sbjct  193  PCHEIVATKLCWEIE-RIGYSS  213



>ref|XP_010558001.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Tarenaya hassleriana]
Length=215

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G  PSYQ AA QL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGNKPSYQEAATQLGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGETVGEV+AV+ MH+RKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETVGEVKAVADMHRRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV EGFI+P AR I+VSAPTA+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLSFIDKAVEEGFISPMARRIIVSAPTAKELVRKLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ +  KL W+   +L Y
Sbjct  188  PEYDEITSKLVWDEVDRLSY  207



>ref|XP_004953163.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Setaria italica]
Length=243

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV RNIDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  19   FRRICVFCGSSHGKKKSYQDAAIELGKELVARNIDLVYGGGSVGLMGLVSQAVYNGGRHV  78

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI+GETVGEV+AV+ MHQRKAEMA++SDAFIALPGGYGTLEELLEVI W
Sbjct  79   IGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARRSDAFIALPGGYGTLEELLEVIAW  138

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FIDKAV EGFI P+AR I+V APT +EL+ +LE+Y 
Sbjct  139  AQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIKPTARSIIVLAPTPKELIQKLEEYS  198

Query  879  PKHNGVAPKLSWEMEQ  926
            P+H  + PK+ WEMEQ
Sbjct  199  PQHEEIIPKMKWEMEQ  214



>gb|EYU18134.1| hypothetical protein MIMGU_mgv1a023227mg [Erythranthe guttata]
Length=217

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  9    FKRICVFCGSSSGKKPTYQEAAVELGKELVERKIDLVYGGGSVGLMGLVSQAVHDGGRHV  68

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP+TLMP EITG+T+GEVRAVSGMHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  69   LGVIPRTLMPLEITGQTIGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  128

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNV+GYYNSLL F+DKAV+EGFI+P++R I+VSAP+A++L+  LE+++
Sbjct  129  AQLGIHRKPVGLLNVEGYYNSLLSFLDKAVDEGFISPTSRRIIVSAPSAKQLVRELEEHI  188

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEI  959
            P+++ +  KL+WE  ++L Y   +S++
Sbjct  189  PEYDEITSKLNWEDVERLNYIPDESDV  215



>ref|XP_009143522.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like [Brassica rapa]
Length=206

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ AA++L N+LV R I+LVYGGGSIG+MGLVSQAV++GGRHV
Sbjct  13   FKRICVFCGSSQGKKSSYQDAAVELGNELVSRKIELVYGGGSIGVMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALPGGYGTLEELLEVITW
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITW  132

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYNSLL FIDKAV EGFI+ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  133  AQLGIHEKPVGLLNVDGYYNSLLSFIDKAVEEGFISTTAREIIVSAPTAKELVKKLEEYA  192

Query  879  PKHNGVAPKLSWE  917
            P H  VA KL WE
Sbjct  193  PCHESVASKLCWE  205



>ref|XP_006430086.1| hypothetical protein CICLE_v10013759mg [Citrus clementina]
 gb|ESR43326.1| hypothetical protein CICLE_v10013759mg [Citrus clementina]
Length=213

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 184/208 (88%), Gaps = 3/208 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AA++L  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPTYQEAAVELGKELVERKIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTL PREITG+ VGEV+ VS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLTPREITGDPVGEVKTVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDG+YNSLL F+DKAV+EGFI+P+AR I++SAPTA++L+ +LE+YV
Sbjct  128  AQLGIHRKPVGLLNVDGFYNSLLSFVDKAVDEGFISPTARRIIISAPTAKKLVRQLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+H+ +  KL W  E +L Y  ++SEIA
Sbjct  188  PEHDEITSKLVW--EDRLNY-VSESEIA  212



>ref|NP_001169307.1| hypothetical protein [Zea mays]
 gb|ACN33350.1| unknown [Zea mays]
 gb|AFW68572.1| hypothetical protein ZEAMMB73_363889 [Zea mays]
Length=207

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY  AAI+L N+LV R++DLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  8    FKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVYDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLM  EI+GETVGEVRAV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  68   IGVIPKTLMTPEISGETVGEVRAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV EGFI PSAR I+V APTAQELM +LE+Y 
Sbjct  128  AQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMDKLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H+ VA  L+WEM    GY
Sbjct  188  PYHDMVASTLNWEMGNLQGY  207



>ref|XP_009122236.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Brassica rapa]
Length=215

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS G  PSYQ AAIQL N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGNKPSYQEAAIQLGNELVERKIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q++AFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQANAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ + +  KL W+   +L Y    SE+A
Sbjct  188  PEFDEITSKLVWDEVDRLSYVPG-SEVA  214



>ref|XP_011046883.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Populus euphratica]
Length=214

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKRVCVFCGSS GK  SYQ AA++LA +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRVCVFCGSSSGKKASYQEAAVELAKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP++LMPRE+TGE VGEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPRSLMPREVTGEPVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQL IH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P+AR I+VSA TA++L  +LEDYV
Sbjct  128  AQLNIHHKPVGLLNVDGYYNSLLSFIDKAVDEGFISPAARRIIVSASTAKQLFRQLEDYV  187

Query  879  PKHNGVAPKLSWEMEQQL  932
            P+H+ +  KL WE   +L
Sbjct  188  PEHDEITAKLVWEEVDRL  205



>emb|CDY14086.1| BnaC02g02030D [Brassica napus]
Length=215

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAI+L N+LVER IDLVYGGGS+GLMGLVS AV++GGRHV
Sbjct  8    FKRICVFCGSSSGKRPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSHAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+ + +  KL W+   +L Y
Sbjct  188  PEFDEITSKLVWDEVDRLSY  207



>ref|XP_009125642.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7 [Brassica rapa]
 emb|CDY04985.1| BnaAnng01670D [Brassica napus]
Length=215

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F R+CVFCGSS GK PSYQ AAI+L N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FNRICVFCGSSSGKKPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIPKTLMPREITGET+GEV+AV+ MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPKTLMPREITGETIGEVKAVADMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV+EGFI+P AR I+VSAP A+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLTFIDKAVDEGFISPMARRIIVSAPNAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+ + +  KL W+   +L Y
Sbjct  188  PEFDEITSKLVWDEVDRLSY  207



>ref|XP_011013919.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3-like isoform X1 [Populus euphratica]
Length=246

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 183/223 (82%), Gaps = 23/223 (10%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SYQ+AAI L N+LV RNIDLVYGGGSIGLMGL+SQAV++GGRHV
Sbjct  18   FKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLISQAVHDGGRHV  77

Query  519  LGVIPKTLMPRE----------------------ITGETVGEVRAVSGMHQRKAEMAKQS  632
            +GVIPKTLM  E                      +TGETVGEV+AV+ MHQRKAEMAK S
Sbjct  78   IGVIPKTLMRPEASVSQGFCSSDEYIIALSTVCLLTGETVGEVKAVADMHQRKAEMAKHS  137

Query  633  DAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPS  812
            DAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+PS
Sbjct  138  DAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPS  197

Query  813  ARHIVVSAPTAQELMSRLEDYVPKHNGVAPKLSWEMEQQLGYT  941
            AR+I+VSAPTA+EL+ +LE+YVP H  VA KLSWE+E QLG++
Sbjct  198  ARNIIVSAPTAKELVKKLEEYVPCHERVASKLSWEIE-QLGHS  239



>ref|XP_004982851.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL10-like isoform X2 [Setaria italica]
Length=206

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK  SY  AAI+L N+LV R++DLVYGGGSIGLMGLVSQAVY+GGRHV
Sbjct  8    FKRICVFCGSSQGKKRSYHDAAIELGNELVARSVDLVYGGGSIGLMGLVSQAVYDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLM  EI+GETVGEVR V+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITW
Sbjct  68   IGVIPKTLMTPEISGETVGEVRPVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKAV EGFI PSAR I+V APTAQELM +LE+YV
Sbjct  128  AQLGIHHKPVGLLNVDGYYNSLLTFIDKAVEEGFINPSARRIIVLAPTAQELMDKLEEYV  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P H+ VA  L+WEM   LGY
Sbjct  188  PYHDRVASTLNWEM-GHLGY  206



>ref|XP_008788743.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG1-like [Phoenix dactylifera]
Length=226

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 182/215 (85%), Gaps = 20/215 (9%)
 Frame = +3

Query  348  VCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHVLGV  527
            VCVFCGSSPG   SYQL         VERNIDLVYGGGS GLMG VSQAVYNGG HVLGV
Sbjct  23   VCVFCGSSPGNKASYQL---------VERNIDLVYGGGSAGLMGHVSQAVYNGGCHVLGV  73

Query  528  IPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALP---------GGYGTLEEL  680
            IP+TLMPREITGETVGEVRAVSGMHQRKAEMA+Q+DAFIALP         GGYGTLEEL
Sbjct  74   IPRTLMPREITGETVGEVRAVSGMHQRKAEMARQADAFIALPVALHFVKILGGYGTLEEL  133

Query  681  LEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMS  860
            LEVITWAQLGIH+KPVGLLNVDGYYN+LL FIDKAV+EGFITP+ARHI+VSA TA EL+S
Sbjct  134  LEVITWAQLGIHEKPVGLLNVDGYYNALLSFIDKAVDEGFITPAARHIIVSAQTALELLS  193

Query  861  RLEDYVPKHNGVAPKLSWEMEQQLGYTTTKSEIAR  965
            +LE+YVP+H GVAPKL WEME QLG+ + K +IAR
Sbjct  194  KLEEYVPRHEGVAPKLKWEME-QLGH-SRKPDIAR  226



>ref|XP_006647546.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2-like [Oryza brachyantha]
Length=244

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L  +LV RNIDLVYGGGS GLMGLVSQAV++GGRHV
Sbjct  20   FRRICVFCGSSHGKKKSYQDAAVDLGKELVTRNIDLVYGGGSAGLMGLVSQAVHSGGRHV  79

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI+GETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  80   IGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  139

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIHDKPVGLLNVDGYYN LL FIDKAV EGFI PSARHI+V APT +EL+ +LE+Y 
Sbjct  140  AQLGIHDKPVGLLNVDGYYNPLLSFIDKAVEEGFIRPSARHIIVLAPTPKELIEKLEEYS  199

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P+H  V  K+ WEME QL Y+
Sbjct  200  PQHEKVVSKMKWEME-QLSYS  219



>ref|XP_003575405.1| PREDICTED: probable cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOGL2 [Brachypodium distachyon]
Length=242

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AAI+L  +LV R IDLVYGGGS+GLMGLVSQAVYNGGRHV
Sbjct  18   FRRICVFCGSSHGKKKSYQDAAIELGKELVSRKIDLVYGGGSVGLMGLVSQAVYNGGRHV  77

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPKTLMPREI+GETVGEV+AV+ MHQRKAEMA+QSDAFIALPGGYGTLEELLEVI W
Sbjct  78   IGVIPKTLMPREISGETVGEVKAVADMHQRKAEMARQSDAFIALPGGYGTLEELLEVIAW  137

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH+KPVGLLNVDGYYN LL FI+KAV EGFI P+A+HI+V APT +EL+ +LE+Y 
Sbjct  138  AQLGIHNKPVGLLNVDGYYNPLLAFIEKAVEEGFIKPTAQHIIVLAPTPKELIEKLEEYS  197

Query  879  PKHNGVAPKLSWEMEQQLGYT  941
            P+H  V P++ WEME QL Y+
Sbjct  198  PRHEKVVPQMKWEME-QLSYS  217



>ref|XP_003553618.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like isoform X1 [Glycine max]
 gb|KHN02178.1| Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7-like 
protein [Glycine soja]
Length=212

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 180/208 (87%), Gaps = 4/208 (2%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK P+YQ AA+QL  +LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPTYQEAAVQLGRELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            LGVIP +LMPREITG+ +GEVRAVS MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   LGVIPTSLMPREITGDPIGEVRAVSSMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDG+YNSLL FIDKAV+EGFI+P+AR I+VSAPTA++LM  LE++V
Sbjct  128  AQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLMLELEEHV  187

Query  879  PKHNGVAPKLSWEMEQQLGYTTTKSEIA  962
            P+ +  A KL WE         T+SE+A
Sbjct  188  PEQDEFASKLVWEER----LYVTESEVA  211



>ref|XP_010906513.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG3 isoform X1 [Elaeis guineensis]
Length=254

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 189/245 (77%), Gaps = 38/245 (16%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVER----------------------------  434
            FKR+CVFCGSS GK  SYQ AA++L  +LV                              
Sbjct  12   FKRICVFCGSSQGKKRSYQDAAVELGKELVRSRITFSEPETGKITVDNGVHPWPSSLAFL  71

Query  435  --------NIDLVYGGGSIGLMGLVSQAVYNGGRHVLGVIPKTLMPREITGETVGEVRAV  590
                    NIDLVYGGGS+GLMGLVSQAV++GGRHV+GVIPKTLMPREITGETVGEV+AV
Sbjct  72   VLNRPVSGNIDLVYGGGSVGLMGLVSQAVHDGGRHVIGVIPKTLMPREITGETVGEVKAV  131

Query  591  SGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLC  770
            + MHQRKAEMA+QSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLL 
Sbjct  132  ADMHQRKAEMARQSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLS  191

Query  771  FIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYVPKHNGVAPKLSWEMEQQLGYTTTK  950
            FIDKAV EGFI P+ARHI+VSAPTA+EL+ +LE+Y P+H  VA KL+WEME +LGY ++K
Sbjct  192  FIDKAVEEGFINPNARHIIVSAPTAKELVKKLEEYFPRHERVASKLNWEME-RLGY-SSK  249

Query  951  SEIAR  965
             EI+R
Sbjct  250  HEISR  254



>ref|NP_001189696.1| cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 
[Arabidopsis thaliana]
 gb|AEC09368.1| protein LONELY GUY 3 [Arabidopsis thaliana]
Length=239

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 181/226 (80%), Gaps = 25/226 (11%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            F+R+CVFCGSS GK  SYQ AA+ L N+LV RNIDLVYGGGSIGLMGLVSQAV++GGRHV
Sbjct  13   FRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHV  72

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALP---------------  653
            +G+IPKTLMPRE+TGETVGEVRAV+ MHQRKAEMAK SDAFIALP               
Sbjct  73   IGIIPKTLMPRELTGETVGEVRAVADMHQRKAEMAKHSDAFIALPEENNLVKLKNMLSWS  132

Query  654  ---------GGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFIT  806
                      GYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLL FIDKAV EGFI+
Sbjct  133  SCSVKATLKSGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFIS  192

Query  807  PSARHIVVSAPTAQELMSRLEDYVPKHNGVAPKLSWEMEQQLGYTT  944
            P+AR I+VSAPTA+EL+ +LE+Y P H  VA KL WEME ++GY++
Sbjct  193  PTAREIIVSAPTAKELVKKLEEYAPCHERVATKLCWEME-RIGYSS  237



>ref|XP_010543825.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase 
LOG7-like [Tarenaya hassleriana]
Length=215

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  339  FKRVCVFCGSSPGKNPSYQLAAIQLANQLVERNIDLVYGGGSIGLMGLVSQAVYNGGRHV  518
            FKR+CVFCGSS GK PSYQ AAI+L N+LVER IDLVYGGGS+GLMGLVSQAV++GGRHV
Sbjct  8    FKRICVFCGSSSGKKPSYQEAAIELGNELVERRIDLVYGGGSVGLMGLVSQAVHHGGRHV  67

Query  519  LGVIPKTLMPREITGETVGEVRAVSGMHQRKAEMAKQSDAFIALPGGYGTLEELLEVITW  698
            +GVIPK+LMPREITGETVGEV+AV  MHQRKAEMA+Q+DAFIALPGGYGTLEELLEVITW
Sbjct  68   IGVIPKSLMPREITGETVGEVKAVDDMHQRKAEMARQADAFIALPGGYGTLEELLEVITW  127

Query  699  AQLGIHDKPVGLLNVDGYYNSLLCFIDKAVNEGFITPSARHIVVSAPTAQELMSRLEDYV  878
            AQLGIH KPVGLLNVDGYYNSLL FIDKA++EGFI+ +AR I+VSAPTA+EL+ +LE+Y 
Sbjct  128  AQLGIHRKPVGLLNVDGYYNSLLSFIDKAMDEGFISAAARRIIVSAPTAKELVRQLEEYE  187

Query  879  PKHNGVAPKLSWEMEQQLGY  938
            P+++ +  KL W+   ++ Y
Sbjct  188  PEYDEITSKLVWDEVDRINY  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3404794646940