BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14896_g1_i2 len=1417 path=[1352:0-159 2723:160-190 1513:191-1374
2697:1375-1380 2697:1381-1386 2697:1387-1392 2697:1393-1398
2697:1399-1404 2697:1405-1410 2697:1411-1416]

Length=1417
                                                                      Score     E

ref|XP_002524051.1|  conserved hypothetical protein                     447   2e-151   Ricinus communis
ref|XP_009776655.1|  PREDICTED: uncharacterized protein LOC104226...    439   1e-147   
ref|XP_009776656.1|  PREDICTED: uncharacterized protein LOC104226...    437   2e-147   
ref|XP_004307831.1|  PREDICTED: uncharacterized protein LOC101311621    436   6e-147   
ref|XP_006350972.1|  PREDICTED: uncharacterized protein LOC102582307    436   6e-147   
ref|XP_009631870.1|  PREDICTED: uncharacterized protein LOC104121556    435   1e-146   
ref|XP_004249897.1|  PREDICTED: uncharacterized protein LOC101246584    433   7e-146   
gb|KDP39553.1|  hypothetical protein JCGZ_02573                         432   9e-146   
emb|CDP15037.1|  unnamed protein product                                427   1e-143   
ref|XP_011010582.1|  PREDICTED: uncharacterized protein LOC105115405    424   1e-142   
ref|XP_007029709.1|  Intracellular protein transport protein USO1...    423   6e-142   
ref|XP_007029708.1|  Intracellular protein transport protein USO1...    422   6e-142   
ref|XP_002269622.2|  PREDICTED: uncharacterized protein LOC100247776    421   2e-141   Vitis vinifera
gb|KHG29515.1|  Serine/threonine-protein kinase                         421   3e-141   
ref|XP_011081733.1|  PREDICTED: uncharacterized protein LOC105164...    421   5e-141   
ref|XP_007029707.1|  Intracellular protein transport protein USO1...    421   6e-141   
ref|XP_011081734.1|  PREDICTED: uncharacterized protein LOC105164...    420   1e-140   
gb|KDO48016.1|  hypothetical protein CISIN_1g019288mg                   419   1e-140   
ref|XP_011044425.1|  PREDICTED: uncharacterized protein LOC105139...    419   2e-140   
ref|XP_006437415.1|  hypothetical protein CICLE_v10032005mg             418   6e-140   
ref|XP_002325450.1|  hypothetical protein POPTR_0019s05960g             417   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_008383832.1|  PREDICTED: uncharacterized protein LOC103446...    417   1e-139   
ref|XP_011044426.1|  PREDICTED: uncharacterized protein LOC105139...    416   2e-139   
ref|XP_009361111.1|  PREDICTED: uncharacterized protein LOC103951...    415   9e-139   
ref|XP_008383835.1|  PREDICTED: uncharacterized protein LOC103446...    414   1e-138   
ref|XP_008383833.1|  PREDICTED: uncharacterized protein LOC103446...    414   3e-138   
ref|XP_009361113.1|  PREDICTED: uncharacterized protein LOC103951...    412   7e-138   
gb|EYU29300.1|  hypothetical protein MIMGU_mgv1a009640mg                412   7e-138   
ref|XP_008234517.1|  PREDICTED: uncharacterized protein LOC103333...    412   1e-137   
ref|XP_008234519.1|  PREDICTED: uncharacterized protein LOC103333...    410   5e-137   
ref|XP_009361112.1|  PREDICTED: uncharacterized protein LOC103951...    410   8e-137   
ref|XP_009368110.1|  PREDICTED: uncharacterized protein LOC103957...    409   9e-137   
ref|XP_010087445.1|  hypothetical protein L484_019648                   409   2e-136   
ref|XP_008383834.1|  PREDICTED: uncharacterized protein LOC103446...    408   5e-136   
ref|XP_006484690.1|  PREDICTED: uncharacterized protein LOC102629...    407   9e-136   
ref|XP_009368117.1|  PREDICTED: uncharacterized protein LOC103957...    405   3e-135   
ref|XP_008382262.1|  PREDICTED: uncharacterized protein LOC103445...    405   1e-134   
ref|XP_009348923.1|  PREDICTED: uncharacterized protein LOC103940...    404   2e-134   
ref|XP_008382274.1|  PREDICTED: uncharacterized protein LOC103445...    402   1e-133   
ref|XP_009348926.1|  PREDICTED: uncharacterized protein LOC103940...    402   1e-133   
ref|XP_008382268.1|  PREDICTED: uncharacterized protein LOC103445...    400   5e-133   
ref|XP_009348925.1|  PREDICTED: uncharacterized protein LOC103940...    400   5e-133   
ref|XP_009368118.1|  PREDICTED: uncharacterized protein LOC103957...    399   6e-133   
gb|AFK47439.1|  unknown                                                 397   8e-132   
ref|XP_010056923.1|  PREDICTED: uncharacterized protein LOC104444...    396   1e-131   
ref|XP_010056922.1|  PREDICTED: uncharacterized protein LOC104444...    395   5e-131   
ref|XP_010056925.1|  PREDICTED: uncharacterized protein LOC104444...    394   8e-131   
ref|XP_010056924.1|  PREDICTED: uncharacterized protein LOC104444...    393   3e-130   
ref|XP_011072845.1|  PREDICTED: uncharacterized protein LOC105157...    390   5e-129   
ref|XP_011072848.1|  PREDICTED: uncharacterized protein LOC105157...    390   5e-129   
gb|KHG22604.1|  Na(+)-translocating NADH-quinone reductase subunit F    388   3e-128   
ref|XP_004140083.1|  PREDICTED: uncharacterized protein LOC101220...    385   4e-127   
ref|XP_004158611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    384   1e-126   
ref|XP_008449379.1|  PREDICTED: uncharacterized protein LOC103491277    384   1e-126   
gb|KDO48018.1|  hypothetical protein CISIN_1g019288mg                   382   1e-126   
ref|XP_007131478.1|  hypothetical protein PHAVU_011G017000g             377   7e-124   
ref|XP_006592001.1|  PREDICTED: uncharacterized protein LOC100819...    374   9e-123   
ref|XP_006587673.1|  PREDICTED: uncharacterized protein LOC100792...    374   1e-122   
gb|KHG17667.1|  Desmoplakin                                             373   2e-122   
ref|XP_003540017.1|  PREDICTED: uncharacterized protein LOC100819...    372   6e-122   
ref|XP_004506334.1|  PREDICTED: uncharacterized protein LOC101496354    371   6e-122   
ref|XP_003534361.1|  PREDICTED: uncharacterized protein LOC100792...    371   1e-121   
emb|CAN62200.1|  hypothetical protein VITISV_032475                     378   2e-121   Vitis vinifera
gb|ACU24497.1|  unknown                                                 369   7e-121   Glycine max [soybeans]
ref|XP_010276970.1|  PREDICTED: uncharacterized protein LOC104611...    368   4e-120   
ref|XP_010271021.1|  PREDICTED: uncharacterized protein LOC104607...    364   5e-119   
ref|XP_008801427.1|  PREDICTED: uncharacterized protein LOC103715...    362   9e-118   
ref|XP_010276969.1|  PREDICTED: uncharacterized protein LOC104611...    362   9e-118   
ref|XP_008801442.1|  PREDICTED: uncharacterized protein LOC103715...    360   2e-117   
ref|XP_010271016.1|  PREDICTED: uncharacterized protein LOC104607...    359   4e-117   
ref|XP_002319776.1|  hypothetical protein POPTR_0013s07430g             357   4e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010276968.1|  PREDICTED: uncharacterized protein LOC104611...    361   5e-117   
ref|XP_008802962.1|  PREDICTED: uncharacterized protein LOC103716...    355   2e-115   
ref|XP_010448102.1|  PREDICTED: uncharacterized protein LOC104730...    353   7e-115   
ref|XP_002867492.1|  hypothetical protein ARALYDRAFT_492028             352   1e-114   
ref|XP_010918059.1|  PREDICTED: uncharacterized protein LOC105042...    353   2e-114   
ref|XP_010906226.1|  PREDICTED: uncharacterized protein LOC105033...    352   3e-114   
ref|XP_010448100.1|  PREDICTED: uncharacterized protein LOC104730...    351   4e-114   
gb|AFK44682.1|  unknown                                                 351   6e-114   
ref|XP_010241455.1|  PREDICTED: uncharacterized protein LOC104586051    351   8e-114   
ref|XP_006284069.1|  hypothetical protein CARUB_v10005195mg             350   1e-113   
ref|XP_010918058.1|  PREDICTED: uncharacterized protein LOC105042...    350   1e-113   
ref|XP_010271020.1|  PREDICTED: uncharacterized protein LOC104607...    350   2e-113   
ref|XP_010918056.1|  PREDICTED: uncharacterized protein LOC105042...    350   6e-113   
ref|XP_010918055.1|  PREDICTED: uncharacterized protein LOC105042...    350   6e-113   
ref|XP_008802963.1|  PREDICTED: uncharacterized protein LOC103716...    348   7e-113   
ref|XP_010695809.1|  PREDICTED: uncharacterized protein LOC104908387    346   4e-112   
ref|XP_010438583.1|  PREDICTED: uncharacterized protein LOC104722159    345   7e-112   
ref|XP_010433341.1|  PREDICTED: uncharacterized protein LOC104717469    344   2e-111   
ref|XP_006413056.1|  hypothetical protein EUTSA_v10025690mg             342   2e-110   
ref|XP_010433334.1|  PREDICTED: uncharacterized protein LOC104717467    342   2e-110   
ref|XP_010438580.1|  PREDICTED: uncharacterized protein LOC104722...    341   4e-110   
ref|XP_006413057.1|  hypothetical protein EUTSA_v10025651mg             341   5e-110   
ref|XP_010448103.1|  PREDICTED: uncharacterized protein LOC104730...    340   6e-110   
ref|XP_010438581.1|  PREDICTED: uncharacterized protein LOC104722...    337   9e-109   
ref|XP_010448104.1|  PREDICTED: uncharacterized protein LOC104730...    337   1e-108   
ref|XP_006284093.1|  hypothetical protein CARUB_v10005230mg             336   3e-108   
ref|XP_010553820.1|  PREDICTED: uncharacterized protein LOC104823...    337   3e-108   
ref|XP_010553821.1|  PREDICTED: uncharacterized protein LOC104823...    336   4e-108   
ref|NP_567781.1|  uncharacterized protein                               335   7e-108   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01610.1|  hypothetical protein                                   335   7e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194491.2|  uncharacterized protein                               335   9e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029711.1|  Intracellular protein transport protein USO1...    333   1e-107   
gb|AAM61004.1|  unknown                                                 334   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553819.1|  PREDICTED: uncharacterized protein LOC104823...    335   1e-107   
ref|XP_007029710.1|  Intracellular protein transport protein USO1...    332   1e-107   
ref|XP_010271022.1|  PREDICTED: uncharacterized protein LOC104607...    333   2e-107   
ref|XP_010553822.1|  PREDICTED: uncharacterized protein LOC104823...    333   4e-107   
ref|XP_009361115.1|  PREDICTED: uncharacterized protein LOC103951...    330   2e-106   
ref|XP_010550952.1|  PREDICTED: uncharacterized protein LOC104821...    332   2e-106   
ref|XP_006647428.1|  PREDICTED: uncharacterized protein LOC102708588    329   2e-105   
ref|XP_009348927.1|  PREDICTED: uncharacterized protein LOC103940...    326   6e-105   
ref|XP_009396209.1|  PREDICTED: uncharacterized protein LOC103981...    330   9e-105   
ref|XP_008382280.1|  PREDICTED: uncharacterized protein LOC103445...    325   2e-104   
ref|XP_009396208.1|  PREDICTED: uncharacterized protein LOC103981...    329   3e-104   
ref|XP_009396211.1|  PREDICTED: uncharacterized protein LOC103981...    329   3e-104   
ref|XP_007219246.1|  hypothetical protein PRUPE_ppa018012mg             324   4e-104   
emb|CDX89232.1|  BnaA01g16610D                                          325   5e-104   
ref|XP_002867491.1|  hypothetical protein ARALYDRAFT_913772             324   9e-104   
ref|XP_009143618.1|  PREDICTED: uncharacterized protein LOC103867315    325   1e-103   
ref|XP_009396210.1|  PREDICTED: uncharacterized protein LOC103981...    327   1e-103   
emb|CDY19047.1|  BnaC01g20210D                                          323   2e-103   
ref|XP_009143663.1|  PREDICTED: uncharacterized protein LOC103867353    321   2e-102   
emb|CDY52991.1|  BnaAnng11850D                                          320   2e-102   
dbj|BAD29314.1|  unknown protein                                        321   3e-102   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19049.1|  BnaC01g20190D                                          319   1e-101   
ref|XP_002454071.1|  hypothetical protein SORBIDRAFT_04g024180          318   6e-101   Sorghum bicolor [broomcorn]
ref|XP_009137673.1|  PREDICTED: uncharacterized protein LOC103861705    317   6e-101   
ref|XP_010550959.1|  PREDICTED: uncharacterized protein LOC104821...    316   7e-101   
emb|CAB38274.1|  hypothetical protein                                   313   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008678740.1|  PREDICTED: uncharacterized protein LOC103653690    314   2e-99    
emb|CDY56327.1|  BnaC07g50400D                                          313   3e-99    
dbj|BAJ91138.1|  predicted protein                                      310   7e-98    
ref|XP_003567800.1|  PREDICTED: uncharacterized protein LOC100845287    307   7e-97    
ref|XP_010528670.1|  PREDICTED: uncharacterized protein LOC104805719    307   8e-97    
ref|XP_009397568.1|  PREDICTED: uncharacterized protein LOC103982372    306   2e-96    
ref|XP_009415147.1|  PREDICTED: uncharacterized protein LOC103996060    306   3e-96    
ref|NP_001056470.1|  Os05g0587400                                       305   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681376.1|  PREDICTED: hypothetical protein isoform X1         305   4e-96    
ref|XP_007131479.1|  hypothetical protein PHAVU_011G017000g             303   6e-96    
ref|XP_008681377.1|  PREDICTED: hypothetical protein isoform X2         304   1e-95    
ref|XP_004961048.1|  PREDICTED: uncharacterized protein LOC101775...    303   2e-95    
gb|EEC79776.1|  hypothetical protein OsI_21185                          303   2e-95    Oryza sativa Indica Group [Indian rice]
emb|CAB38273.1|  hypothetical protein                                   301   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575242.1|  PREDICTED: uncharacterized protein LOC100844...    301   1e-94    
ref|XP_010235607.1|  PREDICTED: uncharacterized protein LOC100844...    301   3e-94    
ref|XP_002441603.1|  hypothetical protein SORBIDRAFT_09g030180          300   3e-94    Sorghum bicolor [broomcorn]
gb|EMS51308.1|  hypothetical protein TRIUR3_17822                       307   5e-93    
dbj|BAK06988.1|  predicted protein                                      290   3e-90    
gb|KGN47863.1|  hypothetical protein Csa_6G408220                       286   4e-90    
ref|XP_004952914.1|  PREDICTED: uncharacterized protein LOC101783264    289   6e-90    
gb|EMT05189.1|  hypothetical protein F775_03767                         297   2e-87    
ref|XP_010906227.1|  PREDICTED: uncharacterized protein LOC105033...    277   1e-85    
gb|EPS70470.1|  hypothetical protein M569_04291                         253   6e-77    
ref|XP_006854221.1|  hypothetical protein AMTR_s00048p00222520          247   8e-74    
ref|NP_001140405.1|  hypothetical protein                               238   2e-71    Zea mays [maize]
ref|XP_009361116.1|  PREDICTED: uncharacterized protein LOC103951...    236   3e-70    
gb|AFW62763.1|  hypothetical protein ZEAMMB73_863256                    229   3e-68    
ref|XP_008382288.1|  PREDICTED: uncharacterized protein LOC103445...    230   1e-67    
ref|XP_009348928.1|  PREDICTED: uncharacterized protein LOC103940...    225   8e-66    
gb|EYU20402.1|  hypothetical protein MIMGU_mgv1a014068mg                193   9e-55    
gb|ABR18020.1|  unknown                                                 172   7e-45    Picea sitchensis
gb|ABR17946.1|  unknown                                                 167   4e-43    Picea sitchensis
gb|AFW62766.1|  hypothetical protein ZEAMMB73_938861                  71.6    1e-11    
ref|XP_002960255.1|  hypothetical protein SELMODRAFT_402395           76.6    1e-11    
ref|XP_002967459.1|  hypothetical protein SELMODRAFT_408480           76.6    1e-11    
ref|XP_009114075.1|  PREDICTED: uncharacterized protein LOC103839...  69.3    1e-10    
ref|XP_009114082.1|  PREDICTED: uncharacterized protein LOC103839...  68.9    2e-10    



>ref|XP_002524051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38419.1| conserved hypothetical protein [Ricinus communis]
Length=342

 Score =   447 bits (1149),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/343 (67%), Positives = 277/343 (81%), Gaps = 1/343 (0%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M SR NG  R QK K  QGEGPNW++IAGGALLSTLS+RLGYKLKQ LD KQQ  + N  
Sbjct  1     MTSRTNGIPRGQKGKTFQGEGPNWIIIAGGALLSTLSIRLGYKLKQTLDTKQQANSSNIM  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K ++R++   CH+ S+++ F QDD+ CYN +SG   + D+K Q + Q+L+ES+  L
Sbjct  61    KGNEKSSDRRRTGGCHMHSNTFSFTQDDDGCYNCISGNEGIGDLKHQPSDQMLSESDVPL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP  +F++ENG  W SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  121   PLVTVPGPKFTKENGIMWVSSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKL  180

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MI+EMQ+QI+ELQSSLNAQL+HS +LQS LD ANRD+FDSEREIQRLRK I
Sbjct  181   RQQLKRRDDMIMEMQDQILELQSSLNAQLTHSMNLQSQLDAANRDMFDSEREIQRLRKAI  240

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV  V   EK PTVP +W SE RNG+ANG+ + +   + SEKG+GDGERIEML+REV
Sbjct  241   ADHCVKHVAPNEKPPTVP-IWPSEVRNGHANGYMDGDGSFELSEKGKGDGERIEMLKREV  299

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LKEVI+GKE+LLQSYKEQKAEL+ ++KELQQRLDSQLPNIL
Sbjct  300   GDLKEVIEGKEFLLQSYKEQKAELAMKIKELQQRLDSQLPNIL  342



>ref|XP_009776655.1| PREDICTED: uncharacterized protein LOC104226377 isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   439 bits (1129),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 247/353 (70%), Positives = 284/353 (80%), Gaps = 10/353 (3%)
 Frame = +3

Query  285   ATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTT  464
              T KMK R N   R+Q+SK +Q EGPNWV+IAG ALLSTLSVRLGYKLKQVLD++QQN T
Sbjct  47    VTPKMKPRTNVGPRSQRSKGVQNEGPNWVIIAGSALLSTLSVRLGYKLKQVLDSRQQNKT  106

Query  465   GNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQ-CNGQVLTE  641
              ++ K N K  E +K  N HLQSS+Y F QDD+ CYN  +G   +  +KQQ CNG   +E
Sbjct  107   ASSLKGNEKSPEGRKLGNGHLQSSTYYFAQDDDGCYNCNTGAGGLGVIKQQQCNG---SE  163

Query  642   SETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKRE  821
              E  LPLVTVP++EF++ENGG WSSS DRLELPQKP H SN SESPCVSESGSDI+SKRE
Sbjct  164   PEMVLPLVTVPAIEFNKENGGPWSSSPDRLELPQKPFHHSNSSESPCVSESGSDIYSKRE  223

Query  822   VIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQR  1001
             VIQKLR Q+KRRDE ILEMQEQIVELQ SLN+QLSHS+HLQSLLD ANRDLFDSEREIQR
Sbjct  224   VIQKLRLQLKRRDETILEMQEQIVELQGSLNSQLSHSAHLQSLLDAANRDLFDSEREIQR  283

Query  1002  LRKVIADHCVGQVDSCEKIPTVPSLWGSEGR----NGYANGHFEAERHLKSSEKGR-GDG  1166
             LRK IADHCVGQV SC+K PTVP +W +E R    NG+ NGH E +R+  +SEKGR GDG
Sbjct  284   LRKAIADHCVGQVGSCDKSPTVP-VWPAEVRYGHMNGHTNGHLEIDRNSDTSEKGRGGDG  342

Query  1167  ERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ER EML+RE  ELKEVI+GK+YL++SYKEQ  ELS +VKELQQRLD+QLPNIL
Sbjct  343   ERFEMLKREKDELKEVIEGKDYLIKSYKEQTTELSIKVKELQQRLDAQLPNIL  395



>ref|XP_009776656.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009776657.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009776659.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009776660.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009776661.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009776662.1| PREDICTED: uncharacterized protein LOC104226377 isoform X2 [Nicotiana 
sylvestris]
Length=345

 Score =   437 bits (1123),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 245/349 (70%), Positives = 282/349 (81%), Gaps = 10/349 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R N   R+Q+SK +Q EGPNWV+IAG ALLSTLSVRLGYKLKQVLD++QQN T ++ 
Sbjct  1     MKPRTNVGPRSQRSKGVQNEGPNWVIIAGSALLSTLSVRLGYKLKQVLDSRQQNKTASSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQ-CNGQVLTESETE  653
             K N K  E +K  N HLQSS+Y F QDD+ CYN  +G   +  +KQQ CNG   +E E  
Sbjct  61    KGNEKSPEGRKLGNGHLQSSTYYFAQDDDGCYNCNTGAGGLGVIKQQQCNG---SEPEMV  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP++EF++ENGG WSSS DRLELPQKP H SN SESPCVSESGSDI+SKREVIQK
Sbjct  118   LPLVTVPAIEFNKENGGPWSSSPDRLELPQKPFHHSNSSESPCVSESGSDIYSKREVIQK  177

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LR Q+KRRDE ILEMQEQIVELQ SLN+QLSHS+HLQSLLD ANRDLFDSEREIQRLRK 
Sbjct  178   LRLQLKRRDETILEMQEQIVELQGSLNSQLSHSAHLQSLLDAANRDLFDSEREIQRLRKA  237

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGR----NGYANGHFEAERHLKSSEKGR-GDGERIE  1178
             IADHCVGQV SC+K PTVP +W +E R    NG+ NGH E +R+  +SEKGR GDGER E
Sbjct  238   IADHCVGQVGSCDKSPTVP-VWPAEVRYGHMNGHTNGHLEIDRNSDTSEKGRGGDGERFE  296

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+RE  ELKEVI+GK+YL++SYKEQ  ELS +VKELQQRLD+QLPNIL
Sbjct  297   MLKREKDELKEVIEGKDYLIKSYKEQTTELSIKVKELQQRLDAQLPNIL  345



>ref|XP_004307831.1| PREDICTED: uncharacterized protein LOC101311621 [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   436 bits (1120),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 239/345 (69%), Positives = 277/345 (80%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +  G  RAQKSK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD KQQ    N S
Sbjct  1     MKPKTTGVPRAQKSKPFQGDGPNWVLIAGGALLSTLSMRLGYKLKQALDIKQQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++R+    CHL S+ Y F Q DD +C+N +SGT  +M+MK   NGQ+LTES+  
Sbjct  61    ---GKSSDRRMPAGCHLHSNVYSFTQQDDGSCFNCISGTESMMEMKCLPNGQMLTESDGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+ +F++ENG  W+SS DRLE+P KP LH SN S+SPCVS+SGSDIFSKREVIQ
Sbjct  118   LPLVTVPAPQFNKENGIIWASSPDRLEMPPKPFLHHSNCSDSPCVSDSGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL+HS+HLQS LD ANRD FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIVELQNSLNAQLAHSAHLQSQLDAANRDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V S +K P   S+W SE R+G+ N   + E +  +SEKGRGDGER+EMLRR
Sbjct  238   AIADHCVGHVSSIDK-PVQASIWQSEVRSGHGNQCLDGENNFDASEKGRGDGERVEMLRR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVIDGKEYLLQSYKEQKAELS ++KELQQRLDSQLPNIL
Sbjct  297   EVGELKEVIDGKEYLLQSYKEQKAELSLKIKELQQRLDSQLPNIL  341



>ref|XP_006350972.1| PREDICTED: uncharacterized protein LOC102582307 [Solanum tuberosum]
Length=339

 Score =   436 bits (1120),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 234/343 (68%), Positives = 276/343 (80%), Gaps = 4/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NG SR+QKS  +Q EGPNWV+IAG ALLSTLSVRLGYKLKQVLD++Q N T ++ 
Sbjct  1     MKPRTNGGSRSQKSNGVQSEGPNWVIIAGSALLSTLSVRLGYKLKQVLDSRQPNKTTSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K ++  K  N H+QSS+Y F+QDD+ CYN  +    +   KQQ NG   +E E  L
Sbjct  61    KGNEKSSDGSKLGNGHMQSSTYYFSQDDDGCYNCNTEAGGLGITKQQYNG---SEPEMAL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP++ F++ENGG WS+S DRLELPQKP H SN SESPCVSESGSDI+SKREVIQKL
Sbjct  118   PLVAVPAIGFNKENGGIWSTSPDRLELPQKPFHRSNSSESPCVSESGSDIYSKREVIQKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRDE ILEMQEQIVELQ+SLN+Q+SHS+H QS+LD ANRDLFDSEREIQRLRK I
Sbjct  178   RLQIKRRDETILEMQEQIVELQASLNSQMSHSTHQQSVLDAANRDLFDSEREIQRLRKAI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVGQV S +K PTVP +W +E R G+ NGH + +R+  +SEKGRGDGER EML+RE 
Sbjct  238   ADHCVGQVGSYDKPPTVP-VWPAEVRYGHTNGHLDVDRNSDTSEKGRGDGERFEMLKREK  296

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVIDGK+YL++SYKEQ  ELS +VKELQQRLD+QLPNIL
Sbjct  297   DELKEVIDGKDYLIKSYKEQTIELSIKVKELQQRLDAQLPNIL  339



>ref|XP_009631870.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631871.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631872.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631873.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631874.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631875.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631876.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
 ref|XP_009631877.1| PREDICTED: uncharacterized protein LOC104121556 [Nicotiana tomentosiformis]
Length=345

 Score =   435 bits (1118),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 246/349 (70%), Positives = 281/349 (81%), Gaps = 10/349 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R N   R+Q+SK +Q EGPNWV+IAG ALLSTLSVRLGYKLKQVLD++QQN T ++ 
Sbjct  1     MKPRTNVGPRSQRSKGVQSEGPNWVIIAGSALLSTLSVRLGYKLKQVLDSRQQNKTTSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQ-QCNGQVLTESETE  653
             K N K  E +K  N HLQSS+Y F QDD+ CYN  +G   +  +KQ Q NG   +E E  
Sbjct  61    KGNEKSPEGRKLGNGHLQSSTYYFAQDDDGCYNCNTGAGGLGVIKQPQFNG---SEPEMV  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP+LEF++ENGG WSSS DRLELPQKP H SN SESPCVSESGSDI+SKREVIQK
Sbjct  118   LPLVTVPALEFNKENGGPWSSSPDRLELPQKPFHHSNSSESPCVSESGSDIYSKREVIQK  177

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LR Q+KRRDE ILEMQEQIVELQ SLN QLSHS+HLQSLLD ANRDLFDSEREIQRLRK 
Sbjct  178   LRLQLKRRDETILEMQEQIVELQGSLNTQLSHSAHLQSLLDAANRDLFDSEREIQRLRKA  237

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGR----NGYANGHFEAERHLKSSEKGR-GDGERIE  1178
             IADHCVGQV SC+K PTVP +W +E R    NG+ NGH E +R+  +SEKGR GDGER E
Sbjct  238   IADHCVGQVGSCDKSPTVP-VWPAEVRYGHMNGHTNGHLEIDRNSDTSEKGRGGDGERFE  296

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+RE  ELKEVI+GK+YL++SYKEQ AELS +VKELQQRLD+QLPNIL
Sbjct  297   MLKREKDELKEVIEGKDYLIRSYKEQTAELSIKVKELQQRLDAQLPNIL  345



>ref|XP_004249897.1| PREDICTED: uncharacterized protein LOC101246584 [Solanum lycopersicum]
Length=340

 Score =   433 bits (1113),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 236/344 (69%), Positives = 277/344 (81%), Gaps = 5/344 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NG SR+QKS  +Q EGPNWV+IAG ALLSTLSVRLGYKLKQVLD++Q N T ++ 
Sbjct  1     MKPRTNGVSRSQKSNGVQSEGPNWVIIAGSALLSTLSVRLGYKLKQVLDSRQPNKTTSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K ++  K  N H+QSS+Y F+QDD+ CYN  +    +   KQQ NG   +E E  L
Sbjct  61    KGNEKSSDGSKLGNGHMQSSTYYFSQDDDGCYNCNTEAGGLGITKQQYNG---SEPEMVL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP++ F++ENGG WS+S DRLELPQKP H SN SESPCVSESGSDI+SKREVIQKL
Sbjct  118   PLVAVPAIGFNKENGGVWSTSPDRLELPQKPFHRSNSSESPCVSESGSDIYSKREVIQKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRDE ILEMQEQIVELQ+SLNAQ+SHS+H QSLLD ANRDLFDSEREIQRLRK I
Sbjct  178   RLQLKRRDETILEMQEQIVELQASLNAQMSHSAHQQSLLDAANRDLFDSEREIQRLRKAI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNG-YANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             ADHCVGQV SC+K PTVP +W +E R G + NGH E +R+  +SEKGRGDGER EML+RE
Sbjct  238   ADHCVGQVGSCDKPPTVP-VWPAEVRYGHHTNGHLEVDRNSDTSEKGRGDGERFEMLKRE  296

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
               ELKEVI+GK+YL+++YKEQ  ELS +VKELQQRLD+QLPNIL
Sbjct  297   KDELKEVIEGKDYLIKNYKEQTVELSIKVKELQQRLDAQLPNIL  340



>gb|KDP39553.1| hypothetical protein JCGZ_02573 [Jatropha curcas]
Length=340

 Score =   432 bits (1112),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 230/344 (67%), Positives = 272/344 (79%), Gaps = 5/344 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MKSR NG  R QK +   GEGPNW+LIAGGALLSTLS+RLGYKLKQ L++KQQ    N S
Sbjct  1     MKSRTNGIPRGQKERNFHGEGPNWILIAGGALLSTLSIRLGYKLKQTLESKQQT---NAS  57

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
               N K +ER++   CH+ S+ Y F QDD+ C+N +SG   + D+K   + Q+L+ES+  L
Sbjct  58    NGNGKSSERRRTGGCHVHSNMYSFTQDDDGCFNCISGNEGIADLKHHPSDQMLSESDVSL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP  EF+RENG  W SS DRLELP KP H SN S+SPCVSESGSDIFSKREVI KL
Sbjct  118   PLVTVPGPEFTRENGVMWISSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIHKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MI+EMQ+QIVELQSSLNA L+HS++LQS LD ANR+LFDSE+EIQRLRK I
Sbjct  178   RQQLKRRDDMIMEMQDQIVELQSSLNAHLAHSTNLQSQLDTANRELFDSEKEIQRLRKAI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGR-GDGERIEMLRRE  1193
             ADHCV  V + EK P+  ++W SE RNG+ANG+ + E     SEKGR GDGERIEML+RE
Sbjct  238   ADHCVKHVATNEK-PSTVTIWPSEVRNGHANGYLDRENSFDLSEKGRAGDGERIEMLKRE  296

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVI+GKEYLLQSYKEQKAELS ++KE+QQRLDS LPNIL
Sbjct  297   VGELKEVIEGKEYLLQSYKEQKAELSMKIKEMQQRLDSNLPNIL  340



>emb|CDP15037.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   427 bits (1097),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 276/343 (80%), Gaps = 2/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK  ANG  R Q+ K  Q EGPNWVLIAGGALLSTLS+RLGYKLKQVLD K  + T N+ 
Sbjct  1     MKPIANGVPRTQRQKGFQSEGPNWVLIAGGALLSTLSIRLGYKLKQVLDMKPPDNTSNSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K + K  ERKK+ +C L  ++Y F+QD   C N LSG+ +VM++KQQ NGQVL+E E  L
Sbjct  61    KGSGKFTERKKSGSCSLHPNAYSFHQDGNACCNCLSGSVNVMEIKQQRNGQVLSEPEMAL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV V S EFS+ENG  W+SS DRLELPQKP H SN S+SPCVSE+GSDIFS REVIQKL
Sbjct  121   PLVKVSSSEFSKENGVIWASSPDRLELPQKPFHHSNSSDSPCVSEAGSDIFSNREVIQKL  180

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MI+EMQ+QIVELQ+SL+ QL+HS+ LQ+LLD ANRDLFDSEREIQRLRKVI
Sbjct  181   RQQLKRRDDMIIEMQDQIVELQNSLSTQLTHSTQLQALLDAANRDLFDSEREIQRLRKVI  240

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVGQ +  +K+ + P +W +E RNG+ N + E E HL S EK R +G +IEMLRREV
Sbjct  241   ADHCVGQDNCGDKLSSAP-VWPAELRNGHLNEYSEVEGHLDSLEKDR-NGGKIEMLRREV  298

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              EL+EVIDGK+YLLQ+YKEQK+ELS ++KELQQRLDSQLPNIL
Sbjct  299   NELREVIDGKDYLLQNYKEQKSELSMKIKELQQRLDSQLPNIL  341



>ref|XP_011010582.1| PREDICTED: uncharacterized protein LOC105115405 [Populus euphratica]
 ref|XP_011010583.1| PREDICTED: uncharacterized protein LOC105115405 [Populus euphratica]
 ref|XP_011010584.1| PREDICTED: uncharacterized protein LOC105115405 [Populus euphratica]
Length=342

 Score =   424 bits (1091),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 222/343 (65%), Positives = 272/343 (79%), Gaps = 1/343 (0%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NGTSR QK++  QGEG NW+ IAGGALLSTLS+ LGYKLKQ LD+KQQ    N+ 
Sbjct  1     MKPRTNGTSRGQKTQNFQGEGRNWIFIAGGALLSTLSIHLGYKLKQTLDSKQQANASNSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K   K ++R+++  C++ S+ Y F QDD+ CY+ + G   + +MK Q N Q+L+ES+  L
Sbjct  61    KGTVKSSDRRRSPGCNMHSNMYSFTQDDDGCYDCIPGNEGIANMKHQSNDQMLSESDIGL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EF++ENG  W SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  121   PLVTVPAAEFTKENGVMWVSSPDRLELPPKPFHNSNCSDSPCVSESGSDIFSKREVIQKL  180

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI+ELQ+SLNAQL+ +S+LQS ++ ANRDLFDS REIQRLRK I
Sbjct  181   RQQLKRRDDMILEMQDQILELQNSLNAQLTLASNLQSQINAANRDLFDSGREIQRLRKAI  240

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV  V   +K P+  + W SE RNG+ANG+ + + + +SSEKGRGD ERIE L+REV
Sbjct  241   ADHCVKHVGINDK-PSAITTWPSEARNGHANGYLDGDSNFESSEKGRGDVERIEKLKREV  299

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK+ELS ++ ELQ RLDSQLPNIL
Sbjct  300   DELKEVIEGKEYLLQSYKEQKSELSMKIMELQHRLDSQLPNIL  342



>ref|XP_007029709.1| Intracellular protein transport protein USO1 isoform 3 [Theobroma 
cacao]
 gb|EOY10211.1| Intracellular protein transport protein USO1 isoform 3 [Theobroma 
cacao]
Length=344

 Score =   423 bits (1087),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 228/343 (66%), Positives = 274/343 (80%), Gaps = 3/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R+   SR QKSK  QGEGPNW+LIAGGALLSTLS+RLGYKLKQ LD KQ++    TS
Sbjct  1     MNTRSGRVSRGQKSKNFQGEGPNWILIAGGALLSTLSIRLGYKLKQALDTKQKDN-ATTS  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + +  ++R++   C L S+ + F Q+D+ C+N +SGT  + + K   NG +L ESE  L
Sbjct  60    LKGHGTSDRRRLSGCRLHSNMFSFTQEDDGCFNCISGTESIGE-KHPPNGLMLPESEVAL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EF+++NG  W+SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  119   PLVTVPTSEFNKDNGVMWASSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKL  178

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI+ELQ+SLNAQ++HSSHLQ+ LD +NRDLFDSEREIQRLRK I
Sbjct  179   RQQLKRRDDMILEMQDQIMELQNSLNAQVAHSSHLQAQLDASNRDLFDSEREIQRLRKAI  238

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   EK  TV + W  + RNG+ANG+ + E +  S EKGRGDGERIEML+REV
Sbjct  239   ADHCVGHVSMNEKTTTV-TAWPPDIRNGHANGYLDGESNSGSPEKGRGDGERIEMLKREV  297

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  298   GELKEVIEGKEYLLQSYKEQKTELSMKIKELQQRLDSQLPNIL  340



>ref|XP_007029708.1| Intracellular protein transport protein USO1 isoform 2 [Theobroma 
cacao]
 gb|EOY10210.1| Intracellular protein transport protein USO1 isoform 2 [Theobroma 
cacao]
Length=340

 Score =   422 bits (1086),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 228/343 (66%), Positives = 274/343 (80%), Gaps = 3/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R+   SR QKSK  QGEGPNW+LIAGGALLSTLS+RLGYKLKQ LD KQ++    TS
Sbjct  1     MNTRSGRVSRGQKSKNFQGEGPNWILIAGGALLSTLSIRLGYKLKQALDTKQKDN-ATTS  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + +  ++R++   C L S+ + F Q+D+ C+N +SGT  + + K   NG +L ESE  L
Sbjct  60    LKGHGTSDRRRLSGCRLHSNMFSFTQEDDGCFNCISGTESIGE-KHPPNGLMLPESEVAL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EF+++NG  W+SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  119   PLVTVPTSEFNKDNGVMWASSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKL  178

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI+ELQ+SLNAQ++HSSHLQ+ LD +NRDLFDSEREIQRLRK I
Sbjct  179   RQQLKRRDDMILEMQDQIMELQNSLNAQVAHSSHLQAQLDASNRDLFDSEREIQRLRKAI  238

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   EK  TV + W  + RNG+ANG+ + E +  S EKGRGDGERIEML+REV
Sbjct  239   ADHCVGHVSMNEKTTTV-TAWPPDIRNGHANGYLDGESNSGSPEKGRGDGERIEMLKREV  297

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  298   GELKEVIEGKEYLLQSYKEQKTELSMKIKELQQRLDSQLPNIL  340



>ref|XP_002269622.2| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662078.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662079.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662080.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662081.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662082.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 ref|XP_010662083.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera]
 emb|CBI26462.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 228/344 (66%), Positives = 273/344 (79%), Gaps = 7/344 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NG  RAQKS+  QGEGPNWVL+AGGALLSTLS+RLGYKLKQ LD KQQ    +  
Sbjct  1     MKPRTNGVPRAQKSRNFQGEGPNWVLLAGGALLSTLSIRLGYKLKQALDTKQQENASS--  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQ-QCNGQVLTESETE  653
                 K A+R K+  C L S++Y F ++D +C++ +SG+  ++D+   Q NGQ+LTES+  
Sbjct  59    ---GKSADRNKSGACRLHSNAYSFTREDNSCFHCVSGSEGILDVNHHQPNGQILTESDVA  115

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLV VP+ E+++ENG  W+SS +RLELP KP H SN S+SPCVSESGSDIFSKREVIQK
Sbjct  116   LPLVMVPAPEYTKENGVVWASSPERLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQK  175

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+K+RD+MILEMQ+QI+ELQ+SL++QLSHSSHLQ  LD ANRDLFDSEREIQRLRK 
Sbjct  176   LRQQLKKRDDMILEMQDQIMELQNSLSSQLSHSSHLQVQLDAANRDLFDSEREIQRLRKA  235

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V   E  P+      SE RNG+ANG+   + +L+S EKGRGD ERIEMLRRE
Sbjct  236   IADHCVGHVGFNEN-PSPAMTCPSEPRNGHANGYLNGDTNLESPEKGRGDSERIEMLRRE  294

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V EL+EVI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  295   VGELREVIEGKEYLLQSYKEQKVELSMKIKELQQRLDSQLPNIL  338



>gb|KHG29515.1| Serine/threonine-protein kinase [Gossypium arboreum]
Length=339

 Score =   421 bits (1082),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 274/343 (80%), Gaps = 4/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R +  SR QKSK  QGEGPNW+LIAGGALLSTLSVRLGYKLKQ LD KQQ+    + 
Sbjct  1     MNTRNSRVSRGQKSKKFQGEGPNWILIAGGALLSTLSVRLGYKLKQALDTKQQDNATASL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             KEN   ++R+++  C L S+ Y F ++D+ C+N +SG  ++   K   NGQ+L ESE  L
Sbjct  61    KENGT-SDRRRSSGCRLHSNMYAFTEEDDGCFNCMSGAENIE--KHPPNGQILPESEVAL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ +FS++NG  W+SS DRLELP +P H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  118   PLVTVPTSDFSKDNGVMWASSPDRLELPPRPFHHSNCSDSPCVSESGSDIFSKREVIQKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQ +KRRD+MILEMQ+QI+ELQ+SLNAQ++HS+HLQS LD ANRDLFDS+REI RLRK I
Sbjct  178   RQHLKRRDDMILEMQDQIMELQNSLNAQVAHSTHLQSQLDAANRDLFDSQREILRLRKAI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG      K+ ++ ++W S+ RNG+ANG+ + E +  S EKGRGDGERIEML+REV
Sbjct  238   ADHCVG-YGGTNKMTSIDTVWPSDIRNGHANGYLDVESNSDSPEKGRGDGERIEMLKREV  296

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  297   GELKEVIEGKEYLLQSYKEQKLELSMKIKELQQRLDSQLPNIL  339



>ref|XP_011081733.1| PREDICTED: uncharacterized protein LOC105164711 isoform X1 [Sesamum 
indicum]
Length=364

 Score =   421 bits (1083),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 237/371 (64%), Positives = 287/371 (77%), Gaps = 13/371 (4%)
 Frame = +3

Query  219   VVCCFSSVRLCS*SATILFNTLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLS  398
             +VC +  +R      +I   TL T  MK R   T    + +  Q  GPNW+LIAGGALLS
Sbjct  5     LVCLWCMIR------SIWSLTLITLIMKPR---TGEVPRGRNFQEGGPNWILIAGGALLS  55

Query  399   TLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNF  578
             TLS+RLGYKLKQV DAKQ + +    K N K  + KK+ +C L S+S+CF+Q D+ CY+ 
Sbjct  56    TLSIRLGYKLKQVHDAKQLDNSSQRLK-NGKSDDWKKSESCPLHSNSFCFSQQDDGCYSR  114

Query  579   LSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL  758
              +G+R+V+++K Q NGQ++TE E  LPLVTVP+ EF +ENG  WSSS D LELP KP H 
Sbjct  115   YNGSRNVVEIKPQHNGQMMTEPEVALPLVTVPTAEFQKENGVMWSSSPDCLELPHKPFHH  174

Query  759   SNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshssh  938
             SN SESPCVS+SGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QI ELQ+SL+AQLSHSSH
Sbjct  175   SNSSESPCVSDSGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIAELQNSLSAQLSHSSH  234

Query  939   lqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWG--SEGRNGYANG  1112
             LQSLLD ANRDLFDSEREIQRLRKVIADHCVG ++S +K   VP +W   ++G NGY NG
Sbjct  235   LQSLLDAANRDLFDSEREIQRLRKVIADHCVGDINSGDKSTAVP-VWPAQADGMNGYTNG  293

Query  1113  HFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQ  1292
             + E E +L S EKGRGDGE+IEML++EV ELKE+I+GK YLLQSY+EQK ELS ++KELQ
Sbjct  294   YLEVESNLGSLEKGRGDGEKIEMLKKEVNELKELIEGKNYLLQSYREQKTELSMKIKELQ  353

Query  1293  QRLDSQLPNIL  1325
             QRLDSQLPNIL
Sbjct  354   QRLDSQLPNIL  364



>ref|XP_007029707.1| Intracellular protein transport protein USO1 isoform 1 [Theobroma 
cacao]
 gb|EOY10209.1| Intracellular protein transport protein USO1 isoform 1 [Theobroma 
cacao]
Length=362

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 276/349 (79%), Gaps = 3/349 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R+   SR QKSK  QGEGPNW+LIAGGALLSTLS+RLGYKLKQ LD KQ++    TS
Sbjct  1     MNTRSGRVSRGQKSKNFQGEGPNWILIAGGALLSTLSIRLGYKLKQALDTKQKDN-ATTS  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + +  ++R++   C L S+ + F Q+D+ C+N +SGT  + + K   NG +L ESE  L
Sbjct  60    LKGHGTSDRRRLSGCRLHSNMFSFTQEDDGCFNCISGTESIGE-KHPPNGLMLPESEVAL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EF+++NG  W+SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  119   PLVTVPTSEFNKDNGVMWASSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKL  178

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI+ELQ+SLNAQ++HSSHLQ+ LD +NRDLFDSEREIQRLRK I
Sbjct  179   RQQLKRRDDMILEMQDQIMELQNSLNAQVAHSSHLQAQLDASNRDLFDSEREIQRLRKAI  238

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   EK  TV + W  + RNG+ANG+ + E +  S EKGRGDGERIEML+REV
Sbjct  239   ADHCVGHVSMNEKTTTV-TAWPPDIRNGHANGYLDGESNSGSPEKGRGDGERIEMLKREV  297

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL*AEFKK  1343
              ELKEVI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL  +  K
Sbjct  298   GELKEVIEGKEYLLQSYKEQKTELSMKIKELQQRLDSQLPNILQMQLSK  346



>ref|XP_011081734.1| PREDICTED: uncharacterized protein LOC105164711 isoform X2 [Sesamum 
indicum]
 ref|XP_011081735.1| PREDICTED: uncharacterized protein LOC105164711 isoform X2 [Sesamum 
indicum]
Length=354

 Score =   420 bits (1079),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/351 (66%), Positives = 279/351 (79%), Gaps = 7/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             TL T  MK R   T    + +  Q  GPNW+LIAGGALLSTLS+RLGYKLKQV DAKQ +
Sbjct  9     TLITLIMKPR---TGEVPRGRNFQEGGPNWILIAGGALLSTLSIRLGYKLKQVHDAKQLD  65

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLT  638
              +    K N K  + KK+ +C L S+S+CF+Q D+ CY+  +G+R+V+++K Q NGQ++T
Sbjct  66    NSSQRLK-NGKSDDWKKSESCPLHSNSFCFSQQDDGCYSRYNGSRNVVEIKPQHNGQMMT  124

Query  639   ESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKR  818
             E E  LPLVTVP+ EF +ENG  WSSS D LELP KP H SN SESPCVS+SGSDIFSKR
Sbjct  125   EPEVALPLVTVPTAEFQKENGVMWSSSPDCLELPHKPFHHSNSSESPCVSDSGSDIFSKR  184

Query  819   EVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQ  998
             EVIQKLRQQ+KRRD+MILEMQ+QI ELQ+SL+AQLSHSSHLQSLLD ANRDLFDSEREIQ
Sbjct  185   EVIQKLRQQLKRRDDMILEMQDQIAELQNSLSAQLSHSSHLQSLLDAANRDLFDSEREIQ  244

Query  999   RLRKVIADHCVGQVDSCEKIPTVPSLWG--SEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             RLRKVIADHCVG ++S +K   VP +W   ++G NGY NG+ E E +L S EKGRGDGE+
Sbjct  245   RLRKVIADHCVGDINSGDKSTAVP-VWPAQADGMNGYTNGYLEVESNLGSLEKGRGDGEK  303

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             IEML++EV ELKE+I+GK YLLQSY+EQK ELS ++KELQQRLDSQLPNIL
Sbjct  304   IEMLKKEVNELKELIEGKNYLLQSYREQKTELSMKIKELQQRLDSQLPNIL  354



>gb|KDO48016.1| hypothetical protein CISIN_1g019288mg [Citrus sinensis]
 gb|KDO48017.1| hypothetical protein CISIN_1g019288mg [Citrus sinensis]
Length=343

 Score =   419 bits (1078),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/344 (65%), Positives = 274/344 (80%), Gaps = 2/344 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R +G SR Q++K +QGEGPNW+LIAGGALLSTLS+RLGYKLKQ  D++QQ    N +
Sbjct  1     MIPRTDGASRGQRTKHIQGEGPNWILIAGGALLSTLSIRLGYKLKQTFDSRQQQANANNA  60

Query  477   -KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   + R+++   HLQ++ Y F QD+ +C+N +SG   +++MK   NG +L+E++  
Sbjct  61    LKGNGTHSGRRRSPARHLQTNMYSFTQDNGSCFNCVSGNEGMVEMKHPPNGPLLSETDVP  120

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             L LVTVP+ EF +ENG  W+SS DRLE+P KP H SN S+SPCVSESGSDIFSKREVI K
Sbjct  121   LALVTVPAPEFGKENGVLWASSPDRLEVPPKPFHHSNCSDSPCVSESGSDIFSKREVICK  180

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL HS+HLQS LD AN+DLFDSERE+QRLRK 
Sbjct  181   LRQQLKRRDDMILEMQDQIVELQNSLNAQLEHSTHLQSQLDAANKDLFDSEREVQRLRKA  240

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V + +K PT  ++W +E RNG ANG+ + E +  + EKGRGDG +IEMLR+E
Sbjct  241   IADHCVGHVGTNDKPPTH-AIWPTEARNGLANGYIDGENNHDNLEKGRGDGGKIEMLRKE  299

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGK+YLLQSYKEQK ELS +VKELQQRLDSQLPNIL
Sbjct  300   VGELKEVIDGKDYLLQSYKEQKTELSMKVKELQQRLDSQLPNIL  343



>ref|XP_011044425.1| PREDICTED: uncharacterized protein LOC105139625 isoform X1 [Populus 
euphratica]
Length=353

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 221/354 (62%), Positives = 277/354 (78%), Gaps = 2/354 (1%)
 Frame = +3

Query  264   TILFNTLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLD  443
             ++  + L   KMK+R NGTSR QK++  QGE PNW+LIAGGALLSTLS+RLGYKLKQ LD
Sbjct  2     SVFSSFLLPLKMKTRTNGTSRGQKAQNFQGERPNWILIAGGALLSTLSIRLGYKLKQTLD  61

Query  444   AKQQNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCN  623
             +KQQ    +  K N   +ER+    C++ S+ Y F Q  + C+N +SG   + D+K + N
Sbjct  62    SKQQANASDGLKGNMNSSERRSP-GCNMHSNLYSFTQGGDVCFNCISGNEGIADLKHRSN  120

Query  624   GQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSD  803
              Q+L+ES+  LPLV VP++EF++ENG  W SS DRLELP KP   SN S+SP VSESGSD
Sbjct  121   DQMLSESDVALPLVMVPAVEFTKENGVMWVSSPDRLELPPKPFSHSNCSDSPSVSESGSD  180

Query  804   IFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDS  983
             I SKREVIQKLRQQ++RRD+MILEMQ+QI+ELQ+SLNAQL+ +S+LQS ++ ANRDLFDS
Sbjct  181   ILSKREVIQKLRQQLRRRDDMILEMQDQILELQNSLNAQLTLASNLQSQINAANRDLFDS  240

Query  984   EREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGD  1163
              REIQRLRK IADHCV  VD+ ++ P+  + W SE RNG+ANG+ + E + ++SEKGRGD
Sbjct  241   GREIQRLRKAIADHCVKHVDTNDR-PSTITAWPSEARNGHANGYLDGESNFETSEKGRGD  299

Query  1164  GERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             G RIEML+REV +LKEVI+GKEYLLQSYKEQKAELS ++KELQ RLDSQLPNIL
Sbjct  300   GGRIEMLKREVGDLKEVIEGKEYLLQSYKEQKAELSMKIKELQHRLDSQLPNIL  353



>ref|XP_006437415.1| hypothetical protein CICLE_v10032005mg [Citrus clementina]
 ref|XP_006437416.1| hypothetical protein CICLE_v10032005mg [Citrus clementina]
 ref|XP_006484688.1| PREDICTED: uncharacterized protein LOC102629026 isoform X1 [Citrus 
sinensis]
 ref|XP_006484689.1| PREDICTED: uncharacterized protein LOC102629026 isoform X2 [Citrus 
sinensis]
 gb|ESR50655.1| hypothetical protein CICLE_v10032005mg [Citrus clementina]
 gb|ESR50656.1| hypothetical protein CICLE_v10032005mg [Citrus clementina]
Length=343

 Score =   418 bits (1074),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 273/344 (79%), Gaps = 2/344 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R +G SR Q++K +QGEGPNW+LIAGGALLSTLS+RLGYKLKQ  D++QQ    N +
Sbjct  1     MIPRTDGASRGQRTKHIQGEGPNWILIAGGALLSTLSIRLGYKLKQTFDSRQQQANANNA  60

Query  477   -KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   + R+++   HLQ++ Y F QD+ +C+N +SG   +++MK   NG +L+E++  
Sbjct  61    LKGNGTHSGRRRSPARHLQTNMYSFTQDNGSCFNCVSGNEGMVEMKHPPNGPLLSETDVP  120

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             L LVTVP+ EF +ENG  W+SS DRLE+P KP H SN S+SPCVSESGSDIFSKREVI K
Sbjct  121   LALVTVPAPEFGKENGVLWASSPDRLEVPPKPFHHSNCSDSPCVSESGSDIFSKREVICK  180

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL HS+HLQS LD AN+DLFDSERE+QRLRK 
Sbjct  181   LRQQLKRRDDMILEMQDQIVELQNSLNAQLEHSTHLQSQLDAANKDLFDSEREVQRLRKA  240

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V + +K P   ++W +E RNG ANG+ + E +  + EKGRGDG +IEMLR+E
Sbjct  241   IADHCVGHVGTNDK-PLTHAIWPTEARNGLANGYIDGENNHDNLEKGRGDGGKIEMLRKE  299

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGK+YLLQSYKEQK ELS +VKELQQRLDSQLPNIL
Sbjct  300   VGELKEVIDGKDYLLQSYKEQKTELSMKVKELQQRLDSQLPNIL  343



>ref|XP_002325450.1| hypothetical protein POPTR_0019s05960g [Populus trichocarpa]
 gb|EEE99831.1| hypothetical protein POPTR_0019s05960g [Populus trichocarpa]
Length=326

 Score =   417 bits (1071),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/343 (64%), Positives = 266/343 (78%), Gaps = 17/343 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NGTSR QK++  QGEG NW+LIAGGALLSTLS+RLGYKLKQ LD++QQ    N+ 
Sbjct  1     MKPRTNGTSRGQKAQNFQGEGRNWILIAGGALLSTLSIRLGYKLKQTLDSRQQANASNSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K ++R+++  C++ S+ Y F QDD+ CYN + G   + DMK Q N Q+L+ES+  L
Sbjct  61    KGNVKSSDRRRSPRCNMHSNMYSFTQDDDGCYNCIPGNEGIADMKHQSNDQMLSESDVGL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EF++ENG  W SS DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  121   PLVTVPAAEFTKENGVMWVSSPDRLELPPKPFHNSNCSDSPCVSESGSDIFSKREVIQKL  180

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI+ELQ+SLNAQL+ +S+LQS ++ ANRDLFDSEREIQRLRK I
Sbjct  181   RQQLKRRDDMILEMQDQILELQNSLNAQLTLASNLQSQINAANRDLFDSEREIQRLRKAI  240

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV                    RNG+ANG+ + + + +S EKGRGD ERIE L+REV
Sbjct  241   ADHCV-----------------KHARNGHANGYLDGDSNFESLEKGRGDVERIEKLKREV  283

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK+ELS ++ ELQ RLDSQLPNIL
Sbjct  284   GELKEVIEGKEYLLQSYKEQKSELSMKIMELQHRLDSQLPNIL  326



>ref|XP_008383832.1| PREDICTED: uncharacterized protein LOC103446483 isoform X1 [Malus 
domestica]
Length=356

 Score =   417 bits (1073),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 229/351 (65%), Positives = 271/351 (77%), Gaps = 6/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +    SRAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                N S    K ++++K+  C + S+ Y F Q +D  C+  +SGT  +M+MK   N Q L
Sbjct  70    NASNGS---GKSSDQRKSAGCRVHSNVYSFTQQNDGGCFXCMSGTEGMMEMKCLPNDQTL  126

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
             TES   LPLV VP+  F++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFS
Sbjct  127   TESNGALPLVMVPAPGFNKENGIVWASSPDRLELPPKPFLHYSNSSDSPCVSESGSDIFS  186

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  187   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  246

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER
Sbjct  247   IQRLRKAIADHCVGHVSPIDRSPQV-TIWQHEERNGHVNGFPDGESNFDATERGRGDGER  305

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  306   VEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  356



>ref|XP_011044426.1| PREDICTED: uncharacterized protein LOC105139625 isoform X2 [Populus 
euphratica]
Length=341

 Score =   416 bits (1070),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 272/343 (79%), Gaps = 2/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK+R NGTSR QK++  QGE PNW+LIAGGALLSTLS+RLGYKLKQ LD+KQQ    +  
Sbjct  1     MKTRTNGTSRGQKAQNFQGERPNWILIAGGALLSTLSIRLGYKLKQTLDSKQQANASDGL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N   +ER+    C++ S+ Y F Q  + C+N +SG   + D+K + N Q+L+ES+  L
Sbjct  61    KGNMNSSERRSP-GCNMHSNLYSFTQGGDVCFNCISGNEGIADLKHRSNDQMLSESDVAL  119

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP++EF++ENG  W SS DRLELP KP   SN S+SP VSESGSDI SKREVIQKL
Sbjct  120   PLVMVPAVEFTKENGVMWVSSPDRLELPPKPFSHSNCSDSPSVSESGSDILSKREVIQKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ++RRD+MILEMQ+QI+ELQ+SLNAQL+ +S+LQS ++ ANRDLFDS REIQRLRK I
Sbjct  180   RQQLRRRDDMILEMQDQILELQNSLNAQLTLASNLQSQINAANRDLFDSGREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV  VD+ ++ P+  + W SE RNG+ANG+ + E + ++SEKGRGDG RIEML+REV
Sbjct  240   ADHCVKHVDTNDR-PSTITAWPSEARNGHANGYLDGESNFETSEKGRGDGGRIEMLKREV  298

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LKEVI+GKEYLLQSYKEQKAELS ++KELQ RLDSQLPNIL
Sbjct  299   GDLKEVIEGKEYLLQSYKEQKAELSMKIKELQHRLDSQLPNIL  341



>ref|XP_009361111.1| PREDICTED: uncharacterized protein LOC103951471 isoform X1 [Pyrus 
x bretschneideri]
Length=356

 Score =   415 bits (1067),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 229/351 (65%), Positives = 272/351 (77%), Gaps = 6/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     RAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
             T  N S +++ P   +K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    TASNGSGKSSDP---RKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQML  126

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
             TES+  LPLV VP+ EF++ENG  W+SS D LELP KP LH SN S+SPCVSESGSDIFS
Sbjct  127   TESDGALPLVMVPAPEFNKENGCVWASSPDHLELPPKPFLHYSNCSDSPCVSESGSDIFS  186

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QI ELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  187   KREVIQKLRQQLKRRDDMILEMQDQIQELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  246

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER
Sbjct  247   IQRLRKAIADHCVGHVSPIDRSPQV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGER  305

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             IEML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQL NIL
Sbjct  306   IEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLLNIL  356



>ref|XP_008383835.1| PREDICTED: uncharacterized protein LOC103446483 isoform X4 [Malus 
domestica]
 ref|XP_008383836.1| PREDICTED: uncharacterized protein LOC103446483 isoform X4 [Malus 
domestica]
 ref|XP_008383837.1| PREDICTED: uncharacterized protein LOC103446483 isoform X4 [Malus 
domestica]
 ref|XP_008383839.1| PREDICTED: uncharacterized protein LOC103446483 isoform X4 [Malus 
domestica]
 ref|XP_008383840.1| PREDICTED: uncharacterized protein LOC103446483 isoform X4 [Malus 
domestica]
Length=341

 Score =   414 bits (1065),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 269/345 (78%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +    SRAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q    N S
Sbjct  1     MKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++++K+  C + S+ Y F Q +D  C+  +SGT  +M+MK   N Q LTES   
Sbjct  61    ---GKSSDQRKSAGCRVHSNVYSFTQQNDGGCFXCMSGTEGMMEMKCLPNDQTLTESNGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+  F++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVMVPAPGFNKENGIVWASSPDRLELPPKPFLHYSNSSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER+EML+R
Sbjct  238   AIADHCVGHVSPIDRSPQV-TIWQHEERNGHVNGFPDGESNFDATERGRGDGERVEMLKR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  297   EVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  341



>ref|XP_008383833.1| PREDICTED: uncharacterized protein LOC103446483 isoform X2 [Malus 
domestica]
Length=354

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 270/351 (77%), Gaps = 8/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +    SRAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                     + K ++++K+  C + S+ Y F Q +D  C+  +SGT  +M+MK   N Q L
Sbjct  70    NA-----RSGKSSDQRKSAGCRVHSNVYSFTQQNDGGCFXCMSGTEGMMEMKCLPNDQTL  124

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
             TES   LPLV VP+  F++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFS
Sbjct  125   TESNGALPLVMVPAPGFNKENGIVWASSPDRLELPPKPFLHYSNSSDSPCVSESGSDIFS  184

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  185   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  244

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER
Sbjct  245   IQRLRKAIADHCVGHVSPIDRSPQV-TIWQHEERNGHVNGFPDGESNFDATERGRGDGER  303

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  304   VEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  354



>ref|XP_009361113.1| PREDICTED: uncharacterized protein LOC103951471 isoform X3 [Pyrus 
x bretschneideri]
Length=341

 Score =   412 bits (1060),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 270/345 (78%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q T  N S
Sbjct  1     MKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQETASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              +++ P   +K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+LTES+  
Sbjct  61    GKSSDP---RKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQMLTESDGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+ EF++ENG  W+SS D LELP KP LH SN S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVMVPAPEFNKENGCVWASSPDHLELPPKPFLHYSNCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QI ELQSSLNAQL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIQELQSSLNAQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGERIEML+R
Sbjct  238   AIADHCVGHVSPIDRSPQV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGERIEMLKR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQL NIL
Sbjct  297   EVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLLNIL  341



>gb|EYU29300.1| hypothetical protein MIMGU_mgv1a009640mg [Erythranthe guttata]
Length=336

 Score =   412 bits (1059),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 272/345 (79%), Gaps = 11/345 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R N   R  +S+  QGEG NW+LIAG ALLSTLS+RLGYKLKQV DAKQ + +    
Sbjct  1     MKPRTNEAPR--RSRNPQGEGNNWMLIAGSALLSTLSIRLGYKLKQVFDAKQVDNSSKKL  58

Query  477   KENNKPAE-RKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             K N K A+ RKK+ +CHL S++ CF QD++ CYN    +R+  D+KQ CN Q ++ESE  
Sbjct  59    KANGKSADDRKKSGSCHLHSNACCFPQDEDGCYNHYPASRNAADIKQHCNSQTMSESEMV  118

Query  654   LPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV+VP+ EF+++N G  WSSS DRLELP KP H SN SESPCVSE+GSDIFSKREVI 
Sbjct  119   LPLVSVPTSEFNKDNNGVMWSSSPDRLELPHKPFHQSNSSESPCVSEAGSDIFSKREVIH  178

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+M+LEMQ+QI ELQ+SL+ QLSHSSH Q+LLD ANRDLFDSEREIQRLRK
Sbjct  179   KLRQQLKRRDDMVLEMQDQIAELQNSLSMQLSHSSHQQALLDSANRDLFDSEREIQRLRK  238

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG VD  +  P+VP +W  EGRNG++NG+ E E +L+SS      GE+IEML+R
Sbjct  239   AIADHCVGHVD--KSPPSVP-IWPPEGRNGHSNGYPEVESNLESSLS----GEKIEMLKR  291

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV+ELKE+IDGK+YLL SYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  292   EVSELKELIDGKDYLLLSYKEQKCELSVKIKELQQRLDSQLPNIL  336



>ref|XP_008234517.1| PREDICTED: uncharacterized protein LOC103333469 isoform X1 [Prunus 
mume]
 ref|XP_008234518.1| PREDICTED: uncharacterized protein LOC103333469 isoform X1 [Prunus 
mume]
Length=338

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 271/345 (79%), Gaps = 9/345 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQKSK  QG+GPNW+LIAGGALLSTLS+RLGYKLKQ LD K Q    N S
Sbjct  1     MKPKTTAVPRAQKSKPFQGDGPNWLLIAGGALLSTLSIRLGYKLKQALDTKHQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++R+K   C + S+ Y F Q  D +C+N +SGT  +M+MK   NGQ+L+ES+  
Sbjct  61    ---GKSSDRRK---CRVHSNVYSFTQQSDGSCFNCMSGTEAMMEMKCLPNGQMLSESDGA  114

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKR+VIQ
Sbjct  115   LPLVTVPTPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFSKRDVIQ  174

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL+HS+HLQS LD ANRD FDSEREIQRLRK
Sbjct  175   KLRQQLKRRDDMILEMQDQIVELQNSLNAQLAHSTHLQSQLDSANRDFFDSEREIQRLRK  234

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V    K   V ++W  E  NG+ANG+ + E +  ++EKGRGDGER+EML+R
Sbjct  235   AIADHCVGHVSPNGKSSPV-TIWQPEATNGHANGYLDGESNFDATEKGRGDGERVEMLKR  293

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYK QK+EL+ ++ ELQQRLDSQLPNIL
Sbjct  294   EVGELKEVIEGKEYLLQSYKVQKSELALKINELQQRLDSQLPNIL  338



>ref|XP_008234519.1| PREDICTED: uncharacterized protein LOC103333469 isoform X2 [Prunus 
mume]
 ref|XP_008234520.1| PREDICTED: uncharacterized protein LOC103333469 isoform X2 [Prunus 
mume]
Length=336

 Score =   410 bits (1054),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 268/345 (78%), Gaps = 11/345 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQKSK  QG+GPNW+LIAGGALLSTLS+RLGYKLKQ LD K Q       
Sbjct  1     MKPKTTAVPRAQKSKPFQGDGPNWLLIAGGALLSTLSIRLGYKLKQALDTKHQ-------  53

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              EN +  +    R C + S+ Y F Q  D +C+N +SGT  +M+MK   NGQ+L+ES+  
Sbjct  54    -ENARSGKSSDRRKCRVHSNVYSFTQQSDGSCFNCMSGTEAMMEMKCLPNGQMLSESDGA  112

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKR+VIQ
Sbjct  113   LPLVTVPTPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFSKRDVIQ  172

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL+HS+HLQS LD ANRD FDSEREIQRLRK
Sbjct  173   KLRQQLKRRDDMILEMQDQIVELQNSLNAQLAHSTHLQSQLDSANRDFFDSEREIQRLRK  232

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V    K   V ++W  E  NG+ANG+ + E +  ++EKGRGDGER+EML+R
Sbjct  233   AIADHCVGHVSPNGKSSPV-TIWQPEATNGHANGYLDGESNFDATEKGRGDGERVEMLKR  291

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYK QK+EL+ ++ ELQQRLDSQLPNIL
Sbjct  292   EVGELKEVIEGKEYLLQSYKVQKSELALKINELQQRLDSQLPNIL  336



>ref|XP_009361112.1| PREDICTED: uncharacterized protein LOC103951471 isoform X2 [Pyrus 
x bretschneideri]
Length=354

 Score =   410 bits (1054),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 270/351 (77%), Gaps = 8/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     RAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
             T       + K ++ +K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    TA-----RSGKSSDPRKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQML  124

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
             TES+  LPLV VP+ EF++ENG  W+SS D LELP KP LH SN S+SPCVSESGSDIFS
Sbjct  125   TESDGALPLVMVPAPEFNKENGCVWASSPDHLELPPKPFLHYSNCSDSPCVSESGSDIFS  184

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QI ELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  185   KREVIQKLRQQLKRRDDMILEMQDQIQELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  244

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER
Sbjct  245   IQRLRKAIADHCVGHVSPIDRSPQV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGER  303

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             IEML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQL NIL
Sbjct  304   IEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLLNIL  354



>ref|XP_009368110.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009368111.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009368113.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009368114.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009368115.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009368116.1| PREDICTED: uncharacterized protein LOC103957652 isoform X1 [Pyrus 
x bretschneideri]
Length=341

 Score =   409 bits (1052),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 269/345 (78%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQ+SK+ QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q    N S
Sbjct  1     MKPKTTAVPRAQRSKSFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++++K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+LTES+  
Sbjct  61    ---GKSSDQRKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQMLTESDGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+  F+++NG  W+SS D LELP KP L  SN S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVMVPAPGFNKDNGIVWASSPDCLELPPKPFLQYSNSSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLN QL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIVELQSSLNTQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER+EML+R
Sbjct  238   AIADHCVGHVSPIDRSPKV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGERVEMLKR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  297   EVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  341



>ref|XP_010087445.1| hypothetical protein L484_019648 [Morus notabilis]
 gb|EXB29126.1| hypothetical protein L484_019648 [Morus notabilis]
Length=354

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 273/357 (76%), Gaps = 17/357 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK +  GT RAQK K LQGEG PNW+LIAGGALLSTLS+RLGYKLKQ +D KQQ    N 
Sbjct  1     MKPKTTGTPRAQKPKLLQGEGGPNWILIAGGALLSTLSIRLGYKLKQAIDTKQQENVNNG  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLS----------GTRDVMDMKQQCN  623
             SK N K ++R+K+  C   S+ Y F +DD  C+N LS          G    MD+  Q +
Sbjct  61    SKGNGKFSDRRKSAGCRTHSNVYSFAEDDGTCFNCLSVLNLTNALEIGAGVAMDITCQPD  120

Query  624   GQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGS  800
             GQ+L+ES+  +PLVTVP+ EF++ENG  W+SS DRLELP KP  H SN S+SPCVSESGS
Sbjct  121   GQMLSESDGAMPLVTVPASEFNKENGVIWASSPDRLELPPKPFNHHSNCSDSPCVSESGS  180

Query  801   DIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFD  980
             D+FSKREVI KLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+ SSHLQS LD ANRDLFD
Sbjct  181   DVFSKREVIHKLRQQLKRRDDMILEMQDQIVELQSSLNAQLARSSHLQSQLDAANRDLFD  240

Query  981   SEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWG--SEGRNGYANGHFEAERHLKSSEKG  1154
             SEREIQRLRK IADHCV    S +K  TVPS W    EG NG+ANG+ E E + ++ EKG
Sbjct  241   SEREIQRLRKAIADHCVAH--SNDKSTTVPS-WPLEREGMNGHANGYHEGESNFETPEKG  297

Query  1155  RGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R +GERIEML+R V ELKEVI+GK+YLLQ+YKEQKAELS  +KELQQRLDSQLP+IL
Sbjct  298   RAEGERIEMLKRNVLELKEVIEGKDYLLQNYKEQKAELSVTIKELQQRLDSQLPSIL  354



>ref|XP_008383834.1| PREDICTED: uncharacterized protein LOC103446483 isoform X3 [Malus 
domestica]
Length=344

 Score =   408 bits (1048),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 263/351 (75%), Gaps = 18/351 (5%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +    SRAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                N                C + S+ Y F Q +D  C+  +SGT  +M+MK   N Q L
Sbjct  70    NASN---------------GCRVHSNVYSFTQQNDGGCFXCMSGTEGMMEMKCLPNDQTL  114

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
             TES   LPLV VP+  F++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFS
Sbjct  115   TESNGALPLVMVPAPGFNKENGIVWASSPDRLELPPKPFLHYSNSSDSPCVSESGSDIFS  174

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  175   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  234

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER
Sbjct  235   IQRLRKAIADHCVGHVSPIDRSPQV-TIWQHEERNGHVNGFPDGESNFDATERGRGDGER  293

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  294   VEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  344



>ref|XP_006484690.1| PREDICTED: uncharacterized protein LOC102629026 isoform X3 [Citrus 
sinensis]
Length=335

 Score =   407 bits (1045),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 267/334 (80%), Gaps = 2/334 (1%)
 Frame = +3

Query  327   AQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS-KENNKPAER  503
              Q++K +QGEGPNW+LIAGGALLSTLS+RLGYKLKQ  D++QQ    N + K N   + R
Sbjct  3     GQRTKHIQGEGPNWILIAGGALLSTLSIRLGYKLKQTFDSRQQQANANNALKGNGTHSGR  62

Query  504   KKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLE  683
             +++   HLQ++ Y F QD+ +C+N +SG   +++MK   NG +L+E++  L LVTVP+ E
Sbjct  63    RRSPARHLQTNMYSFTQDNGSCFNCVSGNEGMVEMKHPPNGPLLSETDVPLALVTVPAPE  122

Query  684   FSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDE  863
             F +ENG  W+SS DRLE+P KP H SN S+SPCVSESGSDIFSKREVI KLRQQ+KRRD+
Sbjct  123   FGKENGVLWASSPDRLEVPPKPFHHSNCSDSPCVSESGSDIFSKREVICKLRQQLKRRDD  182

Query  864   MILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVD  1043
             MILEMQ+QIVELQ+SLNAQL HS+HLQS LD AN+DLFDSERE+QRLRK IADHCVG V 
Sbjct  183   MILEMQDQIVELQNSLNAQLEHSTHLQSQLDAANKDLFDSEREVQRLRKAIADHCVGHVG  242

Query  1044  SCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDG  1223
             + +K P   ++W +E RNG ANG+ + E +  + EKGRGDG +IEMLR+EV ELKEVIDG
Sbjct  243   TNDK-PLTHAIWPTEARNGLANGYIDGENNHDNLEKGRGDGGKIEMLRKEVGELKEVIDG  301

Query  1224  KEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             K+YLLQSYKEQK ELS +VKELQQRLDSQLPNIL
Sbjct  302   KDYLLQSYKEQKTELSMKVKELQQRLDSQLPNIL  335



>ref|XP_009368117.1| PREDICTED: uncharacterized protein LOC103957652 isoform X2 [Pyrus 
x bretschneideri]
Length=339

 Score =   405 bits (1042),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 268/345 (78%), Gaps = 8/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQ+SK+ QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q       
Sbjct  1     MKPKTTAVPRAQRSKSFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENA----  56

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
               + K ++++K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+LTES+  
Sbjct  57    -RSGKSSDQRKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQMLTESDGA  115

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+  F+++NG  W+SS D LELP KP L  SN S+SPCVSESGSDIFSKREVIQ
Sbjct  116   LPLVMVPAPGFNKDNGIVWASSPDCLELPPKPFLQYSNSSDSPCVSESGSDIFSKREVIQ  175

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLN QL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  176   KLRQQLKRRDDMILEMQDQIVELQSSLNTQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  235

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER+EML+R
Sbjct  236   AIADHCVGHVSPIDRSPKV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGERVEMLKR  294

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  295   EVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  339



>ref|XP_008382262.1| PREDICTED: uncharacterized protein LOC103445070 isoform X1 [Malus 
domestica]
Length=356

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 268/351 (76%), Gaps = 6/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     R Q+SK  QGEGPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                N S    K ++R+K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    NASNGS---GKSSDRRKSAGCCVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLHNDQML  126

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
              ES+  LPLVTVP+ EF+RENG  W+SS DRLEL  KP LH SN S+SPCVSESGSDIFS
Sbjct  127   AESDGALPLVTVPAPEFNRENGIVWASSPDRLELRPKPFLHYSNCSDSPCVSESGSDIFS  186

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD AN D FDSERE
Sbjct  187   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANGDFFDSERE  246

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG     ++   V ++W  E RNGY NG  + E +  ++E+GRGD ER
Sbjct  247   IQRLRKAIADHCVGHASPNDRSSHV-TIWQPEERNGYVNGFPDGESNFDATERGRGDEER  305

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  306   VEMLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  356



>ref|XP_009348923.1| PREDICTED: uncharacterized protein LOC103940522 isoform X1 [Pyrus 
x bretschneideri]
Length=356

 Score =   404 bits (1039),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 268/351 (76%), Gaps = 6/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     R Q+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                N S    K ++R+K+  C + S+ Y FNQ +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    NASNGS---GKSSDRRKSAGCCVHSNVYSFNQQNDGGCFNCMSGTEGMMEMKCLPNDQML  126

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
              ES+  LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFS
Sbjct  127   AESDGALPLVTVPAPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFS  186

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  187   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  246

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG      +   V ++W  E RNG  NG  + E +  ++E+GRGD ER
Sbjct  247   IQRLRKAIADHCVGHASPNHRSSHV-TIWQPEERNGDVNGFPDGESNFNATERGRGDEER  305

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +E L REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  306   VENLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  356



>ref|XP_008382274.1| PREDICTED: uncharacterized protein LOC103445070 isoform X3 [Malus 
domestica]
Length=341

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 266/345 (77%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     R Q+SK  QGEGPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q    N S
Sbjct  1     MKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++R+K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L ES+  
Sbjct  61    ---GKSSDRRKSAGCCVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLHNDQMLAESDGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+ EF+RENG  W+SS DRLEL  KP LH SN S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVTVPAPEFNRENGIVWASSPDRLELRPKPFLHYSNCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD AN D FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANGDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG     ++   V ++W  E RNGY NG  + E +  ++E+GRGD ER+EML R
Sbjct  238   AIADHCVGHASPNDRSSHV-TIWQPEERNGYVNGFPDGESNFDATERGRGDEERVEMLNR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  297   EVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  341



>ref|XP_009348926.1| PREDICTED: uncharacterized protein LOC103940522 isoform X3 [Pyrus 
x bretschneideri]
Length=341

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 266/345 (77%), Gaps = 6/345 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     R Q+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q    N S
Sbjct  1     MKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENASNGS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                 K ++R+K+  C + S+ Y FNQ +D  C+N +SGT  +M+MK   N Q+L ES+  
Sbjct  61    ---GKSSDRRKSAGCCVHSNVYSFNQQNDGGCFNCMSGTEGMMEMKCLPNDQMLAESDGA  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVTVPAPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  178   KLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG      +   V ++W  E RNG  NG  + E +  ++E+GRGD ER+E L R
Sbjct  238   AIADHCVGHASPNHRSSHV-TIWQPEERNGDVNGFPDGESNFNATERGRGDEERVENLNR  296

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  297   EVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  341



>ref|XP_008382268.1| PREDICTED: uncharacterized protein LOC103445070 isoform X2 [Malus 
domestica]
Length=354

 Score =   400 bits (1029),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 225/351 (64%), Positives = 267/351 (76%), Gaps = 8/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     R Q+SK  QGEGPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                     + K ++R+K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    NA-----RSGKSSDRRKSAGCCVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLHNDQML  124

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
              ES+  LPLVTVP+ EF+RENG  W+SS DRLEL  KP LH SN S+SPCVSESGSDIFS
Sbjct  125   AESDGALPLVTVPAPEFNRENGIVWASSPDRLELRPKPFLHYSNCSDSPCVSESGSDIFS  184

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD AN D FDSERE
Sbjct  185   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANGDFFDSERE  244

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG     ++   V ++W  E RNGY NG  + E +  ++E+GRGD ER
Sbjct  245   IQRLRKAIADHCVGHASPNDRSSHV-TIWQPEERNGYVNGFPDGESNFDATERGRGDEER  303

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  304   VEMLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  354



>ref|XP_009348925.1| PREDICTED: uncharacterized protein LOC103940522 isoform X2 [Pyrus 
x bretschneideri]
Length=354

 Score =   400 bits (1029),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 224/351 (64%), Positives = 267/351 (76%), Gaps = 8/351 (2%)
 Frame = +3

Query  279   TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
             T    KMK +     R Q+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10    TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459   TTGNTSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVL  635
                     + K ++R+K+  C + S+ Y FNQ +D  C+N +SGT  +M+MK   N Q+L
Sbjct  70    NA-----RSGKSSDRRKSAGCCVHSNVYSFNQQNDGGCFNCMSGTEGMMEMKCLPNDQML  124

Query  636   TESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFS  812
              ES+  LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFS
Sbjct  125   AESDGALPLVTVPAPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFS  184

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSERE
Sbjct  185   KREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSERE  244

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG      +   V ++W  E RNG  NG  + E +  ++E+GRGD ER
Sbjct  245   IQRLRKAIADHCVGHASPNHRSSHV-TIWQPEERNGDVNGFPDGESNFNATERGRGDEER  303

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +E L REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  304   VENLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  354



>ref|XP_009368118.1| PREDICTED: uncharacterized protein LOC103957652 isoform X3 [Pyrus 
x bretschneideri]
Length=329

 Score =   399 bits (1026),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 220/345 (64%), Positives = 261/345 (76%), Gaps = 18/345 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQ+SK+ QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q    N  
Sbjct  1     MKPKTTAVPRAQRSKSFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQENASN--  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                           C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+LTES+  
Sbjct  59    -------------GCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQMLTESDGA  105

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+  F+++NG  W+SS D LELP KP L  SN S+SPCVSESGSDIFSKREVIQ
Sbjct  106   LPLVMVPAPGFNKDNGIVWASSPDCLELPPKPFLQYSNSSDSPCVSESGSDIFSKREVIQ  165

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQSSLN QL+HS++LQS LD ANRD FDSEREIQRLRK
Sbjct  166   KLRQQLKRRDDMILEMQDQIVELQSSLNTQLAHSTNLQSQLDSANRDFFDSEREIQRLRK  225

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGER+EML+R
Sbjct  226   AIADHCVGHVSPIDRSPKV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGERVEMLKR  284

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQLPNIL
Sbjct  285   EVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLPNIL  329



>gb|AFK47439.1| unknown [Lotus japonicus]
Length=340

 Score =   397 bits (1020),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 216/343 (63%), Positives = 262/343 (76%), Gaps = 3/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK ++NG SR  K+  +Q EGPNW+LIA GALLSTLSVRLGYKLKQ LD+K +       
Sbjct  1     MKPQSNGVSRVHKANNIQVEGPNWMLIAAGALLSTLSVRLGYKLKQALDSKPKQNATTVQ  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K    +K+ +C++Q + +   QD+  CY+F +GT   M++K   NGQ L+E +  L
Sbjct  61    KGNVKSFNARKSADCYMQPNGFSQTQDNHGCYSFNAGTGGAMELKCPPNGQTLSEFDGAL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ EFS+EN   W+ S DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKL
Sbjct  121   PLVTVPAAEFSKEN-VVWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKREVIQKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI EL++SLN Q+  SSHLQ  LD ANRDLFD+EREIQRLRK I
Sbjct  180   RQQLKRRDDMILEMQDQISELRNSLNGQMGLSSHLQLQLDAANRDLFDAEREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVGQV   +K  TV + W SE RNG++NGH + E +L+  EK R   ER+EML+R+V
Sbjct  240   ADHCVGQV-PIDKSSTVTN-WSSETRNGHSNGHLDGENNLEPPEKVRDGEERVEMLKRQV  297

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKEYLLQSYKEQK ELS +++ELQQRLDSQLPNIL
Sbjct  298   GELKEVIEGKEYLLQSYKEQKTELSLKIRELQQRLDSQLPNIL  340



>ref|XP_010056923.1| PREDICTED: uncharacterized protein LOC104444856 isoform X2 [Eucalyptus 
grandis]
Length=341

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 253/343 (74%), Gaps = 2/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R    SR QKS  +Q EGPNWVLIAGGALLSTLS RLGYKLKQ  D KQ + +G   
Sbjct  1     MNPRTAAVSRTQKSNGIQREGPNWVLIAGGALLSTLSFRLGYKLKQATDKKQADDSGFLC  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
               N K  +R+K     L S+ Y + Q ++ C+N   G     D K     Q+L E E+ L
Sbjct  61    SGNGKSTDRRKQPTSRLHSNMYSYMQGNDGCFNCFPGNEGATDPKHPSTEQMLEEPESAL  120

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ E++RENG  W+SS DR ELP KP H SN SESPCVSESGSDIFSKREVI KL
Sbjct  121   PLVTVPASEYNRENGVTWASSPDRFELPPKPFHPSNCSESPCVSESGSDIFSKREVIHKL  180

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI +LQ+S NAQL  S+HLQ+ LD ANRDLFDSEREIQRLRK I
Sbjct  181   RQQLKRRDDMILEMQDQITDLQNSFNAQLEQSTHLQAQLDAANRDLFDSEREIQRLRKAI  240

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   EK  T P LW  E RNG+ANGH + E +L S EK RG  ++IEML++EV
Sbjct  241   ADHCVGHVGVQEKNSTAP-LWPPELRNGHANGHVDGENNLDSFEKARG-MDKIEMLKKEV  298

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKE+LLQSYKEQKAELS +++ELQQRLDSQLP+IL
Sbjct  299   GELKEVIEGKEFLLQSYKEQKAELSLKIRELQQRLDSQLPSIL  341



>ref|XP_010056922.1| PREDICTED: uncharacterized protein LOC104444856 isoform X1 [Eucalyptus 
grandis]
Length=342

 Score =   395 bits (1014),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 218/344 (63%), Positives = 255/344 (74%), Gaps = 3/344 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R    SR QKS  +Q EGPNWVLIAGGALLSTLS RLGYKLKQ  D KQ + +G   
Sbjct  1     MNPRTAAVSRTQKSNGIQREGPNWVLIAGGALLSTLSFRLGYKLKQATDKKQADDSGFLC  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYN-FLSGTRDVMDMKQQCNGQVLTESETE  653
               N K  +R+K     L S+ Y + Q ++ C+N F +G     D K     Q+L E E+ 
Sbjct  61    SGNGKSTDRRKQPTSRLHSNMYSYMQGNDGCFNCFPAGNEGATDPKHPSTEQMLEEPESA  120

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP+ E++RENG  W+SS DR ELP KP H SN SESPCVSESGSDIFSKREVI K
Sbjct  121   LPLVTVPASEYNRENGVTWASSPDRFELPPKPFHPSNCSESPCVSESGSDIFSKREVIHK  180

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QI +LQ+S NAQL  S+HLQ+ LD ANRDLFDSEREIQRLRK 
Sbjct  181   LRQQLKRRDDMILEMQDQITDLQNSFNAQLEQSTHLQAQLDAANRDLFDSEREIQRLRKA  240

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V   EK  T P LW  E RNG+ANGH + E +L S EK RG  ++IEML++E
Sbjct  241   IADHCVGHVGVQEKNSTAP-LWPPELRNGHANGHVDGENNLDSFEKARG-MDKIEMLKKE  298

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVI+GKE+LLQSYKEQKAELS +++ELQQRLDSQLP+IL
Sbjct  299   VGELKEVIEGKEFLLQSYKEQKAELSLKIRELQQRLDSQLPSIL  342



>ref|XP_010056925.1| PREDICTED: uncharacterized protein LOC104444856 isoform X4 [Eucalyptus 
grandis]
 gb|KCW73830.1| hypothetical protein EUGRSUZ_E02431 [Eucalyptus grandis]
Length=336

 Score =   394 bits (1013),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 253/343 (74%), Gaps = 7/343 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R    SR QKS  +Q EGPNWVLIAGGALLSTLS RLGYKLKQ  D KQ + +GN  
Sbjct  1     MNPRTAAVSRTQKSNGIQREGPNWVLIAGGALLSTLSFRLGYKLKQATDKKQADDSGN--  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
                 K  +R+K     L S+ Y + Q ++ C+N   G     D K     Q+L E E+ L
Sbjct  59    ---GKSTDRRKQPTSRLHSNMYSYMQGNDGCFNCFPGNEGATDPKHPSTEQMLEEPESAL  115

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ E++RENG  W+SS DR ELP KP H SN SESPCVSESGSDIFSKREVI KL
Sbjct  116   PLVTVPASEYNRENGVTWASSPDRFELPPKPFHPSNCSESPCVSESGSDIFSKREVIHKL  175

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI +LQ+S NAQL  S+HLQ+ LD ANRDLFDSEREIQRLRK I
Sbjct  176   RQQLKRRDDMILEMQDQITDLQNSFNAQLEQSTHLQAQLDAANRDLFDSEREIQRLRKAI  235

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   EK  T P LW  E RNG+ANGH + E +L S EK RG  ++IEML++EV
Sbjct  236   ADHCVGHVGVQEKNSTAP-LWPPELRNGHANGHVDGENNLDSFEKARG-MDKIEMLKKEV  293

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GKE+LLQSYKEQKAELS +++ELQQRLDSQLP+IL
Sbjct  294   GELKEVIEGKEFLLQSYKEQKAELSLKIRELQQRLDSQLPSIL  336



>ref|XP_010056924.1| PREDICTED: uncharacterized protein LOC104444856 isoform X3 [Eucalyptus 
grandis]
Length=337

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 218/344 (63%), Positives = 255/344 (74%), Gaps = 8/344 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R    SR QKS  +Q EGPNWVLIAGGALLSTLS RLGYKLKQ  D KQ + +GN  
Sbjct  1     MNPRTAAVSRTQKSNGIQREGPNWVLIAGGALLSTLSFRLGYKLKQATDKKQADDSGN--  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYN-FLSGTRDVMDMKQQCNGQVLTESETE  653
                 K  +R+K     L S+ Y + Q ++ C+N F +G     D K     Q+L E E+ 
Sbjct  59    ---GKSTDRRKQPTSRLHSNMYSYMQGNDGCFNCFPAGNEGATDPKHPSTEQMLEEPESA  115

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP+ E++RENG  W+SS DR ELP KP H SN SESPCVSESGSDIFSKREVI K
Sbjct  116   LPLVTVPASEYNRENGVTWASSPDRFELPPKPFHPSNCSESPCVSESGSDIFSKREVIHK  175

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QI +LQ+S NAQL  S+HLQ+ LD ANRDLFDSEREIQRLRK 
Sbjct  176   LRQQLKRRDDMILEMQDQITDLQNSFNAQLEQSTHLQAQLDAANRDLFDSEREIQRLRKA  235

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V   EK  T P LW  E RNG+ANGH + E +L S EK RG  ++IEML++E
Sbjct  236   IADHCVGHVGVQEKNSTAP-LWPPELRNGHANGHVDGENNLDSFEKARG-MDKIEMLKKE  293

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVI+GKE+LLQSYKEQKAELS +++ELQQRLDSQLP+IL
Sbjct  294   VGELKEVIEGKEFLLQSYKEQKAELSLKIRELQQRLDSQLPSIL  337



>ref|XP_011072845.1| PREDICTED: uncharacterized protein LOC105157974 isoform X1 [Sesamum 
indicum]
 ref|XP_011072847.1| PREDICTED: uncharacterized protein LOC105157974 isoform X1 [Sesamum 
indicum]
Length=340

 Score =   390 bits (1001),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 272/343 (79%), Gaps = 4/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R  G  R  +S+  Q  G NW+LIAGGALLSTLS+RLGYKLKQVLD KQ N +  + 
Sbjct  1     MNPRTRGVPR--RSRNFQEGGLNWILIAGGALLSTLSIRLGYKLKQVLDTKQLNNSSQSL  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K+  K    KK+ +C L +   CF Q+++ CY+  +G+ +++++KQQ NGQ++TE +  L
Sbjct  59    KDG-KSDIWKKSASCPLHADGLCFTQEEDGCYSGYNGSTNMVEIKQQDNGQMITERKMPL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  WSSS DRLELP KP H SN SESPCVSESGS IFSK EVIQKL
Sbjct  118   PLVIVPTPEFNKENGVMWSSSPDRLELPHKPSHHSNSSESPCVSESGSCIFSKGEVIQKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI EL++SL+++LSHSSHLQSLLD ANRDLFDSEREIQRLRKVI
Sbjct  178   RQQLKRRDDMILEMQDQIAELKNSLSSELSHSSHLQSLLDAANRDLFDSEREIQRLRKVI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG + S +K+   P +W +EG NG+ NG+ + E  L+SSEKGRG+ ++IEML+ EV
Sbjct  238   ADHCVGHIYSGQKLTADP-VWLAEGMNGHTNGYPKVEGKLESSEKGRGEVDKIEMLKGEV  296

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EL+E+I+GK+YLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  297   SELRELIEGKDYLLQSYKEQKWELSVKIKELQQRLDSQLPNIL  339



>ref|XP_011072848.1| PREDICTED: uncharacterized protein LOC105157974 isoform X2 [Sesamum 
indicum]
Length=339

 Score =   390 bits (1001),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 272/343 (79%), Gaps = 4/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R  G  R  +S+  Q  G NW+LIAGGALLSTLS+RLGYKLKQVLD KQ N +  + 
Sbjct  1     MNPRTRGVPR--RSRNFQEGGLNWILIAGGALLSTLSIRLGYKLKQVLDTKQLNNSSQSL  58

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K+  K    KK+ +C L +   CF Q+++ CY+  +G+ +++++KQQ NGQ++TE +  L
Sbjct  59    KDG-KSDIWKKSASCPLHADGLCFTQEEDGCYSGYNGSTNMVEIKQQDNGQMITERKMPL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  WSSS DRLELP KP H SN SESPCVSESGS IFSK EVIQKL
Sbjct  118   PLVIVPTPEFNKENGVMWSSSPDRLELPHKPSHHSNSSESPCVSESGSCIFSKGEVIQKL  177

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI EL++SL+++LSHSSHLQSLLD ANRDLFDSEREIQRLRKVI
Sbjct  178   RQQLKRRDDMILEMQDQIAELKNSLSSELSHSSHLQSLLDAANRDLFDSEREIQRLRKVI  237

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG + S +K+   P +W +EG NG+ NG+ + E  L+SSEKGRG+ ++IEML+ EV
Sbjct  238   ADHCVGHIYSGQKLTADP-VWLAEGMNGHTNGYPKVEGKLESSEKGRGEVDKIEMLKGEV  296

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EL+E+I+GK+YLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  297   SELRELIEGKDYLLQSYKEQKWELSVKIKELQQRLDSQLPNIL  339



>gb|KHG22604.1| Na(+)-translocating NADH-quinone reductase subunit F [Gossypium 
arboreum]
Length=340

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 266/343 (78%), Gaps = 3/343 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R    SR QKS++ QGEG NW+LIAGGALLSTLS+RLGYKLKQ LD KQQ+ +   S
Sbjct  1     MNTRGGQVSRGQKSRSFQGEGLNWILIAGGALLSTLSIRLGYKLKQALDTKQQHDSSTRS  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K     ++R+++  C L S+ Y F Q+D+ C+N +SG   +   K   NG +   SE  L
Sbjct  61    KGIGS-SDRRRSSGCRLHSNMYSFTQEDDWCFNCISGAESIGG-KHPPNGHMPPSSEVAL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ +F+++NG  W+SS D LELP KP H SN S+SP VSESGSDI+SKREVIQKL
Sbjct  119   PLVTVPTSDFNKDNGIMWASSPDHLELPPKPFHHSNCSDSPRVSESGSDIYSKREVIQKL  178

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+QI ELQ+SLNAQ+SHSSHLQS LDVANRDLFDSEREIQRLRKVI
Sbjct  179   RQQLKRRDDMILEMQDQITELQNSLNAQISHSSHLQSQLDVANRDLFDSEREIQRLRKVI  238

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV +V++ +K  TV +L   + +NG+ANG+   E +L S EKGRGD ERI MLR EV
Sbjct  239   ADHCVVRVNTNDKTSTVTAL-APDIKNGHANGYLGIETNLDSPEKGRGDEERIGMLRSEV  297

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVI+GK+YLLQSYKEQK ELS ++KELQQRLD QLP+IL
Sbjct  298   EELKEVIEGKQYLLQSYKEQKMELSMKIKELQQRLDYQLPSIL  340



>ref|XP_004140083.1| PREDICTED: uncharacterized protein LOC101220277 isoform 1 [Cucumis 
sativus]
 ref|XP_004140084.1| PREDICTED: uncharacterized protein LOC101220277 isoform 2 [Cucumis 
sativus]
Length=342

 Score =   385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 258/343 (75%), Gaps = 1/343 (0%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R + + RAQKS+    EGPNWVLIAGGALLSTLS+RLGYKLKQ  D +Q   +G++ 
Sbjct  1     MTPRTSRSPRAQKSRISSNEGPNWVLIAGGALLSTLSIRLGYKLKQAFDTRQLKDSGSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
               N K +ER+KA  C   S+ Y F +DDE C+N ++GT+   D+      Q++  SE  L
Sbjct  61    TGNVKTSERRKAAGCRC-SNVYSFTRDDECCFNCMAGTQCTTDVNCPPADQIVVASENAL  119

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  W+SS DRLELP K  H SN S+SPCVS+SGSDIFSKREVI KL
Sbjct  120   PLVLVPASEFNKENGIIWASSPDRLELPAKQFHNSNCSDSPCVSDSGSDIFSKREVIHKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRD+MILEMQ+QIV LQ+SLNAQ++HSSHLQS LD +N+DLFDSEREIQRLRK I
Sbjct  180   RHQLKRRDDMILEMQDQIVHLQNSLNAQVAHSSHLQSQLDASNQDLFDSEREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHC+GQ    +K       W  E RNG ANG+ +   + +  EK RGDGERIEML++EV
Sbjct  240   ADHCLGQAGPNDKSSLSVRSWSGETRNGQANGYMDVNCNFEGPEKIRGDGERIEMLKKEV  299

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LK+VI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  300   GDLKDVIEGKEYLLQSYKEQKTELSLKIKELQQRLDSQLPNIL  342



>ref|XP_004158611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220277 
[Cucumis sativus]
Length=342

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 257/343 (75%), Gaps = 1/343 (0%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R + + RAQKS+    EGPNWVLIAGGALLSTLS+RLGYKLKQ  D +Q   +G++ 
Sbjct  1     MTPRTSRSPRAQKSRISSNEGPNWVLIAGGALLSTLSIRLGYKLKQAFDTRQLKDSGSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
               N K +ER+KA  C   S+ Y F +DDE C+N ++GT+   D+      Q++  SE  L
Sbjct  61    TGNVKTSERRKAAGCRC-SNVYSFTRDDECCFNCMAGTQCTTDVNCPPADQIVVASENAL  119

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  W+SS DRLELP K  H SN S+SPCVS+SGSDIFSKREVI KL
Sbjct  120   PLVLVPASEFNKENGIIWASSPDRLELPAKQFHNSNCSDSPCVSDSGSDIFSKREVIHKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRD+MILEMQ+QIV LQ+SLNAQ++HSSHLQS LD +N+DLFDSEREIQRLRK I
Sbjct  180   RHQLKRRDDMILEMQDQIVHLQNSLNAQVAHSSHLQSQLDASNQDLFDSEREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHC+GQ    +K       W  E RNG ANG+ +   + +  EK RGDGERIEML +EV
Sbjct  240   ADHCLGQAGPNDKSSLSVRSWSGETRNGQANGYMDVNCNFEGPEKIRGDGERIEMLXKEV  299

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LK+VI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  300   GDLKDVIEGKEYLLQSYKEQKTELSLKIKELQQRLDSQLPNIL  342



>ref|XP_008449379.1| PREDICTED: uncharacterized protein LOC103491277 [Cucumis melo]
 ref|XP_008449380.1| PREDICTED: uncharacterized protein LOC103491277 [Cucumis melo]
Length=342

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 258/343 (75%), Gaps = 1/343 (0%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R +   RAQKS+    EGPNWVLIAGGALLSTLS+RLGYKLKQ  D +Q   +G++ 
Sbjct  1     MTPRTSRGPRAQKSRISSTEGPNWVLIAGGALLSTLSIRLGYKLKQAFDTRQLKDSGSSL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
               N K +ER+KA  C   S+ Y F +DDE C+N ++GT+   D+K     Q++  SE+ L
Sbjct  61    TGNAKTSERRKAVGCRC-SNVYSFTRDDECCFNCMAGTQCTTDVKCPPADQIVVASESTL  119

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  W SS DRLELP K    SN S+SPCVS+SGSDIFSKREVI KL
Sbjct  120   PLVLVPASEFNKENGIIWESSPDRLELPAKQFQHSNCSDSPCVSDSGSDIFSKREVIHKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRD+MILEMQ+QIV LQ+SLNAQ++HSSHLQS LD AN+DLFDSEREIQRLRK I
Sbjct  180   RHQLKRRDDMILEMQDQIVHLQNSLNAQVAHSSHLQSQLDAANQDLFDSEREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHC+GQV   +K       W  E RNG ANG+ +   + ++ E  RGDGERIEML++EV
Sbjct  240   ADHCLGQVGPKDKSSLSVRSWSGETRNGQANGYMDVNCNFEAPEIIRGDGERIEMLKKEV  299

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LK+VI+GKEYLLQSYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  300   GDLKDVIEGKEYLLQSYKEQKTELSLKIKELQQRLDSQLPNIL  342



>gb|KDO48018.1| hypothetical protein CISIN_1g019288mg [Citrus sinensis]
Length=315

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 256/344 (74%), Gaps = 30/344 (9%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R +G SR Q++K +QGEGPNW+LIAGGALLSTLS+RLGYKLKQ  D++QQ    N +
Sbjct  1     MIPRTDGASRGQRTKHIQGEGPNWILIAGGALLSTLSIRLGYKLKQTFDSRQQQANANNA  60

Query  477   -KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   + R+++   HLQ++ Y F QD+ +C+N                          
Sbjct  61    LKGNGTHSGRRRSPARHLQTNMYSFTQDNGSCFN--------------------------  94

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
                V+VP+ EF +ENG  W+SS DRLE+P KP H SN S+SPCVSESGSDIFSKREVI K
Sbjct  95    --CVSVPAPEFGKENGVLWASSPDRLEVPPKPFHHSNCSDSPCVSESGSDIFSKREVICK  152

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL HS+HLQS LD AN+DLFDSERE+QRLRK 
Sbjct  153   LRQQLKRRDDMILEMQDQIVELQNSLNAQLEHSTHLQSQLDAANKDLFDSEREVQRLRKA  212

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG V + +K PT  ++W +E RNG ANG+ + E +  + EKGRGDG +IEMLR+E
Sbjct  213   IADHCVGHVGTNDKPPT-HAIWPTEARNGLANGYIDGENNHDNLEKGRGDGGKIEMLRKE  271

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGK+YLLQSYKEQK ELS +VKELQQRLDSQLPNIL
Sbjct  272   VGELKEVIDGKDYLLQSYKEQKTELSMKVKELQQRLDSQLPNIL  315



>ref|XP_007131478.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
 ref|XP_007131480.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
 gb|ESW03472.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
 gb|ESW03474.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
Length=344

 Score =   377 bits (967),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 210/348 (60%), Positives = 255/348 (73%), Gaps = 9/348 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK  +NG SR  K+   Q EGPNW++ A GALLSTLS+RLGYKLKQ LD+K +       
Sbjct  1     MKPHSNGVSRGHKANGTQVEGPNWLIFAAGALLSTLSIRLGYKLKQALDSKPKQNATAIQ  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K +  KK+ +  LQ++ Y   QD+  C++ +SGT   M++K   NGQ+L E +  L
Sbjct  61    KGNGKSSSMKKSADYFLQTNGYSQTQDNHGCFSCISGTGGTMEVKCPPNGQMLNEFDGAL  120

Query  657   PLVTV--PSLEFSRENGGAWSSSVD-RLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
             PLVTV  P+ EFS+ENG  W+ S D  LELP KP H SN S+SPCVSESGSDIFSKREVI
Sbjct  121   PLVTVPAPAAEFSKENGVMWACSPDHHLELPSKPFHHSNCSDSPCVSESGSDIFSKREVI  180

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLN+Q+  SSHLQ  LD  NRDLFDSEREIQRLR
Sbjct  181   QKLRQQLKRRDDMILEMQDQLAELQNSLNSQMGLSSHLQLQLDATNRDLFDSEREIQRLR  240

Query  1008  KVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEM  1181
             K IADHCVG V  D   K+ T P    +E RNG+ NGH + + +  S EK R + ER+E+
Sbjct  241   KAIADHCVGYVPHDKSSKVTTSP----AEIRNGFLNGHLDGDSNSDSPEKPRDEEERVEL  296

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L+R+V ELKEVI+GKEYLLQSYKEQK ELS +V+ELQ RLDSQLPNIL
Sbjct  297   LKRQVGELKEVIEGKEYLLQSYKEQKTELSMKVRELQHRLDSQLPNIL  344



>ref|XP_006592001.1| PREDICTED: uncharacterized protein LOC100819480 isoform X2 [Glycine 
max]
 gb|KHN46488.1| hypothetical protein glysoja_035164 [Glycine soja]
Length=343

 Score =   374 bits (960),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 258/348 (74%), Gaps = 10/348 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK + +G SRA K+   Q EGPNW++ A GALLSTLS+RLGYKLKQ LD+K +       
Sbjct  1     MKPQTSGMSRAHKANNTQIEGPNWLIFAAGALLSTLSIRLGYKLKQALDSKPKQNATTGQ  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE-  653
             K N K    K + +C +QS+ Y   QD+  C+  +SGT   M++K   NGQ+   +E + 
Sbjct  61    KGNGKSTNTKNSADCFMQSNGYSLAQDNHGCFGCISGTGGTMELKCPPNGQMQMHNEFDG  120

Query  654   -LPLVTVPSL-EFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLVTVP+  EFS+ENG  W+ S DRLELP KP H SN S+SPCVSESGSDIFSKREVI
Sbjct  121   ALPLVTVPAAAEFSKENG-VWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKREVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQ+  SSHLQ  LD  NRDLF+S+REIQRLR
Sbjct  180   QKLRQQLKRRDDMILEMQDQMAELQNSLNAQMGLSSHLQLQLDATNRDLFESKREIQRLR  239

Query  1008  KVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEM  1181
             K IADHCVG V  D   K+  +P    +E RNG +NGH + E + +SSEK R + ERIE+
Sbjct  240   KAIADHCVGFVPHDKSSKVTVLP----TEIRNGLSNGHLDGENNCESSEKLRDEEERIEL  295

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L+R+V ELKEVI+GKEYLL SYKEQKAELS +++ELQQRLDSQLPNIL
Sbjct  296   LKRQVGELKEVIEGKEYLLLSYKEQKAELSLKIRELQQRLDSQLPNIL  343



>ref|XP_006587673.1| PREDICTED: uncharacterized protein LOC100792977 isoform X2 [Glycine 
max]
 gb|KHN11746.1| hypothetical protein glysoja_006199 [Glycine soja]
Length=345

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 257/349 (74%), Gaps = 10/349 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKA-LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK + NG SRA K+    Q EGPNW++ A GALLSTLS+RLGYKLKQ +D+K +      
Sbjct  1     MKPQTNGMSRAHKANNNTQFEGPNWLIFAAGALLSTLSIRLGYKLKQAVDSKPKQNATTG  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQV--LTESE  647
              K N K    K + +C +QS+ Y   QD+  C++ +SGT   M++K   NGQ+  L E +
Sbjct  61    QKGNGKSTHTKNSTDCFMQSNGYSQTQDNHGCFSCISGTGGTMELKCPPNGQMQMLNEFD  120

Query  648   TELPLVTVPSL-EFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREV  824
               LPLVTVP++ EFS+ENG  W+ S DRLELP KP H SN S+SPCVSESGSDIFSKREV
Sbjct  121   GALPLVTVPAVAEFSKENGVVWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKREV  180

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQ+  SSHLQ  LD  N DLFDSEREIQRL
Sbjct  181   IQKLRQQLKRRDDMILEMQDQMAELQNSLNAQMGLSSHLQLQLDATNSDLFDSEREIQRL  240

Query  1005  RKVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIE  1178
             RK IADHCVG V  D   K+   P    +E RN  +NGH + E + +S EK R + ERIE
Sbjct  241   RKAIADHCVGFVHHDKSSKVTVFP----AEIRNDLSNGHLDGENNCESPEKLRDEEERIE  296

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +L+R+V ELKEVI+GKEYLLQ+YKEQKAELS +++ELQQRLDSQLPNIL
Sbjct  297   LLKRQVGELKEVIEGKEYLLQNYKEQKAELSLKIRELQQRLDSQLPNIL  345



>gb|KHG17667.1| Desmoplakin [Gossypium arboreum]
Length=342

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 252/346 (73%), Gaps = 30/346 (9%)
 Frame = +3

Query  288   THKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTG  467
             T KM +R    S+ QKS   QG GPNW+LIAGGALLSTLS+R G KLKQ LD+KQQ    
Sbjct  27    TCKMNTRGGQVSKGQKSNKFQGGGPNWILIAGGALLSTLSIRFGCKLKQALDSKQQ-YDA  85

Query  468   NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
              T+ + N+ ++R++   C LQS+ Y F+QD   C+N +S                     
Sbjct  86    TTNLKGNRTSDRRRPSGCRLQSNMYSFSQDHNACFNCMS---------------------  124

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
                    VPS +F+++NG  W+SS DRLELP KP H SN S+SPCVSESGSDIFSKREVI
Sbjct  125   -------VPSTDFNKDNGVMWASSPDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVI  177

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+QIVELQ+SLNAQ+++S+HLQS LD ANR+LFDSE EIQRLR
Sbjct  178   QKLRQQLKRRDDMILEMQDQIVELQNSLNAQVANSTHLQSQLDAANRELFDSEMEIQRLR  237

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
             K IADHC+G V + EK     + W  + RNG+ NG+ + E +L S EKGRGDGERIEML+
Sbjct  238   KAIADHCLGHVGTNEKTSNATT-WPYDIRNGHGNGYVDVESNLGSPEKGRGDGERIEMLK  296

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             REV ELKEVI+GKEYLLQSYKEQK ELS ++KELQ RLDSQLPNIL
Sbjct  297   REVGELKEVIEGKEYLLQSYKEQKMELSMKIKELQLRLDSQLPNIL  342



>ref|XP_003540017.1| PREDICTED: uncharacterized protein LOC100819480 isoform X1 [Glycine 
max]
Length=340

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 260/350 (74%), Gaps = 17/350 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAK--QQNTTGN  470
             MK + +G SRA K+   Q EGPNW++ A GALLSTLS+RLGYKLKQ LD+K  Q  TTGN
Sbjct  1     MKPQTSGMSRAHKANNTQIEGPNWLIFAAGALLSTLSIRLGYKLKQALDSKPKQNATTGN  60

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
                 N K      + +C +QS+ Y   QD+  C+  +SGT   M++K   NGQ+   +E 
Sbjct  61    GKSTNTK-----NSADCFMQSNGYSLAQDNHGCFGCISGTGGTMELKCPPNGQMQMHNEF  115

Query  651   E--LPLVTVPSL-EFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKRE  821
             +  LPLVTVP+  EFS+ENG  W+ S DRLELP KP H SN S+SPCVSESGSDIFSKRE
Sbjct  116   DGALPLVTVPAAAEFSKENG-VWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKRE  174

Query  822   VIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQR  1001
             VIQKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQ+  SSHLQ  LD  NRDLF+S+REIQR
Sbjct  175   VIQKLRQQLKRRDDMILEMQDQMAELQNSLNAQMGLSSHLQLQLDATNRDLFESKREIQR  234

Query  1002  LRKVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERI  1175
             LRK IADHCVG V  D   K+  +P    +E RNG +NGH + E + +SSEK R + ERI
Sbjct  235   LRKAIADHCVGFVPHDKSSKVTVLP----TEIRNGLSNGHLDGENNCESSEKLRDEEERI  290

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             E+L+R+V ELKEVI+GKEYLL SYKEQKAELS +++ELQQRLDSQLPNIL
Sbjct  291   ELLKRQVGELKEVIEGKEYLLLSYKEQKAELSLKIRELQQRLDSQLPNIL  340



>ref|XP_004506334.1| PREDICTED: uncharacterized protein LOC101496354 [Cicer arietinum]
Length=336

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 211/343 (62%), Positives = 251/343 (73%), Gaps = 7/343 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK + NG SR  K+   + EGPNW++IA GALLSTLS+RLGYKLKQ LD+K ++      
Sbjct  1     MKPQTNG-SRVHKANHTRVEGPNWLIIAAGALLSTLSIRLGYKLKQALDSKPKHNATTIL  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N K +  +K  +C +Q + Y   QD+  C++  SGT   M++K   NGQ+L+E    L
Sbjct  60    KGNGKSSNIRKPPDCFMQPNRYSQTQDNHGCFSCNSGTGGSMELKCPQNGQMLSEFNGAL  119

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP  EFS+ENG  WS S DRLELP KP HLSN S+SPCVSESGSDIFSKREVIQKL
Sbjct  120   PLVTVPPAEFSKENGVVWSCSPDRLELPSKPFHLSNCSDSPCVSESGSDIFSKREVIQKL  179

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRD+MILEMQ+Q+ ELQ+SLN QL  SSHLQ  L+  NRDLFDSEREIQRLRK I
Sbjct  180   RQQLKRRDDMILEMQDQMAELQNSLNDQLGLSSHLQLQLEATNRDLFDSEREIQRLRKAI  239

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCVG V   +   +  + W +E RNG+ NG      +L   EK R + ERIEML+R+V
Sbjct  240   ADHCVGYVPHDKS--STGTAWSAETRNGHPNGDI----NLDLPEKTRDEEERIEMLKRQV  293

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKE I+GKEYLLQSYKEQKAELS + KELQQRLDSQLPNIL
Sbjct  294   GELKEAIEGKEYLLQSYKEQKAELSLKNKELQQRLDSQLPNIL  336



>ref|XP_003534361.1| PREDICTED: uncharacterized protein LOC100792977 isoform X1 [Glycine 
max]
Length=342

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 259/351 (74%), Gaps = 17/351 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKA-LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAK--QQNTTG  467
             MK + NG SRA K+    Q EGPNW++ A GALLSTLS+RLGYKLKQ +D+K  Q  TTG
Sbjct  1     MKPQTNGMSRAHKANNNTQFEGPNWLIFAAGALLSTLSIRLGYKLKQAVDSKPKQNATTG  60

Query  468   NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQV--LTE  641
             N      K    K + +C +QS+ Y   QD+  C++ +SGT   M++K   NGQ+  L E
Sbjct  61    N-----GKSTHTKNSTDCFMQSNGYSQTQDNHGCFSCISGTGGTMELKCPPNGQMQMLNE  115

Query  642   SETELPLVTVPSL-EFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKR  818
              +  LPLVTVP++ EFS+ENG  W+ S DRLELP KP H SN S+SPCVSESGSDIFSKR
Sbjct  116   FDGALPLVTVPAVAEFSKENGVVWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKR  175

Query  819   EVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQ  998
             EVIQKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQ+  SSHLQ  LD  N DLFDSEREIQ
Sbjct  176   EVIQKLRQQLKRRDDMILEMQDQMAELQNSLNAQMGLSSHLQLQLDATNSDLFDSEREIQ  235

Query  999   RLRKVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             RLRK IADHCVG V  D   K+   P    +E RN  +NGH + E + +S EK R + ER
Sbjct  236   RLRKAIADHCVGFVHHDKSSKVTVFP----AEIRNDLSNGHLDGENNCESPEKLRDEEER  291

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             IE+L+R+V ELKEVI+GKEYLLQ+YKEQKAELS +++ELQQRLDSQLPNIL
Sbjct  292   IELLKRQVGELKEVIEGKEYLLQNYKEQKAELSLKIRELQQRLDSQLPNIL  342



>emb|CAN62200.1| hypothetical protein VITISV_032475 [Vitis vinifera]
Length=570

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 252/320 (79%), Gaps = 7/320 (2%)
 Frame = +3

Query  369   VLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCHLQSSSYCF  548
             +L  GGALLSTLS+RLGYKLKQ LD KQQ    +      K A+R K+  C L S++Y F
Sbjct  257   ILTKGGALLSTLSIRLGYKLKQALDTKQQENASS-----GKSADRNKSGACRLHSNAYSF  311

Query  549   NQDDENCYNFLSGTRDVMDMKQ-QCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVD  725
              ++D +C++ +SG+  ++D+   Q NGQ+LTES+  LPLV VP+ E+++ENG  W SS +
Sbjct  312   TREDNSCFHCVSGSEGILDVNHHQPNGQILTESDVALPLVMVPAPEYTKENGVVWXSSPE  371

Query  726   RLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqs  905
             RLELP KP H SN S+SPCVSESGSDIFSKREVIQKLRQQ+K+RD+MILEMQ+QI+ELQ+
Sbjct  372   RLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKLRQQLKKRDDMILEMQDQIMELQN  431

Query  906   slnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGS  1085
             SL++QLSHSSHLQ  LD ANRDLFDSEREIQRLRK IADHCVG V   E  P+      S
Sbjct  432   SLSSQLSHSSHLQVQLDAANRDLFDSEREIQRLRKAIADHCVGHVGFNEN-PSPAMTCPS  490

Query  1086  EGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAE  1265
             E RNG+ANG+   + +L+S EKGRGD ERIEMLRREV EL+EVI+GKEYLLQSYKEQK E
Sbjct  491   EPRNGHANGYLNGDTNLESPEKGRGDSERIEMLRREVGELREVIEGKEYLLQSYKEQKVE  550

Query  1266  LSTQVKELQQRLDSQLPNIL  1325
             LS ++KELQQRLDSQLPNIL
Sbjct  551   LSMKIKELQQRLDSQLPNIL  570



>gb|ACU24497.1| unknown [Glycine max]
Length=342

 Score =   369 bits (947),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 258/351 (74%), Gaps = 17/351 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKA-LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAK--QQNTTG  467
             MK + NG SRA K+    Q EGPNW++ A GALLSTLS+RLGYKLKQ +D+K  Q  TTG
Sbjct  1     MKPQTNGMSRAHKANNNTQFEGPNWLIFAAGALLSTLSIRLGYKLKQAVDSKPKQNATTG  60

Query  468   NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQV--LTE  641
             N      K    K + +C +QS+ Y   QD+  C++ +SGT   M++K   NGQ+  L E
Sbjct  61    N-----GKSTHTKNSTDCFMQSNGYSQTQDNHGCFSCISGTGGTMELKCPPNGQMQMLNE  115

Query  642   SETELPLVTVPSL-EFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKR  818
              +  LPLVTVP++ EFS+ENG  W+ S DRLELP KP H SN S+SPCVSESGSDIFSKR
Sbjct  116   FDGALPLVTVPAVAEFSKENGVVWACSPDRLELPSKPFHHSNCSDSPCVSESGSDIFSKR  175

Query  819   EVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQ  998
             EVIQKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQ+  SSHLQ  LD  N DLFDSEREIQ
Sbjct  176   EVIQKLRQQLKRRDDMILEMQDQMAELQNSLNAQMGLSSHLQLQLDATNSDLFDSEREIQ  235

Query  999   RLRKVIADHCVGQV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             RLRK IADHCVG V  D   K+   P    +E RN  +NGH + E + +S EK R + ER
Sbjct  236   RLRKAIADHCVGFVHHDKSSKVTVFP----AEIRNDLSNGHLDGENNCESPEKLRDEEER  291

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             IE+L+R+V ELKEVI+GKEYLLQ+YKEQKAELS +++ELQQRLD QLPNIL
Sbjct  292   IELLKRQVGELKEVIEGKEYLLQNYKEQKAELSLKIRELQQRLDFQLPNIL  342



>ref|XP_010276970.1| PREDICTED: uncharacterized protein LOC104611562 isoform X3 [Nelumbo 
nucifera]
Length=371

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 214/358 (60%), Positives = 269/358 (75%), Gaps = 17/358 (5%)
 Frame = +3

Query  273   FNTLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQ  452
             FN L   KMK +ANG SRA+KSK +Q EGPNW+LI GGALLSTLS+R+GYKLKQ L  K+
Sbjct  24    FNILQILKMKPKANGISRAEKSKKIQ-EGPNWILIIGGALLSTLSIRVGYKLKQALYTKR  82

Query  453   QNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFL------SGTRD-VMDMK  611
              +        N +  ++++   C   S+ Y F QD+++C N +      +G  D  +++K
Sbjct  83    PDNG------NKRSVDKRRPGTCISHSNPYSFAQDEDSCCNVMAFQGVETGFSDGKVEVK  136

Query  612   QQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSE  791
             +   G  L +++  LPLV +P+LE ++ENG  W+SS DRLELP +P H SN S+S CVSE
Sbjct  137   RPPTGLRLQDTDLALPLVKIPALESNKENGVIWASSPDRLELPPRPFHHSNSSDSLCVSE  196

Query  792   SGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRD  971
             SGSDIF+KREVIQKLRQQ+KRRDEMILEMQ+QI  LQSSL+ QL+HS++LQS LD ANRD
Sbjct  197   SGSDIFTKREVIQKLRQQLKRRDEMILEMQDQITSLQSSLSIQLAHSTNLQSQLDAANRD  256

Query  972   LFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEK  1151
             LF+SEREIQRLRK IADHCVG   S EK   V + W S G+NG+ NG  + E +L+  +K
Sbjct  257   LFESEREIQRLRKAIADHCVGD-RSPEKSIAVRN-W-SAGQNGHVNGFIDGESNLEVVDK  313

Query  1152  GRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             GRGDGERIEML+REV ELKEVI+GKEYLLQ+YKEQKAELS++VKELQQRL SQ+P+IL
Sbjct  314   GRGDGERIEMLKREVGELKEVIEGKEYLLQNYKEQKAELSSKVKELQQRLASQVPSIL  371



>ref|XP_010271021.1| PREDICTED: uncharacterized protein LOC104607162 isoform X3 [Nelumbo 
nucifera]
Length=342

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 253/345 (73%), Gaps = 5/345 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK RA+G SRAQKSK    EGPNWVLIAGGALLSTLS + GYKLKQVLD +Q +   N  
Sbjct  1     MKPRADGISRAQKSKFCH-EGPNWVLIAGGALLSTLSFQFGYKLKQVLDTRQLDNASNGL  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVM-DMKQQCNGQVLTESETE  653
             K   K A ++K+  C   S+ Y F QD+    NF SG  D M  +K   +G +L E+   
Sbjct  60    KGTAKSANKRKSGTCTSHSNLYSFAQDEGGGCNFHSGFSDGMVGVKCSPSGSILQETNPA  119

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP LE ++ENG  W+SS D LELP KP H SN S+SPC+SESGSDIF+K+EVI+K
Sbjct  120   LPLVTVPVLESNKENGVMWASSPDCLELPPKPFHHSNSSDSPCLSESGSDIFTKQEVIRK  179

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRDEMILEMQ+QI  LQ+SL+ QL+ S+HLQS LD ANRDLF+SE+EIQRLRK 
Sbjct  180   LRQQLKRRDEMILEMQDQITSLQNSLSVQLTRSTHLQSQLDSANRDLFESEQEIQRLRKA  239

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGR-GDGERIEMLRR  1190
             IADHCV     CEK P   + W +  +NG+ NG       ++  +KG  GDGERIEML++
Sbjct  240   IADHCVVDTSPCEK-PMAVNNWATR-QNGHINGFIVGVSDVEVLDKGSGGDGERIEMLKK  297

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLLQSYKEQKAEL + VKELQQRL SQ+PNIL
Sbjct  298   EVVELKEVIEGKEYLLQSYKEQKAELYSTVKELQQRLASQVPNIL  342



>ref|XP_008801427.1| PREDICTED: uncharacterized protein LOC103715538 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008801436.1| PREDICTED: uncharacterized protein LOC103715538 isoform X1 [Phoenix 
dactylifera]
Length=369

 Score =   362 bits (929),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 208/368 (57%), Positives = 263/368 (71%), Gaps = 15/368 (4%)
 Frame = +3

Query  243   RLCS*SATILFNTLATHKMKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLG  419
             R CS S T LF T     MK +AN    RAQK K +QGEGPNWV+IAGGALLSTLS+RLG
Sbjct  10    RQCS-SNTQLFLT-----MKPKANAAIQRAQKVKHVQGEGPNWVIIAGGALLSTLSIRLG  63

Query  420   YKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-  596
              KLKQ+ D KQ     N +KEN K   ++    C L S  YC+ QD++ CY+ LSG  D 
Sbjct  64    CKLKQIFDTKQSKNF-NNAKENGKYIAKRTPGACQLHSKLYCYTQDEDGCYHCLSGISDG  122

Query  597   VMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSE  773
              +D+KQ     +  +++  LPLV +P+ + +++  G  W+SS DRLELPQ+PLH SN S+
Sbjct  123   ALDIKQPPASPLSKDTDVSLPLVKIPAADSNKDGTGVMWASSPDRLELPQRPLHHSNSSD  182

Query  774   SPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsll  953
             SPCVSESGSDI+S+REVIQKLRQQ+KRRDEMI+EMQ QI +LQ+SL+ Q++HS++LQS L
Sbjct  183   SPCVSESGSDIYSRREVIQKLRQQLKRRDEMIMEMQAQITDLQNSLSIQMTHSANLQSQL  242

Query  954   DVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA---  1124
             D ANRDLFD+EREIQRLRK IADHCV +  + EK P     W SE  +G  NG+ ++   
Sbjct  243   DYANRDLFDAEREIQRLRKAIADHCVAEAGTLEK-PVTTRSWRSEAISGQVNGYPDSMGD  301

Query  1125  -ERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRL  1301
              E H    E  R  GER+EML+REV ELKEVI+GK++LLQSYKEQK EL +++KELQ +L
Sbjct  302   VELHCVGGENVRDGGERVEMLKREVGELKEVIEGKDFLLQSYKEQKVELCSKMKELQLKL  361

Query  1302  DSQLPNIL  1325
              SQ+P IL
Sbjct  362   ASQVPTIL  369



>ref|XP_010276969.1| PREDICTED: uncharacterized protein LOC104611562 isoform X2 [Nelumbo 
nucifera]
Length=380

 Score =   362 bits (930),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 213/367 (58%), Positives = 265/367 (72%), Gaps = 13/367 (4%)
 Frame = +3

Query  273   FNTLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQ  452
             FN L   KMK +ANG SRA+KSK +Q EGPNW+LI GGALLSTLS+R+GYKLKQ L  K+
Sbjct  24    FNILQILKMKPKANGISRAEKSKKIQ-EGPNWILIIGGALLSTLSIRVGYKLKQALYTKR  82

Query  453   QNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQV  632
              +     S +  +P        C   S+ Y F QD+++C N ++     +++K+   G  
Sbjct  83    PDNGNKRSVDKRRPG------TCISHSNPYSFAQDEDSCCNVMAFQ---VEVKRPPTGLR  133

Query  633   LTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFS  812
             L +++  LPLV +P+LE ++ENG  W+SS DRLELP +P H SN S+S CVSESGSDIF+
Sbjct  134   LQDTDLALPLVKIPALESNKENGVIWASSPDRLELPPRPFHHSNSSDSLCVSESGSDIFT  193

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KREVIQKLRQQ+KRRDEMILEMQ+QI  LQSSL+ QL+HS++LQS LD ANRDLF+SERE
Sbjct  194   KREVIQKLRQQLKRRDEMILEMQDQITSLQSSLSIQLAHSTNLQSQLDAANRDLFESERE  253

Query  993   IQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
             IQRLRK IADHCVG   S EK   V + W S G+NG+ NG  + E +L+  +KGRGDGER
Sbjct  254   IQRLRKAIADHCVGD-RSPEKSIAVRN-W-SAGQNGHVNGFIDGESNLEVVDKGRGDGER  310

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL*AEFKKHVY  1352
             IEML+REV ELKEVI+GKEYLLQ+YKEQKAELS++VKELQQRL SQ      +    H  
Sbjct  311   IEMLKREVGELKEVIEGKEYLLQNYKEQKAELSSKVKELQQRLASQGRRNFSSSLGLHAP  370

Query  1353  SCLVGFH  1373
              C+   H
Sbjct  371   CCIDCVH  377



>ref|XP_008801442.1| PREDICTED: uncharacterized protein LOC103715538 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008801450.1| PREDICTED: uncharacterized protein LOC103715538 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008801458.1| PREDICTED: uncharacterized protein LOC103715538 isoform X2 [Phoenix 
dactylifera]
Length=348

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 255/350 (73%), Gaps = 9/350 (3%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK +AN    RAQK K +QGEGPNWV+IAGGALLSTLS+RLG KLKQ+ D KQ     N 
Sbjct  1     MKPKANAAIQRAQKVKHVQGEGPNWVIIAGGALLSTLSIRLGCKLKQIFDTKQSKNF-NN  59

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             +KEN K   ++    C L S  YC+ QD++ CY+ LSG  D  +D+KQ     +  +++ 
Sbjct  60    AKENGKYIAKRTPGACQLHSKLYCYTQDEDGCYHCLSGISDGALDIKQPPASPLSKDTDV  119

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P+ + +++  G  W+SS DRLELPQ+PLH SN S+SPCVSESGSDI+S+REVI
Sbjct  120   SLPLVKIPAADSNKDGTGVMWASSPDRLELPQRPLHHSNSSDSPCVSESGSDIYSRREVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRDEMI+EMQ QI +LQ+SL+ Q++HS++LQS LD ANRDLFD+EREIQRLR
Sbjct  180   QKLRQQLKRRDEMIMEMQAQITDLQNSLSIQMTHSANLQSQLDYANRDLFDAEREIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERI  1175
             K IADHCV +  + EK P     W SE  +G  NG+ ++    E H    E  R  GER+
Sbjct  240   KAIADHCVAEAGTLEK-PVTTRSWRSEAISGQVNGYPDSMGDVELHCVGGENVRDGGERV  298

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EML+REV ELKEVI+GK++LLQSYKEQK EL +++KELQ +L SQ+P IL
Sbjct  299   EMLKREVGELKEVIEGKDFLLQSYKEQKVELCSKMKELQLKLASQVPTIL  348



>ref|XP_010271016.1| PREDICTED: uncharacterized protein LOC104607162 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271017.1| PREDICTED: uncharacterized protein LOC104607162 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271018.1| PREDICTED: uncharacterized protein LOC104607162 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271019.1| PREDICTED: uncharacterized protein LOC104607162 isoform X1 [Nelumbo 
nucifera]
Length=344

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 253/347 (73%), Gaps = 7/347 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK RA+G SRAQKSK    EGPNWVLIAGGALLSTLS + GYKLKQVLD +Q +   N  
Sbjct  1     MKPRADGISRAQKSKFCH-EGPNWVLIAGGALLSTLSFQFGYKLKQVLDTRQLDNASNGL  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLS--GTRDVM-DMKQQCNGQVLTESE  647
             K   K A ++K+  C   S+ Y F QD+    NF S  G  D M  +K   +G +L E+ 
Sbjct  60    KGTAKSANKRKSGTCTSHSNLYSFAQDEGGGCNFHSAAGFSDGMVGVKCSPSGSILQETN  119

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
               LPLVTVP LE ++ENG  W+SS D LELP KP H SN S+SPC+SESGSDIF+K+EVI
Sbjct  120   PALPLVTVPVLESNKENGVMWASSPDCLELPPKPFHHSNSSDSPCLSESGSDIFTKQEVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             +KLRQQ+KRRDEMILEMQ+QI  LQ+SL+ QL+ S+HLQS LD ANRDLF+SE+EIQRLR
Sbjct  180   RKLRQQLKRRDEMILEMQDQITSLQNSLSVQLTRSTHLQSQLDSANRDLFESEQEIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGR-GDGERIEML  1184
             K IADHCV     CEK P   + W +  +NG+ NG       ++  +KG  GDGERIEML
Sbjct  240   KAIADHCVVDTSPCEK-PMAVNNWATR-QNGHINGFIVGVSDVEVLDKGSGGDGERIEML  297

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV ELKEVI+GKEYLLQSYKEQKAEL + VKELQQRL SQ+PNIL
Sbjct  298   KKEVVELKEVIEGKEYLLQSYKEQKAELYSTVKELQQRLASQVPNIL  344



>ref|XP_002319776.1| hypothetical protein POPTR_0013s07430g [Populus trichocarpa]
 gb|EEE95699.1| hypothetical protein POPTR_0013s07430g [Populus trichocarpa]
Length=291

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 240/343 (70%), Gaps = 52/343 (15%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK R NGTSR QK++  QGE PNW+LIAGGALLSTLS+RLGYKLKQ LD+KQQ       
Sbjct  1     MKPRTNGTSRGQKAQNFQGERPNWILIAGGALLSTLSIRLGYKLKQTLDSKQQ-------  53

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
                                          N  + L G   + ++K + N Q+L+ES+  L
Sbjct  54    ----------------------------ANASDGLKGNEGIANLKHRSNDQMLSESDVAL  85

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLV VP+ EF++ENG  W SS DRLELP KP   SN S+SP VSESGSDI SKREVIQKL
Sbjct  86    PLVMVPAAEFTKENGVMWVSSPDRLELPPKPFSHSNCSDSPSVSESGSDILSKREVIQKL  145

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ++RRD+MILEMQ+QI+E+Q+SLNAQL+ SS+LQS LD ANRDLFDS REIQRLRK I
Sbjct  146   RQQLRRRDDMILEMQDQILEIQNSLNAQLTLSSNLQSQLDAANRDLFDSGREIQRLRKAI  205

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             ADHCV                    RNG+ANG+ + E + ++SEKGRGDG RIEML+REV
Sbjct  206   ADHCV-----------------KHARNGHANGYLDGESNFETSEKGRGDGGRIEMLKREV  248

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              +LKEVI+GKEYLLQSYKEQKAELS ++ ELQ RLDSQLPNIL
Sbjct  249   GDLKEVIEGKEYLLQSYKEQKAELSMKIMELQHRLDSQLPNIL  291



>ref|XP_010276968.1| PREDICTED: uncharacterized protein LOC104611562 isoform X1 [Nelumbo 
nucifera]
Length=390

 Score =   361 bits (926),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 214/374 (57%), Positives = 269/374 (72%), Gaps = 17/374 (5%)
 Frame = +3

Query  273   FNTLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQ  452
             FN L   KMK +ANG SRA+KSK +Q EGPNW+LI GGALLSTLS+R+GYKLKQ L  K+
Sbjct  24    FNILQILKMKPKANGISRAEKSKKIQ-EGPNWILIIGGALLSTLSIRVGYKLKQALYTKR  82

Query  453   QNTTGNTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFL------SGTRD-VMDMK  611
              +        N +  ++++   C   S+ Y F QD+++C N +      +G  D  +++K
Sbjct  83    PDNG------NKRSVDKRRPGTCISHSNPYSFAQDEDSCCNVMAFQGVETGFSDGKVEVK  136

Query  612   QQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSE  791
             +   G  L +++  LPLV +P+LE ++ENG  W+SS DRLELP +P H SN S+S CVSE
Sbjct  137   RPPTGLRLQDTDLALPLVKIPALESNKENGVIWASSPDRLELPPRPFHHSNSSDSLCVSE  196

Query  792   SGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRD  971
             SGSDIF+KREVIQKLRQQ+KRRDEMILEMQ+QI  LQSSL+ QL+HS++LQS LD ANRD
Sbjct  197   SGSDIFTKREVIQKLRQQLKRRDEMILEMQDQITSLQSSLSIQLAHSTNLQSQLDAANRD  256

Query  972   LFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEK  1151
             LF+SEREIQRLRK IADHCVG   S EK   V + W S G+NG+ NG  + E +L+  +K
Sbjct  257   LFESEREIQRLRKAIADHCVGD-RSPEKSIAVRN-W-SAGQNGHVNGFIDGESNLEVVDK  313

Query  1152  GRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL*A  1331
             GRGDGERIEML+REV ELKEVI+GKEYLLQ+YKEQKAELS++VKELQQRL SQ      +
Sbjct  314   GRGDGERIEMLKREVGELKEVIEGKEYLLQNYKEQKAELSSKVKELQQRLASQGRRNFSS  373

Query  1332  EFKKHVYSCLVGFH  1373
                 H   C+   H
Sbjct  374   SLGLHAPCCIDCVH  387



>ref|XP_008802962.1| PREDICTED: uncharacterized protein LOC103716651 isoform X1 [Phoenix 
dactylifera]
Length=348

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 254/350 (73%), Gaps = 9/350 (3%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK RANGT  +AQK K +QGEGPNWVLIAGGALLSTLS+RLG KLKQ+ + KQ   + N 
Sbjct  1     MKMRANGTIQKAQKLKHVQGEGPNWVLIAGGALLSTLSIRLGCKLKQIFETKQSKNS-NN  59

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             +KEN K   ++    C L S+ YC+ QD++ CY+ LSG  D  +D+K+     +  E++ 
Sbjct  60    AKENGKNVAKRSPGACQLHSTLYCYTQDEDGCYHCLSGASDGAVDIKRPPTSPLSKEADV  119

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV VP  + +++  G  W+SS D LELP++P H SN S+SPC+SESGSDI+SKREVI
Sbjct  120   SLPLVKVPEADSNKDGSGVIWASSPDHLELPRRPFHHSNSSDSPCISESGSDIYSKREVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
              KLR Q+KRRDEMI+EMQ QI++LQ+S++ Q++HS++LQS LD ANRDLFD+EREIQRLR
Sbjct  180   HKLRLQLKRRDEMIMEMQTQIMDLQNSVSIQMTHSANLQSQLDSANRDLFDAEREIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERI  1175
             K IADHCV +    EK P     W  E   G  NG+ ++    E H    EK R D ER+
Sbjct  240   KAIADHCVAEAGFLEK-PVTTRNWRPEAVIGQVNGYIDSMDDVELHCIGGEKVRDDSERV  298

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EML+R+V ELKEVI+GK++LLQSYKEQK EL +++K LQ RL+SQ+PNIL
Sbjct  299   EMLKRKVGELKEVIEGKDFLLQSYKEQKVELCSKIKVLQLRLESQVPNIL  348



>ref|XP_010448102.1| PREDICTED: uncharacterized protein LOC104730607 isoform X2 [Camelina 
sativa]
Length=337

 Score =   353 bits (907),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 261/347 (75%), Gaps = 14/347 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R +G S+ Q++    GEGPNW+LIAGGALLSTLS+R GYKLKQ LD K Q+ + +  
Sbjct  1     MSTRRSGISKHQRADKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDWKPQSNSSSGL  60

Query  477   KENNKPAERKKARNCHLQSSSY-CFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             K N   +ER+K+ +C L S+++ C + +D  C+  + G+ +V + K+  N Q+++ S+T 
Sbjct  61    KANGGASERQKSTSCCLHSNTFSCAHSND--CFRSIPGSENV-EGKEVTNEQMVSASDTS  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  FS+ENG  W++S DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQ
Sbjct  118   LPLVTVPAPSFSKENGVMWATSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ +HSSHLQ  LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQNSYNAQTAHSSHLQEQLDTMNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG--QVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
              IADH VG     + +  P  P  W     +G+ NG  ++E + +S EKG  DGER+EML
Sbjct  238   AIADHSVGCGAGSNGKTSPVAP--W-----SGHVNGFMDSESNYESQEKGSRDGERVEML  290

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV+ELKEVI+GK+YLL+SYKEQK ELS +VKELQQRLDSQ+PNIL
Sbjct  291   KKEVSELKEVIEGKDYLLRSYKEQKIELSEKVKELQQRLDSQVPNIL  337



>ref|XP_002867492.1| hypothetical protein ARALYDRAFT_492028 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43751.1| hypothetical protein ARALYDRAFT_492028 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 259/346 (75%), Gaps = 12/346 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG S+ Q++    G+ PNW+LIAGGALLSTLS+R GYKLKQ LD K Q + G+  
Sbjct  1     MSTRRNGISKHQRADKFCGDRPNWILIAGGALLSTLSIRFGYKLKQSLDWKPQ-SNGSAG  59

Query  477   KENNKPAERKKARNCHLQS-SSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              + N  +ER+K+ +C L S +S C + +D  C+  + GT +V + K+  N Q+++ S+T 
Sbjct  60    IKPNGISERQKSTSCCLHSNTSSCTHNNDYCCFRSIPGTENV-EGKEVTNEQMISASDTS  118

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPL  VP+  FS+ENG  W++S DRLELP KP  H SN S+SPCVSE+ SDIFSKREVIQ
Sbjct  119   LPLAKVPAPSFSKENGIMWATSPDRLELPPKPYNHHSNCSDSPCVSETSSDIFSKREVIQ  178

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ+SHSSHLQ+ LD  NRDLF+SERE+QRLRK
Sbjct  179   KLRQQLKRRDDMILEMQEQILELQNSYNAQMSHSSHLQAQLDTLNRDLFESEREVQRLRK  238

Query  1011  VIADHCVGQVDSCEKI-PTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
              IADH VG   S  K  P  P  W     +G+ +G  ++E + +S EK   DGER+EMLR
Sbjct  239   AIADHSVGCTGSNGKTSPVAP--W-----SGHVDGFMDSESNYESQEKSLRDGERVEMLR  291

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EV+ELKEVIDGKEYLL+SYKEQK ELS +VKELQQRLDSQLPNIL
Sbjct  292   KEVSELKEVIDGKEYLLRSYKEQKIELSQKVKELQQRLDSQLPNIL  337



>ref|XP_010918059.1| PREDICTED: uncharacterized protein LOC105042509 isoform X4 [Elaeis 
guineensis]
 ref|XP_010918060.1| PREDICTED: uncharacterized protein LOC105042509 isoform X4 [Elaeis 
guineensis]
 ref|XP_010918061.1| PREDICTED: uncharacterized protein LOC105042509 isoform X4 [Elaeis 
guineensis]
Length=348

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/350 (57%), Positives = 249/350 (71%), Gaps = 9/350 (3%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK +A G   RAQK K +QG GPNWV+IAGGALLSTLS+R G KLKQ+ + KQ     N 
Sbjct  1     MKPKATGAIQRAQKVKHMQGGGPNWVIIAGGALLSTLSIRFGCKLKQIFEIKQSKNF-NN  59

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             +KEN K A ++    CHL S  YC  QD++ CY+ LSG  D  +D KQ     +   ++ 
Sbjct  60    AKENGKFAAKRTPGACHLHSKLYCHTQDEDGCYHCLSGISDGALDTKQPPASPLSNNTDV  119

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P+ + +++  G  W+SS DRLELPQ+P H SN SESPCVSESGSDI+SKREVI
Sbjct  120   SLPLVKIPAADSNKDGSGVMWASSPDRLELPQRPFHHSNSSESPCVSESGSDIYSKREVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRDEMI+EMQ QI++LQ+SL+ Q++HS  LQS L+ ANRDLFD+EREIQRLR
Sbjct  180   QKLRQQLKRRDEMIMEMQAQIMDLQNSLSIQMTHSMDLQSQLESANRDLFDAEREIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERI  1175
             K IADHCV +  + EK P     W SE  NG  NG+ ++    E      E  R D ER+
Sbjct  240   KAIADHCVSEARTLEK-PVTTRSWRSEAINGQVNGYLDSMGDVEVQCFGGEIVRDDVERV  298

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EML+ EV ELKEVI+GK++LLQSYKEQK EL ++++ELQ RL SQ+PNIL
Sbjct  299   EMLKMEVGELKEVIEGKDFLLQSYKEQKVELCSKMEELQLRLASQVPNIL  348



>ref|XP_010906226.1| PREDICTED: uncharacterized protein LOC105033220 isoform X1 [Elaeis 
guineensis]
Length=348

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 251/350 (72%), Gaps = 9/350 (3%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK RA+GT  +AQK K +QGEGPNWVLIAGGALLSTLS+RLG KLKQ+ + KQ   + N 
Sbjct  1     MKMRAHGTIQKAQKVKHVQGEGPNWVLIAGGALLSTLSIRLGCKLKQMFETKQSKNS-NN  59

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             +KEN K   +++   C L S  YC+ QD++ CY+ LSGT D  +D+KQ   G    +++ 
Sbjct  60    AKENGKNVAKRRPGACQLHSKLYCYTQDEDGCYHCLSGTSDGAVDVKQPPAGPWSKDADV  119

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              L LV VP    + ++ G  W+SS D  ELP++P H SN S+SPC+SESGSDI+SKREVI
Sbjct  120   SLSLVKVPEANSNNDSSGVMWASSPDHPELPRRPFHHSNSSDSPCISESGSDIYSKREVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLR Q+KRRDEMI+EMQ QI++LQ+S+  Q++HS+ LQS LD AN DLFD+EREIQRLR
Sbjct  180   QKLRLQLKRRDEMIMEMQAQIMDLQNSVGIQMTHSAKLQSQLDSANGDLFDTEREIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERI  1175
             K IADHCV      EK P     W  E  NG  NG+ ++    E H    EK R D ER+
Sbjct  240   KAIADHCVADAGFLEK-PVATRTWRPEAINGQVNGYVDSTDDVELHCVGGEKVRDDSERV  298

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EML+R+V ELKEVI+GK++LLQSYKEQK EL +++KELQ RL+SQ+PNIL
Sbjct  299   EMLKRKVGELKEVIEGKDFLLQSYKEQKVELCSKIKELQLRLESQVPNIL  348



>ref|XP_010448100.1| PREDICTED: uncharacterized protein LOC104730607 isoform X1 [Camelina 
sativa]
Length=337

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 260/347 (75%), Gaps = 14/347 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R +G S+ Q++    GEGPNW+LIAGGALLSTLS+R GYKLKQ LD K Q+   +  
Sbjct  1     MSTRRSGISKHQRADKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDWKPQSNGSSGL  60

Query  477   KENNKPAERKKARNCHLQSSSY-CFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             K N   +ER+K+ +C L S+++ C + +D  C+  + G+ +V + K+  N Q+++ S+T 
Sbjct  61    KANGGASERQKSTSCCLHSNTFSCAHSND--CFRSIPGSENV-EGKEVTNEQMVSASDTS  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  FS+ENG  W++S DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQ
Sbjct  118   LPLVTVPAPSFSKENGVMWATSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ +HSSHLQ  LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQNSYNAQTAHSSHLQEQLDTMNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG--QVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
              IADH VG     + +  P  P  W     +G+ NG  ++E + ++ EKG  DGER+EML
Sbjct  238   AIADHSVGCGAGSNGKTSPVAP--W-----SGHVNGFMDSESNYEAQEKGSRDGERVEML  290

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV+ELKEVI+GK+YLL+SYKEQK ELS +VKELQQRLDSQ+PNIL
Sbjct  291   KKEVSELKEVIEGKDYLLRSYKEQKIELSEKVKELQQRLDSQVPNIL  337



>gb|AFK44682.1| unknown [Medicago truncatula]
 gb|KEH17621.1| hypothetical protein MTR_0004s0230 [Medicago truncatula]
Length=345

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 207/353 (59%), Positives = 248/353 (70%), Gaps = 18/353 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +A  +S   +      EGP W++IA GALLSTLS+RLGYKLKQ +D+K         
Sbjct  1     MKMKAQSSSNGSRVHKNGEEGPTWIIIAAGALLSTLSIRLGYKLKQAIDSKPPPPKHENL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFN-----QDDENCYNFL-----SGTRDVMDMKQQCNG  626
             K N K +  +K       S S CFN     QD+ N  N       SGT   M++K+  + 
Sbjct  61    KGNGKSSNIRKP------SPSDCFNGYSQMQDNSNNNNHAFFTCNSGTGGSMELKRAQSE  114

Query  627   QVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDI  806
             Q+L+E    LPLVTVP  EFS+ENG  W+ S DRLELP KP HLSN S+SPCVSESGSDI
Sbjct  115   QMLSEFNGALPLVTVPPAEFSKENGVVWACSPDRLELPSKPFHLSNCSDSPCVSESGSDI  174

Query  807   FSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSE  986
             FSKREVIQKLRQQ+KRRD+MILEMQ+Q+ ELQ+SLNAQL  SSHLQ  L+ ANRDLFDSE
Sbjct  175   FSKREVIQKLRQQLKRRDDMILEMQDQMAELQNSLNAQLGLSSHLQLQLEAANRDLFDSE  234

Query  987   REIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDG  1166
             REIQRLRK IADHCVG V   +   +  + W  + RNG  NGH + + +L + EK + + 
Sbjct  235   REIQRLRKAIADHCVGYVPHDKS--STGTAWSVDTRNGNPNGHLDGDNNLDTHEKTKDEE  292

Query  1167  ERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ERIEML+R+V ELKE I+GKEYLLQSYKEQK+ELS +VKELQQRLDSQLPNIL
Sbjct  293   ERIEMLKRQVGELKEAIEGKEYLLQSYKEQKSELSLKVKELQQRLDSQLPNIL  345



>ref|XP_010241455.1| PREDICTED: uncharacterized protein LOC104586051 [Nelumbo nucifera]
Length=343

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 256/345 (74%), Gaps = 4/345 (1%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK  A+G SRAQKSK  QGEGPNWVL+AGGALLSTLS++LGYKLKQ LD K+ N   N  
Sbjct  1     MKPGAHGISRAQKSKKFQGEGPNWVLVAGGALLSTLSIQLGYKLKQALDTKRLNNASNRL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSG-TRDVMDMKQQCNGQVLTESETE  653
             K N    +++    C   S+ Y F QD+++ +   SG +  +M++K Q     L E    
Sbjct  61    KGNADSVDKRTLGVCTSNSNLYSFPQDEDSFHKCCSGFSSGMMEIKHQSTASTLKEPNLT  120

Query  654   LPLVTVPSLEFSRENGGAW-SSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVT+P LE ++ENG  W SSS + LE+P KP H SN SESPCVSESGSDI +K+EVI 
Sbjct  121   LPLVTIPYLESNKENGVMWASSSPNCLEMPPKPFHHSNSSESPCVSESGSDIITKQEVIN  180

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KL+QQ+KRRDE+ILEMQ+QI  LQ+ LN QL+HS+HLQS L+ AN +LF+SEREIQRLRK
Sbjct  181   KLKQQLKRRDELILEMQDQITALQNVLNGQLTHSAHLQSHLEAANSELFESEREIQRLRK  240

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG++ +CEK   V +   +E ++G+ NG    E +L   +K +G G+RIE+L++
Sbjct  241   AIADHCVGEMGTCEKPMAVGNC--AEEQDGHTNGFIGGENYLAVMDKRKGGGDRIEILKK  298

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EVAELKEVI+GKEYLLQSYKEQK ELS++V+ELQ++L S++P+IL
Sbjct  299   EVAELKEVIEGKEYLLQSYKEQKTELSSKVQELQEKLASRVPSIL  343



>ref|XP_006284069.1| hypothetical protein CARUB_v10005195mg [Capsella rubella]
 gb|EOA16967.1| hypothetical protein CARUB_v10005195mg [Capsella rubella]
Length=338

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/347 (59%), Positives = 258/347 (74%), Gaps = 13/347 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG  + Q+++   GEGPNW+LIAGGALLSTLS+R GYKLKQ LD K Q   G+  
Sbjct  1     MSTRRNGIPKHQRAEKFFGEGPNWILIAGGALLSTLSIRFGYKLKQSLDWKPQ-LNGSAK  59

Query  477   KENNKPAERKKARNCHLQS-SSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              + N  +ER K+ +C L S +S C + +D  C+  + G+ +V + K+  N Q+++ S+T 
Sbjct  60    LKANGTSERPKSSSCCLHSNTSSCGHNNDYCCFRSIPGSENV-EGKEMTNEQMVSASDTS  118

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  FS+ENG  W+SS DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQ
Sbjct  119   LPLVTVPAPSFSKENGVMWASSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQ  178

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+EL++S NAQ++HSSHLQ+ LD  NRDLF+SERE+QRLRK
Sbjct  179   KLRQQLKRRDDMILEMQEQILELENSYNAQMAHSSHLQAQLDTMNRDLFESEREVQRLRK  238

Query  1011  VIADHCVG--QVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
              IADH VG     + +  P  P  W     +G+ NG  ++E + +S EKG  DGER+EML
Sbjct  239   AIADHSVGCGTGSNGKTSPVAP--W-----SGHVNGFMDSESNYESQEKGLRDGERVEML  291

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV ELKEVI+GKEYLL+SYKEQK EL  +VKELQQRLDSQ+PNIL
Sbjct  292   KKEVGELKEVIEGKEYLLRSYKEQKIELLQKVKELQQRLDSQVPNIL  338



>ref|XP_010918058.1| PREDICTED: uncharacterized protein LOC105042509 isoform X3 [Elaeis 
guineensis]
Length=350

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 248/349 (71%), Gaps = 9/349 (3%)
 Frame = +3

Query  300   KSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             K +A G   RAQK K +QG GPNWV+IAGGALLSTLS+R G KLKQ+ + KQ     N +
Sbjct  4     KPKATGAIQRAQKVKHMQGGGPNWVIIAGGALLSTLSIRFGCKLKQIFEIKQSKNF-NNA  62

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETE  653
             KEN K A ++    CHL S  YC  QD++ CY+ LSG  D  +D KQ     +   ++  
Sbjct  63    KENGKFAAKRTPGACHLHSKLYCHTQDEDGCYHCLSGISDGALDTKQPPASPLSNNTDVS  122

Query  654   LPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV +P+ + +++  G  W+SS DRLELPQ+P H SN SESPCVSESGSDI+SKREVIQ
Sbjct  123   LPLVKIPAADSNKDGSGVMWASSPDRLELPQRPFHHSNSSESPCVSESGSDIYSKREVIQ  182

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRDEMI+EMQ QI++LQ+SL+ Q++HS  LQS L+ ANRDLFD+EREIQRLRK
Sbjct  183   KLRQQLKRRDEMIMEMQAQIMDLQNSLSIQMTHSMDLQSQLESANRDLFDAEREIQRLRK  242

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERIE  1178
              IADHCV +  + EK P     W SE  NG  NG+ ++    E      E  R D ER+E
Sbjct  243   AIADHCVSEARTLEK-PVTTRSWRSEAINGQVNGYLDSMGDVEVQCFGGEIVRDDVERVE  301

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+ EV ELKEVI+GK++LLQSYKEQK EL ++++ELQ RL SQ+PNIL
Sbjct  302   MLKMEVGELKEVIEGKDFLLQSYKEQKVELCSKMEELQLRLASQVPNIL  350



>ref|XP_010271020.1| PREDICTED: uncharacterized protein LOC104607162 isoform X2 [Nelumbo 
nucifera]
Length=344

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 248/342 (73%), Gaps = 7/342 (2%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK RA+G SRAQKSK    EGPNWVLIAGGALLSTLS + GYKLKQVLD +Q +   N  
Sbjct  1     MKPRADGISRAQKSKFCH-EGPNWVLIAGGALLSTLSFQFGYKLKQVLDTRQLDNASNGL  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLS--GTRDVM-DMKQQCNGQVLTESE  647
             K   K A ++K+  C   S+ Y F QD+    NF S  G  D M  +K   +G +L E+ 
Sbjct  60    KGTAKSANKRKSGTCTSHSNLYSFAQDEGGGCNFHSAAGFSDGMVGVKCSPSGSILQETN  119

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
               LPLVTVP LE ++ENG  W+SS D LELP KP H SN S+SPC+SESGSDIF+K+EVI
Sbjct  120   PALPLVTVPVLESNKENGVMWASSPDCLELPPKPFHHSNSSDSPCLSESGSDIFTKQEVI  179

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             +KLRQQ+KRRDEMILEMQ+QI  LQ+SL+ QL+ S+HLQS LD ANRDLF+SE+EIQRLR
Sbjct  180   RKLRQQLKRRDEMILEMQDQITSLQNSLSVQLTRSTHLQSQLDSANRDLFESEQEIQRLR  239

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGR-GDGERIEML  1184
             K IADHCV     CEK P   + W +  +NG+ NG       ++  +KG  GDGERIEML
Sbjct  240   KAIADHCVVDTSPCEK-PMAVNNWATR-QNGHINGFIVGVSDVEVLDKGSGGDGERIEML  297

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQ  1310
             ++EV ELKEVI+GKEYLLQSYKEQKAEL + VKELQQRL SQ
Sbjct  298   KKEVVELKEVIEGKEYLLQSYKEQKAELYSTVKELQQRLASQ  339



>ref|XP_010918056.1| PREDICTED: uncharacterized protein LOC105042509 isoform X2 [Elaeis 
guineensis]
Length=368

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 248/349 (71%), Gaps = 9/349 (3%)
 Frame = +3

Query  300   KSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             K +A G   RAQK K +QG GPNWV+IAGGALLSTLS+R G KLKQ+ + KQ     N +
Sbjct  22    KPKATGAIQRAQKVKHMQGGGPNWVIIAGGALLSTLSIRFGCKLKQIFEIKQSKNF-NNA  80

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETE  653
             KEN K A ++    CHL S  YC  QD++ CY+ LSG  D  +D KQ     +   ++  
Sbjct  81    KENGKFAAKRTPGACHLHSKLYCHTQDEDGCYHCLSGISDGALDTKQPPASPLSNNTDVS  140

Query  654   LPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV +P+ + +++  G  W+SS DRLELPQ+P H SN SESPCVSESGSDI+SKREVIQ
Sbjct  141   LPLVKIPAADSNKDGSGVMWASSPDRLELPQRPFHHSNSSESPCVSESGSDIYSKREVIQ  200

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRDEMI+EMQ QI++LQ+SL+ Q++HS  LQS L+ ANRDLFD+EREIQRLRK
Sbjct  201   KLRQQLKRRDEMIMEMQAQIMDLQNSLSIQMTHSMDLQSQLESANRDLFDAEREIQRLRK  260

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERIE  1178
              IADHCV +  + EK P     W SE  NG  NG+ ++    E      E  R D ER+E
Sbjct  261   AIADHCVSEARTLEK-PVTTRSWRSEAINGQVNGYLDSMGDVEVQCFGGEIVRDDVERVE  319

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+ EV ELKEVI+GK++LLQSYKEQK EL ++++ELQ RL SQ+PNIL
Sbjct  320   MLKMEVGELKEVIEGKDFLLQSYKEQKVELCSKMEELQLRLASQVPNIL  368



>ref|XP_010918055.1| PREDICTED: uncharacterized protein LOC105042509 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 248/349 (71%), Gaps = 9/349 (3%)
 Frame = +3

Query  300   KSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             K +A G   RAQK K +QG GPNWV+IAGGALLSTLS+R G KLKQ+ + KQ     N +
Sbjct  25    KPKATGAIQRAQKVKHMQGGGPNWVIIAGGALLSTLSIRFGCKLKQIFEIKQSKNF-NNA  83

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETE  653
             KEN K A ++    CHL S  YC  QD++ CY+ LSG  D  +D KQ     +   ++  
Sbjct  84    KENGKFAAKRTPGACHLHSKLYCHTQDEDGCYHCLSGISDGALDTKQPPASPLSNNTDVS  143

Query  654   LPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV +P+ + +++  G  W+SS DRLELPQ+P H SN SESPCVSESGSDI+SKREVIQ
Sbjct  144   LPLVKIPAADSNKDGSGVMWASSPDRLELPQRPFHHSNSSESPCVSESGSDIYSKREVIQ  203

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRDEMI+EMQ QI++LQ+SL+ Q++HS  LQS L+ ANRDLFD+EREIQRLRK
Sbjct  204   KLRQQLKRRDEMIMEMQAQIMDLQNSLSIQMTHSMDLQSQLESANRDLFDAEREIQRLRK  263

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERIE  1178
              IADHCV +  + EK P     W SE  NG  NG+ ++    E      E  R D ER+E
Sbjct  264   AIADHCVSEARTLEK-PVTTRSWRSEAINGQVNGYLDSMGDVEVQCFGGEIVRDDVERVE  322

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+ EV ELKEVI+GK++LLQSYKEQK EL ++++ELQ RL SQ+PNIL
Sbjct  323   MLKMEVGELKEVIEGKDFLLQSYKEQKVELCSKMEELQLRLASQVPNIL  371



>ref|XP_008802963.1| PREDICTED: uncharacterized protein LOC103716651 isoform X2 [Phoenix 
dactylifera]
Length=342

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 195/350 (56%), Positives = 251/350 (72%), Gaps = 15/350 (4%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK RANGT  +AQK K +QGEGPNWVLIAGGALLSTLS+RLG KLKQ+ + KQ       
Sbjct  1     MKMRANGTIQKAQKLKHVQGEGPNWVLIAGGALLSTLSIRLGCKLKQIFETKQ-------  53

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             SK +N    ++    C L S+ YC+ QD++ CY+ LSG  D  +D+K+     +  E++ 
Sbjct  54    SKNSNNAKAKRSPGACQLHSTLYCYTQDEDGCYHCLSGASDGAVDIKRPPTSPLSKEADV  113

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV VP  + +++  G  W+SS D LELP++P H SN S+SPC+SESGSDI+SKREVI
Sbjct  114   SLPLVKVPEADSNKDGSGVIWASSPDHLELPRRPFHHSNSSDSPCISESGSDIYSKREVI  173

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
              KLR Q+KRRDEMI+EMQ QI++LQ+S++ Q++HS++LQS LD ANRDLFD+EREIQRLR
Sbjct  174   HKLRLQLKRRDEMIMEMQTQIMDLQNSVSIQMTHSANLQSQLDSANRDLFDAEREIQRLR  233

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERI  1175
             K IADHCV +    EK P     W  E   G  NG+ ++    E H    EK R D ER+
Sbjct  234   KAIADHCVAEAGFLEK-PVTTRNWRPEAVIGQVNGYIDSMDDVELHCIGGEKVRDDSERV  292

Query  1176  EMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EML+R+V ELKEVI+GK++LLQSYKEQK EL +++K LQ RL+SQ+PNIL
Sbjct  293   EMLKRKVGELKEVIEGKDFLLQSYKEQKVELCSKIKVLQLRLESQVPNIL  342



>ref|XP_010695809.1| PREDICTED: uncharacterized protein LOC104908387 [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 255/344 (74%), Gaps = 11/344 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MKSR++  +RAQ+ ++ QGEG NWVLI GGALLSTLS+RLG+KLKQ LD+KQQ    N  
Sbjct  1     MKSRSSSDARAQRLRSTQGEGSNWVLIVGGALLSTLSIRLGFKLKQALDSKQQE---NAI  57

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + ++ +  ++  NC   SS + +  D+ +C+N  SG R VM++K   NGQ+LTE E  L
Sbjct  58    LKGSERSVGRRLGNCRSNSSLHSYGLDENSCFNCASGER-VMEVKNPPNGQMLTEPEVSL  116

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             PLVTVP+ E+    G  W SS +R+E P KP H S+ S+SPCVSESGSDIFSKR+VIQKL
Sbjct  117   PLVTVPAPEY----GMVWVSSPERVEPPSKPFHQSSNSDSPCVSESGSDIFSKRDVIQKL  172

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             R Q+KRRD+M+LEMQ+QI ELQ++LN Q+SHS++LQS LD AN++LFDSEREIQRLRK I
Sbjct  173   RYQLKRRDDMVLEMQDQISELQNALNVQMSHSNNLQSQLDSANKELFDSEREIQRLRKAI  232

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKG-RGDGERIEMLRRE  1193
             ADHC+   DS EK+    S   SE  NG+ NG F  +      EK   GD ERIEML++E
Sbjct  233   ADHCLAYGDSNEKLSANTS--PSEHINGHVNGFFNGDGKFGFHEKSVVGDEERIEMLKKE  290

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +  LKE+I+GKEYLL+ +KEQK ELST++KELQQRLDSQLP+IL
Sbjct  291   ITGLKEIIEGKEYLLEGFKEQKVELSTKIKELQQRLDSQLPHIL  334



>ref|XP_010438583.1| PREDICTED: uncharacterized protein LOC104722159 [Camelina sativa]
 ref|XP_010438584.1| PREDICTED: uncharacterized protein LOC104722159 [Camelina sativa]
 ref|XP_010438585.1| PREDICTED: uncharacterized protein LOC104722159 [Camelina sativa]
Length=337

 Score =   345 bits (886),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 258/347 (74%), Gaps = 14/347 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R +G S+ Q++    G+GPNW+LIAGGALLSTLS+R GYKLKQ LD K  +   +  
Sbjct  1     MSTRRSGISKHQRADKFCGQGPNWILIAGGALLSTLSIRFGYKLKQSLDWKPHSNGSSGL  60

Query  477   KENNKPAERKKARNCHLQSSSY-CFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             K N   +ER+K+ +C L S+++ C + +D  C+  + G+ +V + K+  N Q+++ S+T 
Sbjct  61    KANGGASERQKSTSCCLHSNTFSCAHSND--CFRSIPGSENV-EGKEVINEQMVSASDTS  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTV +  FS+ENG  W++S DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQ
Sbjct  118   LPLVTVSAPSFSKENGVMWATSPDRLELPPKPYNHQSTCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ +HSSHLQ  LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQNSYNAQTAHSSHLQEQLDTMNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG--QVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
              IADH VG     + +  P  P  W     +G+ NG  ++E + +S EKG  DGER+EML
Sbjct  238   AIADHSVGCGAGSNGKTSPVAP--W-----SGHVNGFMDSESNYESQEKGSRDGERVEML  290

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV+ELKEVI+GK+YLL+SYKEQK ELS +VKELQQRLDSQ+PNIL
Sbjct  291   KKEVSELKEVIEGKDYLLRSYKEQKIELSQKVKELQQRLDSQVPNIL  337



>ref|XP_010433341.1| PREDICTED: uncharacterized protein LOC104717469 [Camelina sativa]
Length=337

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 259/347 (75%), Gaps = 14/347 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R +G S+ Q++    GEGPNW+LIAGGALLSTLS+R GYKLKQ LD K Q+ + +  
Sbjct  1     MSTRRSGISKHQRADKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDWKPQSNSSSGL  60

Query  477   KENNKPAERKKARNCHLQSSSY-CFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             K N   +ER+K+ +C L S+++ C + +D  C+  + G+ +V + K+  + Q+++ S+T 
Sbjct  61    KANGGASERQKSTSCCLHSNTFSCAHSND--CFRSIPGSENV-EGKEVTDEQMVSASDTS  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  FS+ENG  W++S DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQ
Sbjct  118   LPLVTVPAPSFSKENGVMWATSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ QI+ELQ+S NAQ +HSSHLQ  LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQVQILELQNSYNAQTAHSSHLQEQLDTMNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG--QVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
              IADH VG     + +  P  P  W     +G+ NG  ++E + +S EKG  DGER+EML
Sbjct  238   AIADHSVGCGAGSNGKTSPVAP--W-----SGHVNGFMDSESNYESQEKGSRDGERVEML  290

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EV+ELKEVI+GK+YLL+SYKEQK EL+ ++KELQQRLDSQ+P IL
Sbjct  291   KKEVSELKEVIEGKDYLLRSYKEQKMELTQKIKELQQRLDSQVPIIL  337



>ref|XP_006413056.1| hypothetical protein EUTSA_v10025690mg [Eutrema salsugineum]
 gb|ESQ54509.1| hypothetical protein EUTSA_v10025690mg [Eutrema salsugineum]
Length=328

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/344 (57%), Positives = 250/344 (73%), Gaps = 17/344 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG SR Q+ +  +GEGPNW+LIAGGALLSTLS+R GYKLKQ++D+K  ++ G + 
Sbjct  1     MSTRRNGISRHQRVENFRGEGPNWILIAGGALLSTLSIRFGYKLKQLIDSKP-HSNGTSG  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              ++N  ++R ++R C L S++    ++ + C++   GT +V +     N Q++  S   L
Sbjct  60    LKSNGTSDRGRSRGCCLHSNASSCERNHDCCFHCTPGTENV-EGNHAANEQMVVPS-NPL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQK  833
             PLV V +  FS+ENG  W+SS D LE+  +P  H S  S+SPCVSESGSD+FSKREVIQK
Sbjct  118   PLVKVTTPSFSKENGTMWASSPDHLEVHTRPYQHQSTCSDSPCVSESGSDMFSKREVIQK  177

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+M+LEMQEQI ELQSS +AQ++H SHLQ+ LD  NRDLF+SERE+QRLRK 
Sbjct  178   LRQQLKRRDDMVLEMQEQISELQSSHSAQMAHCSHLQTQLDATNRDLFESEREVQRLRKA  237

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG               GS G +G ANG  E+E + +S  KG  DGERIEMLR+E
Sbjct  238   IADHCVGHA-------------GSNGWSGDANGFMESESNYESPVKGSRDGERIEMLRKE  284

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGKEYLL+SYKEQK ELS ++KELQQRLD QLPNIL
Sbjct  285   VGELKEVIDGKEYLLRSYKEQKIELSEKMKELQQRLDLQLPNIL  328



>ref|XP_010433334.1| PREDICTED: uncharacterized protein LOC104717467 [Camelina sativa]
 ref|XP_010433335.1| PREDICTED: uncharacterized protein LOC104717467 [Camelina sativa]
 ref|XP_010433336.1| PREDICTED: uncharacterized protein LOC104717467 [Camelina sativa]
 ref|XP_010433337.1| PREDICTED: uncharacterized protein LOC104717467 [Camelina sativa]
 ref|XP_010433338.1| PREDICTED: uncharacterized protein LOC104717467 [Camelina sativa]
Length=327

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 245/345 (71%), Gaps = 20/345 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K   N TG  
Sbjct  1     MTTRRNGISRNQRVESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPHLNATGGL  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   ++R ++R C L S++    +++  C++   GT +          + +  S T 
Sbjct  61    -KPNGTTSDRGRSRGCCLHSNTSPCERNNHCCFHSTPGTEN--GESNHATNEQMVASSTT  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  +S+ENG  W SS D  E+P KP  H S  S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVTVPTPTYSKENGVMWGSSPDLREVPMKPCNHQSTCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQSSLN+Q  HSSH+Q+ LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQSSLNSQTGHSSHVQTQLDATNRDLFESEREVQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG                + G +G  NG  ++E   +S EKG  DGERIEMLR+
Sbjct  238   AIADHCVGS---------------NNGWSGDVNGFMDSENSYESPEKGSKDGERIEMLRK  282

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GK+YLL SYKEQK EL+ ++KELQQR+DSQLPNIL
Sbjct  283   EVGELKEVIEGKDYLLSSYKEQKMELTQKIKELQQRVDSQLPNIL  327



>ref|XP_010438580.1| PREDICTED: uncharacterized protein LOC104722158 isoform X1 [Camelina 
sativa]
Length=327

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 248/345 (72%), Gaps = 20/345 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K   N TG  
Sbjct  1     MTTRRNGISRIQRGESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPHLNATGGL  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   ++R ++R C L S++    + ++ C++   GT +  D     N Q+   S T 
Sbjct  61    -KPNGTTSDRGRSRGCCLHSNASPCERSNDCCFHSTPGTEN-GDGNHATNEQMAVSSTT-  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  +S+ENG  W SS D  E+P KP H  S  S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVTVPTPTYSKENGVMWGSSPDLREVPMKPYHHQSTCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLN+Q  HSSH+Q+ LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQNSLNSQTGHSSHVQTQLDATNRDLFESEREVQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG                + G +G  NG  ++E   +S EKG  DGERIEML++
Sbjct  238   AIADHCVGS---------------NNGWSGDVNGFMDSENSYESPEKGSKDGERIEMLKK  282

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GK+YL++SYKEQK EL+ ++KELQQRLDSQLPN+L
Sbjct  283   EVGELKEVIEGKDYLIRSYKEQKIELTQKIKELQQRLDSQLPNML  327



>ref|XP_006413057.1| hypothetical protein EUTSA_v10025651mg [Eutrema salsugineum]
 gb|ESQ54510.1| hypothetical protein EUTSA_v10025651mg [Eutrema salsugineum]
Length=338

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 254/349 (73%), Gaps = 18/349 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M  R N  ++ Q+++   G+GPNW+LIAGGALLSTLS+R GYKLKQ LD K Q + G+  
Sbjct  1     MSPRRNSITKHQRAEKFCGQGPNWILIAGGALLSTLSIRFGYKLKQSLDLKPQ-SNGSAG  59

Query  477   KENNKPAERKKARNC--HLQSSSYCFNQDDENCYNF--LSGTRDVMDMKQQCNGQVLTES  644
              + N  +ER+K+  C  H  +SS   N D   C +F  + GT +V + K+    Q+++  
Sbjct  60    LKANGTSERQKSVGCCLHFNTSSCAHNSD---CCSFRSIPGTENV-EGKEVIGQQMVSAP  115

Query  645   ETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKRE  821
             +T LPLVTV    +S+ENG  W+SS DRLELP KP  H S  S+SPCVSE+ SDIFSKRE
Sbjct  116   DTSLPLVTVTVPSYSKENGVMWTSSPDRLELPPKPYNHQSTCSDSPCVSETSSDIFSKRE  175

Query  822   VIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQR  1001
             VIQKLRQQ+KRRD+MI+EMQEQI+ELQ+S NAQ+SHSSHLQ+ LD  NRDLF+SERE+QR
Sbjct  176   VIQKLRQQLKRRDDMIVEMQEQILELQNSYNAQISHSSHLQAQLDAMNRDLFESEREVQR  235

Query  1002  LRKVIADHCVGQVDSCEKI-PTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIE  1178
             LRK IADH VG   S  K  P  P  W     +G+ NG  ++E   +S EKG  DGER+E
Sbjct  236   LRKAIADHSVGCAGSNGKTSPVAP--W-----SGHVNGFIDSESTYESPEKGVKDGERVE  288

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             MLR+EV+ELKEVIDGKEYLL+SYKEQK ELS ++KELQQRLDSQLPNIL
Sbjct  289   MLRKEVSELKEVIDGKEYLLRSYKEQKIELSQKIKELQQRLDSQLPNIL  337



>ref|XP_010448103.1| PREDICTED: uncharacterized protein LOC104730608 isoform X1 [Camelina 
sativa]
Length=327

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 249/345 (72%), Gaps = 20/345 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K   N TG  
Sbjct  1     MTTRRNGISRNQRVESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPHLNATGGL  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   ++R ++R C L S++    + ++ C++   GT +  D     N Q++  S T 
Sbjct  61    -KPNGTTSDRGRSRGCCLHSNASPCERSNDCCFHSTPGTEN-GDSNHATNEQMVASSTT-  117

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  +S+E+G  W SS D  ++P KP H  S  S+SPCVSESGSDIFSKREVIQ
Sbjct  118   LPLVTVPTPTYSKESGVMWGSSPDLRDVPMKPYHHQSTCSDSPCVSESGSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLN+Q  HSSH+Q+ LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMILEMQEQILELQNSLNSQTGHSSHVQTQLDATNRDLFESEREVQRLRK  237

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG                + G +G  NG  ++E   +S EKG  DGERIEML++
Sbjct  238   AIADHCVGS---------------NNGWSGDVNGFMDSENSYESPEKGSKDGERIEMLKK  282

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GK+YLL+SYKEQK EL+ ++KELQQRLDSQLPNIL
Sbjct  283   EVGELKEVIEGKDYLLRSYKEQKMELTQKIKELQQRLDSQLPNIL  327



>ref|XP_010438581.1| PREDICTED: uncharacterized protein LOC104722158 isoform X2 [Camelina 
sativa]
Length=323

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 247/345 (72%), Gaps = 24/345 (7%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K   N T N 
Sbjct  1     MTTRRNGISRIQRGESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPHLNATANG  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             +      ++R ++R C L S++    + ++ C++   GT +  D     N Q+   S T 
Sbjct  61    TT-----SDRGRSRGCCLHSNASPCERSNDCCFHSTPGTEN-GDGNHATNEQMAVSSTT-  113

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  +S+ENG  W SS D  E+P KP H  S  S+SPCVSESGSDIFSKREVIQ
Sbjct  114   LPLVTVPTPTYSKENGVMWGSSPDLREVPMKPYHHQSTCSDSPCVSESGSDIFSKREVIQ  173

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLN+Q  HSSH+Q+ LD  NRDLF+SERE+QRLRK
Sbjct  174   KLRQQLKRRDDMILEMQEQILELQNSLNSQTGHSSHVQTQLDATNRDLFESEREVQRLRK  233

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG                + G +G  NG  ++E   +S EKG  DGERIEML++
Sbjct  234   AIADHCVGS---------------NNGWSGDVNGFMDSENSYESPEKGSKDGERIEMLKK  278

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GK+YL++SYKEQK EL+ ++KELQQRLDSQLPN+L
Sbjct  279   EVGELKEVIEGKDYLIRSYKEQKIELTQKIKELQQRLDSQLPNML  323



>ref|XP_010448104.1| PREDICTED: uncharacterized protein LOC104730608 isoform X2 [Camelina 
sativa]
Length=323

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 248/345 (72%), Gaps = 24/345 (7%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K   N T N 
Sbjct  1     MTTRRNGISRNQRVESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPHLNATANG  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             +      ++R ++R C L S++    + ++ C++   GT +  D     N Q++  S T 
Sbjct  61    TT-----SDRGRSRGCCLHSNASPCERSNDCCFHSTPGTEN-GDSNHATNEQMVASSTT-  113

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+  +S+E+G  W SS D  ++P KP H  S  S+SPCVSESGSDIFSKREVIQ
Sbjct  114   LPLVTVPTPTYSKESGVMWGSSPDLRDVPMKPYHHQSTCSDSPCVSESGSDIFSKREVIQ  173

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLN+Q  HSSH+Q+ LD  NRDLF+SERE+QRLRK
Sbjct  174   KLRQQLKRRDDMILEMQEQILELQNSLNSQTGHSSHVQTQLDATNRDLFESEREVQRLRK  233

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVG                + G +G  NG  ++E   +S EKG  DGERIEML++
Sbjct  234   AIADHCVG---------------SNNGWSGDVNGFMDSENSYESPEKGSKDGERIEMLKK  278

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GK+YLL+SYKEQK EL+ ++KELQQRLDSQLPNIL
Sbjct  279   EVGELKEVIEGKDYLLRSYKEQKMELTQKIKELQQRLDSQLPNIL  323



>ref|XP_006284093.1| hypothetical protein CARUB_v10005230mg [Capsella rubella]
 gb|EOA16991.1| hypothetical protein CARUB_v10005230mg [Capsella rubella]
Length=327

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 249/345 (72%), Gaps = 20/345 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K  +  G   
Sbjct  1     MTTRRNGISRNQRVESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSVDSKPHSNGG---  57

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + +  ++R ++  C L S++   +++++ C++  SGT +  D     N  +   S T L
Sbjct  58    LKPSGTSDRGRSLGCCLHSNASPCDRNNDFCFHSTSGTEN-GDGNHATNEHIAVSSTT-L  115

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQK  833
             PLVTVPS  +S+ENG  W S+ D LE+P KP H  S  S+SPCVSESGSDIFSKREVIQK
Sbjct  116   PLVTVPSPTYSKENGVMWGSTPDHLEVPMKPYHHQSTCSDSPCVSESGSDIFSKREVIQK  175

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MI+EMQEQI+ELQ+SLNAQ+  SSHLQ+ LD  NRDLF+SERE+QRLRK 
Sbjct  176   LRQQLKRRDDMIVEMQEQILELQNSLNAQMGDSSHLQTQLDTTNRDLFESEREVQRLRKA  235

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSS-EKGRGDGERIEMLRR  1190
             IADHCVGQ              GS G +G  NG   +E   +S  EKG  DGERIEML++
Sbjct  236   IADHCVGQA-------------GSNGWSGDVNGFMGSENSYESPPEKGSKDGERIEMLKK  282

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVI+GKEYLL+SYKEQK EL  +VKELQQRLDSQLP+IL
Sbjct  283   EVGELKEVIEGKEYLLRSYKEQKIELLQKVKELQQRLDSQLPSIL  327



>ref|XP_010553820.1| PREDICTED: uncharacterized protein LOC104823796 isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 250/346 (72%), Gaps = 11/346 (3%)
 Frame = +3

Query  294   KMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             KM +R NG SR Q+ + ++GEGPNW+LIAGGALLSTLS+R GYKLK+ LD+KQQ NTTG 
Sbjct  6     KMSTRRNGVSRCQRVENIRGEGPNWILIAGGALLSTLSIRFGYKLKRSLDSKQQANTTGG  65

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
                + N  ++R+ +R C   +   C  Q+D++C + + GT    + K     Q+ + S +
Sbjct  66    L--KVNGASDRRSSRCCLHSNVPSCV-QNDDHCLHCIPGTESA-EGKHAPKEQMGSASNS  121

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVI  827
              LPLVTV + EF++E+G  W SS DRLELP KP  H S  S+SPCVSE GSDIF KREVI
Sbjct  122   PLPLVTVHTPEFNKESGIMWVSSPDRLELPPKPFNHHSTCSDSPCVSECGSDIFIKREVI  181

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+QI+ELQ+SL+AQ++HSSHLQ  L+  NRDLF SERE+QRLR
Sbjct  182   QKLRQQLKRRDDMILEMQDQILELQNSLSAQMAHSSHLQGQLEATNRDLFGSEREVQRLR  241

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
             K   D CVG   S  K   V + WG    NG+ +G    E + +S EKG  DGERI+MLR
Sbjct  242   KAFTDQCVGYTGSNGKASPVAA-WGGH-TNGFMDG---GESNSESPEKGLADGERIDMLR  296

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             REV ELKEVI+GKEYLL SYKEQK EL  +VKELQQRLD QLPNIL
Sbjct  297   REVGELKEVIEGKEYLLHSYKEQKGELLLKVKELQQRLDLQLPNIL  342



>ref|XP_010553821.1| PREDICTED: uncharacterized protein LOC104823796 isoform X3 [Tarenaya 
hassleriana]
Length=342

 Score =   336 bits (862),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 250/346 (72%), Gaps = 11/346 (3%)
 Frame = +3

Query  294   KMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             KM +R NG SR Q+ + ++GEGPNW+LIAGGALLSTLS+R GYKLK+ LD+KQQ NTTG 
Sbjct  6     KMSTRRNGVSRCQRVENIRGEGPNWILIAGGALLSTLSIRFGYKLKRSLDSKQQANTTGC  65

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
              +   N  ++R+ +R C   +   C  Q+D++C + + GT    + K     Q+ + S +
Sbjct  66    YAV--NGASDRRSSRCCLHSNVPSCV-QNDDHCLHCIPGTESA-EGKHAPKEQMGSASNS  121

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVI  827
              LPLVTV + EF++E+G  W SS DRLELP KP  H S  S+SPCVSE GSDIF KREVI
Sbjct  122   PLPLVTVHTPEFNKESGIMWVSSPDRLELPPKPFNHHSTCSDSPCVSECGSDIFIKREVI  181

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+QI+ELQ+SL+AQ++HSSHLQ  L+  NRDLF SERE+QRLR
Sbjct  182   QKLRQQLKRRDDMILEMQDQILELQNSLSAQMAHSSHLQGQLEATNRDLFGSEREVQRLR  241

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
             K   D CVG   S  K   V + WG    NG+ +G    E + +S EKG  DGERI+MLR
Sbjct  242   KAFTDQCVGYTGSNGKASPVAA-WGGH-TNGFMDG---GESNSESPEKGLADGERIDMLR  296

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             REV ELKEVI+GKEYLL SYKEQK EL  +VKELQQRLD QLPNIL
Sbjct  297   REVGELKEVIEGKEYLLHSYKEQKGELLLKVKELQQRLDLQLPNIL  342



>ref|NP_567781.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974627.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD94753.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF74723.1| At4g27620 [Arabidopsis thaliana]
 gb|AEE85368.1| uncharacterized protein AT4G27620 [Arabidopsis thaliana]
 gb|AEE85369.1| uncharacterized protein AT4G27620 [Arabidopsis thaliana]
Length=325

 Score =   335 bits (859),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 243/344 (71%), Gaps = 20/344 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K  ++     
Sbjct  1     MTTRRNGVSRHQRFESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPPHSNATGG  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + N   +R + + C L S++    ++++ C++   GT +          + + ES T L
Sbjct  61    LKPNGTTDRGRFKGCCLHSNASPCERNNDCCFHCTPGTEN--GEGNHATNEQMAESSTSL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLH-LSNGSESPCVSESGSDIFSKREVIQK  833
             PLVTVP+  +S+E+   W SS D LE+P K  H  S  S+SPCVSESGSDIFSKREVIQK
Sbjct  119   PLVTVPASSYSKESAVVWGSSPDHLEVPMKAYHQHSTCSDSPCVSESGSDIFSKREVIQK  178

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MI+EMQEQI+ELQ+SLNAQ+ HSSH+Q+ LD  NRDLF+SERE+QRLRK 
Sbjct  179   LRQQLKRRDDMIVEMQEQILELQNSLNAQMGHSSHIQTQLDATNRDLFESEREVQRLRKA  238

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG                  G NG++ G   +E + +S E G  DGERIEMLR+E
Sbjct  239   IADHCVGHT----------------GSNGWS-GDVNSENNYESPENGIRDGERIEMLRKE  281

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  282   VGELKEVIDGKEYLLRSYKEQKTELLQKVKELQQRLDSQLPNIL  325



>dbj|BAF01610.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score =   335 bits (859),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 254/347 (73%), Gaps = 17/347 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG S+ Q+     GEGPNW+LIAGGALLSTLS+R GYKLKQ LD+K Q + G+  
Sbjct  1     MSTRRNGISKHQRGDKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDSKPQ-SNGSAG  59

Query  477   KENNKPAERKKARNCHLQSS-SYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              + N  +ER+K+ +C L S+ S C   +D  C+  + GT  V + K+  + Q+++ S+T 
Sbjct  60    LKPNGTSERQKSTSCCLHSTTSSCTQNNDFCCFRSIPGTESV-EGKEVTSEQMISASDTS  118

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+   S+ENG  W++S DRLELP +P  H SN S+SPCVSE+ SDIFSKREVIQ
Sbjct  119   LPLVTVPAPS-SKENGVVWATSPDRLELPPRPYNHNSNCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MI EMQEQI+ELQ+S NAQ +HSSHLQ+ LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMIQEMQEQILELQNSYNAQTAHSSHLQAQLDTLNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG-QVDSCEKIPTVPSLWGSEGRNGYANGHF-EAERHLKSSEKGRGDGERIEML  1184
              IADH VG   DS  K   V          G  NG F ++E + +S EK   DGER+EML
Sbjct  238   AIADHSVGCGADSNGKTSPV----------GPWNGGFMDSESNYESQEKSLRDGERVEML  287

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EV+ELKEVIDGKEYLL+SYKEQK ELS +VKELQQRLDSQL N+L
Sbjct  288   RKEVSELKEVIDGKEYLLRSYKEQKIELSQKVKELQQRLDSQLQNLL  334



>ref|NP_194491.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_849458.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001078453.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22647.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42429.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85365.1| uncharacterized protein AT4G27610 [Arabidopsis thaliana]
 gb|AEE85366.1| uncharacterized protein AT4G27610 [Arabidopsis thaliana]
 gb|AEE85367.1| uncharacterized protein AT4G27610 [Arabidopsis thaliana]
Length=334

 Score =   335 bits (859),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 254/347 (73%), Gaps = 17/347 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG S+ Q+     GEGPNW+LIAGGALLSTLS+R GYKLKQ LD+K Q + G+  
Sbjct  1     MSTRRNGISKHQRGDKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDSKPQ-SNGSAG  59

Query  477   KENNKPAERKKARNCHLQSS-SYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              + N  +ER+K+ +C L S+ S C   +D  C+  + GT  V + K+  + Q+++ S+T 
Sbjct  60    LKPNGTSERQKSTSCCLHSTTSSCTQNNDFCCFRSIPGTESV-EGKEVTSEQMISASDTS  118

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLVTVP+   S+ENG  W++S DRLELP +P  H SN S+SPCVSE+ SDIFSKREVIQ
Sbjct  119   LPLVTVPAPS-SKENGVMWATSPDRLELPPRPYNHNSNCSDSPCVSETSSDIFSKREVIQ  177

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MI EMQEQI+ELQ+S NAQ +HSSHLQ+ LD  NRDLF+SERE+QRLRK
Sbjct  178   KLRQQLKRRDDMIQEMQEQILELQNSYNAQTAHSSHLQAQLDTLNRDLFESEREVQRLRK  237

Query  1011  VIADHCVG-QVDSCEKIPTVPSLWGSEGRNGYANGHF-EAERHLKSSEKGRGDGERIEML  1184
              IADH VG   DS  K   V          G  NG F ++E + +S EK   DGER+EML
Sbjct  238   AIADHSVGCGADSNGKTSPV----------GPWNGGFMDSESNYESQEKSLRDGERVEML  287

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EV+ELKEVIDGKEYLL+SYKEQK ELS +VKELQQRLDSQL N+L
Sbjct  288   RKEVSELKEVIDGKEYLLRSYKEQKIELSQKVKELQQRLDSQLQNLL  334



>ref|XP_007029711.1| Intracellular protein transport protein USO1 isoform 5 [Theobroma 
cacao]
 gb|EOY10213.1| Intracellular protein transport protein USO1 isoform 5 [Theobroma 
cacao]
Length=283

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 218/268 (81%), Gaps = 2/268 (1%)
 Frame = +3

Query  540   YCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSS  719
             + F Q+D+ C+N +SGT  + + K   NG +L ESE  LPLVTVP+ EF+++NG  W+SS
Sbjct  2     FSFTQEDDGCFNCISGTESIGE-KHPPNGLMLPESEVALPLVTVPTSEFNKDNGVMWASS  60

Query  720   VDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVEl  899
              DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QI+EL
Sbjct  61    PDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIMEL  120

Query  900   qsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLW  1079
             Q+SLNAQ++HSSHLQ+ LD +NRDLFDSEREIQRLRK IADHCVG V   EK  TV + W
Sbjct  121   QNSLNAQVAHSSHLQAQLDASNRDLFDSEREIQRLRKAIADHCVGHVSMNEKTTTV-TAW  179

Query  1080  GSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQK  1259
               + RNG+ANG+ + E +  S EKGRGDGERIEML+REV ELKEVI+GKEYLLQSYKEQK
Sbjct  180   PPDIRNGHANGYLDGESNSGSPEKGRGDGERIEMLKREVGELKEVIEGKEYLLQSYKEQK  239

Query  1260  AELSTQVKELQQRLDSQLPNIL*AEFKK  1343
              ELS ++KELQQRLDSQLPNIL  +  K
Sbjct  240   TELSMKIKELQQRLDSQLPNILQMQLSK  267



>gb|AAM61004.1| unknown [Arabidopsis thaliana]
Length=325

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 243/344 (71%), Gaps = 20/344 (6%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K  ++     
Sbjct  1     MTTRRNGVSRHQRFESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPPHSNATGG  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + N   +R + + C L S++    ++++ C++   GT +          + + ES T L
Sbjct  61    LKPNGTTDRGRFKGCCLHSNASPCERNNDCCFHCTPGTEN--GEGNHATNEQMAESSTSL  118

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLH-LSNGSESPCVSESGSDIFSKREVIQK  833
             PLVTVP+  +S+E+   W SS D LE+P K  H  S  S++PCVSESGSDIFSKREVIQK
Sbjct  119   PLVTVPASSYSKESAVVWGSSPDHLEVPMKAYHQHSTCSDTPCVSESGSDIFSKREVIQK  178

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MI+EMQEQI+ELQ+SLNAQ+ HSSH+Q+ LD  NRDLF+SERE+QRLRK 
Sbjct  179   LRQQLKRRDDMIVEMQEQILELQNSLNAQMGHSSHIQTQLDATNRDLFESEREVQRLRKA  238

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG                  G NG++ G   +E + +S E G  DGERIEMLR+E
Sbjct  239   IADHCVGHT----------------GSNGWS-GDVNSENNYESPENGIRDGERIEMLRKE  281

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  282   VGELKEVIDGKEYLLRSYKEQKTELLQKVKELQQRLDSQLPNIL  325



>ref|XP_010553819.1| PREDICTED: uncharacterized protein LOC104823796 isoform X1 [Tarenaya 
hassleriana]
Length=346

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 249/348 (72%), Gaps = 11/348 (3%)
 Frame = +3

Query  294   KMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             KM +R NG SR Q+ + ++GEGPNW+LIAGGALLSTLS+R GYKLK+ LD+KQQ NTTG 
Sbjct  6     KMSTRRNGVSRCQRVENIRGEGPNWILIAGGALLSTLSIRFGYKLKRSLDSKQQANTTGG  65

Query  471   T--SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTES  644
                    N  ++R+ +R C   +   C  Q+D++C + + GT    + K     Q+ + S
Sbjct  66    LKGCYAVNGASDRRSSRCCLHSNVPSCV-QNDDHCLHCIPGTESA-EGKHAPKEQMGSAS  123

Query  645   ETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKRE  821
              + LPLVTV + EF++E+G  W SS DRLELP KP  H S  S+SPCVSE GSDIF KRE
Sbjct  124   NSPLPLVTVHTPEFNKESGIMWVSSPDRLELPPKPFNHHSTCSDSPCVSECGSDIFIKRE  183

Query  822   VIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQR  1001
             VIQKLRQQ+KRRD+MILEMQ+QI+ELQ+SL+AQ++HSSHLQ  L+  NRDLF SERE+QR
Sbjct  184   VIQKLRQQLKRRDDMILEMQDQILELQNSLSAQMAHSSHLQGQLEATNRDLFGSEREVQR  243

Query  1002  LRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEM  1181
             LRK   D CVG   S  K   V + WG    NG+ +G    E + +S EKG  DGERI+M
Sbjct  244   LRKAFTDQCVGYTGSNGKASPVAA-WGGH-TNGFMDG---GESNSESPEKGLADGERIDM  298

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LRREV ELKEVI+GKEYLL SYKEQK EL  +VKELQQRLD QLPNIL
Sbjct  299   LRREVGELKEVIEGKEYLLHSYKEQKGELLLKVKELQQRLDLQLPNIL  346



>ref|XP_007029710.1| Intracellular protein transport protein USO1 isoform 4 [Theobroma 
cacao]
 gb|EOY10212.1| Intracellular protein transport protein USO1 isoform 4 [Theobroma 
cacao]
Length=268

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 215/262 (82%), Gaps = 2/262 (1%)
 Frame = +3

Query  540   YCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSS  719
             + F Q+D+ C+N +SGT  + + K   NG +L ESE  LPLVTVP+ EF+++NG  W+SS
Sbjct  2     FSFTQEDDGCFNCISGTESIGE-KHPPNGLMLPESEVALPLVTVPTSEFNKDNGVMWASS  60

Query  720   VDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVEl  899
              DRLELP KP H SN S+SPCVSESGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QI+EL
Sbjct  61    PDRLELPPKPFHHSNCSDSPCVSESGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIMEL  120

Query  900   qsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLW  1079
             Q+SLNAQ++HSSHLQ+ LD +NRDLFDSEREIQRLRK IADHCVG V   EK  TV + W
Sbjct  121   QNSLNAQVAHSSHLQAQLDASNRDLFDSEREIQRLRKAIADHCVGHVSMNEKTTTV-TAW  179

Query  1080  GSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQK  1259
               + RNG+ANG+ + E +  S EKGRGDGERIEML+REV ELKEVI+GKEYLLQSYKEQK
Sbjct  180   PPDIRNGHANGYLDGESNSGSPEKGRGDGERIEMLKREVGELKEVIEGKEYLLQSYKEQK  239

Query  1260  AELSTQVKELQQRLDSQLPNIL  1325
              ELS ++KELQQRLDSQLPNI 
Sbjct  240   TELSMKIKELQQRLDSQLPNIF  261



>ref|XP_010271022.1| PREDICTED: uncharacterized protein LOC104607162 isoform X4 [Nelumbo 
nucifera]
Length=313

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 237/344 (69%), Gaps = 32/344 (9%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK RA+G SRAQKSK    EGPNWVLIAGGALLSTLS + GYKLKQVLD +Q +   N  
Sbjct  1     MKPRADGISRAQKSKFCH-EGPNWVLIAGGALLSTLSFQFGYKLKQVLDTRQLDNASNGL  59

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K   K A ++K+  C   S+ Y F QD+    NF S                        
Sbjct  60    KGTAKSANKRKSGTCTSHSNLYSFAQDEGGGCNFHS------------------------  95

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
                 VP LE ++ENG  W+SS D LELP KP H SN S+SPC+SESGSDIF+K+EVI+KL
Sbjct  96    ----VPVLESNKENGVMWASSPDCLELPPKPFHHSNSSDSPCLSESGSDIFTKQEVIRKL  151

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQQ+KRRDEMILEMQ+QI  LQ+SL+ QL+ S+HLQS LD ANRDLF+SE+EIQRLRK I
Sbjct  152   RQQLKRRDEMILEMQDQITSLQNSLSVQLTRSTHLQSQLDSANRDLFESEQEIQRLRKAI  211

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGR-GDGERIEMLRRE  1193
             ADHCV     CEK P   + W +  +NG+ NG       ++  +KG  GDGERIEML++E
Sbjct  212   ADHCVVDTSPCEK-PMAVNNWATR-QNGHINGFIVGVSDVEVLDKGSGGDGERIEMLKKE  269

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVI+GKEYLLQSYKEQKAEL + VKELQQRL SQ+PNIL
Sbjct  270   VVELKEVIEGKEYLLQSYKEQKAELYSTVKELQQRLASQVPNIL  313



>ref|XP_010553822.1| PREDICTED: uncharacterized protein LOC104823796 isoform X4 [Tarenaya 
hassleriana]
Length=338

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 249/346 (72%), Gaps = 15/346 (4%)
 Frame = +3

Query  294   KMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             KM +R NG SR Q+ + ++GEGPNW+LIAGGALLSTLS+R GYKLK+ LD+KQQ NTT N
Sbjct  6     KMSTRRNGVSRCQRVENIRGEGPNWILIAGGALLSTLSIRFGYKLKRSLDSKQQANTTVN  65

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
              +      ++R+ +R C   +   C  Q+D++C + + GT    + K     Q+ + S +
Sbjct  66    GA------SDRRSSRCCLHSNVPSCV-QNDDHCLHCIPGTESA-EGKHAPKEQMGSASNS  117

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVI  827
              LPLVTV + EF++E+G  W SS DRLELP KP  H S  S+SPCVSE GSDIF KREVI
Sbjct  118   PLPLVTVHTPEFNKESGIMWVSSPDRLELPPKPFNHHSTCSDSPCVSECGSDIFIKREVI  177

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MILEMQ+QI+ELQ+SL+AQ++HSSHLQ  L+  NRDLF SERE+QRLR
Sbjct  178   QKLRQQLKRRDDMILEMQDQILELQNSLSAQMAHSSHLQGQLEATNRDLFGSEREVQRLR  237

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
             K   D CVG   S  K   V + WG    NG+ +G    E + +S EKG  DGERI+MLR
Sbjct  238   KAFTDQCVGYTGSNGKASPVAA-WGGH-TNGFMDG---GESNSESPEKGLADGERIDMLR  292

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             REV ELKEVI+GKEYLL SYKEQK EL  +VKELQQRLD QLPNIL
Sbjct  293   REVGELKEVIEGKEYLLHSYKEQKGELLLKVKELQQRLDLQLPNIL  338



>ref|XP_009361115.1| PREDICTED: uncharacterized protein LOC103951471 isoform X4 [Pyrus 
x bretschneideri]
Length=287

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 224/281 (80%), Gaps = 3/281 (1%)
 Frame = +3

Query  489   KPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLV  665
             K ++ +K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+LTES+  LPLV
Sbjct  8     KSSDPRKSAGCRVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLPNDQMLTESDGALPLV  67

Query  666   TVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQKLRQ  842
              VP+ EF++ENG  W+SS D LELP KP LH SN S+SPCVSESGSDIFSKREVIQKLRQ
Sbjct  68    MVPAPEFNKENGCVWASSPDHLELPPKPFLHYSNCSDSPCVSESGSDIFSKREVIQKLRQ  127

Query  843   QVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIAD  1022
             Q+KRRD+MILEMQ+QI ELQSSLNAQL+HS++LQS LD ANRD FDSEREIQRLRK IAD
Sbjct  128   QLKRRDDMILEMQDQIQELQSSLNAQLAHSTNLQSQLDSANRDFFDSEREIQRLRKAIAD  187

Query  1023  HCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAE  1202
             HCVG V   ++ P V ++W  E RNG+ NG  + E +  ++E+GRGDGERIEML+REV E
Sbjct  188   HCVGHVSPIDRSPQV-TIWQPEERNGHVNGFPDGESNFDATERGRGDGERIEMLKREVGE  246

Query  1203  LKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQL NIL
Sbjct  247   LKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLLNIL  287



>ref|XP_010550952.1| PREDICTED: uncharacterized protein LOC104821693 isoform X1 [Tarenaya 
hassleriana]
Length=327

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 246/348 (71%), Gaps = 26/348 (7%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M  R +   R Q+ +  +GEGPNW+LIAGGALLSTLS+R GYKLKQ LD+KQQ N TG  
Sbjct  1     MSRRRDEAFRRQRVENFRGEGPNWILIAGGALLSTLSIRFGYKLKQSLDSKQQANATGGL  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCY-NFLSGTRDVMDMKQQCNGQVLTESET  650
               + N   +R+ +  C   + S C   DD  CY + + GT      K +   Q+ + S +
Sbjct  61    --KVNGTCDRRSSCCCLHANVSSCSQNDD--CYLHCIPGTESAHG-KHEPKEQMASASIS  115

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP---LHLSNGSESPCVSESGSDIFSKRE  821
              LPLVTVP+ EFS+ENG  W+SS +RLE P KP    H S  S+SP VSESGSDIFSKRE
Sbjct  116   PLPLVTVPAQEFSKENGVMWASSPNRLEQPPKPSNHHHHSTCSDSPSVSESGSDIFSKRE  175

Query  822   VIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQR  1001
             VIQKLRQQ+KRRD+MIL+MQ+QI+ELQ+SLNAQ++HSSHLQ+ LD  NRDLFDSERE+QR
Sbjct  176   VIQKLRQQLKRRDDMILDMQDQILELQNSLNAQMAHSSHLQAQLDATNRDLFDSERELQR  235

Query  1002  LRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEM  1181
             LRKVIADHC G  +            G    NG+ +G F  E    S EKG GD ER+EM
Sbjct  236   LRKVIADHCTGHTN------------GFGHTNGFMDGEFNHE----SPEKGLGDRERVEM  279

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LRREV +LKEVI+GKEYLL SYKEQKAELS ++KELQQRLDSQLPNIL
Sbjct  280   LRREVGDLKEVIEGKEYLLNSYKEQKAELSLKIKELQQRLDSQLPNIL  327



>ref|XP_006647428.1| PREDICTED: uncharacterized protein LOC102708588 [Oryza brachyantha]
Length=339

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 249/351 (71%), Gaps = 20/351 (6%)
 Frame = +3

Query  297   MKSRAN-GTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ N    +A+K+  +QG GPNWVL+AGG LLSTLSV+LG KLKQ+ DAKQ+N+  NT
Sbjct  1     MKSKTNRSIQKARKTDNVQGGGPNWVLVAGGVLLSTLSVKLGCKLKQLFDAKQRNS--NT  58

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
             SK   +P        C L SS Y F+ D  +CY+  SG  + + +KQ          E  
Sbjct  59    SKGQRRPG------TCELHSSLYRFS-DHMSCYHCNSG--NGVGVKQTPASPASKPIEPS  109

Query  654   LPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV +P  E S+EN G  W SS DRLE P+KP   SN S SPCVSESGSDI+SKREVIQ
Sbjct  110   LPLVKIPGPESSKENNGVMWISSPDRLEDPRKPFQYSNSSGSPCVSESGSDIYSKREVIQ  169

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQ +K+RDEMI+EMQ QI +L++SLN Q +HS++LQS LD ANRDLF+SEREIQ LRK
Sbjct  170   KLRQHLKKRDEMIMEMQSQIADLKNSLNIQETHSTNLQSQLDAANRDLFESEREIQHLRK  229

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA------ERHLKSSEKGRGDGER  1172
             +IADHCV +  S +K P +   W S G NG+ANG+ ++      E H    EK +G+ ER
Sbjct  230   IIADHCVAEALSHDK-PLLAGRWQSGGTNGHANGYADSSSIDDPELHFIGLEKRKGEVER  288

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI+GK++LLQSYKEQK ELS+++KELQ++  +Q+PNIL
Sbjct  289   VEMLKREVGELKEVIEGKDFLLQSYKEQKVELSSKIKELQEKFSTQVPNIL  339



>ref|XP_009348927.1| PREDICTED: uncharacterized protein LOC103940522 isoform X4 [Pyrus 
x bretschneideri]
Length=287

 Score =   326 bits (836),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 226/287 (79%), Gaps = 3/287 (1%)
 Frame = +3

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
             T + + K ++R+K+  C + S+ Y FNQ +D  C+N +SGT  +M+MK   N Q+L ES+
Sbjct  2     TERGSGKSSDRRKSAGCCVHSNVYSFNQQNDGGCFNCMSGTEGMMEMKCLPNDQMLAESD  61

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREV  824
               LPLVTVP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKREV
Sbjct  62    GALPLVTVPAPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFSKREV  121

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD ANRD FDSEREIQRL
Sbjct  122   IQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANRDFFDSEREIQRL  181

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             RK IADHCVG      +   V ++W  E RNG  NG  + E +  ++E+GRGD ER+E L
Sbjct  182   RKAIADHCVGHASPNHRSSHV-TIWQPEERNGDVNGFPDGESNFNATERGRGDEERVENL  240

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  241   NREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  287



>ref|XP_009396209.1| PREDICTED: uncharacterized protein LOC103981270 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=425

 Score =   330 bits (847),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 209/398 (53%), Positives = 266/398 (67%), Gaps = 22/398 (6%)
 Frame = +3

Query  183   WSSRAYWLVQFDVVCCFSSVRLCS*SA-------TILFNTLAT-HKMKSRANGTS---RA  329
             W +  Y  V     CC   +R    +A       + LFN  ++ H+ K  +  T+   R 
Sbjct  33    WLALPYRKVPHTHNCCGREIRSIVAAADSAPTRSSKLFNHFSSSHRFKMTSKTTASIQRV  92

Query  330   QKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKK  509
             QK   ++ EGPNWVLIAG ALLSTL+V LG KLK+    ++Q+T     KE  K A +K 
Sbjct  93    QKLNHVRQEGPNWVLIAGSALLSTLTVSLGCKLKKAFQIRRQDTA---HKEYRKSASKKS  149

Query  510   ARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETELPLVTVPSLEF  686
             +  C L SS Y FNQD+E C   LSGT +  +D+KQ  N  V  E++  L LV +P+ E 
Sbjct  150   SGACQLHSSLYHFNQDEEVCCYCLSGTSEGRVDVKQPKNP-VAHEADVSLTLVEIPAAEQ  208

Query  687   SRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDE  863
             +++ G   W SS DRLE+P+KPLH SN S SPC+SESGSDI+SKREVIQKLRQQ+KRRDE
Sbjct  209   NKDVGSVMWISSPDRLEMPRKPLHHSNSSGSPCISESGSDIYSKREVIQKLRQQLKRRDE  268

Query  864   MILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVD  1043
             MI+EMQ QI +LQ+SLN QLS S+HLQ+ LD   RDLF+SEREIQ+LRKVIADHCV +V 
Sbjct  269   MIMEMQAQITDLQNSLNIQLSQSAHLQAQLDCTGRDLFNSEREIQQLRKVIADHCVAEVV  328

Query  1044  SCEKIPTVPSLWGSEGRNGYANGHFE----AERHLKSSEKGRGDGERIEMLRREVAELKE  1211
             S EK P     W  E  NG+ NG+ +     E +   +EK + + ERIEML+REV ELKE
Sbjct  329   SPEK-PIEARQWHHEATNGFMNGYPDNVDGMEVNCVGAEKAKAERERIEMLKREVQELKE  387

Query  1212  VIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             VIDGK++LLQSYKEQK EL +++KELQ +L SQ+PNIL
Sbjct  388   VIDGKDFLLQSYKEQKTELCSKIKELQLKLASQVPNIL  425



>ref|XP_008382280.1| PREDICTED: uncharacterized protein LOC103445070 isoform X4 [Malus 
domestica]
Length=287

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 185/281 (66%), Positives = 223/281 (79%), Gaps = 3/281 (1%)
 Frame = +3

Query  489   KPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLV  665
             K ++R+K+  C + S+ Y F Q +D  C+N +SGT  +M+MK   N Q+L ES+  LPLV
Sbjct  8     KSSDRRKSAGCCVHSNVYSFTQQNDGGCFNCMSGTEGMMEMKCLHNDQMLAESDGALPLV  67

Query  666   TVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQKLRQ  842
             TVP+ EF+RENG  W+SS DRLEL  KP LH SN S+SPCVSESGSDIFSKREVIQKLRQ
Sbjct  68    TVPAPEFNRENGIVWASSPDRLELRPKPFLHYSNCSDSPCVSESGSDIFSKREVIQKLRQ  127

Query  843   QVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIAD  1022
             Q+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD AN D FDSEREIQRLRK IAD
Sbjct  128   QLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDSANGDFFDSEREIQRLRKAIAD  187

Query  1023  HCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAE  1202
             HCVG     ++   V ++W  E RNGY NG  + E +  ++E+GRGD ER+EML REV E
Sbjct  188   HCVGHASPNDRSSHV-TIWQPEERNGYVNGFPDGESNFDATERGRGDEERVEMLNREVGE  246

Query  1203  LKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPNIL
Sbjct  247   LKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPNIL  287



>ref|XP_009396208.1| PREDICTED: uncharacterized protein LOC103981270 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=429

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 266/399 (67%), Gaps = 20/399 (5%)
 Frame = +3

Query  183   WSSRAYWLVQFDVVCCFSSVRLCS*SA-------TILFNTLAT-HKMKSRANGTS---RA  329
             W +  Y  V     CC   +R    +A       + LFN  ++ H+ K  +  T+   R 
Sbjct  33    WLALPYRKVPHTHNCCGREIRSIVAAADSAPTRSSKLFNHFSSSHRFKMTSKTTASIQRV  92

Query  330   QKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTG-NTSKENNKPAERK  506
             QK   ++ EGPNWVLIAG ALLSTL+V LG KLK+    ++Q+T   +   E  K A +K
Sbjct  93    QKLNHVRQEGPNWVLIAGSALLSTLTVSLGCKLKKAFQIRRQDTAHKDVHTEYRKSASKK  152

Query  507   KARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETELPLVTVPSLE  683
              +  C L SS Y FNQD+E C   LSGT +  +D+KQ  N  V  E++  L LV +P+ E
Sbjct  153   SSGACQLHSSLYHFNQDEEVCCYCLSGTSEGRVDVKQPKNP-VAHEADVSLTLVEIPAAE  211

Query  684   FSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRD  860
              +++ G   W SS DRLE+P+KPLH SN S SPC+SESGSDI+SKREVIQKLRQQ+KRRD
Sbjct  212   QNKDVGSVMWISSPDRLEMPRKPLHHSNSSGSPCISESGSDIYSKREVIQKLRQQLKRRD  271

Query  861   EMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQV  1040
             EMI+EMQ QI +LQ+SLN QLS S+HLQ+ LD   RDLF+SEREIQ+LRKVIADHCV +V
Sbjct  272   EMIMEMQAQITDLQNSLNIQLSQSAHLQAQLDCTGRDLFNSEREIQQLRKVIADHCVAEV  331

Query  1041  DSCEKIPTVPSLWGSEGRNGYANGHFE----AERHLKSSEKGRGDGERIEMLRREVAELK  1208
              S EK P     W  E  NG+ NG+ +     E +   +EK + + ERIEML+REV ELK
Sbjct  332   VSPEK-PIEARQWHHEATNGFMNGYPDNVDGMEVNCVGAEKAKAERERIEMLKREVQELK  390

Query  1209  EVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EVIDGK++LLQSYKEQK EL +++KELQ +L SQ+PNIL
Sbjct  391   EVIDGKDFLLQSYKEQKTELCSKIKELQLKLASQVPNIL  429



>ref|XP_009396211.1| PREDICTED: uncharacterized protein LOC103981270 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 262/390 (67%), Gaps = 17/390 (4%)
 Frame = +3

Query  183   WSSRAYWLVQFDVVCCFSSVRLCS*SATILFNTLATHKMKSRANGTS---RAQKSKALQG  353
             W +  Y  V     CC   +R    +A    +   +H+ K  +  T+   R QK   ++ 
Sbjct  33    WLALPYRKVPHTHNCCGREIRSIVAAAD---SAPTSHRFKMTSKTTASIQRVQKLNHVRQ  89

Query  354   EGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCHLQS  533
             EGPNWVLIAG ALLSTL+V LG KLK+    ++Q+T     KE  K A +K +  C L S
Sbjct  90    EGPNWVLIAGSALLSTLTVSLGCKLKKAFQIRRQDTA---HKEYRKSASKKSSGACQLHS  146

Query  534   SSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGA-  707
             S Y FNQD+E C   LSGT +  +D+KQ  N  V  E++  L LV +P+ E +++ G   
Sbjct  147   SLYHFNQDEEVCCYCLSGTSEGRVDVKQPKNP-VAHEADVSLTLVEIPAAEQNKDVGSVM  205

Query  708   WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQ  887
             W SS DRLE+P+KPLH SN S SPC+SESGSDI+SKREVIQKLRQQ+KRRDEMI+EMQ Q
Sbjct  206   WISSPDRLEMPRKPLHHSNSSGSPCISESGSDIYSKREVIQKLRQQLKRRDEMIMEMQAQ  265

Query  888   IVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTV  1067
             I +LQ+SLN QLS S+HLQ+ LD   RDLF+SEREIQ+LRKVIADHCV +V S EK P  
Sbjct  266   ITDLQNSLNIQLSQSAHLQAQLDCTGRDLFNSEREIQQLRKVIADHCVAEVVSPEK-PIE  324

Query  1068  PSLWGSEGRNGYANGHFE----AERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYL  1235
                W  E  NG+ NG+ +     E +   +EK + + ERIEML+REV ELKEVIDGK++L
Sbjct  325   ARQWHHEATNGFMNGYPDNVDGMEVNCVGAEKAKAERERIEMLKREVQELKEVIDGKDFL  384

Query  1236  LQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LQSYKEQK EL +++KELQ +L SQ+PNIL
Sbjct  385   LQSYKEQKTELCSKIKELQLKLASQVPNIL  414



>ref|XP_007219246.1| hypothetical protein PRUPE_ppa018012mg, partial [Prunus persica]
 gb|EMJ20445.1| hypothetical protein PRUPE_ppa018012mg, partial [Prunus persica]
Length=285

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 182/294 (62%), Positives = 219/294 (74%), Gaps = 11/294 (4%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             MK +     RAQKSK  QG+GPNW+LIAGGALLSTLS+RLGYKLKQ LD K Q       
Sbjct  1     MKPKTTAVPRAQKSKPFQGDGPNWLLIAGGALLSTLSIRLGYKLKQALDTKHQ-------  53

Query  477   KENNKPAERKKARNCHLQSSSYCFNQ-DDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              EN +  +    R C + S+ Y F Q  D +C+N +SGT  +M+MK   +GQ+L+ES+  
Sbjct  54    -ENARSGKSSDRRKCRVHSNVYSFTQQSDGSCFNCMSGTEAMMEMKCLPDGQMLSESDGA  112

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREVIQ  830
             LPLV VP+ EF++ENG  W+SS DRLELP KP LH SN S+SPCVSESGSDIFSKR+VIQ
Sbjct  113   LPLVKVPTPEFNKENGIVWASSPDRLELPPKPFLHYSNCSDSPCVSESGSDIFSKRDVIQ  172

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQ+QIVELQ+SLNAQL+HS+HLQS LD ANRD FDSEREIQRLRK
Sbjct  173   KLRQQLKRRDDMILEMQDQIVELQNSLNAQLAHSTHLQSQLDSANRDFFDSEREIQRLRK  232

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGER  1172
              IADHCVG      K   V ++W  E  NG+ANG+ + E +  ++EKGRGDGER
Sbjct  233   AIADHCVGHASPNGKSSPV-TIWQPEATNGHANGYLDGESNFDATEKGRGDGER  285



>emb|CDX89232.1| BnaA01g16610D [Brassica napus]
Length=333

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 252/347 (73%), Gaps = 19/347 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQ-VLDAKQQNTTGN  470
             M +  NG S+ Q+++ + G+G PNW+LIAGGALLSTLS+R GYKLKQ  L     ++  +
Sbjct  1     MSTPRNGFSKHQRAEKVCGQGGPNWILIAGGALLSTLSIRFGYKLKQSPLFKPPHHSNAS  60

Query  471   TSKENNKPAERKKARNC-HLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
                + N  +ER++   C H  ++S C   +D +C+  + GT +V + K++ N Q+++ S+
Sbjct  61    PGFKANGTSERQRCCCCLHSSNTSSCAKNNDYSCFRSVPGTENV-EGKEETNEQMVSVSD  119

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREV  824
               LPLVTVP+  +S+ENG  W+SS DRLELP +P  H S  S+SPCVSE+ SDIFSKREV
Sbjct  120   NSLPLVTVPAPSYSKENGVMWTSSPDRLELPPRPYNHHSTCSDSPCVSETSSDIFSKREV  179

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ+SHSSHLQ+ LD  NRDLF+SERE++RL
Sbjct  180   IQKLRQQLKRRDDMILEMQEQILELQNSYNAQMSHSSHLQAQLDSMNRDLFESEREVERL  239

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             RK IADH V    +    P  P  W         NG  E+E + +S+EKG  +GERIE L
Sbjct  240   RKAIADHSVSNGKTS---PVAP--W---------NGFMESENNYESAEKGTREGERIERL  285

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EV+ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  286   RKEVSELKEVIDGKEYLLRSYKEQKIELQEKVKELQQRLDSQLPNIL  332



>ref|XP_002867491.1| hypothetical protein ARALYDRAFT_913772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43750.1| hypothetical protein ARALYDRAFT_913772 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score =   324 bits (831),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 238/344 (69%), Gaps = 28/344 (8%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG S         GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K  ++     
Sbjct  1     MTTRRNGLS--------SGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPPHSNATAG  52

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
              + N  ++R ++  C L S+     ++++ C++   GT +  +     N Q    S T L
Sbjct  53    FKPNGTSDRGRSLGCCLHSNVSPCERNNDCCFHCTPGTEN-GEGNHATNEQTAVSS-TSL  110

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL-SNGSESPCVSESGSDIFSKREVIQK  833
             P+VTVP+  +S+EN G W+SS D LE+P K  H  S  S+SPCVSESGSDIFSKREVIQK
Sbjct  111   PIVTVPASSYSKENAGMWASSPDHLEVPMKAYHHHSTCSDSPCVSESGSDIFSKREVIQK  170

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MI+EMQEQI+ELQ+SLNAQ+ HSS +Q+ LD  NRDLF+SERE+QRLRK 
Sbjct  171   LRQQLKRRDDMIVEMQEQILELQNSLNAQMGHSSQVQTQLDATNRDLFESEREVQRLRKA  230

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVG                  G NG++ G   +E + +S E G  DGERIEMLR+E
Sbjct  231   IADHCVGHT----------------GSNGWS-GDVNSENNYESPENGIRDGERIEMLRKE  273

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  274   VGELKEVIDGKEYLLRSYKEQKTELLQKVKELQQRLDSQLPNIL  317



>ref|XP_009143618.1| PREDICTED: uncharacterized protein LOC103867315 [Brassica rapa]
 ref|XP_009143627.1| PREDICTED: uncharacterized protein LOC103867315 [Brassica rapa]
Length=333

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 250/347 (72%), Gaps = 19/347 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAK-QQNTTGN  470
             M +  NG S+ Q+++ + G+G PNW+LIAGGALLSTLS+R GYKLKQ    K    +  +
Sbjct  1     MSTPRNGFSKHQRAEKVCGQGGPNWILIAGGALLSTLSIRFGYKLKQSPHFKPSHQSNAS  60

Query  471   TSKENNKPAERKKARNC-HLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
                + N  +ER++   C H  ++S C   +D +C+  + GT +V + K + N Q+++ S+
Sbjct  61    PGFKANGTSERQRCCCCLHSSNTSSCAKNNDYSCFRSVPGTENV-EGKAETNEQMVSVSD  119

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREV  824
               LPLVTVP+  +S+ENG  W+SS DRLELP +P  H S  S+SPCVSE+ SDIFSKREV
Sbjct  120   NSLPLVTVPAPSYSKENGVMWTSSPDRLELPPRPYNHHSTCSDSPCVSETSSDIFSKREV  179

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ+SHSSHLQ+ LD  NRDLF+SERE++RL
Sbjct  180   IQKLRQQLKRRDDMILEMQEQILELQNSYNAQMSHSSHLQAQLDSMNRDLFESEREVERL  239

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             RK IADH V    +    P  P  W         NG  E+E + +S+EKG  +GERIE L
Sbjct  240   RKAIADHSVSNGKTS---PVAP--W---------NGFMESENNYESAEKGTREGERIERL  285

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EV+ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  286   RKEVSELKEVIDGKEYLLRSYKEQKIELQEKVKELQQRLDSQLPNIL  332



>ref|XP_009396210.1| PREDICTED: uncharacterized protein LOC103981270 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=418

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 262/391 (67%), Gaps = 15/391 (4%)
 Frame = +3

Query  183   WSSRAYWLVQFDVVCCFSSVRLCS*SATILFNTLATHKMKSRANGTS---RAQKSKALQG  353
             W +  Y  V     CC   +R    +A    +   +H+ K  +  T+   R QK   ++ 
Sbjct  33    WLALPYRKVPHTHNCCGREIRSIVAAAD---SAPTSHRFKMTSKTTASIQRVQKLNHVRQ  89

Query  354   EGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTG-NTSKENNKPAERKKARNCHLQ  530
             EGPNWVLIAG ALLSTL+V LG KLK+    ++Q+T   +   E  K A +K +  C L 
Sbjct  90    EGPNWVLIAGSALLSTLTVSLGCKLKKAFQIRRQDTAHKDVHTEYRKSASKKSSGACQLH  149

Query  531   SSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGA  707
             SS Y FNQD+E C   LSGT +  +D+KQ  N  V  E++  L LV +P+ E +++ G  
Sbjct  150   SSLYHFNQDEEVCCYCLSGTSEGRVDVKQPKNP-VAHEADVSLTLVEIPAAEQNKDVGSV  208

Query  708   -WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQE  884
              W SS DRLE+P+KPLH SN S SPC+SESGSDI+SKREVIQKLRQQ+KRRDEMI+EMQ 
Sbjct  209   MWISSPDRLEMPRKPLHHSNSSGSPCISESGSDIYSKREVIQKLRQQLKRRDEMIMEMQA  268

Query  885   QIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPT  1064
             QI +LQ+SLN QLS S+HLQ+ LD   RDLF+SEREIQ+LRKVIADHCV +V S EK P 
Sbjct  269   QITDLQNSLNIQLSQSAHLQAQLDCTGRDLFNSEREIQQLRKVIADHCVAEVVSPEK-PI  327

Query  1065  VPSLWGSEGRNGYANGHFE----AERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEY  1232
                 W  E  NG+ NG+ +     E +   +EK + + ERIEML+REV ELKEVIDGK++
Sbjct  328   EARQWHHEATNGFMNGYPDNVDGMEVNCVGAEKAKAERERIEMLKREVQELKEVIDGKDF  387

Query  1233  LLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             LLQSYKEQK EL +++KELQ +L SQ+PNIL
Sbjct  388   LLQSYKEQKTELCSKIKELQLKLASQVPNIL  418



>emb|CDY19047.1| BnaC01g20210D [Brassica napus]
Length=317

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 238/344 (69%), Gaps = 28/344 (8%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             M +R NG SR Q+    +GEG PNW+LIAGGALLSTLS+R GYKL Q +D+K        
Sbjct  1     MSTRRNGISRHQRVDNSRGEGGPNWILIAGGALLSTLSIRFGYKLTQFVDSKPHPDATAG  60

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
              K N   ++R K+R C L S S    ++ + C++   GT +V        G+ +      
Sbjct  61    LKPNGT-SDRGKSRGCCLHSGSSSCERNKDCCFHTSPGTENV-------EGEQMVAPSDS  112

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             LPLVTVP+  + +ENG  W+  +          H S  S+SPCVSESGSDIFSKREVIQK
Sbjct  113   LPLVTVPAPSYIKENGVGWADHMKSYN------HQSTCSDSPCVSESGSDIFSKREVIQK  166

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQEQI+ELQ+SLN+Q+SHSSHLQ+ LD  NRDL++SERE+QRLRK 
Sbjct  167   LRQQLKRRDDMILEMQEQIIELQNSLNSQMSHSSHLQAQLDATNRDLYESEREVQRLRKA  226

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRRE  1193
             IADHCVGQ              GS G NG ANG  ++E + +S EKG  DGER++MLR+E
Sbjct  227   IADHCVGQA-------------GSNGWNGEANGFMDSESNYESPEKGSKDGERVDMLRKE  273

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             V ELKEVIDGKEYLL+SYKEQK ELS +V+ELQ+RLDSQLPNIL
Sbjct  274   VGELKEVIDGKEYLLRSYKEQKIELSEKVRELQKRLDSQLPNIL  317



>ref|XP_009143663.1| PREDICTED: uncharacterized protein LOC103867353 [Brassica rapa]
 ref|XP_009143670.1| PREDICTED: uncharacterized protein LOC103867353 [Brassica rapa]
 ref|XP_009143677.1| PREDICTED: uncharacterized protein LOC103867353 [Brassica rapa]
 ref|XP_009143685.1| PREDICTED: uncharacterized protein LOC103867353 [Brassica rapa]
Length=319

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 242/345 (70%), Gaps = 28/345 (8%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             M +R NG SR Q+ +  +GEG PNW+LIAGGALLSTLS+R GYKLKQ +D+K   + TG 
Sbjct  1     MSTRRNGISRHQRVENSRGEGGPNWILIAGGALLSTLSIRFGYKLKQSVDSKPHPDATGG  60

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
                   KP        C L S S    ++ + C++   GT +V +     N Q++  S++
Sbjct  61    L-----KPNGTSDRGRCCLHSGSSSCERNKDCCFHTTPGTENV-ERDHAINEQMVAPSDS  114

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
              LPLVTVP+  + +ENG  W+  +          H S  S+SPCVSESGSDIFSKREVIQ
Sbjct  115   -LPLVTVPAPSYIKENGVGWAEHMKSYN------HQSTCSDSPCVSESGSDIFSKREVIQ  167

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLNAQ+SHSSHLQ+ LD  NRDL++SERE+QRLRK
Sbjct  168   KLRQQLKRRDDMILEMQEQIIELQNSLNAQMSHSSHLQAQLDATNRDLYESEREVQRLRK  227

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVGQ              GS G NG ANG  ++E + +S +KG  DGER+EMLR+
Sbjct  228   AIADHCVGQA-------------GSNGWNGGANGFMDSESNYESPQKGSKDGERVEMLRK  274

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVIDGKEYLL+SYKEQK ELS +V+ELQQRLDSQ+PNIL
Sbjct  275   EVGELKEVIDGKEYLLRSYKEQKIELSEKVRELQQRLDSQVPNIL  319



>emb|CDY52991.1| BnaAnng11850D [Brassica napus]
Length=319

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 242/345 (70%), Gaps = 28/345 (8%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGN  470
             M +R NG SR Q+ +  +GEG PNW+LIAGGALLSTLS+R GYKLKQ +D+K   + TG 
Sbjct  1     MSTRRNGISRHQRVENSRGEGGPNWILIAGGALLSTLSIRFGYKLKQSVDSKPHPDATGG  60

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
                   KP        C L S S    ++ + C++   GT +V +     N Q++  S++
Sbjct  61    L-----KPNGTSDRGRCCLHSGSSSCERNKDCCFHTTPGTENV-ERDHAINEQMVAPSDS  114

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQ  830
              LPLVTVP+  + +ENG  W+  +          H S  S+SPCVSESGSDIFSKREVIQ
Sbjct  115   -LPLVTVPAPSYIKENGVGWAEHMKSYN------HQSTCSDSPCVSESGSDIFSKREVIQ  167

Query  831   KLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRK  1010
             KLRQQ+KRRD+MILEMQEQI+ELQ+SLNAQ+SHSSHLQ+ LD  NRDL++SERE+QRLRK
Sbjct  168   KLRQQLKRRDDMILEMQEQIIELQNSLNAQMSHSSHLQAQLDATNRDLYESEREVQRLRK  227

Query  1011  VIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRR  1190
              IADHCVGQ              GS G NG ANG  ++E + +S +KG  DGER+EMLR+
Sbjct  228   AIADHCVGQA-------------GSNGWNGEANGFMDSESNYESPQKGSKDGERVEMLRK  274

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELKEVIDGKEYLL+SYKEQK ELS +V+ELQQRLDSQ+PNIL
Sbjct  275   EVGELKEVIDGKEYLLRSYKEQKIELSEKVRELQQRLDSQVPNIL  319



>dbj|BAD29314.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG91171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73490.1| hypothetical protein OsI_07822 [Oryza sativa Indica Group]
 gb|EEE57262.1| hypothetical protein OsJ_07283 [Oryza sativa Japonica Group]
Length=341

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 250/352 (71%), Gaps = 20/352 (6%)
 Frame = +3

Query  297   MKSRAN-GTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ N    +A+K+  +QG GPNWVL+AGG LLSTLSV+LG KLKQ+ DAKQ+N+  NT
Sbjct  1     MKSKTNRSIQKARKTDNVQG-GPNWVLVAGGVLLSTLSVKLGCKLKQLFDAKQRNS--NT  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSG-TRDVMDMKQQCNGQVLTESET  650
             SK   +P        C L S+ Y F+ D  +CY+  SG + + + +KQ        + E 
Sbjct  58    SKAQRRPG------TCELHSNLYRFS-DHLSCYHCNSGFSGNGVGVKQAPASPASKQMEP  110

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P  E S+EN G  W SS DRLE P+KP   SN S SPCVSESGSDI+SK+EVI
Sbjct  111   SLPLVKIPGPESSKENNGVMWISSPDRLEDPRKPFQYSNSSGSPCVSESGSDIYSKKEVI  170

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQ +K+RDEMI+EMQ QI +L++SLN Q +HS++LQS LD ANRDLF+SEREIQ LR
Sbjct  171   QKLRQHLKKRDEMIMEMQAQIADLKNSLNIQETHSTNLQSQLDSANRDLFESEREIQHLR  230

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA------ERHLKSSEKGRGDGE  1169
             K+IADHCV +  S +K P +   W S   NG+ANG+ ++      E H    +K +G+ E
Sbjct  231   KIIADHCVAEALSHDK-PLLAGHWQSGATNGHANGYADSSSVDDPELHFIGLDKRKGEAE  289

Query  1170  RIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EML+REV ELKEVI+GK++LLQSYKEQK ELS++++ELQ++  SQ+PNIL
Sbjct  290   RVEMLKREVGELKEVIEGKDFLLQSYKEQKVELSSKIRELQEKFSSQVPNIL  341



>emb|CDY19049.1| BnaC01g20190D [Brassica napus]
Length=332

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 250/347 (72%), Gaps = 19/347 (5%)
 Frame = +3

Query  297   MKSRANGTSRAQ-KSKALQGEG-PNWVLIAGGALLSTLSVRLGYKLKQVLDAKQ-QNTTG  467
             M +  NG S+ Q +++ + G+G PNW+LIAGGALLSTLS+R GYKLKQ    K    +  
Sbjct  1     MSTPRNGFSKHQQRAEKVCGQGGPNWILIAGGALLSTLSIRFGYKLKQSPHFKPPHQSNA  60

Query  468   NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
             +   + N  +ER++    H  ++S C   +D +C+  + GT +V + K++ N Q+ + S+
Sbjct  61    SPGFKANGTSERQRCCCLHSSTTSSCAKNNDYSCFRSIPGTENV-EGKEETNEQMESVSD  119

Query  648   TELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREV  824
             T LPLVTVP+  +S+ENG  W+SS DRLELP +P  H S  S+SPCVSE+ SDIFSKREV
Sbjct  120   TSLPLVTVPAPSYSKENGVMWTSSPDRLELPPRPYNHHSTCSDSPCVSETSSDIFSKREV  179

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MILEMQEQI+ELQ+S NAQ+SHSSHLQ+ LD  NRDLF+SERE++RL
Sbjct  180   IQKLRQQLKRRDDMILEMQEQILELQNSYNAQMSHSSHLQAQLDSMNRDLFESEREVERL  239

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             RK IADH V    +    P  P  W         NG  ++E + +S+EKG  +GERIE L
Sbjct  240   RKAIADHSVSNGKTS---PVAP--W---------NGFMDSENNYESAEKGSREGERIERL  285

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EV+ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRL+SQLPNIL
Sbjct  286   RKEVSELKEVIDGKEYLLRSYKEQKIELQQKVKELQQRLNSQLPNIL  332



>ref|XP_002454071.1| hypothetical protein SORBIDRAFT_04g024180 [Sorghum bicolor]
 gb|EES07047.1| hypothetical protein SORBIDRAFT_04g024180 [Sorghum bicolor]
Length=341

 Score =   318 bits (814),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 240/334 (72%), Gaps = 18/334 (5%)
 Frame = +3

Query  345   LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCH  524
             +QGEGPNWVL+AGG LLSTLSV++G KLKQ+ D KQQN   NTSK       ++++  C 
Sbjct  19    VQGEGPNWVLVAGGVLLSTLSVKIGCKLKQLFDGKQQN---NTSKA------KRRSEACE  69

Query  525   LQSSSYCFNQDDENCYNFLSG-TRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENG  701
             L S  Y F  D   CY  +SG +   +++KQ     V    E+ LPLV +P+ E S+EN 
Sbjct  70    LHSDLYRFG-DQTGCYYCMSGLSNGGVEVKQAPASPVPKSVESSLPLVKIPTPESSKENS  128

Query  702   GA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEM  878
             G  W SS DRLE P++P   SN S SPCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EM
Sbjct  129   GVMWISSPDRLEDPRRPFQYSNSSGSPCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEM  188

Query  879   QEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKI  1058
             Q QI +L++SLN Q++ S++LQS LD ANRDLF+SEREIQ LRK+IADHCV +  S EK 
Sbjct  189   QTQIADLKNSLNIQVTQSTNLQSQLDAANRDLFESEREIQHLRKIIADHCVAEALSHEK-  247

Query  1059  PTVPSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDG  1223
             P     W S+  NG++NG+      +A+ H    EK +G+ ER+EML++EV ELKEVI+G
Sbjct  248   PLQAGHWHSDAANGHSNGYADGSVDDADLHCVGIEKRKGEVERVEMLKKEVVELKEVIEG  307

Query  1224  KEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             K+++LQSYKEQK EL ++++ELQ++L +Q+PNIL
Sbjct  308   KDFVLQSYKEQKVELCSKIRELQEKLSAQVPNIL  341



>ref|XP_009137673.1| PREDICTED: uncharacterized protein LOC103861705 [Brassica rapa]
 ref|XP_009137674.1| PREDICTED: uncharacterized protein LOC103861705 [Brassica rapa]
 emb|CDY29848.1| BnaA03g48690D [Brassica napus]
Length=329

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 246/343 (72%), Gaps = 21/343 (6%)
 Frame = +3

Query  306   RANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKEN  485
             R NG S+A K       GPNW+LIAGGALLST S+R  ++L+        +++     + 
Sbjct  5     RNNGFSKADKVC-----GPNWILIAGGALLSTFSIRFAWRLRHSSHPLSNSSSLGF--QA  57

Query  486   NKPAERKKARNCHLQSS-SYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPL  662
             N  +ER+K+  C L SS S C + D+  C++  SGT + ++ K++ N Q+++ S+T LPL
Sbjct  58    NGTSEREKSLGCCLHSSKSSCAHNDEYCCFHSNSGT-EHLEGKEEPNEQMVSASDTSLPL  116

Query  663   VTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQKLR  839
             VT+P+  +S+E+G  W+SS DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQKLR
Sbjct  117   VTLPAPLYSKEDGVMWTSSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQKLR  176

Query  840   QQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIA  1019
             QQ+KRRD+MILEMQEQI+ELQ+S NAQ +HSSHLQ+ +D  NRDLF+SERE++RLRK IA
Sbjct  177   QQLKRRDDMILEMQEQILELQNSYNAQRAHSSHLQAQVDSMNRDLFESEREVERLRKAIA  236

Query  1020  DHCVGQVDSCEKI-PTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREV  1196
             DH VG   S  K  P  P          ++NG  E+E + +S EKG  DGERIEMLR+EV
Sbjct  237   DHSVGCTGSNGKTSPVAP----------WSNGFMESENNYESVEKGSRDGERIEMLRKEV  286

Query  1197  AELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
              ELKEVIDGKEYLL++YKEQK ELS +VKELQQRLDSQ PNIL
Sbjct  287   EELKEVIDGKEYLLRNYKEQKIELSQKVKELQQRLDSQFPNIL  329



>ref|XP_010550959.1| PREDICTED: uncharacterized protein LOC104821693 isoform X2 [Tarenaya 
hassleriana]
Length=294

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 231/347 (67%), Gaps = 57/347 (16%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQ-NTTGNT  473
             M  R +   R Q+ +  +GEGPNW+LIAGGALLSTLS+R GYKLKQ LD+KQQ N TG  
Sbjct  1     MSRRRDEAFRRQRVENFRGEGPNWILIAGGALLSTLSIRFGYKLKQSLDSKQQANATGG-  59

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETE  653
                                                L GT      K +   Q+ + S + 
Sbjct  60    -----------------------------------LKGTESAHG-KHEPKEQMASASISP  83

Query  654   LPLVTVPSLEFSRENGGAWSSSVDRLELPQKP---LHLSNGSESPCVSESGSDIFSKREV  824
             LPLVTVP+ EFS+ENG  W+SS +RLE P KP    H S  S+SP VSESGSDIFSKREV
Sbjct  84    LPLVTVPAQEFSKENGVMWASSPNRLEQPPKPSNHHHHSTCSDSPSVSESGSDIFSKREV  143

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRD+MIL+MQ+QI+ELQ+SLNAQ++HSSHLQ+ LD  NRDLFDSERE+QRL
Sbjct  144   IQKLRQQLKRRDDMILDMQDQILELQNSLNAQMAHSSHLQAQLDATNRDLFDSERELQRL  203

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             RKVIADHC G  +                  G+ NG  + E + +S EKG GD ER+EML
Sbjct  204   RKVIADHCTGHTNGF----------------GHTNGFMDGEFNHESPEKGLGDRERVEML  247

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             RREV +LKEVI+GKEYLL SYKEQKAELS ++KELQQRLDSQLPNIL
Sbjct  248   RREVGDLKEVIEGKEYLLNSYKEQKAELSLKIKELQQRLDSQLPNIL  294



>emb|CAB38274.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81412.1| hypothetical protein [Arabidopsis thaliana]
Length=291

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 228/346 (66%), Gaps = 58/346 (17%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAK--QQNTTGN  470
             M +R NG SR Q+ ++ +GEGPNW+LIAGGALLSTLS+R GYKLKQ +D+K    N TG 
Sbjct  1     MTTRRNGVSRHQRFESFRGEGPNWILIAGGALLSTLSIRFGYKLKQSIDSKPPHSNATGG  60

Query  471   TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESET  650
               +  N   E   A N                                    + + ES T
Sbjct  61    LKRTEN--GEGNHATN------------------------------------EQMAESST  82

Query  651   ELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLH-LSNGSESPCVSESGSDIFSKREVI  827
              LPLVTVP+  +S+E+   W SS D LE+P K  H  S  S+SPCVSESGSDIFSKREVI
Sbjct  83    SLPLVTVPASSYSKESAVVWGSSPDHLEVPMKAYHQHSTCSDSPCVSESGSDIFSKREVI  142

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MI+EMQEQI+ELQ+SLNAQ+ HSSH+Q+ LD  NRDLF+SERE+QRLR
Sbjct  143   QKLRQQLKRRDDMIVEMQEQILELQNSLNAQMGHSSHIQTQLDATNRDLFESEREVQRLR  202

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLR  1187
             K IADHCVG                  G NG++ G   +E + +S E G  DGERIEMLR
Sbjct  203   KAIADHCVGHT----------------GSNGWS-GDVNSENNYESPENGIRDGERIEMLR  245

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EV ELKEVIDGKEYLL+SYKEQK EL  +VKELQQRLDSQLPNIL
Sbjct  246   KEVGELKEVIDGKEYLLRSYKEQKTELLQKVKELQQRLDSQLPNIL  291



>ref|XP_008678740.1| PREDICTED: uncharacterized protein LOC103653690 [Zea mays]
Length=341

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 238/334 (71%), Gaps = 18/334 (5%)
 Frame = +3

Query  345   LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCH  524
             +QGEGPNWVL+AGG LLS LSV++G KLKQ  + KQQN   NTSK   +P        C 
Sbjct  19    VQGEGPNWVLVAGGFLLSALSVKIGCKLKQWFNGKQQN---NTSKAKRRP------EACE  69

Query  525   LQSSSYCFNQDDENCYNFLSGTRDV-MDMKQQCNGQVLTESETELPLVTVPSLEFSRENG  701
             L S  Y F+     CY+ +SG  D  +++KQ     V    E+ LPLV +P+ E S+EN 
Sbjct  70    LHSDLYRFSDQTGCCYS-VSGLADSGVEVKQAPASPVPKSVESSLPLVKIPTPESSKENS  128

Query  702   GA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEM  878
             G  W SS DRLE P++P   SN S SPCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EM
Sbjct  129   GVMWISSPDRLEDPRRPFQYSNSSGSPCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEM  188

Query  879   QEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKI  1058
             Q QI +L++S+N Q++ S++LQS LDVANRDLF+SEREIQ LRK+IADHCV +  S EK 
Sbjct  189   QTQIADLKNSINIQVTQSTNLQSQLDVANRDLFESEREIQHLRKIIADHCVAEALSHEK-  247

Query  1059  PTVPSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDG  1223
             P     W S+  NG++NG+      +A+ H    EK +G+ ER+EML++EV ELKEVI+G
Sbjct  248   PLQAGHWQSDATNGHSNGYADGCVDDADLHCVGIEKRKGEVERVEMLKKEVVELKEVIEG  307

Query  1224  KEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             K+++LQSYKEQKAEL  +++ELQ++L +Q+PNIL
Sbjct  308   KDFVLQSYKEQKAELCLKIRELQEKLSAQVPNIL  341



>emb|CDY56327.1| BnaC07g50400D [Brassica napus]
Length=323

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 240/342 (70%), Gaps = 30/342 (9%)
 Frame = +3

Query  312   NGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQV-LDAKQQNTTGNTSKENN  488
             NG S+A+K       GPNW+LIAGGALLSTLS+R G++L+Q  LD   Q    N S    
Sbjct  8     NGFSKAEKVC-----GPNWILIAGGALLSTLSIRFGWRLRQSSLDFNPQ-IQSNASL---  58

Query  489   KPAERKKARNCHLQSS-SYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLV  665
                     + C L SS S C + D+  C++ + GT  V + K++ NG +++ S+T LPLV
Sbjct  59    ------GFKGCCLHSSKSSCAHNDEYCCFHSIPGTEHV-EGKEETNGHMISASDTSLPLV  111

Query  666   TVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQKLRQ  842
             T+P+  + +ENG  W+SS DRLELP KP  H S  S+SPCVSE+ SDIFSKREVIQKLRQ
Sbjct  112   TLPAPSYGKENGVMWTSSPDRLELPPKPYNHHSTCSDSPCVSETSSDIFSKREVIQKLRQ  171

Query  843   QVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIAD  1022
             Q+KRRD+MILEMQEQ + LQ+S NAQ +HSSHLQ+ LD  NRDLF+SERE++RLRK IAD
Sbjct  172   QLKRRDDMILEMQEQNLVLQNSYNAQRAHSSHLQAQLDSMNRDLFESEREVERLRKAIAD  231

Query  1023  HCVGQVDSCEKI-PTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVA  1199
             H VG   S  K  P  P          ++NG  E+E + +S EKG  DGERIEMLR+EV 
Sbjct  232   HSVGCTGSNGKTSPVAP----------WSNGFMESENNYESQEKGSRDGERIEMLRKEVE  281

Query  1200  ELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ELKEVIDGKEYLL++YKEQK ELS +VKELQQRLDSQ PNIL
Sbjct  282   ELKEVIDGKEYLLRNYKEQKNELSQKVKELQQRLDSQFPNIL  323



>dbj|BAJ91138.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91332.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=338

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 246/348 (71%), Gaps = 20/348 (6%)
 Frame = +3

Query  303   SRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSK  479
             S++NG+  +A K    QGEGP+WVL+AGG LLSTLSVR G KLKQ+ D K+QN   NTS+
Sbjct  4     SKSNGSVQKAGKVNHAQGEGPSWVLVAGGVLLSTLSVRFGCKLKQMFDTKKQN---NTSR  60

Query  480   ENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELP  659
                  A+R+   +C L S+ Y F+ D+ NCY  +S     +++KQ     +    E  LP
Sbjct  61    -----AKRRHG-SCELHSNLYRFD-DETNCYCCVSDGG--VEIKQGPASSLSKPDEPSLP  111

Query  660   LVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             L  +P  E S+EN G  W+SS DRLE P++PL  SN S SPCVSESGSDI+ KREVIQKL
Sbjct  112   LAKIPGPESSKENSGVMWTSSPDRLEDPRRPLQYSNSSGSPCVSESGSDIYIKREVIQKL  171

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQ ++RRDEMI+EMQ QI +L++SL+ + + +++LQS LD ANRDLF+SEREIQ+LRK+I
Sbjct  172   RQHLRRRDEMIMEMQTQIADLKNSLSIEETQTTNLQSQLDGANRDLFESEREIQQLRKII  231

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGERIEM  1181
             ADHCV +  S +K P     W  +  NG+ANG+ ++     E H    EK  G+ +R+EM
Sbjct  232   ADHCVAEALSRDK-PLQAGNWQPDAANGHANGYADSSIDDPELHCIGVEKRNGEADRVEM  290

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L+REV ELKEVI+GK++LLQSYKEQK EL ++++ELQ+RL +Q+PNIL
Sbjct  291   LKREVGELKEVIEGKDFLLQSYKEQKVELCSRMRELQERLSAQVPNIL  338



>ref|XP_003567800.1| PREDICTED: uncharacterized protein LOC100845287 [Brachypodium 
distachyon]
 ref|XP_010230965.1| PREDICTED: uncharacterized protein LOC100845287 [Brachypodium 
distachyon]
 ref|XP_010230966.1| PREDICTED: uncharacterized protein LOC100845287 [Brachypodium 
distachyon]
Length=343

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 247/349 (71%), Gaps = 17/349 (5%)
 Frame = +3

Query  303   SRANGTS-RAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSK  479
             S+ANG++ RA +   ++GEG +WVL+AGG LLSTLSVRLG KLKQ+LD K+QN++ +T K
Sbjct  4     SKANGSAQRAGEVNHVRGEGASWVLVAGGVLLSTLSVRLGCKLKQMLDVKKQNSSAST-K  62

Query  480   ENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDV-MDMKQQCNGQVLTESETEL  656
             +N +P      R C L S+ Y F  D  NCY  +SG  D  +++KQ     +    E  L
Sbjct  63    DNRRP------RACELHSNLYRF-YDQTNCYCCVSGIADGGVEVKQAPASSLSKPDEPSL  115

Query  657   PLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
             PL  V   + S+EN G  W+SS DRLE P++P   SN S SPCVSESGSDI SKREVIQK
Sbjct  116   PLARVSGPDSSKENSGVMWTSSPDRLEDPRRPFQYSNSSGSPCVSESGSDICSKREVIQK  175

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQ +KRRDEMI+EMQ QI +L++SL+ Q++ +++LQS LD AN+DLF+SEREIQ+LRK+
Sbjct  176   LRQHLKRRDEMIMEMQAQIADLKNSLSIQVTQTTNLQSQLDAANQDLFESEREIQQLRKI  235

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGERIE  1178
             IADHC+ +  S +K       W S+  NG+ANG+  +     + H    +K   + ER+E
Sbjct  236   IADHCLAEAVSHDK-SLQAGHWQSDATNGHANGYPASSVDDHDLHCVGIQKRNVEVERVE  294

Query  1179  MLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ML+REV +LKEVI+GK++LLQSYKEQK EL ++++ELQ+RL +Q+PNIL
Sbjct  295   MLKREVGDLKEVIEGKDFLLQSYKEQKVELCSKIRELQERLSAQVPNIL  343



>ref|XP_010528670.1| PREDICTED: uncharacterized protein LOC104805719 [Tarenaya hassleriana]
Length=336

 Score =   307 bits (786),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 250/345 (72%), Gaps = 11/345 (3%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG  R ++ +  +GEGPNW+LIAGGALLSTLS+R GYKLKQ  D+KQQ    +  
Sbjct  1     MNTRRNGVFRRERVENFRGEGPNWILIAGGALLSTLSIRFGYKLKQSFDSKQQECATSGL  60

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
             K N   ++R+ +R C L S+     Q+D+ C++ + GT    + K     Q+ +  +  L
Sbjct  61    KVNGT-SDRRSSRCC-LHSNVASCAQNDDCCFHCIPGTESA-EGKHVPKEQMASVPDFPL  117

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQK  833
             PLVTVP  EF++ENG  W+SS DRLELP KP  H S  S+SPCVSESGSDIFSKREVIQK
Sbjct  118   PLVTVPPPEFNKENGVMWASSPDRLELPPKPFNHHSTCSDSPCVSESGSDIFSKREVIQK  177

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MILEMQ+QI+ELQ+SLNAQ++HSSHLQ+ L+  NRD+FDSERE+QRLRK 
Sbjct  178   LRQQLKRRDDMILEMQDQILELQNSLNAQMAHSSHLQAQLEATNRDIFDSEREVQRLRKA  237

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKG-RGDGERIEMLRR  1190
             IADHCVG   S  K  +  + W     NG+ NG  + E + +S EKG  G+GER+EMLRR
Sbjct  238   IADHCVGNGGSNGKGSSPVAAW-----NGHTNGFMDRESN-ESPEKGINGEGERVEMLRR  291

Query  1191  EVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EV ELK+VI     LL++YKEQK ELS ++K+LQQRLDSQLPNIL
Sbjct  292   EVGELKDVIXXXXXLLRNYKEQKEELSLKIKDLQQRLDSQLPNIL  336



>ref|XP_009397568.1| PREDICTED: uncharacterized protein LOC103982372 [Musa acuminata 
subsp. malaccensis]
Length=331

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 246/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             M+ + NGT  R QK    +G GPNWVLIAGGALLSTLS+RLG KLKQV + K Q+   N 
Sbjct  1     MRPKTNGTLQRGQKLNHYKGNGPNWVLIAGGALLSTLSIRLGCKLKQVFETKLQD---NV  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSG-TRDVMDMKQQCNGQVLTESET  650
             +  N K   + ++  C + S+ Y F+Q+++   + LSG + D  D+KQ  N  + TE + 
Sbjct  58    NTGNRKFTPKIRSAACQMNSNLYQFHQNEDTHCHCLSGISGDGTDIKQSKN-PMSTEMDL  116

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              L LV     E ++E+G   W+SS DRLELPQKP H S+ S+SPC+SESGSDI+SKREVI
Sbjct  117   SLQLVKFSDTERNKESGSVIWASSPDRLELPQKPFHHSSSSDSPCMSESGSDIYSKREVI  176

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRD+MI+EMQ Q+++LQ+SL+ Q + S+ LQ+ +D ANRDLF+SEREIQRLR
Sbjct  177   QKLRQQLKRRDDMIMEMQAQVIDLQNSLSIQATQSADLQAQIDAANRDLFESEREIQRLR  236

Query  1008  KVIADHCVGQVDSCEKIPTVPS-LWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEML  1184
             K+IAD+C  +  S EK    P+  W  EG NG  NG+        ++    GD E+IEML
Sbjct  237   KIIADYCAVKAVSPEK----PARHWCPEGANGTMNGY--------ANGIDEGDFEKIEML  284

Query  1185  RREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +R+V ELKEVI+GK++LLQSYKEQK ELS+++KELQ +LDS +PNIL
Sbjct  285   KRQVGELKEVIEGKDFLLQSYKEQKVELSSKIKELQLKLDSHVPNIL  331



>ref|XP_009415147.1| PREDICTED: uncharacterized protein LOC103996060 [Musa acuminata 
subsp. malaccensis]
Length=345

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 248/351 (71%), Gaps = 14/351 (4%)
 Frame = +3

Query  297   MKSRANGTSR---AQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTG  467
             MKS+ NGT     AQK+  LQGEGPNWV + GGALLSTLS++LG +LK+  D K+ +   
Sbjct  1     MKSKTNGTGTSQAAQKTNVLQGEGPNWVFVVGGALLSTLSIKLGCQLKRAFDNKRHD---  57

Query  468   NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE  647
               +KEN K    +++R C+L +  Y F QD++N Y+FLS T  V    ++    ++ E++
Sbjct  58    EANKENRKSTADRRSRACNLHNL-YHFAQDEDNHYHFLSETSRVGVDAKRPKSPIVMEAD  116

Query  648   TELPLVTVPSLEFSRENGGAW-SSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREV  824
               LPLV +P+ E ++       +SS+DRLELP KP H SN S+S C+SESGSD++SKRE+
Sbjct  117   LSLPLVKIPATETNKVVEDIMRASSLDRLELPWKPFHHSNCSDS-CISESGSDVYSKREL  175

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+K+RDEMI+EMQ QI ++Q+SL+ Q + ++HLQS LD AN+DLF+SERE++RL
Sbjct  176   IQKLRQQLKQRDEMIMEMQTQITDVQNSLHIQRAQTAHLQSQLDSANKDLFNSEREVRRL  235

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGER  1172
             RKVI DH V +V S +K+  V   W  E  NG ANG+ ++    E H    +K   D E+
Sbjct  236   RKVITDHHVAEVTSPDKL-VVAGNWHPESANGLANGYADSVNDLELHRVGVDKREIDVEK  294

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             + ML+REV+ELKEVI+GK++LLQSYK+QK E  +++KELQ +L SQ+PNIL
Sbjct  295   VGMLKREVSELKEVIEGKDFLLQSYKDQKVEFCSKIKELQLKLASQVPNIL  345



>ref|NP_001056470.1| Os05g0587400 [Oryza sativa Japonica Group]
 gb|AAT44161.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18384.1| Os05g0587400 [Oryza sativa Japonica Group]
 dbj|BAG95395.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64865.1| hypothetical protein OsJ_19722 [Oryza sativa Japonica Group]
Length=340

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 245/352 (70%), Gaps = 21/352 (6%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ NG+  +A K    Q   PNWVL+AGG LLSTLSVRLG KLKQ+ DAK+QN+    
Sbjct  1     MKSKENGSIQKAGKVDHSQRGRPNWVLVAGGVLLSTLSVRLGCKLKQMFDAKKQNSM---  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE--  647
                   P  +++   C L S+ Y FN D  +CY  +S   D ++++Q   G  L +S   
Sbjct  58    ------PKVKRRPGACDLHSNLYRFN-DQTSCYCCMSAVADGVEIRQ-APGSPLPKSTDL  109

Query  648   TELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREV  824
             + L LV +P  E S+EN G  W+SS DRLE P+KP   SN S SPC SESGSDI++KREV
Sbjct  110   SPLLLVEIPGPESSKENSGVMWTSSPDRLEDPRKPFQYSNSSGSPCFSESGSDIYNKREV  169

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRDEMI EMQ QIV+L++SL  Q++ +++LQS LD A+R+LF+SEREIQ L
Sbjct  170   IQKLRQQLKRRDEMIAEMQAQIVDLKNSLVVQVTQTTNLQSQLDAASRELFESEREIQHL  229

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGE  1169
             RK+IADHCV +  S +K P     W S+  NG+ANG+ ++     E H    EK +G+ E
Sbjct  230   RKIIADHCVAEALSHDK-PLQAGHWQSDATNGHANGYADSSVDDPELHYIGIEKRKGEVE  288

Query  1170  RIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EML+REV +LKEVI+GK++L+QSYKEQK EL  +++ELQ++L +Q+PNIL
Sbjct  289   KVEMLKREVCDLKEVIEGKDFLIQSYKEQKLELCGKIRELQEKLSAQVPNIL  340



>ref|XP_008681376.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28995.1| unknown [Zea mays]
 gb|AFW72049.1| hypothetical protein ZEAMMB73_381976 [Zea mays]
Length=340

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 238/334 (71%), Gaps = 18/334 (5%)
 Frame = +3

Query  345   LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCH  524
             +QGEGPNWVL+AGG LLSTLSV++  KLKQ+LD KQQN   NTS+   +P        C 
Sbjct  18    VQGEGPNWVLVAGGVLLSTLSVKVVCKLKQLLDGKQQN---NTSEAKGRP------EACK  68

Query  525   LQSSSYCFNQDDENCYNFLSGTRDV-MDMKQQCNGQVLTESETELPLVTVPSLEFSRENG  701
             L S  Y F+ D   CY  +SG  +  +++KQ     V    E+ LPLV +P+ E S+EN 
Sbjct  69    LHSDLYRFS-DQTGCYYCMSGLANGGVEVKQTPASPVPKSVESSLPLVKIPTPESSKENS  127

Query  702   GA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEM  878
             G  W SS DRLE P++P   SN S SPCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EM
Sbjct  128   GVMWISSPDRLEDPRRPFQYSNSSGSPCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEM  187

Query  879   QEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKI  1058
             Q QI +L++SLN Q++ SS+LQS LD ANRDLF+SEREIQ LRK+IADHCV +  S +K 
Sbjct  188   QTQIADLKNSLNIQVTQSSNLQSQLDAANRDLFESEREIQHLRKIIADHCVTEALSHDK-  246

Query  1059  PTVPSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDG  1223
             P   + W  +  NG++NG+      +A+ H  S EK + + ER+EML++EV ELKEVI+G
Sbjct  247   PLQAAHWQPDAANGHSNGYGDGCVDDADLHCISIEKRKVEVERVEMLKKEVVELKEVIEG  306

Query  1224  KEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             K+++LQSYKEQK EL ++++ELQ++L +Q+P IL
Sbjct  307   KDFVLQSYKEQKVELFSKIRELQEKLSAQVPIIL  340



>ref|XP_007131479.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
 gb|ESW03473.1| hypothetical protein PHAVU_011G017000g [Phaseolus vulgaris]
Length=276

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 211/279 (76%), Gaps = 9/279 (3%)
 Frame = +3

Query  504   KKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPS--  677
             KK+ +  LQ++ Y   QD+  C++ +SGT   M++K   NGQ+L E +  LPLVTVP+  
Sbjct  2     KKSADYFLQTNGYSQTQDNHGCFSCISGTGGTMEVKCPPNGQMLNEFDGALPLVTVPAPA  61

Query  678   LEFSRENGGAWSSSVDR-LELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKR  854
              EFS+ENG  W+ S D  LELP KP H SN S+SPCVSESGSDIFSKREVIQKLRQQ+KR
Sbjct  62    AEFSKENGVMWACSPDHHLELPSKPFHHSNCSDSPCVSESGSDIFSKREVIQKLRQQLKR  121

Query  855   RDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVG  1034
             RD+MILEMQ+Q+ ELQ+SLN+Q+  SSHLQ  LD  NRDLFDSEREIQRLRK IADHCVG
Sbjct  122   RDDMILEMQDQLAELQNSLNSQMGLSSHLQLQLDATNRDLFDSEREIQRLRKAIADHCVG  181

Query  1035  QV--DSCEKIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELK  1208
              V  D   K+ T P+    E RNG+ NGH + + +  S EK R + ER+E+L+R+V ELK
Sbjct  182   YVPHDKSSKVTTSPA----EIRNGFLNGHLDGDSNSDSPEKPRDEEERVELLKRQVGELK  237

Query  1209  EVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             EVI+GKEYLLQSYKEQK ELS +V+ELQ RLDSQLPNIL
Sbjct  238   EVIEGKEYLLQSYKEQKTELSMKVRELQHRLDSQLPNIL  276



>ref|XP_008681377.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=337

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 237/333 (71%), Gaps = 19/333 (6%)
 Frame = +3

Query  345   LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCH  524
             +QGEGPNWVL+AGG LLSTLSV++  KLKQ+LD KQQN   NTS+   +P        C 
Sbjct  18    VQGEGPNWVLVAGGVLLSTLSVKVVCKLKQLLDGKQQN---NTSEAKGRP------EACK  68

Query  525   LQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGG  704
             L S  Y F+ D   CY +L+     +++KQ     V    E+ LPLV +P+ E S+EN G
Sbjct  69    LHSDLYRFS-DQTGCYYWLANGG--VEVKQTPASPVPKSVESSLPLVKIPTPESSKENSG  125

Query  705   A-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQ  881
               W SS DRLE P++P   SN S SPCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EMQ
Sbjct  126   VMWISSPDRLEDPRRPFQYSNSSGSPCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEMQ  185

Query  882   EQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIP  1061
              QI +L++SLN Q++ SS+LQS LD ANRDLF+SEREIQ LRK+IADHCV +  S +K P
Sbjct  186   TQIADLKNSLNIQVTQSSNLQSQLDAANRDLFESEREIQHLRKIIADHCVTEALSHDK-P  244

Query  1062  TVPSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGK  1226
                + W  +  NG++NG+      +A+ H  S EK + + ER+EML++EV ELKEVI+GK
Sbjct  245   LQAAHWQPDAANGHSNGYGDGCVDDADLHCISIEKRKVEVERVEMLKKEVVELKEVIEGK  304

Query  1227  EYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +++LQSYKEQK EL ++++ELQ++L +Q+P IL
Sbjct  305   DFVLQSYKEQKVELFSKIRELQEKLSAQVPIIL  337



>ref|XP_004961048.1| PREDICTED: uncharacterized protein LOC101775916 isoform X1 [Setaria 
italica]
 ref|XP_004961049.1| PREDICTED: uncharacterized protein LOC101775916 isoform X2 [Setaria 
italica]
 ref|XP_004961050.1| PREDICTED: uncharacterized protein LOC101775916 isoform X3 [Setaria 
italica]
Length=339

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 245/351 (70%), Gaps = 20/351 (6%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ANG+  +A K+  +QG GPNWVL+AGG LLSTLSVRLG KLKQ+   KQQNT+   
Sbjct  1     MKSKANGSIQKAGKANDVQG-GPNWVLVAGGVLLSTLSVRLGSKLKQIFVTKQQNTS---  56

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDV-MDMKQQCNGQVLTESET  650
                 NK   R  A  C L S+ Y F+ D  +C+ F+SG  D  +++KQ     +   +E 
Sbjct  57    ----NKAKRRPGA--CDLHSNLYRFS-DQTSCHCFMSGHADGGVEVKQVPQSPISISTEP  109

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
                LV + + E S+EN G  WSSS D+LE P+KP   SN S SP VSESGSDI++KREVI
Sbjct  110   SNLLVKIAAPESSKENSGVMWSSSPDQLEDPRKPFQHSNCSGSPSVSESGSDIYTKREVI  169

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQQ+KRRDEMI+EMQ QI +L++SL  Q++ +++LQS LD  NRDLF+SERE+Q LR
Sbjct  170   QKLRQQLKRRDEMIMEMQAQIADLKNSLTIQVTQNTNLQSQLDGTNRDLFESEREVQHLR  229

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAE-----RHLKSSEKGRGDGER  1172
             K++AD+CV +    +K P     W S G NG+ NG+ ++       H    EK +G+ ER
Sbjct  230   KIVADYCVAEPLLHDK-PFQDGQWQSNGTNGHVNGYSDSSIDDPVLHFNGVEKRKGEAER  288

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +E+L+REV ELKEVI+GK++LLQSYKEQK EL ++V+ELQ++L +Q+PNIL
Sbjct  289   VELLKREVGELKEVIEGKDFLLQSYKEQKVELCSKVRELQEKLSAQVPNIL  339



>gb|EEC79776.1| hypothetical protein OsI_21185 [Oryza sativa Indica Group]
Length=340

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 245/352 (70%), Gaps = 21/352 (6%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ NG+  +A K    Q   PNWVL+AGG LLSTLSVRLG KLKQ+ DAK+QN+    
Sbjct  1     MKSKENGSIQKAGKVDHSQRGRPNWVLVAGGVLLSTLSVRLGCKLKQMFDAKKQNSM---  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESE--  647
                   P  +++   C L S+ Y FN D  +CY  +S   D ++++Q   G  L +S   
Sbjct  58    ------PKVKRRPGACDLHSNLYRFN-DQTSCYCCMSAVADGVEIRQ-APGSPLPKSTDL  109

Query  648   TELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREV  824
             + L LV +P  E S+EN G  W+SS DRLE P+KP   SN S SPC SESGSDI++KREV
Sbjct  110   SPLLLVEIPGPESSKENSGVMWTSSPDRLEDPRKPFQYSNSSGSPCFSESGSDIYNKREV  169

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRDEMI EMQ QIV+L++SL  Q++ +++LQS LD A+R+LF+S+REIQ L
Sbjct  170   IQKLRQQLKRRDEMIAEMQAQIVDLKNSLVVQVTQTTNLQSQLDAASRELFESKREIQHL  229

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGE  1169
             RK+IADHCV +  S +K P     W S+  NG+ANG+ ++     + H    EK +G+ E
Sbjct  230   RKIIADHCVAEALSYDK-PLQAGHWQSDATNGHANGYADSSVDDPDLHYIGIEKRKGEVE  288

Query  1170  RIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             ++EML+REV +LKEVI+GK++L+QSYKEQK EL  +++ELQ++L +Q+PNIL
Sbjct  289   KVEMLKREVCDLKEVIEGKDFLIQSYKEQKLELCGKIRELQEKLSAQIPNIL  340



>emb|CAB38273.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81411.1| hypothetical protein [Arabidopsis thaliana]
Length=299

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 235/346 (68%), Gaps = 50/346 (14%)
 Frame = +3

Query  297   MKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTS  476
             M +R NG S+ Q+     GEGPNW+LIAGGALLSTLS+R GYKLKQ LD+K Q+      
Sbjct  1     MSTRRNGISKHQRGDKFCGEGPNWILIAGGALLSTLSIRFGYKLKQSLDSKPQS------  54

Query  477   KENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETEL  656
                N  A  K+                            + ++ K+  + Q+++ S+T L
Sbjct  55    ---NGSAGLKRT---------------------------ESVEGKEVTSEQMISASDTSL  84

Query  657   PLVTVPSLEFSRENGGAWSSSVDRLELPQKPL-HLSNGSESPCVSESGSDIFSKREVIQK  833
             PLVTVP+   S+ENG  W++S DRLELP +P  H SN S+SPCVSE+ SDIFSKREVIQK
Sbjct  85    PLVTVPA-PSSKENGVMWATSPDRLELPPRPYNHNSNCSDSPCVSETSSDIFSKREVIQK  143

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LRQQ+KRRD+MI EMQEQI+ELQ+S NAQ +HSSHLQ+ LD  NRDLF+SERE+QRLRK 
Sbjct  144   LRQQLKRRDDMIQEMQEQILELQNSYNAQTAHSSHLQAQLDTLNRDLFESEREVQRLRKA  203

Query  1014  IADHCVG-QVDSCEKIPTVPSLWGSEGRNGYANGHF-EAERHLKSSEKGRGDGERIEMLR  1187
             IADH VG   DS  K   V          G  NG F ++E + +S EK   DGER+EMLR
Sbjct  204   IADHSVGCGADSNGKTSPV----------GPWNGGFMDSESNYESQEKSLRDGERVEMLR  253

Query  1188  REVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EV+ELKEVIDGKEYLL+SYKEQK ELS +VKELQQRLDSQL N+L
Sbjct  254   KEVSELKEVIDGKEYLLRSYKEQKIELSQKVKELQQRLDSQLQNLL  299



>ref|XP_003575242.1| PREDICTED: uncharacterized protein LOC100844800 isoform X2 [Brachypodium 
distachyon]
Length=340

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 235/351 (67%), Gaps = 19/351 (5%)
 Frame = +3

Query  297   MKSRAN-GTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ N G  +A +   LQG GPNWVL+AGG LLSTLSV+LG K+KQ+ D KQQ+TT   
Sbjct  1     MKSKTNRGMQKAVRVDHLQGGGPNWVLVAGGVLLSTLSVKLGCKIKQMFDTKQQDTT---  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             SK   +P        C L S+  C  +D  +CY  +SG  D  +++    +  +   +E 
Sbjct  58    SKAKRRPGA------CELHSN-LCRFRDQSSCYYCISGHSDGEVEVNHGPSSPLSKSAEP  110

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P  E S++N G  W SS DRLE P+KP   SN S SPCVSESGSDI+SKREVI
Sbjct  111   SLPLVKIPGPESSKDNNGVMWISSPDRLENPRKPFQYSNNSGSPCVSESGSDIYSKREVI  170

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLR  +KRRDEMI+EMQ QI +L++SL  Q + SS++QS LD ANRD+F+SEREIQ LR
Sbjct  171   QKLRLHLKRRDEMIMEMQAQIADLKNSLAIQETQSSNMQSQLDAANRDMFESEREIQHLR  230

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGER  1172
             K+IADHCV +  S +K       W S+  NG+AN + ++     E      EK +G+ ER
Sbjct  231   KIIADHCVAEALSHDK-QLHAGHWQSDATNGHANAYTDSSVDDPELQFMGIEKKKGEVER  289

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI GK++LL SYKEQK EL +Q++ELQ +L  Q+ NIL
Sbjct  290   VEMLKREVGELKEVIGGKDFLLHSYKEQKVELCSQIRELQGKLSLQVHNIL  340



>ref|XP_010235607.1| PREDICTED: uncharacterized protein LOC100844800 isoform X1 [Brachypodium 
distachyon]
Length=346

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 235/357 (66%), Gaps = 25/357 (7%)
 Frame = +3

Query  297   MKSRAN-GTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ N G  +A +   LQG GPNWVL+AGG LLSTLSV+LG K+KQ+ D KQQ+TT   
Sbjct  1     MKSKTNRGMQKAVRVDHLQGGGPNWVLVAGGVLLSTLSVKLGCKIKQMFDTKQQDTT---  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDV-------MDMKQQCNGQV  632
             SK   +P        C L S+  C  +D  +CY  +SG   V       +++    +  +
Sbjct  58    SKAKRRPGA------CELHSN-LCRFRDQSSCYYCISGASSVFGHSDGEVEVNHGPSSPL  110

Query  633   LTESETELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIF  809
                +E  LPLV +P  E S++N G  W SS DRLE P+KP   SN S SPCVSESGSDI+
Sbjct  111   SKSAEPSLPLVKIPGPESSKDNNGVMWISSPDRLENPRKPFQYSNNSGSPCVSESGSDIY  170

Query  810   SKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSER  989
             SKREVIQKLR  +KRRDEMI+EMQ QI +L++SL  Q + SS++QS LD ANRD+F+SER
Sbjct  171   SKREVIQKLRLHLKRRDEMIMEMQAQIADLKNSLAIQETQSSNMQSQLDAANRDMFESER  230

Query  990   EIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKG  1154
             EIQ LRK+IADHCV +  S +K       W S+  NG+AN + ++     E      EK 
Sbjct  231   EIQHLRKIIADHCVAEALSHDK-QLHAGHWQSDATNGHANAYTDSSVDDPELQFMGIEKK  289

Query  1155  RGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +G+ ER+EML+REV ELKEVI GK++LL SYKEQK EL +Q++ELQ +L  Q+ NIL
Sbjct  290   KGEVERVEMLKREVGELKEVIGGKDFLLHSYKEQKVELCSQIRELQGKLSLQVHNIL  346



>ref|XP_002441603.1| hypothetical protein SORBIDRAFT_09g030180 [Sorghum bicolor]
 gb|EES20033.1| hypothetical protein SORBIDRAFT_09g030180 [Sorghum bicolor]
Length=340

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 244/352 (69%), Gaps = 21/352 (6%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             M S+ANG+  +A +   L G GPNWVL+AGG LLSTLSVRLG +LKQ+ + KQQN +   
Sbjct  1     MNSKANGSIKKAGRGDHLHG-GPNWVLVAGGILLSTLSVRLGCRLKQLFETKQQNPS---  56

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             +K   +P   +      L S+ Y F+ D  +C+ ++SG  D  +++KQ  +  +   +E 
Sbjct  57    TKAKRRPGAFE------LHSNLYRFS-DQPSCHCYMSGHADGEVELKQAPSSPIPKSTEP  109

Query  651   ELPLVTVPSLEFSRENGG-AWSSSVDRLELPQKP-LHLSNGSESPCVSESGSDIFSKREV  824
                LV +P+LE S+EN G  WSSS DRLE P+K     SN S SP +SESGSDI+SKREV
Sbjct  110   SNLLVKIPTLESSKENSGIMWSSSPDRLEDPRKATFQYSNCSGSPSISESGSDIYSKREV  169

Query  825   IQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRL  1004
             IQKLRQQ+KRRDEMI+EMQ QI EL++SL  Q + ++ LQS LD  NRDLF+S+RE+Q L
Sbjct  170   IQKLRQQLKRRDEMIMEMQAQIAELKNSLAIQATENTGLQSQLDATNRDLFESDREVQHL  229

Query  1005  RKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGE  1169
             RK++ADHCV    S +K P     W + G NG+ANG+ ++     E H    EK +G+ E
Sbjct  230   RKIVADHCVADSLSLDK-PFHAGQWQTNGTNGHANGYSDSSMDDPEVHCNGIEKRKGEAE  288

Query  1170  RIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             R+EMLR+EV ELKEVI+GK++LLQSYKEQK EL ++++ELQ++L +Q+PNIL
Sbjct  289   RMEMLRKEVGELKEVIEGKDFLLQSYKEQKVELCSKIRELQEKLSAQVPNIL  340



>gb|EMS51308.1| hypothetical protein TRIUR3_17822 [Triticum urartu]
Length=660

 Score =   307 bits (786),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 242/348 (70%), Gaps = 20/348 (6%)
 Frame = +3

Query  303   SRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSK  479
             S+ NG+  +A +    QGEGP+WVL+AGG L+STLSVRLG KLKQ+ D K+QN+T   S+
Sbjct  326   SKTNGSVQKAGRVSHAQGEGPSWVLVAGGVLVSTLSVRLGCKLKQMFDTKKQNST---SR  382

Query  480   ENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELP  659
                +P        C L S+ Y F+ D+ NCY  +S     +++KQ     +    E  LP
Sbjct  383   AKRRPGA------CELHSNLYRFD-DETNCYCCVSD--GGVEIKQAPASYLSKPDEFSLP  433

Query  660   LVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             L  +P  E S+EN G  W+SS DRLE  ++PL  SN S SPCVSE+GSDI+ KREVIQKL
Sbjct  434   LAKIPGPESSKENSGVMWTSSPDRLEDHRRPLQYSNSSGSPCVSEAGSDIYIKREVIQKL  493

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQ ++RRDEMI+EMQ QI +L++SL+ + + +++LQS LD ANRDLF+SEREIQ+LRK+I
Sbjct  494   RQHLRRRDEMIMEMQAQIADLKNSLSIEETQTANLQSQLDGANRDLFESEREIQQLRKII  553

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGERIEM  1181
             ADHCV +  S +K P     W  +  NG+ANG+ ++     E H    EK  G+ ER+EM
Sbjct  554   ADHCVAEALSRDK-PLQAGNWQPDAANGHANGYADSSIDDPELHCIGIEKRNGEAERVEM  612

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L+REV ELKEVI+GK++LLQSYKEQK EL ++++ELQ+RL +Q+PNIL
Sbjct  613   LKREVGELKEVIEGKDFLLQSYKEQKVELCSKMRELQERLSAQVPNIL  660



>dbj|BAK06988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 231/351 (66%), Gaps = 19/351 (5%)
 Frame = +3

Query  297   MKSRAN-GTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MKS+ N G  +A +   LQG GPNW+L+ GG LLSTLSV+LG KLKQ+ D KQQN+    
Sbjct  1     MKSKTNRGIQKAGRGDHLQGGGPNWILVVGGVLLSTLSVKLGCKLKQMFDMKQQNSF---  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESET  650
             SK  ++P        C L S+  C  +   +CY  +SG  D  +++K          +E 
Sbjct  58    SKAESRPG------GCELHSN-LCRFRGQTSCYYCISGHSDGAVEVKHPPASPSSKSAEP  110

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P  E S++N G  W S  DRLE P+KP   SN S SP VSESGSDI+SKREVI
Sbjct  111   SLPLVKIPVQESSKDNSGVMWISLPDRLEDPRKPFQYSNSSGSPRVSESGSDIYSKREVI  170

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQ +KRRDEMI+E+Q QI  L++SL  Q + SS+LQS L+ ANRD+F+SEREIQ LR
Sbjct  171   QKLRQHLKRRDEMIMEIQAQIAGLKNSLAIQETQSSNLQSQLESANRDIFESEREIQYLR  230

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGER  1172
             K+I DHC+G+  S  K P     W S+  NG+ANG+  +     E H     K R + ER
Sbjct  231   KIITDHCIGEALSHGK-PLHVGHWQSDATNGHANGYANSSVDDHELHFIGIGKKREELER  289

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML+REV ELKEVI GK+++L SYKEQK EL +Q++ELQ++L S +PNIL
Sbjct  290   MEMLKREVGELKEVIGGKDFVLGSYKEQKVELCSQIRELQEKLSSHVPNIL  340



>gb|KGN47863.1| hypothetical protein Csa_6G408220 [Cucumis sativus]
Length=249

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 194/249 (78%), Gaps = 0/249 (0%)
 Frame = +3

Query  579   LSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHL  758
             ++GT+   D+      Q++  SE  LPLV VP+ EF++ENG  W+SS DRLELP K  H 
Sbjct  1     MAGTQCTTDVNCPPADQIVVASENALPLVLVPASEFNKENGIIWASSPDRLELPAKQFHN  60

Query  759   SNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshssh  938
             SN S+SPCVS+SGSDIFSKREVI KLR Q+KRRD+MILEMQ+QIV LQ+SLNAQ++HSSH
Sbjct  61    SNCSDSPCVSDSGSDIFSKREVIHKLRHQLKRRDDMILEMQDQIVHLQNSLNAQVAHSSH  120

Query  939   lqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHF  1118
             LQS LD +N+DLFDSEREIQRLRK IADHC+GQ    +K       W  E RNG ANG+ 
Sbjct  121   LQSQLDASNQDLFDSEREIQRLRKAIADHCLGQAGPNDKSSLSVRSWSGETRNGQANGYM  180

Query  1119  EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQR  1298
             +   + +  EK RGDGERIEML++EV +LK+VI+GKEYLLQSYKEQK ELS ++KELQQR
Sbjct  181   DVNCNFEGPEKIRGDGERIEMLKKEVGDLKDVIEGKEYLLQSYKEQKTELSLKIKELQQR  240

Query  1299  LDSQLPNIL  1325
             LDSQLPNIL
Sbjct  241   LDSQLPNIL  249



>ref|XP_004952914.1| PREDICTED: uncharacterized protein LOC101783264 [Setaria italica]
Length=340

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 246/351 (70%), Gaps = 19/351 (5%)
 Frame = +3

Query  297   MKSRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNT  473
             MK++ + +  R+ +   +QGEG NWVL+AGG LLSTLSVRLG KLKQ+ D KQ+N   NT
Sbjct  1     MKTKTSRSLQRSGRGNHVQGEGTNWVLVAGGILLSTLSVRLGCKLKQLFDGKQEN---NT  57

Query  474   SKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDV-MDMKQQCNGQVLTESET  650
             SK   +P        C   S  Y F+ D  +CY  +SG  D  +++KQ     V    E 
Sbjct  58    SKAKRRP------EACERHSDLYRFS-DQTDCYYCISGLADGGVEVKQAPVSPVPKSVEP  110

Query  651   ELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVI  827
              LPLV +P+ E S+EN G  W SS DRLE P++P H SN S SP VSESGSDI+SKREVI
Sbjct  111   SLPLVKIPAPEPSKENSGVMWISSPDRLEDPRRPFHYSNSSGSPSVSESGSDIYSKREVI  170

Query  828   QKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR  1007
             QKLRQ +K+RDEMI+EMQ QI +L++SLN Q++ S++LQS LD ANRDLF+SEREIQ LR
Sbjct  171   QKLRQHLKKRDEMIMEMQAQIADLKNSLNIQVTQSTNLQSQLDAANRDLFESEREIQHLR  230

Query  1008  KVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGER  1172
             K+IADHCV +  + EK P     W S+  NG++NG+      +A+ H    EK +G+ ER
Sbjct  231   KIIADHCVAEALAHEK-PLQAGHWQSDATNGHSNGYADGSIDDADLHCVGMEKRKGEVER  289

Query  1173  IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +EML++EV ELKEVI+GK+++LQSYKEQK EL ++++ELQ++L +Q+PNIL
Sbjct  290   VEMLKKEVVELKEVIEGKDFVLQSYKEQKVELCSKIRELQEKLSAQVPNIL  340



>gb|EMT05189.1| hypothetical protein F775_03767 [Aegilops tauschii]
Length=876

 Score =   297 bits (761),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 177/343 (52%), Positives = 237/343 (69%), Gaps = 20/343 (6%)
 Frame = +3

Query  303   SRANGT-SRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSK  479
             S+ NG+  +A +    QGEGP+WVL+AGG L+STLSVRLG KLKQ+ D K+QN+T   S+
Sbjct  262   SKTNGSVQKAGRVSHAQGEGPSWVLVAGGVLVSTLSVRLGCKLKQMFDTKKQNST---SR  318

Query  480   ENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELP  659
                +P        C L S+ Y F+ D+ NCY  +S     +++KQ     +    E  LP
Sbjct  319   AKRRPGA------CELHSNLYRFD-DETNCYCCVSDGG--VEIKQGPASSLSKPDEPSLP  369

Query  660   LVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKL  836
             L  +P  E S+EN G  W+SS DRLE  ++PL  SN S SPCVSESGSDI+ KREVIQKL
Sbjct  370   LAKIPGPESSKENSGVMWTSSPDRLEDHRRPLQYSNSSGSPCVSESGSDIYIKREVIQKL  429

Query  837   RQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVI  1016
             RQ ++RRDEMI+EMQ QI +L++SL+ + + +++LQS LD ANRDLF+SEREIQ+LRK+I
Sbjct  430   RQHLRRRDEMIMEMQAQIADLKNSLSIEETQAANLQSQLDGANRDLFESEREIQQLRKII  489

Query  1017  ADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA-----ERHLKSSEKGRGDGERIEM  1181
             ADHCV +  S +K P     W  +  NG+ANG+ ++     E H    EK  G+ ER+EM
Sbjct  490   ADHCVAEALSRDK-PLQAGNWQPDAANGHANGYADSSIDDPELHCIGVEKRNGEAERVEM  548

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQ  1310
             L+REV ELKEVI+GK++LLQSYKEQK EL ++++ELQ+RL +Q
Sbjct  549   LKREVGELKEVIEGKDFLLQSYKEQKVELCSKMRELQERLSAQ  591



>ref|XP_010906227.1| PREDICTED: uncharacterized protein LOC105033220 isoform X2 [Elaeis 
guineensis]
Length=295

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/288 (55%), Positives = 202/288 (70%), Gaps = 7/288 (2%)
 Frame = +3

Query  480   ENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSGTRD-VMDMKQQCNGQVLTESETEL  656
             EN K   +++   C L S  YC+ QD++ CY+ LSGT D  +D+KQ   G    +++  L
Sbjct  9     ENGKNVAKRRPGACQLHSKLYCYTQDEDGCYHCLSGTSDGAVDVKQPPAGPWSKDADVSL  68

Query  657   PLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQK  833
              LV VP    + ++ G  W+SS D  ELP++P H SN S+SPC+SESGSDI+SKREVIQK
Sbjct  69    SLVKVPEANSNNDSSGVMWASSPDHPELPRRPFHHSNSSDSPCISESGSDIYSKREVIQK  128

Query  834   LRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKV  1013
             LR Q+KRRDEMI+EMQ QI++LQ+S+  Q++HS+ LQS LD AN DLFD+EREIQRLRK 
Sbjct  129   LRLQLKRRDEMIMEMQAQIMDLQNSVGIQMTHSAKLQSQLDSANGDLFDTEREIQRLRKA  188

Query  1014  IADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEA----ERHLKSSEKGRGDGERIEM  1181
             IADHCV      EK P     W  E  NG  NG+ ++    E H    EK R D ER+EM
Sbjct  189   IADHCVADAGFLEK-PVATRTWRPEAINGQVNGYVDSTDDVELHCVGGEKVRDDSERVEM  247

Query  1182  LRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L+R+V ELKEVI+GK++LLQSYKEQK EL +++KELQ RL+SQ+PNIL
Sbjct  248   LKRKVGELKEVIEGKDFLLQSYKEQKVELCSKIKELQLRLESQVPNIL  295



>gb|EPS70470.1| hypothetical protein M569_04291, partial [Genlisea aurea]
Length=279

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 216/331 (65%), Gaps = 57/331 (17%)
 Frame = +3

Query  348   QGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQ-QNTTGNTSKENNKPAERKKARNCH  524
             QGE PNWV I G ALLS LSVRLGYKLKQVL+AKQ +N+     K N K  +  K  +CH
Sbjct  1     QGESPNWVFITGSALLSVLSVRLGYKLKQVLEAKQTENSPTQCLKANGKSPDGNKGGSCH  60

Query  525   LQSSSYCFNQDDENCYNFLSGTRDVMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGG  704
             L S  +CF++         SG+ +  ++    +G VL           VPS EF+REN G
Sbjct  61    LHSDDFCFSR--------YSGSGNAGEIS---SGMVLA----------VPSSEFNRENNG  99

Query  705   A-WSSSVDRLELPQKP-LHL-SNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILE  875
               WSSS DRLELPQKP LH  SN S+SPCVSESGSDIF++REV+QKLR Q+KRRD+ ILE
Sbjct  100   VMWSSSPDRLELPQKPFLHQQSNCSDSPCVSESGSDIFTRREVVQKLRHQLKRRDDTILE  159

Query  876   MQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLR-KVIADHCVGQVDSCE  1052
             MQ+QI +LQSSL+A++S+SSHLQSLLD AN D FDS REIQRLR +  ++ C        
Sbjct  160   MQDQIAKLQSSLSAEMSNSSHLQSLLDAANADAFDSGREIQRLRGRCNSNGC--------  211

Query  1053  KIPTVPSLWGSEGRNGYANGHFEAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEY  1232
                       +  R G   G +E               E+IE+L++EVAELKEVI+GKEY
Sbjct  212   ----------NNDREGDLGGSWER-------------SEKIELLKKEVAELKEVIEGKEY  248

Query  1233  LLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             L++ YKEQ  ELS  +++LQ+RLDSQLPNI+
Sbjct  249   LVERYKEQTRELSLTIQDLQKRLDSQLPNII  279



>ref|XP_006854221.1| hypothetical protein AMTR_s00048p00222520 [Amborella trichopoda]
 gb|ERN15688.1| hypothetical protein AMTR_s00048p00222520 [Amborella trichopoda]
Length=336

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 217/344 (63%), Gaps = 35/344 (10%)
 Frame = +3

Query  357   GPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSK-ENNKPAERKKARNCHLQS  533
             GPNWVLIAGGALL +LS++LG+KLK  L+ KQ   T N SK E+ KPA +K++  C L S
Sbjct  7     GPNWVLIAGGALLGSLSIKLGHKLKLALEPKQTTDTSNKSKGEHGKPAVKKRSVVCPLHS  66

Query  534   SSYCFNQDDENCYNFLSG----TRDVMDMKQQCNGQVLTESETEL-PLVTVPSLEFSREN  698
             + Y F QDD++C + LSG    T D  +  Q     VL + +  L PLVTV        +
Sbjct  67    NLYSFRQDDDSCCHCLSGNPNGTTDTKNPSQTSVPSVLKDVDPSLGPLVTV-------HD  119

Query  699   GGAWSSSVDRLELPQKPLHLSNGSESPCVSESGS-DIFSKREVIQKLRQQVKRRDEMILE  875
               A S   +  E+   P   SN S SPCVSESGS D F +R+VI +LR Q+KRRD+MILE
Sbjct  120   PTAASIDPNHREV-GLPFQHSNSSGSPCVSESGSSDPFGRRDVIHRLRLQLKRRDDMILE  178

Query  876   MQEQIVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCV--GQVDSC  1049
             M  QI +   +L  +L+  +H+Q  L+ +NR+LF +EREIQ+LRKVIADHC   G  DSC
Sbjct  179   MHAQISDQNKALEERLALVAHIQLQLESSNRELFRAEREIQKLRKVIADHCANRGSPDSC  238

Query  1050  EKIPTVPSLWGSEG-----------RNGYANGHFEAERHLKSSEKGRGD-GERIEMLRRE  1193
                  V   W   G           +NG+  G  E E+ L   + G GD GE++E+L+RE
Sbjct  239   GSAGMV---WPESGDVARIQCGGGVQNGFVGGK-EEEKDL--VDLGWGDEGEKVEILKRE  292

Query  1194  VAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
               EL+E+IDGK++LL+SY+EQK EL+T+VKELQ R+ SQ+PNIL
Sbjct  293   SGELREMIDGKDFLLESYREQKMELATKVKELQLRVASQIPNIL  336



>ref|NP_001140405.1| hypothetical protein [Zea mays]
 gb|ACF83763.1| unknown [Zea mays]
 gb|AFW72048.1| hypothetical protein ZEAMMB73_381976 [Zea mays]
Length=255

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 185/248 (75%), Gaps = 7/248 (3%)
 Frame = +3

Query  600   MDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGA-WSSSVDRLELPQKPLHLSNGSES  776
             +++KQ     V    E+ LPLV +P+ E S+EN G  W SS DRLE P++P   SN S S
Sbjct  9     VEVKQTPASPVPKSVESSLPLVKIPTPESSKENSGVMWISSPDRLEDPRRPFQYSNSSGS  68

Query  777   PCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllD  956
             PCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EMQ QI +L++SLN Q++ SS+LQS LD
Sbjct  69    PCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEMQTQIADLKNSLNIQVTQSSNLQSQLD  128

Query  957   VANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHF-----E  1121
              ANRDLF+SEREIQ LRK+IADHCV +  S +K P   + W  +  NG++NG+      +
Sbjct  129   AANRDLFESEREIQHLRKIIADHCVTEALSHDK-PLQAAHWQPDAANGHSNGYGDGCVDD  187

Query  1122  AERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRL  1301
             A+ H  S EK + + ER+EML++EV ELKEVI+GK+++LQSYKEQK EL ++++ELQ++L
Sbjct  188   ADLHCISIEKRKVEVERVEMLKKEVVELKEVIEGKDFVLQSYKEQKVELFSKIRELQEKL  247

Query  1302  DSQLPNIL  1325
              +Q+P IL
Sbjct  248   SAQVPIIL  255



>ref|XP_009361116.1| PREDICTED: uncharacterized protein LOC103951471 isoform X5 [Pyrus 
x bretschneideri]
Length=287

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +3

Query  780   CVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDV  959
             C+SESGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QI ELQSSLNAQL+HS++LQS LD 
Sbjct  107   CMSESGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIQELQSSLNAQLAHSTNLQSQLDS  166

Query  960   ANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLK  1139
             ANRD FDSEREIQRLRK IADHCVG V   ++ P V ++W  E RNG+ NG  + E +  
Sbjct  167   ANRDFFDSEREIQRLRKAIADHCVGHVSPIDRSPQV-TIWQPEERNGHVNGFPDGESNFD  225

Query  1140  SSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPN  1319
             ++E+GRGDGERIEML+REV ELKEVI+GKEYLLQSYKEQKAE S ++KELQQRLDSQL N
Sbjct  226   ATERGRGDGERIEMLKREVGELKEVIEGKEYLLQSYKEQKAEFSLKIKELQQRLDSQLLN  285

Query  1320  IL  1325
             IL
Sbjct  286   IL  287


 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = +3

Query  279  TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
            T    KMK +     RAQ+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10   TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459  TTGNTSKENNKPAERKKARNCHLQSSSYCFN-QDDENCYNFLS  584
            T  N S +++ P   +K+  C + S+ Y F  Q+D  C+N +S
Sbjct  70   TASNGSGKSSDP---RKSAGCRVHSNVYSFTQQNDGGCFNCMS  109



>gb|AFW62763.1| hypothetical protein ZEAMMB73_863256 [Zea mays]
Length=211

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 166/211 (79%), Gaps = 6/211 (3%)
 Frame = +3

Query  708   WSSSVDRLELPQKPLHLSNGSESPCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQ  887
             W SS DRLE P++P   SN S SPCVSESGSDI+SKREVIQKLRQ +K+RDEMI+EMQ Q
Sbjct  2     WISSPDRLEDPRRPFQYSNSSGSPCVSESGSDIYSKREVIQKLRQHLKKRDEMIMEMQTQ  61

Query  888   IVElqsslnaqlshsshlqsllDVANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTV  1067
             I +L++S+N Q++ S++LQS LDVANRDLF+SEREIQ LRK+IADHCV +  S EK P  
Sbjct  62    IADLKNSINIQVTQSTNLQSQLDVANRDLFESEREIQHLRKIIADHCVAEALSHEK-PLQ  120

Query  1068  PSLWGSEGRNGYANGHF-----EAERHLKSSEKGRGDGERIEMLRREVAELKEVIDGKEY  1232
                W S+  NG++NG+      +A+ H    EK +G+ ER+EML++EV ELKEVI+GK++
Sbjct  121   AGHWQSDATNGHSNGYADGCVDDADLHCVGIEKRKGEVERVEMLKKEVVELKEVIEGKDF  180

Query  1233  LLQSYKEQKAELSTQVKELQQRLDSQLPNIL  1325
             +LQSYKEQKAEL  +++ELQ++L +Q+PNIL
Sbjct  181   VLQSYKEQKAELCLKIRELQEKLSAQVPNIL  211



>ref|XP_008382288.1| PREDICTED: uncharacterized protein LOC103445070 isoform X5 [Malus 
domestica]
Length=287

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = +3

Query  780   CVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDV  959
             C+SESGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD 
Sbjct  107   CMSESGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDS  166

Query  960   ANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLK  1139
             AN D FDSEREIQRLRK IADHCVG     ++   V ++W  E RNGY NG  + E +  
Sbjct  167   ANGDFFDSEREIQRLRKAIADHCVGHASPNDRSSHV-TIWQPEERNGYVNGFPDGESNFD  225

Query  1140  SSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPN  1319
             ++E+GRGD ER+EML REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPN
Sbjct  226   ATERGRGDEERVEMLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPN  285

Query  1320  IL  1325
             IL
Sbjct  286   IL  287


 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +3

Query  279  TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
            T    KMK +     R Q+SK  QGEGPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10   TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459  TTGNTSKENNKPAERKKARNCHLQSSSYCFN-QDDENCYNFLS  584
               N S    K ++R+K+  C + S+ Y F  Q+D  C+N +S
Sbjct  70   NASNGS---GKSSDRRKSAGCCVHSNVYSFTQQNDGGCFNCMS  109



>ref|XP_009348928.1| PREDICTED: uncharacterized protein LOC103940522 isoform X5 [Pyrus 
x bretschneideri]
Length=287

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = +3

Query  780   CVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDV  959
             C+SESGSDIFSKREVIQKLRQQ+KRRD+MILEMQ+QIVELQSSLNAQL+HS++LQS LD 
Sbjct  107   CMSESGSDIFSKREVIQKLRQQLKRRDDMILEMQDQIVELQSSLNAQLAHSTNLQSQLDS  166

Query  960   ANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHLK  1139
             ANRD FDSEREIQRLRK IADHCVG      +   V ++W  E RNG  NG  + E +  
Sbjct  167   ANRDFFDSEREIQRLRKAIADHCVGHASPNHRSSHV-TIWQPEERNGDVNGFPDGESNFN  225

Query  1140  SSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLPN  1319
             ++E+GRGD ER+E L REV ELKEV++GKEYLLQSYKEQKAELS ++KELQQRL+SQLPN
Sbjct  226   ATERGRGDEERVENLNREVGELKEVMEGKEYLLQSYKEQKAELSLKIKELQQRLNSQLPN  285

Query  1320  IL  1325
             IL
Sbjct  286   IL  287


 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +3

Query  279  TLATHKMKSRANGTSRAQKSKALQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQN  458
            T    KMK +     R Q+SK  QG+GPNWVLIAGGALLSTLS+RLGYKLKQ LD K Q 
Sbjct  10   TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRLGYKLKQALDTKPQE  69

Query  459  TTGNTSKENNKPAERKKARNCHLQSSSYCFN-QDDENCYNFLS  584
               N S    K ++R+K+  C + S+ Y FN Q+D  C+N +S
Sbjct  70   NASNGS---GKSSDRRKSAGCCVHSNVYSFNQQNDGGCFNCMS  109



>gb|EYU20402.1| hypothetical protein MIMGU_mgv1a014068mg [Erythranthe guttata]
Length=202

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 165/243 (68%), Gaps = 41/243 (17%)
 Frame = +3

Query  597   VMDMKQQCNGQVLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSES  776
             + ++K+Q + +  TE     PLVT    EF++E+                    ++ S+S
Sbjct  1     MAEIKEQHHTKTTTEPSIARPLVT----EFNKEH--------------------TSSSDS  36

Query  777   PCVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllD  956
             PCVSESGSDIF K EVIQKLRQQ+KRRD+MILEMQ QI EL++S++ QLSHSSHLQSLLD
Sbjct  37    PCVSESGSDIFGKPEVIQKLRQQLKRRDDMILEMQYQIAELRNSISFQLSHSSHLQSLLD  96

Query  957   VANRDLFDSEREIQRLRKVIADHCVGQVDSCEKIPTVPSLWGSEGRNGYANGHFEAERHL  1136
              ANRDLFDSE EIQRLRK IADHCVG     E   + P   G            E E +L
Sbjct  97    SANRDLFDSETEIQRLRKAIADHCVG----YETSSSAPVWLG------------EVEGNL  140

Query  1137  KSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQLP  1316
             +SS+K R D E+IEML+REV ELKE+I+GK+YLL+ YKEQK ELS ++ ELQQRLDSQL 
Sbjct  141   ESSDKKR-DEEKIEMLKREVNELKELIEGKDYLLKIYKEQKFELSMKINELQQRLDSQLL  199

Query  1317  NIL  1325
             NIL
Sbjct  200   NIL  202



>gb|ABR18020.1| unknown [Picea sitchensis]
Length=406

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 204/424 (48%), Gaps = 104/424 (25%)
 Frame = +3

Query  303   SRANGTSRAQKSKALQG-------EGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNT  461
             S  NG SR  KS  +Q        EG NWV+I GG + S LSV LG KLKQ L+  +Q  
Sbjct  4     SEKNGKSR--KSAFVQNSMQNAPQEGLNWVVILGGTIASALSVTLGRKLKQALENNRQRD  61

Query  462   TGNTSKENNKP---AERKKARNCHLQSSSYCF-NQDDENCYNFLSGTRD-VMDMK---QQ  617
             T    KE N+P   +  K+    H   S+  +  Q    C +   G  D  ++MK   Q 
Sbjct  62    T----KELNEPEGSSATKRTSGVHPMRSNLDYGTQGGVVCIHCFPGAYDGAVEMKLGPQD  117

Query  618   CNGQ------VLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESP  779
              N Q        T S     L  +     S EN   W S  ++L+LP+  LH SN SES 
Sbjct  118   ANFQFDDRVGAHTISPQRCKLSEIQIYSESTENSPLWVSP-EQLDLPKVHLHQSNSSESV  176

Query  780   CVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDV  959
             C S++GSD+FSKR+VI +LR+Q+KRRDEMILEMQ QI + Q  L+ Q+S  ++LQS LD 
Sbjct  177   CTSDTGSDVFSKRDVIHRLREQLKRRDEMILEMQAQITDQQQILSNQISQMTNLQSQLDA  236

Query  960   ANRDLFDSEREIQRLRKVIA------------------------------------DHCV  1031
             ANR+LF +EREIQRLRK IA                                    D  V
Sbjct  237   ANRELFGTEREIQRLRKAIADHCAGHAVEMSCSSGSMITNYTMVDHSMSKSIADLKDSTV  296

Query  1032  GQVDSCE------------------KIPTVPSLWG--------SEGRNGYANGHFEAERH  1133
             G  + C                   K P V  +W         S  RNG    H +    
Sbjct  297   GSAELCNGGTQRFHEQKLQEQTYDLKTPNV-KVWNLIEDLPCVSLNRNGEMTKHEDTL--  353

Query  1134  LKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQL  1313
                        E ++ L RE+AELK ++ GK YLL++Y+ Q+ EL TQ+KELQ +L +Q+
Sbjct  354   -----------ESVKDLERELAELKRLVSGKNYLLEAYENQRVELCTQLKELQLKLGTQM  402

Query  1314  PNIL  1325
              ++L
Sbjct  403   ASVL  406



>gb|ABR17946.1| unknown [Picea sitchensis]
Length=406

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 152/424 (36%), Positives = 204/424 (48%), Gaps = 104/424 (25%)
 Frame = +3

Query  303   SRANGTSRAQKSKALQG-------EGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNT  461
             S  NG SR  KS  +Q        EG NWV+I GG + S LSV LG KLKQ L+  +Q  
Sbjct  4     SEKNGKSR--KSAFVQNSMQNAPQEGLNWVVILGGTIASALSVTLGRKLKQALENNRQRD  61

Query  462   TGNTSKENNKP---AERKKARNCHLQSSSYCF-NQDDENCYNFLSGTRD-VMDMK---QQ  617
             T    KE N+P   +  K+    H   S+  +  Q    C +   G  D  ++MK   Q 
Sbjct  62    T----KELNEPEGSSATKRTSGVHPMRSNLDYGTQGGVVCIHCFPGAYDGAVEMKLGPQD  117

Query  618   CNGQ------VLTESETELPLVTVPSLEFSRENGGAWSSSVDRLELPQKPLHLSNGSESP  779
              N Q        T S     L  +     S EN   W S  ++L+LP+  LH SN SES 
Sbjct  118   ANFQFDDRVGAHTISPQRCKLSEIQIYSESTENSPLWVSP-EQLDLPKVHLHQSNSSESV  176

Query  780   CVSESGSDIFSKREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDV  959
             C S++GSD+FSKR+VI +LR+Q+KRRDEMILEMQ QI + Q  L+ Q+S  ++LQS LD 
Sbjct  177   CTSDTGSDVFSKRDVIHRLREQLKRRDEMILEMQAQITDQQQILSNQISQMTNLQSQLDA  236

Query  960   ANRDLFDSEREIQRLRK------------------------VIADH------------CV  1031
             ANR+LF +EREIQRLRK                         + DH             V
Sbjct  237   ANRELFGTEREIQRLRKAIADHCAGHAVEMSCSSGSMITNYTMVDHSMSKSIADLKGSTV  296

Query  1032  GQVDSCE------------------KIPTVPSLWG--------SEGRNGYANGHFEAERH  1133
             G  + C                   K P V  +W         S  RNG    H +    
Sbjct  297   GSAELCNGGTQRFHEQKLQEQTYDLKTPDV-KVWNLIEDLPCVSLNRNGEMTKHEDTL--  353

Query  1134  LKSSEKGRGDGERIEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQQRLDSQL  1313
                        E ++ L RE+AELK ++ GK YL+++Y+ Q+ EL TQ+KELQ +L +Q+
Sbjct  354   -----------ESVKDLERELAELKRLVSGKNYLIEAYENQRVELCTQLKELQLKLGTQM  402

Query  1314  PNIL  1325
              ++L
Sbjct  403   ASVL  406



>gb|AFW62766.1| hypothetical protein ZEAMMB73_938861, partial [Zea mays]
Length=87

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 9/77 (12%)
 Frame = +3

Query  345  LQGEGPNWVLIAGGALLSTLSVRLGYKLKQVLDAKQQNTTGNTSKENNKPAERKKARNCH  524
            +QGEGPNWVL+AGG LLS LSV++G KLKQ  + KQQN   NTSK   +P        C 
Sbjct  19   VQGEGPNWVLVAGGFLLSALSVKIGCKLKQWFNGKQQN---NTSKAKRRPEA------CE  69

Query  525  LQSSSYCFNQDDENCYN  575
            L S  Y F+     CY+
Sbjct  70   LHSDLYRFSDQTGCCYS  86



>ref|XP_002960255.1| hypothetical protein SELMODRAFT_402395 [Selaginella moellendorffii]
 gb|EFJ37794.1| hypothetical protein SELMODRAFT_402395 [Selaginella moellendorffii]
Length=516

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 97/186 (52%), Gaps = 20/186 (11%)
 Frame = +3

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KR+V+ +LRQQ+K RDEMI++MQ QI+E    ++        L+ LL  ANR LF +E+E
Sbjct  86    KRDVVHRLRQQLKNRDEMIMQMQTQILEQSRIIHVHQLRIGDLELLLTAANRSLFVAEQE  145

Query  993   IQRLRKVIADHCVGQVDSC-----------EKIPTVPSLWGSEGRNGYANGHFEAERHLK  1139
             I++L+K++A+ C  +  SC           +K+      W  E ++          R L 
Sbjct  146   IEQLQKLLAECCSCRSASCQVRKLGSLHVEDKVFKAQKRWTCENQHKDMRDLVSEARRLT  205

Query  1140  SSEKGRGDGER---------IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQ  1292
                K  G+ +R         +  +R E++E K +      L Q+  +++A+LS  + +LQ
Sbjct  206   EKLKVVGENKRGQAREYEKEVRRVRSELSEAKNLASKNASLFQACDKERAKLSGTLTKLQ  265

Query  1293  QRLDSQ  1310
             Q+L+SQ
Sbjct  266   QKLESQ  271



>ref|XP_002967459.1| hypothetical protein SELMODRAFT_408480 [Selaginella moellendorffii]
 gb|EFJ32058.1| hypothetical protein SELMODRAFT_408480 [Selaginella moellendorffii]
Length=516

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 96/186 (52%), Gaps = 20/186 (11%)
 Frame = +3

Query  813   KREVIQKLRQQVKRRDEMILEMQEQIVElqsslnaqlshsshlqsllDVANRDLFDSERE  992
             KR+V+ +LRQQ+K RDEMI++MQ QI+E    +         L+ LL  ANR LF +E+E
Sbjct  86    KRDVVHRLRQQLKNRDEMIMQMQTQILEQSRIIQVHQLRIGDLELLLTAANRSLFVAEQE  145

Query  993   IQRLRKVIADHCVGQVDSC-----------EKIPTVPSLWGSEGRNGYANGHFEAERHLK  1139
             I++L+K++A+ C  +  SC           +K+      W  E ++          R L 
Sbjct  146   IEQLQKLLAECCSCRSASCQVRKRGSLHVEDKVFKAQKRWTCENQHKDMRDLVSEARRLT  205

Query  1140  SSEKGRGDGER---------IEMLRREVAELKEVIDGKEYLLQSYKEQKAELSTQVKELQ  1292
                K  G+ +R         +  +R E++E K +      L Q+  +++A+LS  + +LQ
Sbjct  206   EKLKVVGENKRGQAREYEKEVRRVRSELSEAKNLASKNASLFQACDKERAKLSGTLTKLQ  265

Query  1293  QRLDSQ  1310
             Q+L+SQ
Sbjct  266   QKLESQ  271



>ref|XP_009114075.1| PREDICTED: uncharacterized protein LOC103839315 isoform X1 [Brassica 
rapa]
Length=118

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query  297  MKSRANGTSRAQKSKALQGE-GPNWVLIAGGALLSTLSVRLGYKLKQ-VLDAKQQNTTGN  470
            M +  NG S+ Q+++ + G+ GPNW+LIAGGALLSTLS+R GYKLKQ  L      +  +
Sbjct  1    MSTPRNGFSKHQRAEKVCGQRGPNWILIAGGALLSTLSIRFGYKLKQSPLFKPPHQSNAS  60

Query  471  TSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSG  587
               + N  +ER++    H  ++S C   +  +C+  + G
Sbjct  61   PGFKANGTSERQRCCCLHSSTTSSCAKNNGYSCFRSVPG  99



>ref|XP_009114082.1| PREDICTED: uncharacterized protein LOC103839315 isoform X2 [Brassica 
rapa]
Length=117

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +3

Query  297  MKSRANGTSRAQKSKALQGE-GPNWVLIAGGALLSTLSVRLGYKLKQ--VLDAKQQNTTG  467
            M +  NG S+ Q+++ + G+ GPNW+LIAGGALLSTLS+R GYKLKQ  +     Q+   
Sbjct  1    MSTPRNGFSKHQRAEKVCGQRGPNWILIAGGALLSTLSIRFGYKLKQSPLFKPPHQSNAS  60

Query  468  NTSKENNKPAERKKARNCHLQSSSYCFNQDDENCYNFLSG  587
               K N   +ER++    H  ++S C   +  +C+  + G
Sbjct  61   PGFKANGT-SERQRCCCLHSSTTSSCAKNNGYSCFRSVPG  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3792526190046