BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14892_g3_i1 len=181 path=[1381:0-180]

Length=181
                                                                      Score     E

ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         83.6    8e-17   
gb|AES74035.2|  subtilisin-like serine protease                       79.7    8e-16   
ref|XP_003603784.1|  Subtilisin-like serine protease                  80.1    9e-16   
gb|KEH34337.1|  subtilisin-like serine protease                       79.7    2e-15   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           79.7    2e-15   
ref|XP_003603196.1|  Subtilisin-type protease                         77.8    8e-15   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        77.8    8e-15   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like         77.8    9e-15   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         77.8    9e-15   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like         77.4    1e-14   
ref|XP_003603807.1|  Subtilisin-type protease                         77.0    2e-14   
emb|CDP21113.1|  unnamed protein product                              75.5    2e-14   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       75.9    4e-14   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  75.9    5e-14   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        75.5    6e-14   
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  75.5    7e-14   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  75.5    7e-14   
gb|KHN09070.1|  Subtilisin-like protease                              75.1    9e-14   
ref|XP_010229422.1|  PREDICTED: CO(2)-response secreted protease-...  74.3    1e-13   
gb|AES74057.2|  subtilisin-like serine protease                       74.3    1e-13   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       74.7    1e-13   
dbj|BAJ93850.1|  predicted protein                                    74.3    2e-13   
gb|EEE69927.1|  hypothetical protein OsJ_29791                        73.6    2e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDP18817.1|  unnamed protein product                              74.3    2e-13   
ref|NP_001236511.1|  subtilisin-type protease precursor               73.9    2e-13   
ref|NP_001175897.1|  Os09g0482660                                     73.6    2e-13   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                     73.9    2e-13   Glycine max [soybeans]
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg           73.9    2e-13   
ref|XP_003603806.1|  Subtilisin-like serine protease                  73.6    2e-13   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       73.6    2e-13   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        73.6    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         73.2    4e-13   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         73.2    4e-13   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      73.2    4e-13   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  72.8    5e-13   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       72.8    5e-13   
gb|KHN45943.1|  Subtilisin-like protease                              72.0    6e-13   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              72.4    6e-13   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       72.4    8e-13   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  71.6    1e-12   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         71.6    1e-12   
ref|XP_002461867.1|  hypothetical protein SORBIDRAFT_02g009600        71.6    1e-12   Sorghum bicolor [broomcorn]
ref|XP_006645770.1|  PREDICTED: subtilisin-like protease-like         71.2    2e-12   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              71.2    2e-12   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  71.2    2e-12   
gb|EYU38295.1|  hypothetical protein MIMGU_mgv1a0026492mg             68.6    2e-12   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  71.2    2e-12   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              70.9    2e-12   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              70.5    3e-12   
ref|XP_009607188.1|  PREDICTED: subtilisin-like protease SBT5.3       70.5    3e-12   
emb|CDP07365.1|  unnamed protein product                              70.1    4e-12   
ref|XP_008778811.1|  PREDICTED: xylem serine proteinase 1-like        67.0    5e-12   
gb|EYU17578.1|  hypothetical protein MIMGU_mgv1a0038491mg             69.3    5e-12   
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease      69.7    5e-12   Vitis vinifera
ref|XP_008375386.1|  PREDICTED: subtilisin-like protease              69.7    6e-12   
dbj|BAJ53097.1|  JHL20J20.3                                           69.3    8e-12   
gb|KDP36888.1|  hypothetical protein JCGZ_08179                       69.3    8e-12   
gb|KHG24601.1|  Cucumisin                                             68.9    1e-11   
ref|XP_008800195.1|  PREDICTED: xylem serine proteinase 1-like        67.4    1e-11   
gb|KHN10324.1|  Subtilisin-like protease                              68.9    1e-11   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like         68.9    1e-11   
gb|KHN10158.1|  Subtilisin-like protease                              68.6    1e-11   
gb|EPS69827.1|  hypothetical protein M569_04935                       68.6    1e-11   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like         68.6    1e-11   
emb|CBI19918.3|  unnamed protein product                              68.6    1e-11   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  68.6    1e-11   Vitis vinifera
ref|XP_010095549.1|  Subtilisin-like protease                         68.6    1e-11   
gb|KDO37215.1|  hypothetical protein CISIN_1g038289mg                 65.9    1e-11   
ref|XP_007133571.1|  hypothetical protein PHAVU_011G190300g           68.2    2e-11   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg           68.2    2e-11   
gb|EAY73513.1|  hypothetical protein OsI_01395                        68.2    2e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAA89562.1|  putative subtilisin-like protein                     68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09847.1|  hypothetical protein OsI_32138                        67.8    2e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAJ99628.1|  predicted protein                                    67.8    2e-11   
ref|XP_008672702.1|  PREDICTED: uncharacterized protein LOC100279...  67.8    2e-11   
ref|NP_001145938.1|  uncharacterized protein LOC100279461 precursor   67.8    2e-11   Zea mays [maize]
ref|NP_001063751.1|  Os09g0530800                                     67.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457657.1|  hypothetical protein SORBIDRAFT_03g011300        67.8    3e-11   Sorghum bicolor [broomcorn]
gb|EEE54331.1|  hypothetical protein OsJ_01304                        68.2    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         67.8    3e-11   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like    67.4    3e-11   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like         67.4    3e-11   
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3       67.4    4e-11   
ref|XP_009400152.1|  PREDICTED: subtilisin-like protease SBT5.4       67.0    4e-11   
gb|EMT32761.1|  Subtilisin-like protease                              67.0    5e-11   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like         67.0    5e-11   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        67.0    5e-11   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg           67.0    5e-11   
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg           67.0    5e-11   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       67.0    6e-11   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760        66.6    6e-11   Sorghum bicolor [broomcorn]
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like         66.6    6e-11   
tpg|DAA62443.1|  TPA: putative subtilase family protein               66.2    7e-11   
ref|XP_002300693.2|  putative subtilisin precursor family protein     66.6    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease      66.6    8e-11   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        66.6    8e-11   
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative    66.2    8e-11   Ricinus communis
gb|AES89241.2|  subtilisin-like serine protease                       65.9    9e-11   
tpg|DAA62442.1|  TPA: putative subtilase family protein               65.9    9e-11   
ref|XP_006347851.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_004967678.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 65.9    1e-10   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   66.2    1e-10   
emb|CDM82985.1|  unnamed protein product                              66.2    1e-10   
gb|AES74037.2|  subtilisin-like serine protease                       65.1    1e-10   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.9    1e-10   
dbj|BAA13135.1|  subtilisin-like protein                              65.9    1e-10   Picea abies
tpg|DAA62441.1|  TPA: putative subtilase family protein               65.9    1e-10   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...  65.9    1e-10   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor   65.9    1e-10   Zea mays [maize]
ref|XP_002893091.1|  subtilase                                        65.9    1e-10   
ref|XP_003603786.1|  Subtilisin-like protease                         65.1    1e-10   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           65.9    1e-10   
ref|XP_010109770.1|  hypothetical protein L484_008446                 65.9    1e-10   
ref|XP_002272598.1|  PREDICTED: xylem serine proteinase 1             65.9    1e-10   Vitis vinifera
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...  65.9    1e-10   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  65.9    1e-10   
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65424.1|  subtilisin-like serine protease                       65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391632.1|  PREDICTED: subtilisin-like protease isoform X1   65.9    1e-10   
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2   65.9    2e-10   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 65.5    2e-10   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           65.9    2e-10   
gb|EMS51782.1|  Subtilisin-like protease SDD1                         65.5    2e-10   
dbj|BAK05842.1|  predicted protein                                    65.5    2e-10   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                       65.5    2e-10   
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478           65.5    2e-10   
ref|NP_001169390.1|  putative subtilase family protein precursor      65.5    2e-10   Zea mays [maize]
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661            65.5    2e-10   
gb|EMT21161.1|  Cucumisin                                             65.1    2e-10   
ref|XP_003607044.1|  Subtilisin-like protease                         65.1    2e-10   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease              65.1    2e-10   
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980        65.1    2e-10   Sorghum bicolor [broomcorn]
ref|NP_001146035.1|  uncharacterized protein LOC100279566             64.7    2e-10   Zea mays [maize]
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-10   
gb|KEH19206.1|  subtilisin-like serine protease                       65.1    2e-10   
gb|KEH19203.1|  subtilisin-like serine protease                       65.1    2e-10   
gb|KEH19205.1|  subtilisin-like serine protease                       65.1    2e-10   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    2e-10   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...  65.1    2e-10   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  65.1    2e-10   
gb|KEH19202.1|  subtilisin-like serine protease                       65.1    2e-10   
gb|AFW73751.1|  putative subtilase family protein                     65.1    2e-10   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5       65.1    2e-10   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  65.1    3e-10   
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
emb|CDY44210.1|  BnaC05g15670D                                        64.7    3e-10   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
emb|CDY57477.1|  BnaAnng14590D                                        64.7    3e-10   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like         64.7    3e-10   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4       64.7    3e-10   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  64.7    3e-10   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  64.7    4e-10   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like         64.7    4e-10   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...  64.7    4e-10   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g           64.3    4e-10   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      64.3    4e-10   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  64.3    4e-10   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                   64.3    4e-10   
ref|XP_009776157.1|  PREDICTED: subtilisin-like protease              64.3    5e-10   
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    5e-10   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  64.3    5e-10   
gb|KGN55997.1|  hypothetical protein Csa_3G045110                     63.9    5e-10   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           63.9    6e-10   
ref|XP_002307740.1|  putative subtilisin precursor family protein     63.9    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002985983.1|  hypothetical protein SELMODRAFT_234928           63.9    6e-10   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease              63.9    6e-10   
gb|EYU39036.1|  hypothetical protein MIMGU_mgv1a026993mg              63.9    6e-10   
gb|KCW65828.1|  hypothetical protein EUGRSUZ_G03177                   63.5    6e-10   
ref|XP_002985746.1|  hypothetical protein SELMODRAFT_424725           63.2    7e-10   
ref|XP_002985741.1|  hypothetical protein SELMODRAFT_424715           63.5    7e-10   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.9    7e-10   
ref|XP_010694663.1|  PREDICTED: CO(2)-response secreted protease-...  63.5    7e-10   
ref|XP_002456214.1|  hypothetical protein SORBIDRAFT_03g032240        63.5    8e-10   Sorghum bicolor [broomcorn]
ref|XP_010908011.1|  PREDICTED: CO(2)-response secreted protease-...  63.5    8e-10   
gb|KDP25554.1|  hypothetical protein JCGZ_20710                       63.5    8e-10   
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease              63.5    8e-10   
ref|XP_004245672.2|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  63.9    9e-10   
ref|XP_002985742.1|  hypothetical protein SELMODRAFT_424716           63.2    9e-10   
ref|XP_002974442.1|  hypothetical protein SELMODRAFT_414628           63.2    9e-10   
ref|XP_002985747.1|  hypothetical protein SELMODRAFT_424726           63.2    9e-10   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5       63.5    9e-10   
ref|XP_002978893.1|  hypothetical protein SELMODRAFT_110049           63.2    9e-10   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g           63.2    9e-10   
gb|KDO48661.1|  hypothetical protein CISIN_1g0368302mg                62.8    9e-10   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease              63.2    1e-09   
ref|XP_010091321.1|  Subtilisin-like protease                         63.5    1e-09   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  63.2    1e-09   
ref|XP_004246134.2|  PREDICTED: subtilisin-like protease              63.2    1e-09   
ref|XP_004244590.1|  PREDICTED: subtilisin-like protease              63.2    1e-09   
gb|EYU39035.1|  hypothetical protein MIMGU_mgv1a001882mg              63.2    1e-09   
ref|XP_002979023.1|  hypothetical protein SELMODRAFT_177291           63.2    1e-09   
ref|XP_002464801.1|  hypothetical protein SORBIDRAFT_01g026900        63.2    1e-09   Sorghum bicolor [broomcorn]
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...  63.2    1e-09   
ref|XP_006358371.1|  PREDICTED: subtilisin-like protease-like         63.2    1e-09   
emb|CDP16605.1|  unnamed protein product                              62.8    1e-09   
ref|XP_002984936.1|  hypothetical protein SELMODRAFT_121213           62.8    1e-09   
ref|XP_002984832.1|  hypothetical protein SELMODRAFT_121107           62.8    1e-09   
gb|EMT11746.1|  Xylem serine proteinase 1                             61.2    1e-09   
emb|CDP09845.1|  unnamed protein product                              62.8    1e-09   
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg           62.8    1e-09   
ref|XP_008351622.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  62.8    2e-09   
ref|XP_002984834.1|  hypothetical protein SELMODRAFT_181325           62.8    2e-09   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease              62.8    2e-09   
gb|EYU39028.1|  hypothetical protein MIMGU_mgv1a002635mg              62.8    2e-09   
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like         62.8    2e-09   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg           62.8    2e-09   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like         62.8    2e-09   
gb|EMT24493.1|  Subtilisin-like protease                              62.0    2e-09   
gb|KHN39834.1|  Cucumisin                                             62.8    2e-09   
gb|EPS60118.1|  hypothetical protein M569_14685                       60.1    2e-09   
ref|XP_009767059.1|  PREDICTED: subtilisin-like protease              62.8    2e-09   
ref|XP_011085840.1|  PREDICTED: CO(2)-response secreted protease-...  62.8    2e-09   
ref|XP_006358408.1|  PREDICTED: subtilisin-like protease-like         62.8    2e-09   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                        62.8    2e-09   
gb|EYU39027.1|  hypothetical protein MIMGU_mgv1a019149mg              62.4    2e-09   
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg           62.4    2e-09   
ref|XP_009599111.1|  PREDICTED: subtilisin-like protease              62.4    2e-09   
ref|XP_007141642.1|  hypothetical protein PHAVU_008G213300g           62.0    2e-09   
gb|EPS59928.1|  hypothetical protein M569_14877                       62.4    2e-09   
ref|XP_009776158.1|  PREDICTED: subtilisin-like protease              62.4    2e-09   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                 62.4    2e-09   
ref|XP_006363699.1|  PREDICTED: subtilisin-like protease SDD1-like    62.4    2e-09   
ref|XP_007141643.1|  hypothetical protein PHAVU_008G213300g           62.4    2e-09   
emb|CDX77071.1|  BnaC04g38660D                                        62.4    2e-09   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...  62.4    2e-09   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   62.4    2e-09   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg           62.4    2e-09   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...  62.4    2e-09   
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   62.4    2e-09   
ref|XP_009373327.1|  PREDICTED: subtilisin-like protease SDD1         62.0    2e-09   
gb|EMS53854.1|  Cucumisin                                             62.0    2e-09   
gb|EYU39034.1|  hypothetical protein MIMGU_mgv1a019276mg              62.4    2e-09   
gb|EYU39037.1|  hypothetical protein MIMGU_mgv1a021904mg              62.0    2e-09   
gb|KDP25553.1|  hypothetical protein JCGZ_20709                       62.0    2e-09   
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg           62.0    2e-09   
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease              62.0    2e-09   
ref|XP_010477248.1|  PREDICTED: CO(2)-response secreted protease      62.0    2e-09   
gb|ABZ89187.1|  putative protein                                      62.0    3e-09   Coffea canephora [robusta coffee]
ref|XP_002985648.1|  hypothetical protein SELMODRAFT_424712           58.9    3e-09   
emb|CDO99977.1|  unnamed protein product                              62.0    3e-09   
gb|ADZ55305.1|  serine protease                                       62.0    3e-09   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1         62.0    3e-09   
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease              62.0    3e-09   
ref|XP_002984931.1|  hypothetical protein SELMODRAFT_424020           62.0    3e-09   
ref|XP_010498447.1|  PREDICTED: CO(2)-response secreted protease-...  61.6    3e-09   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                       62.0    3e-09   
ref|XP_010498446.1|  PREDICTED: CO(2)-response secreted protease-...  61.6    3e-09   
gb|EYU39031.1|  hypothetical protein MIMGU_mgv1a025139mg              61.6    3e-09   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like         61.6    3e-09   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              61.6    3e-09   
gb|EMT31638.1|  Subtilisin-like protease                              61.6    3e-09   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1         61.6    4e-09   
ref|NP_001043993.2|  Os01g0702300                                     61.6    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71345.1|  hypothetical protein OsI_03414                        61.6    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002509665.1|  Xylem serine proteinase 1 precursor, putative    61.6    4e-09   Ricinus communis
ref|XP_009767058.1|  PREDICTED: subtilisin-like protease              61.6    4e-09   
ref|XP_009614059.1|  PREDICTED: subtilisin-like protease              61.6    4e-09   
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like    61.6    4e-09   
gb|EAZ13237.1|  hypothetical protein OsJ_03159                        61.6    4e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CBI34783.3|  unnamed protein product                              60.1    4e-09   
ref|XP_011077880.1|  PREDICTED: xylem serine proteinase 1             61.6    4e-09   
gb|KGN55998.1|  hypothetical protein Csa_3G045120                     61.6    4e-09   
dbj|BAK01624.1|  predicted protein                                    61.6    4e-09   
ref|XP_004231226.1|  PREDICTED: CO(2)-response secreted protease-...  61.6    4e-09   
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g           61.2    4e-09   
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg              61.2    4e-09   
ref|NP_001168937.1|  uncharacterized protein LOC100382750             60.1    4e-09   Zea mays [maize]
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4       61.6    4e-09   
gb|ABG37022.1|  serine protease                                       61.2    4e-09   Nicotiana tabacum [American tobacco]
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg              61.2    5e-09   
ref|XP_002980373.1|  hypothetical protein SELMODRAFT_112475           61.2    5e-09   
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g           60.8    5e-09   
emb|CBI38006.3|  unnamed protein product                              61.2    5e-09   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5       61.2    5e-09   
dbj|BAD81785.1|  P69E protein-like                                    61.6    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002962719.1|  hypothetical protein SELMODRAFT_61337            61.2    5e-09   
ref|XP_006857987.1|  hypothetical protein AMTR_s00069p00181550        61.2    5e-09   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         61.2    5e-09   
gb|KFK44142.1|  hypothetical protein AALP_AA1G220500                  61.2    5e-09   
ref|XP_007015871.1|  Cucumisin protein                                61.2    6e-09   
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like         61.2    6e-09   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3       61.2    6e-09   
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative    60.8    6e-09   
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg           61.2    6e-09   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease              60.8    6e-09   
ref|XP_007209030.1|  hypothetical protein PRUPE_ppa023234mg           60.8    6e-09   
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like         60.8    6e-09   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4     60.8    6e-09   
ref|XP_002509660.1|  Xylem serine proteinase 1 precursor, putative    60.8    6e-09   
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2     60.8    7e-09   
ref|XP_002525223.1|  Xylem serine proteinase 1 precursor, putative    60.8    7e-09   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1     60.8    7e-09   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1         60.8    7e-09   
ref|XP_008449184.1|  PREDICTED: uncharacterized protein LOC103491134  61.2    7e-09   
ref|XP_003588418.1|  Serine protease-like protein                     60.8    7e-09   
ref|XP_002960360.1|  hypothetical protein SELMODRAFT_402550           60.8    7e-09   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3     60.8    7e-09   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1         60.8    8e-09   
ref|XP_002967355.1|  hypothetical protein SELMODRAFT_439868           60.8    8e-09   
gb|KDP29035.1|  hypothetical protein JCGZ_16424                       60.8    8e-09   
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like         60.5    8e-09   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...  60.5    9e-09   
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like         60.5    9e-09   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3       60.5    9e-09   
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg              60.5    9e-09   
ref|XP_002509658.1|  Xylem serine proteinase 1 precursor, putative    60.5    9e-09   
emb|CDP09846.1|  unnamed protein product                              60.5    9e-09   
ref|XP_011029125.1|  PREDICTED: subtilisin-like protease SDD1         60.5    9e-09   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  60.5    1e-08   
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  60.5    1e-08   
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease              60.5    1e-08   
ref|NP_001238252.1|  subtilisin-type protease precursor               60.5    1e-08   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...  60.5    1e-08   
ref|XP_010661610.1|  PREDICTED: xylem serine proteinase 1             60.5    1e-08   
ref|XP_004244588.1|  PREDICTED: subtilisin-like protease              60.5    1e-08   
dbj|BAF95753.1|  subtilase                                            60.5    1e-08   
ref|XP_004292752.1|  PREDICTED: subtilisin-like protease-like         60.5    1e-08   
emb|CBI38830.3|  unnamed protein product                              60.5    1e-08   
gb|ADY38794.1|  serine protease                                       60.1    1e-08   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g           60.1    1e-08   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...  60.1    1e-08   
gb|EYU39032.1|  hypothetical protein MIMGU_mgv1a023804mg              60.1    1e-08   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease              60.1    1e-08   
ref|XP_004491111.1|  PREDICTED: subtilisin-like protease-like         60.1    1e-08   
ref|XP_008238738.1|  PREDICTED: subtilisin-like protease              60.1    1e-08   
ref|XP_002303965.2|  hypothetical protein POPTR_0003s18830g           60.1    1e-08   
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1         60.1    1e-08   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4       60.1    1e-08   
emb|CBI38462.3|  unnamed protein product                              60.1    1e-08   
ref|XP_007208895.1|  hypothetical protein PRUPE_ppa026788mg           60.1    1e-08   
gb|EYU39344.1|  hypothetical protein MIMGU_mgv1a024295mg              59.7    1e-08   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         60.1    1e-08   
emb|CAN82764.1|  hypothetical protein VITISV_030629                   60.1    1e-08   
ref|XP_004964076.1|  PREDICTED: subtilisin-like protease-like         60.1    1e-08   
gb|KDP25558.1|  hypothetical protein JCGZ_20714                       60.1    1e-08   
ref|XP_002275471.2|  PREDICTED: uncharacterized protein LOC100242816  60.1    1e-08   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1         60.1    1e-08   
emb|CDY33400.1|  BnaA07g04390D                                        60.1    1e-08   
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease              60.1    1e-08   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease              60.1    1e-08   
emb|CDY18042.1|  BnaC07g04280D                                        60.1    1e-08   
gb|EYU28958.1|  hypothetical protein MIMGU_mgv1a020772mg              59.7    1e-08   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...  60.1    1e-08   
ref|XP_002974277.1|  hypothetical protein SELMODRAFT_414626           57.0    2e-08   
ref|XP_010090170.1|  Subtilisin-like protease                         59.7    2e-08   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3       59.7    2e-08   
gb|AIC80768.1|  subtilase                                             59.7    2e-08   
ref|XP_008437177.1|  PREDICTED: subtilisin-like protease              59.7    2e-08   
ref|XP_004492669.1|  PREDICTED: xylem serine proteinase 1-like        59.7    2e-08   
ref|XP_009354470.1|  PREDICTED: cucumisin-like                        59.7    2e-08   
ref|XP_003571078.1|  PREDICTED: subtilisin-like protease SBT5.3       59.7    2e-08   
emb|CDP10007.1|  unnamed protein product                              59.7    2e-08   
gb|EMT04348.1|  Subtilisin-like protease                              59.7    2e-08   
emb|CDP19526.1|  unnamed protein product                              59.7    2e-08   
ref|XP_006358842.1|  PREDICTED: subtilisin-like protease-like         59.7    2e-08   
gb|KHG28029.1|  Subtilisin-like protease SDD1                         59.7    2e-08   
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease              59.7    2e-08   
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg           59.7    2e-08   
ref|XP_009608769.1|  PREDICTED: subtilisin-like protease SDD1         59.7    2e-08   
ref|XP_010650971.1|  PREDICTED: cucumisin-like                        59.7    2e-08   
gb|KCW77653.1|  hypothetical protein EUGRSUZ_D01951                   59.7    2e-08   
ref|XP_002974441.1|  hypothetical protein SELMODRAFT_414627           59.3    2e-08   
ref|XP_008794758.1|  PREDICTED: subtilisin-like protease SBT5.3       59.7    2e-08   
emb|CDY15084.1|  BnaC03g44450D                                        59.7    2e-08   
ref|XP_002308740.2|  hypothetical protein POPTR_0006s00370g           59.3    2e-08   
ref|XP_010242650.1|  PREDICTED: xylem serine proteinase 1-like        59.7    2e-08   
gb|EMT20391.1|  Xylem serine proteinase 1                             59.3    2e-08   
ref|XP_009608768.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
ref|XP_009629567.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...  59.3    2e-08   
ref|XP_009762586.1|  PREDICTED: xylem serine proteinase 1 isoform X1  59.3    2e-08   
ref|XP_010053374.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
ref|XP_002866352.1|  subtilase family protein                         59.3    2e-08   
ref|XP_009762587.1|  PREDICTED: xylem serine proteinase 1 isoform X2  59.3    2e-08   
gb|EPS65938.1|  hypothetical protein M569_08836                       59.3    2e-08   
ref|XP_002893090.1|  predicted protein                                59.3    2e-08   
ref|XP_009781098.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_009375889.1|  PREDICTED: xylem serine proteinase 1             59.3    2e-08   
ref|XP_006370729.1|  hypothetical protein POPTR_0001s45480g           59.3    2e-08   
gb|KHF99410.1|  Xylem serinease 1 -like protein                       59.3    2e-08   
emb|CBI16044.3|  unnamed protein product                              59.7    2e-08   
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3       59.3    2e-08   
ref|XP_010108071.1|  Subtilisin-like protease SDD1                    59.3    2e-08   
ref|XP_010034346.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
gb|KCW78235.1|  hypothetical protein EUGRSUZ_D02423                   59.3    2e-08   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4       59.3    2e-08   
gb|KFK27428.1|  hypothetical protein AALP_AA8G381300                  59.3    2e-08   
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
gb|KCW51742.1|  hypothetical protein EUGRSUZ_J01202                   59.3    2e-08   
ref|XP_010053873.1|  PREDICTED: xylem serine proteinase 1             59.3    2e-08   
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg              59.3    2e-08   
gb|KCW51741.1|  hypothetical protein EUGRSUZ_J01200                   59.3    2e-08   
emb|CAA07250.1|  serine protease                                      59.3    2e-08   
ref|NP_001234257.1|  subtilisin-like endoprotease precursor           59.3    2e-08   
ref|XP_004244715.1|  PREDICTED: subtilisin-like protease              59.3    3e-08   
ref|XP_008780363.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  59.3    3e-08   
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease              59.3    3e-08   
emb|CDY67543.1|  BnaCnng55400D                                        59.3    3e-08   
ref|XP_002992980.1|  hypothetical protein SELMODRAFT_187138           59.3    3e-08   
dbj|BAC42673.1|  putative subtilisin-like protease                    59.3    3e-08   
emb|CDP03080.1|  unnamed protein product                              58.9    3e-08   
ref|XP_006339775.1|  PREDICTED: xylem serine proteinase 1-like        59.3    3e-08   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              59.3    3e-08   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...  59.3    3e-08   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg              59.3    3e-08   
ref|XP_006358405.1|  PREDICTED: subtilisin-like protease-like         59.3    3e-08   
ref|XP_004166925.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.9    3e-08   
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                 59.3    3e-08   
ref|XP_008232921.1|  PREDICTED: xylem serine proteinase 1             58.9    3e-08   
ref|XP_011081166.1|  PREDICTED: subtilisin-like protease SDD1         59.3    3e-08   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                       58.9    3e-08   
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
dbj|BAB08348.1|  serine protease-like protein                         58.9    3e-08   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like    58.9    3e-08   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_004147599.1|  PREDICTED: subtilisin-like protease-like         58.9    3e-08   
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg              58.9    3e-08   
ref|XP_010273983.1|  PREDICTED: cucumisin-like                        58.9    3e-08   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg           58.9    3e-08   
ref|NP_200789.2|  Subtilase 5.4                                       58.9    3e-08   
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_004168804.1|  PREDICTED: xylem serine proteinase 1-like        58.9    3e-08   
ref|XP_002303548.2|  hypothetical protein POPTR_0003s11840g           58.9    3e-08   
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_009781100.1|  PREDICTED: subtilisin-like protease SDD1         58.5    3e-08   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1         58.9    3e-08   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1         58.9    3e-08   
ref|XP_009611955.1|  PREDICTED: xylem serine proteinase 1             58.9    3e-08   
ref|XP_010326073.1|  PREDICTED: xylem serine proteinase 1             58.9    3e-08   
emb|CBI37197.3|  unnamed protein product                              59.3    3e-08   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...  58.9    3e-08   
ref|XP_009762964.1|  PREDICTED: subtilisin-like protease SDD1         58.9    3e-08   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                  58.9    3e-08   
ref|XP_008381953.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.9    3e-08   
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_010919425.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|NP_565330.1|  Subtilase-like protein                              58.9    3e-08   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                    58.9    3e-08   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   
ref|XP_004308419.1|  PREDICTED: xylem serine proteinase 1-like        58.9    3e-08   
ref|XP_002453487.1|  hypothetical protein SORBIDRAFT_04g006740        58.5    3e-08   
ref|XP_002509669.1|  Cucumisin precursor, putative                    58.9    3e-08   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like         58.9    3e-08   
gb|EYU39026.1|  hypothetical protein MIMGU_mgv1a019074mg              58.9    3e-08   
ref|XP_002511771.1|  Xylem serine proteinase 1 precursor, putative    58.9    3e-08   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         58.9    3e-08   
ref|XP_004149226.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...  58.9    3e-08   
ref|XP_002891020.1|  subtilase family protein                         58.9    3e-08   
gb|EYU28957.1|  hypothetical protein MIMGU_mgv1a020114mg              58.9    3e-08   
ref|XP_006854360.1|  hypothetical protein AMTR_s00039p00160190        58.9    4e-08   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease              58.9    4e-08   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease              58.9    4e-08   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg           58.9    4e-08   
gb|KDP25559.1|  hypothetical protein JCGZ_20715                       58.9    4e-08   
ref|XP_003538718.1|  PREDICTED: subtilisin-like protease-like         58.9    4e-08   
gb|KGN59114.1|  hypothetical protein Csa_3G775270                     58.5    4e-08   
ref|XP_003525747.1|  PREDICTED: subtilisin-like protease SDD1-like    58.5    4e-08   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4       58.9    4e-08   
gb|KHN34449.1|  Subtilisin-like protease SDD1                         58.5    4e-08   
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.5    4e-08   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease              58.5    4e-08   
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g           58.5    4e-08   
gb|KDP32632.1|  hypothetical protein JCGZ_13182                       58.5    4e-08   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-08   
ref|XP_002303550.2|  hypothetical protein POPTR_0003s11860g           58.5    4e-08   
ref|XP_002325705.1|  hypothetical protein POPTR_0019s00970g           58.5    4e-08   
ref|XP_010905124.1|  PREDICTED: subtilisin-like protease              58.5    4e-08   
emb|CAN62640.1|  hypothetical protein VITISV_010210                   58.5    4e-08   
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  58.5    4e-08   
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4       58.5    4e-08   
ref|XP_006363697.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-08   
ref|XP_010058207.1|  PREDICTED: subtilisin-like protease              58.9    4e-08   
emb|CAN72470.1|  hypothetical protein VITISV_000738                   58.5    4e-08   
gb|KDO63673.1|  hypothetical protein CISIN_1g039265mg                 58.5    4e-08   
gb|KCW72066.1|  hypothetical protein EUGRSUZ_E00511                   58.5    4e-08   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                     58.5    4e-08   
gb|KHN44767.1|  Subtilisin-like protease                              58.5    4e-08   
gb|EYU35056.1|  hypothetical protein MIMGU_mgv1a002051mg              58.5    4e-08   
ref|XP_010058211.1|  PREDICTED: subtilisin-like protease SDD1         58.5    4e-08   
ref|XP_006440474.1|  hypothetical protein CICLE_v10023558mg           58.5    4e-08   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1         58.5    4e-08   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940        58.5    4e-08   
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like    58.5    5e-08   
ref|XP_010538433.1|  PREDICTED: subtilisin-like protease SBT5.4       58.5    5e-08   
gb|EMT24678.1|  Subtilisin-like protease                              58.2    5e-08   
gb|EPS72026.1|  serine protease                                       58.5    5e-08   
ref|XP_002299578.1|  hypothetical protein POPTR_0001s08340g           58.5    5e-08   
gb|EMS59706.1|  Subtilisin-like protease                              58.2    5e-08   



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S GF+PD TTD IALGAFHAVE+G++VVCSAGNSGP  S+VVN+APWI 
Sbjct  279  GVDVLSLSLGASPGFQPDLTTDPIALGAFHAVERGILVVCSAGNSGPSSSTVVNDAPWIL  338



>gb|AES74035.2| subtilisin-like serine protease [Medicago truncatula]
Length=423

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVL++SLG    F+PD TTD I +GAFHAVE G+VVVCSAGN GP +S+VVN+APWI 
Sbjct  71   GVDVLAISLGAHSFFRPDLTTDPIVIGAFHAVEHGIVVVCSAGNDGPTQSTVVNDAPWIL  130



>ref|XP_003603784.1| Subtilisin-like serine protease [Medicago truncatula]
Length=569

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVL++SLG    F+PD TTD I +GAFHAVE G+VVVCSAGN GP +S+VVN+APWI 
Sbjct  217  GVDVLAISLGAHSFFRPDLTTDPIVIGAFHAVEHGIVVVCSAGNDGPTQSTVVNDAPWIL  276



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+SLGGS   +PD  TDVIA+GAFHAVE+G+VV+CSAGNSGP +S+VVN+APWI 
Sbjct  253  GVDILSVSLGGSPDPQPDLKTDVIAIGAFHAVERGIVVICSAGNSGPEQSTVVNDAPWIL  312



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S GF+PD TTD IA+GAFHAVE+G+VV CSAGNSGP   +VVN+APWI 
Sbjct  277  GVDVLSLSLGASPGFQPDLTTDPIAIGAFHAVERGIVVACSAGNSGPSSYTVVNDAPWIL  336



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     +PD  TDVIA+GAFHA+E G+VVVCSAGNSGP  S+VVN+APWI 
Sbjct  271  GVDVLSLSLGRGPSSQPDLKTDVIAIGAFHAMEHGIVVVCSAGNSGPELSTVVNDAPWIL  330



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG    F+PD T D IA+GAFHAVEKG+ VVCSAGN GP   +VVN+APWI 
Sbjct  280  GVDVLSLSLGTPSVFRPDLTADPIAIGAFHAVEKGITVVCSAGNDGPSSGTVVNDAPWIL  339



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG S  F+PDFT+D IA+G+FHAV KGV VVCSAGNSGP  ++VVN APWI 
Sbjct  285  GVDVLSVSLGASPYFRPDFTSDPIAIGSFHAVAKGVTVVCSAGNSGPAAATVVNAAPWIL  344



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG    F+PD T D IA+GAFHAVEKG+ VVCSAGN GP   +VVN+APWI 
Sbjct  275  GVDVLSLSLGTPSVFRPDLTADPIAIGAFHAVEKGITVVCSAGNDGPSSGTVVNDAPWIL  334



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GV+VLSLSLG S  F+PD  TD +A+GAFHAVE+G++VVCSAGNSGP   +VVN+APWIF
Sbjct  284  GVNVLSLSLGASPDFRPDLATDPVAIGAFHAVERGILVVCSAGNSGPDPETVVNDAPWIF  343



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLGG    +PD  TDVIA+GAFHAVE+G+VVVC+AGN+GP RS++ N+APWI 
Sbjct  274  GVDVLSLSLGGGPDPEPDLKTDVIAIGAFHAVERGIVVVCAAGNAGPERSTLTNDAPWIL  333



>emb|CDP21113.1| unnamed protein product [Coffea canephora]
Length=381

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+PDF +D IA+GAFHA EKGV+V+CSAGN GP   +VVN APW+F
Sbjct  263  GVDIISISVGQSSVFQPDFLSDPIAIGAFHAAEKGVMVICSAGNEGPEPYTVVNSAPWLF  322



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G +PDF T+ IA+GAFHAVEKG+VVVCSAGNSGP   +VVN APWI 
Sbjct  275  GVDVLSLSLGSSPGLEPDFPTNPIAIGAFHAVEKGIVVVCSAGNSGPGPKTVVNTAPWIL  334



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+SLSLG S   +PDF  D IA+GAFHAV+KG+ VVCSAGN GP  S+VVN APWI 
Sbjct  285  GVDVMSLSLGASAYLRPDFNEDPIAIGAFHAVDKGITVVCSAGNDGPSSSTVVNAAPWIL  344



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG S  FKPDF  D IA+GAFHA + G++VVCSAGN GP  SSVVN APWI 
Sbjct  287  GVDILSLSLGASPFFKPDFVNDPIAIGAFHATQHGILVVCSAGNGGPDSSSVVNSAPWIL  346



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F+PDF+ D IA+G+FHAV KGV VVCSAGNSGP  ++VVN APWI 
Sbjct  310  GVDVISVSLGASPYFRPDFSADPIAIGSFHAVAKGVTVVCSAGNSGPGAATVVNAAPWIL  369



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F+PDF+ D IA+G+FHAV KGV VVCSAGNSGP  ++VVN APWI 
Sbjct  310  GVDVISVSLGASPYFRPDFSADPIAIGSFHAVAKGVTVVCSAGNSGPGAATVVNAAPWIL  369



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG S GF+PD T+D I+LGAFHA+E G++VVCSAGN GP   ++VN+APWI 
Sbjct  275  GVDVLSVSLGASTGFRPDLTSDPISLGAFHAMEHGILVVCSAGNDGPSSYTLVNDAPWIL  334



>ref|XP_010229422.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=521

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F PDF+ D IA+GAFHAV KGV V CSAGN+GP  S+VVN APWI 
Sbjct  26   GVDVISVSLGASPYFSPDFSEDPIAIGAFHAVAKGVTVACSAGNAGPGSSTVVNAAPWIM  85



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLS+G     +P+ TTD IA+GAFHAVE+G+VVVCSAGN G  R++V+N+APW+ 
Sbjct  275  GVDVLSLSIGPYSSSRPNLTTDPIAIGAFHAVERGIVVVCSAGNEGSERNTVINDAPWML  334



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G +PDF ++ IA+GAFHAVEKG+VVVCSAGNSGP   +VVN APWI 
Sbjct  275  GVDVLSLSLGSSPGLEPDFPSNPIAIGAFHAVEKGIVVVCSAGNSGPGPKTVVNTAPWIL  334



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F PDF+ D IA+G+FHAV KGV+VVCSAGN+GP  S+VVN APWI 
Sbjct  291  GVDVVSVSLGASPYFSPDFSEDPIAIGSFHAVAKGVMVVCSAGNAGPDASTVVNAAPWIM  350



>gb|EEE69927.1| hypothetical protein OsJ_29791 [Oryza sativa Japonica Group]
Length=468

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F+PDF+ D IA+G+FHAV KG++VVCSAGN+GP  ++VVN APWI 
Sbjct  264  GVDVISVSLGASPYFRPDFSDDPIAIGSFHAVAKGIMVVCSAGNAGPDAATVVNAAPWIL  323



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+PDF +D IA+GAFHA EKGV+V+CSAGN GP   +VVN APW+F
Sbjct  281  GVDIISISIGQSSVFQPDFLSDPIAIGAFHAAEKGVMVICSAGNEGPEPYTVVNSAPWLF  340



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+SLG S GF+PD T+D I+LGAFHA+E G++VVCSAGN GP   ++VN+APWI 
Sbjct  275  GVDLLSVSLGASTGFRPDLTSDPISLGAFHAMEHGILVVCSAGNDGPSSYTLVNDAPWIL  334



>ref|NP_001175897.1| Os09g0482660 [Oryza sativa Japonica Group]
 dbj|BAH94625.1| Os09g0482660, partial [Oryza sativa Japonica Group]
Length=523

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F+PDF+ D IA+G+FHAV KG++VVCSAGN+GP  ++VVN APWI 
Sbjct  22   GVDVISVSLGASPYFRPDFSDDPIAIGSFHAVAKGIMVVCSAGNAGPDAATVVNAAPWIL  81



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+SLG S GF+PD T+D I+LGAFHA+E G++VVCSAGN GP   ++VN+APWI 
Sbjct  275  GVDLLSVSLGASTGFRPDLTSDPISLGAFHAMEHGILVVCSAGNDGPSSYTLVNDAPWIL  334



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            GVDVLSLSLG    ++P+ ++D IA+GAFHAVE+G+ VVCSAGN GP R +VVN APWI
Sbjct  251  GVDVLSLSLGSPIEYEPELSSDPIAIGAFHAVEQGITVVCSAGNDGPSRETVVNAAPWI  309



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLS+G     +P+ TTD IA+GAFHAVE+G+VVVCSAGN G  R++V+N+APW+ 
Sbjct  275  GVDVLSLSIGPYSSSRPNLTTDPIAIGAFHAVERGIVVVCSAGNEGSERNTVINDAPWML  334



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+SLG S  F+PDF  D IA+GAFHAV KG+ VVCSAGN GP  S+VVN APWI 
Sbjct  302  GVDLLSVSLGASAYFRPDFDEDPIAIGAFHAVAKGITVVCSAGNYGPDASTVVNAAPWIL  361



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F+PDF+ D IA+G+FHAV KG++VVCSAGN+GP  ++VVN APWI 
Sbjct  309  GVDVISVSLGASPYFRPDFSDDPIAIGSFHAVAKGIMVVCSAGNAGPDAATVVNAAPWIL  368



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     +P  T+D IA+GAFHAV++G++VVC+AGN+GP + SVVN+APWI 
Sbjct  278  GVDVLSLSLGVLPLSRPKLTSDTIAIGAFHAVQRGILVVCAAGNAGPLKYSVVNDAPWIL  337



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D TTD +A+GAFHAVE+G++VVCSAGNSGP+  +V+N+APWIF
Sbjct  294  DLTTDPVAIGAFHAVERGILVVCSAGNSGPHNRTVLNDAPWIF  336



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG S  F PDF TD IA+G+FHAVEKG+ VVCSAGN GP   +VVN APWI 
Sbjct  266  GVDLLSLSLGSSAVFAPDFATDPIAIGSFHAVEKGITVVCSAGNDGPSPQTVVNVAPWIL  325



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG S  F+PDF  D IA+GAFHAV KG+ VVCSAGN GP   +VVN APWI 
Sbjct  284  GVDLLSLSLGASPYFRPDFDQDPIAIGAFHAVAKGITVVCSAGNDGPSAGTVVNAAPWIL  343



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG S  F+PDF  D IA+GAFHAV KG+ VVCSAGN GP   +VVN APWI 
Sbjct  284  GVDLLSLSLGASAYFRPDFDEDPIAIGAFHAVAKGITVVCSAGNDGPDAGTVVNAAPWIL  343



>gb|KHN45943.1| Subtilisin-like protease [Glycine soja]
Length=482

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG S GF+PD T+D IA+GAFHAVE+G++VVC  GN GP   ++VN+APWI 
Sbjct  114  GVDVLSVSLGASTGFRPDLTSDPIAIGAFHAVERGILVVCFVGNDGPSSYTLVNDAPWIL  173



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G +P+F+ D IA+GAFHAVEKG++VVCSAGN GP   SVVN APWI 
Sbjct  275  GVDVLSLSLGSSSGLEPEFSNDPIAIGAFHAVEKGILVVCSAGNDGPSAKSVVNVAPWIL  334



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G +P+F+ D IA+GAFHAVEKG++VVCSAGN GP   SVVN APWI 
Sbjct  275  GVDVLSLSLGSSSGLEPEFSNDPIAIGAFHAVEKGILVVCSAGNDGPSAKSVVNVAPWIL  334



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +PDF+TD IA+GAFHAVEKG++V CSAGNSGP   +VVN APWI 
Sbjct  252  EPDFSTDPIAIGAFHAVEKGIIVACSAGNSGPSPLTVVNVAPWIL  296



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            G DV+S+SLG S  F+PDF+ D IA+G+FHAV KGV+VVCSAGN+GP  ++VVN APWI 
Sbjct  308  GGDVISVSLGASPYFRPDFSEDPIAIGSFHAVAKGVMVVCSAGNAGPDAATVVNAAPWIL  367



>ref|XP_002461867.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
 gb|EER98388.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
Length=826

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S  F PD   D IA+GAFHAV KGV+VVCSAGNSGP  ++VVN APWI 
Sbjct  315  GVDVVSVSLGASPYFLPDLYADPIAIGAFHAVAKGVMVVCSAGNSGPDAATVVNAAPWIL  374



>ref|XP_006645770.1| PREDICTED: subtilisin-like protease-like, partial [Oryza brachyantha]
Length=564

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF TD IALGAFHA +KGV+VVCS GN GP   +VVN APWI 
Sbjct  206  GVDVVSISIGMSSAFQSDFLTDPIALGAFHAHQKGVLVVCSGGNDGPNPYTVVNSAPWIL  265



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG + GF+P+ + D IA+GAFHAVE+G+ VVCSAGN GP   +VVN APWI 
Sbjct  304  GVDVLSLSLGSASGFQPELSNDPIAIGAFHAVEQGITVVCSAGNDGPDPGTVVNAAPWIL  363



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG    FKP+   D IA+GAFHAV+  + VVCSAGN GP R SVVN APWI 
Sbjct  240  GVDVLSLSLGAPSFFKPELIDDPIAIGAFHAVQHNITVVCSAGNDGPTRGSVVNAAPWIL  299



>gb|EYU38295.1| hypothetical protein MIMGU_mgv1a0026492mg, partial [Erythranthe 
guttata]
Length=242

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA + GV VVCSAGN GP   +VVN APWIF
Sbjct  134  GVDIISVSIGMSSIFESDFLSDPIAIGAFHAEQSGVTVVCSAGNDGPDSYTVVNSAPWIF  193



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG    FKP+   D IA+GAFHAV+  + VVCSAGN GP R SVVN APWI 
Sbjct  240  GVDVLSLSLGAPSFFKPELIDDPIAIGAFHAVQHNITVVCSAGNDGPTRGSVVNAAPWIL  299



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+SLG S   +PDF  D IA+GAFHAV KG+ VVCSAGN GP  +S+VN APWI 
Sbjct  282  GVDLMSVSLGASKFNRPDFAADPIAIGAFHAVAKGITVVCSAGNDGPSSASLVNTAPWIL  341



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            GVDVLSLSLG    ++P+ ++D IA+GAFHAVE+G+ VVCSAGN GP   +VVN APWI
Sbjct  289  GVDVLSLSLGSPIEYEPELSSDPIAIGAFHAVEQGITVVCSAGNDGPSPETVVNAAPWI  347



>ref|XP_009607188.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=792

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF  D IA+GAFHA E+GVVVVCSAGN GP   +V N APWIF
Sbjct  290  GVDIISISIGRSFVFQTDFKDDPIAIGAFHAAERGVVVVCSAGNEGPDPYTVTNSAPWIF  349



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG S G + +F+ D IA+GAFHAVEKG++VVCSAGN GP R +VVN APWI 
Sbjct  271  GVDILSLSLGASAGSELEFSVDPIAIGAFHAVEKGILVVCSAGNDGPARETVVNVAPWIL  330



>ref|XP_008778811.1| PREDICTED: xylem serine proteinase 1-like [Phoenix dactylifera]
Length=171

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV +G+ VVCSAGNSGPY  +V+N APWI 
Sbjct  91   PAYVEDVLAIGSFHAVARGITVVCSAGNSGPYSQTVINTAPWII  134



>gb|EYU17578.1| hypothetical protein MIMGU_mgv1a0038491mg, partial [Erythranthe 
guttata]
Length=501

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +P+F TD +A+GAFHAVE+G+ VVCSAGNSGP  +S VN APWI 
Sbjct  99   RPNFQTDPVAIGAFHAVERGITVVCSAGNSGPSPASAVNVAPWIM  143



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G +  F+ DF  D IA+GAFHA + GV+VVCSAGNSGP   ++VN APWIF
Sbjct  288  GVDIISVSIGMTSIFQSDFLNDPIAIGAFHAQQMGVMVVCSAGNSGPDPYTIVNSAPWIF  347



>ref|XP_008375386.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+PD+  D IA+GAFHA + GV+V+CSAGN GP   ++VN APWIF
Sbjct  286  GVDVISISIGMSSLFQPDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPYTIVNTAPWIF  345



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG   GF  D   D IA+GAFHAVE G+ VVCSAGN GP   +VVN+APWI 
Sbjct  263  GVDVLSISLGTPSGFVSDLNKDTIAIGAFHAVENGITVVCSAGNDGPTSGTVVNDAPWIL  322



>gb|KDP36888.1| hypothetical protein JCGZ_08179 [Jatropha curcas]
Length=705

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG   GF  D   D IA+GAFHAVE G+ VVCSAGN GP   +VVN+APWI 
Sbjct  230  GVDVLSISLGTPSGFVSDLNKDTIAIGAFHAVENGITVVCSAGNDGPTSGTVVNDAPWIL  289



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            GVDVLSLSLG    FKP+   D IALGAFHAV+ G+ VVCSAGN GP   +VVN APWI
Sbjct  274  GVDVLSLSLGAPSFFKPEIADDPIALGAFHAVQHGITVVCSAGNDGPDPGTVVNAAPWI  332



>ref|XP_008800195.1| PREDICTED: xylem serine proteinase 1-like [Phoenix dactylifera]
Length=349

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+SLG     +P+F  D IA+GAFHAV KG+ VVCSAGN GP   +VVN APWI 
Sbjct  149  GVDLLSVSLGAERNSRPEFDKDPIAIGAFHAVAKGITVVCSAGNDGPGAGTVVNAAPWIL  208



>gb|KHN10324.1| Subtilisin-like protease [Glycine soja]
Length=778

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA +KGV+VVCSAGN GP   +VVN APWIF
Sbjct  287  GVDIISISIGLSSLFQSDFLSDPIAIGAFHAEQKGVLVVCSAGNDGPDPFTVVNSAPWIF  346



>ref|XP_003541562.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=778

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA +KGV+VVCSAGN GP   +VVN APWIF
Sbjct  287  GVDIISISIGLSSLFQSDFLSDPIAIGAFHAEQKGVLVVCSAGNDGPDPFTVVNSAPWIF  346



>gb|KHN10158.1| Subtilisin-like protease [Glycine soja]
Length=721

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA +KGV+VVCSAGN GP   +VVN APWIF
Sbjct  230  GVDIISISIGLSSLFQSDFLSDPIAIGAFHAEQKGVLVVCSAGNDGPDPFTVVNTAPWIF  289



>gb|EPS69827.1| hypothetical protein M569_04935, partial [Genlisea aurea]
Length=721

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF  D IA+GAFHA + GV VVCS GN GP  S+VVN APWIF
Sbjct  231  GVDIISISIGVSSIFQSDFLNDPIAIGAFHAAQMGVAVVCSGGNDGPQASTVVNSAPWIF  290



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA +KGV+VVCSAGN GP   +VVN APWIF
Sbjct  286  GVDIISISIGLSSLFQSDFLSDPIAIGAFHAEQKGVLVVCSAGNDGPDPFTVVNTAPWIF  345



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S  F+ +F+TD IA+GA+HAV KG+ VVCSAGN GP   +VVN APWI 
Sbjct  249  GVDVLSLSLGSSAVFELEFSTDPIAIGAYHAVAKGITVVCSAGNDGPSPQTVVNIAPWIL  308



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S  F+ +F+TD IA+GA+HAV KG+ VVCSAGN GP   +VVN APWI 
Sbjct  274  GVDVLSLSLGSSAVFELEFSTDPIAIGAYHAVAKGITVVCSAGNDGPSPQTVVNIAPWIL  333



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  177  VDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            VDVLSLSLG    F+PD   D IA+GAFHAVEKG+ VVCSAGN GP  ++V N  PWI 
Sbjct  178  VDVLSLSLGSPAVFRPDLDNDPIAIGAFHAVEKGITVVCSAGNDGPSPATVSNAVPWIL  236



>gb|KDO37215.1| hypothetical protein CISIN_1g038289mg, partial [Citrus sinensis]
Length=226

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP  S+VVN APWIF
Sbjct  107  GVDIISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPSTVVNTAPWIF  166



>ref|XP_007133571.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
 gb|ESW05565.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
Length=678

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF +D IA+GAFHA + GV+VVCSAGN GP   +VVN APWIF
Sbjct  187  GVDVISISIGLSSLFQADFLSDPIAIGAFHAEQMGVMVVCSAGNDGPDPFTVVNSAPWIF  246



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+++G+FHAV KG+ V+CSAGNSGPY  +V+N APWIF
Sbjct  262  PSYVKDVVSIGSFHAVAKGISVICSAGNSGPYPQTVINSAPWIF  305



>gb|EAY73513.1| hypothetical protein OsI_01395 [Oryza sativa Indica Group]
Length=788

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF  D IALGAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  287  GVDVVSISIGMSSAFQSDFLADPIALGAFHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  346



>dbj|BAA89562.1| putative subtilisin-like protein [Oryza sativa Japonica Group]
Length=795

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF  D IALGAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  290  GVDVVSISIGMSSAFQSDFLADPIALGAFHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  349



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV KGVVVVCSAGNSGPY  +V+N APWI
Sbjct  294  PAYVDDVLSIGSFHAVAKGVVVVCSAGNSGPYSETVINSAPWI  336



>dbj|BAJ99628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F  DF +D IALGAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  293  GVDVISISIGMSSAFASDFLSDPIALGAFHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  352



>ref|XP_008672702.1| PREDICTED: uncharacterized protein LOC100279461 isoform X1 [Zea 
mays]
 tpg|DAA54193.1| TPA: putative subtilase family protein [Zea mays]
Length=782

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF TD IALGA HA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  287  GVDVISISIGMSSVFQSDFLTDPIALGALHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  346



>ref|NP_001145938.1| uncharacterized protein LOC100279461 precursor [Zea mays]
 gb|ACL52885.1| unknown [Zea mays]
Length=803

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF TD IALGA HA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  287  GVDVISISIGMSSVFQSDFLTDPIALGALHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  346



>ref|NP_001063751.1| Os09g0530800 [Oryza sativa Japonica Group]
 dbj|BAF25665.1| Os09g0530800 [Oryza sativa Japonica Group]
 gb|EAZ45452.1| hypothetical protein OsJ_30103 [Oryza sativa Japonica Group]
Length=769

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV KGVVVVCSAGNSGPY  +V+N APWI
Sbjct  294  PAYVDDVLSIGSFHAVAKGVVVVCSAGNSGPYSETVINSAPWI  336



>ref|XP_002457657.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
 gb|EES02777.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
Length=790

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF TD IALGA HA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  294  GVDVISISIGMSSVFQSDFLTDPIALGALHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  353



>gb|EEE54331.1| hypothetical protein OsJ_01304 [Oryza sativa Japonica Group]
Length=958

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF  D IALGAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  258  GVDVVSISIGMSSAFQSDFLADPIALGAFHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  317



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG +  ++PD ++D IA+GAFHAVE+G++VV SAGN GP R +V N APW+ 
Sbjct  287  GVDVLSLSLGSTS-YQPDLSSDPIAMGAFHAVERGIIVVSSAGNDGPNRETVANFAPWLL  345



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV KG+VVVCSAGNSGPY  +V+N APWI
Sbjct  293  PAYVDDVLSIGSFHAVAKGIVVVCSAGNSGPYSETVINSAPWI  335



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+PD+  D IA+GAFHA + GV+V+CS GN GP   +VVN APWIF
Sbjct  280  GVDMISISIGLSSLFQPDYLNDPIAIGAFHAEQMGVMVICSGGNDGPDPYTVVNTAPWIF  339



>ref|XP_009355089.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP   ++VN APWIF
Sbjct  291  GVDVISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPNPYTIVNTAPWIF  350



>ref|XP_009400152.1| PREDICTED: subtilisin-like protease SBT5.4 [Musa acuminata subsp. 
malaccensis]
Length=740

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF +D IA+GAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  249  GVDVISISIGMSSAFQTDFLSDPIAIGAFHANQRGVMVVCSGGNDGPDPYTVVNSAPWIL  308



>gb|EMT32761.1| Subtilisin-like protease [Aegilops tauschii]
Length=779

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            PD  TD +ALGAFHA ++GV+VVCSAGN GP  S+VVN APWI 
Sbjct  303  PDLLTDPVALGAFHAHQRGVLVVCSAGNDGPDPSTVVNSAPWIL  346



>ref|XP_006471277.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=806

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP  S+VVN APWIF
Sbjct  314  GVDIISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPSTVVNTAPWIF  373



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+++LS+G   G + +F+T+ IA+GAFHAVEKG+ VV SAGN GP R SVVN APWIF
Sbjct  275  GVDIINLSIGQPAGAEFEFSTNPIAIGAFHAVEKGIFVVASAGNDGPSRESVVNVAPWIF  334



>ref|XP_006432516.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45756.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=780

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP  S+VVN APWIF
Sbjct  288  GVDIISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPSTVVNTAPWIF  347



>ref|XP_006432515.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45755.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=779

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP  S+VVN APWIF
Sbjct  287  GVDIISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPSTVVNTAPWIF  346



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+SLG S    P+ T+D IA+GAFHA E G++VVCSAGN GP   +VVN APWI 
Sbjct  272  GVDVVSVSLGASAMSIPEVTSDPIAIGAFHAAENGILVVCSAGNDGPSSGTVVNAAPWIL  331



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+VVVCSAGNSGPY  +V+N APWI
Sbjct  290  PAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAPWI  332



>ref|XP_006660880.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=768

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHA  KGVVVVCSAGNSGPY  +V+N APWI
Sbjct  293  PAYVNDVLSIGSFHAAAKGVVVVCSAGNSGPYSETVINSAPWI  335



>tpg|DAA62443.1| TPA: putative subtilase family protein [Zea mays]
Length=496

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+VVVCSAGNSGPY  +V+N APW+
Sbjct  130  PAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAPWL  172



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG    F  D+  D IA+GAFHAVE G+ VVCSAGN GP   +V N APWI 
Sbjct  271  GVDILSLSLGSPASFMLDYKEDPIAIGAFHAVENGITVVCSAGNDGPSEETVTNVAPWIL  330



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG    F  D+  D IA+GAFHAVE G+ VVCSAGN GP   +V N APWI 
Sbjct  269  GVDILSLSLGSPASFMLDYKEDPIAIGAFHAVENGITVVCSAGNDGPSEETVTNVAPWIL  328



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+++LS+G   G + +F+T+ IA+GAFHAVEKG+ VV SAGN GP R +VVN APWIF
Sbjct  272  GVDIINLSIGQPAGAEFEFSTNPIAIGAFHAVEKGIFVVASAGNDGPLRETVVNVAPWIF  331



>ref|XP_002525580.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF36839.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=777

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ D+  D IA+GAFHA + GV+++CSAGN GP   ++VN APWIF
Sbjct  287  GVDVISISIGLSSIFQSDYLNDPIAIGAFHAQQMGVMIICSAGNDGPDPYTIVNSAPWIF  346



>gb|AES89241.2| subtilisin-like serine protease [Medicago truncatula]
Length=545

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+A+G+FHAV KGV VVCS GNSGPY  +V+N APW+
Sbjct  226  PSYVEDVLAIGSFHAVAKGVSVVCSGGNSGPYAQTVINTAPWV  268



>tpg|DAA62442.1| TPA: putative subtilase family protein [Zea mays]
Length=487

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+VVVCSAGNSGPY  +V+N APW+
Sbjct  293  PAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAPWL  335



>ref|XP_006347851.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=774

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF  D IA+GAFHA E+G+ VVCS+GN GP   +V N APWIF
Sbjct  285  GVDIISISIGRSFVFQTDFKDDPIAIGAFHAAERGIGVVCSSGNEGPDPYTVTNSAPWIF  344



>ref|XP_004967678.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=781

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ DF +D IALGA HA ++GV+VVCS GN GP   +VVN APW+ 
Sbjct  286  GVDVISISIGMSSAFQSDFLSDPIALGALHAHQRGVLVVCSGGNDGPNPYTVVNSAPWLL  345



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLGGS G     T D IALGAFHAVE G+ VVCSAGN GP   SVVN APWIF
Sbjct  108  GVDVLSLSLGGSAGIVRPLTDDPIALGAFHAVEHGITVVCSAGNDGPSSGSVVNFAPWIF  167



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S GF+ + + + IA+GAFHAVEKG+VVVCSAGNSGP   +VVN APWI 
Sbjct  277  GVDVLSLSLGSSPGFE-ELSKNPIAIGAFHAVEKGIVVVCSAGNSGPDPKTVVNTAPWIL  335



>emb|CDM82985.1| unnamed protein product [Triticum aestivum]
Length=787

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S     DF +D IALGAFHA ++GV+VVCS GN GP   +VVN APWI 
Sbjct  294  GVDVISISIGMSSALASDFLSDPIALGAFHAHQRGVLVVCSGGNDGPNPYTVVNSAPWIL  353



>gb|AES74037.2| subtilisin-like serine protease [Medicago truncatula]
Length=373

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            KPD  TD  A+GAFHA+E+G+VVVCSA NSG   S+V N+APWI 
Sbjct  185  KPDLKTDSTAIGAFHAMERGIVVVCSARNSGRKPSTVSNDAPWIL  229



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S GF+ + + + IA+GAFHAVEKG+VVVCSAGNSGP   +VVN APWI 
Sbjct  277  GVDVLSLSLGSSPGFE-ELSKNPIAIGAFHAVEKGIVVVCSAGNSGPDPKTVVNTAPWIL  335



>dbj|BAA13135.1| subtilisin-like protein [Picea abies]
Length=779

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G     + DF  D IA+GAFHA +KG++VV SAGN GP   +VVN APWIF
Sbjct  284  GVDIVSISIGVRSSNQADFVKDAIAIGAFHATQKGILVVSSAGNEGPDSQTVVNAAPWIF  343



>tpg|DAA62441.1| TPA: putative subtilase family protein [Zea mays]
Length=593

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+VVVCSAGNSGPY  +V+N APW+
Sbjct  293  PAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAPWL  335



>ref|XP_010543788.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Tarenaya 
hassleriana]
Length=766

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD +S+S+G     +PDF  D IA+GAFHA  +G++V+CSAGN GP   +VVN APWIF
Sbjct  282  GVDFISISIGLGSSLQPDFLVDPIAIGAFHAELRGILVICSAGNEGPTPFTVVNAAPWIF  341



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+VVVCSAGNSGPY  +V+N APW+
Sbjct  293  PAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAPWL  335



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHAVE+G++V+CSAGN GP   +V N APWI 
Sbjct  233  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAVEQGILVICSAGNDGPDGGTVTNTAPWIL  292



>ref|XP_003603786.1| Subtilisin-like protease [Medicago truncatula]
Length=402

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            KPD  TD  A+GAFHA+E+G+VVVCSA NSG   S+V N+APWI 
Sbjct  185  KPDLKTDSTAIGAFHAMERGIVVVCSARNSGRKPSTVSNDAPWIL  229



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHAVE+G++V+CSAGN GP   +V N APWI 
Sbjct  273  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAVEQGILVICSAGNDGPDGGTVTNTAPWIM  332



>ref|XP_010109770.1| hypothetical protein L484_008446 [Morus notabilis]
 gb|EXC24675.1| hypothetical protein L484_008446 [Morus notabilis]
Length=745

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV KG+ VVCS GNSGPY  +V+N APWI 
Sbjct  263  PSYIDDVLAIGSFHAVAKGISVVCSGGNSGPYTQTVINTAPWIL  306



>ref|XP_002272598.1| PREDICTED: xylem serine proteinase 1 [Vitis vinifera]
 emb|CBI38829.3| unnamed protein product [Vitis vinifera]
Length=736

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P++  D IA+GAFHA++KG++ V SAGN GP +SS+VN APWIF
Sbjct  277  PNYAEDSIAIGAFHAMKKGILTVASAGNDGPSQSSIVNHAPWIF  320



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHAVE+G++V+CSAGN GP   +V N APWI 
Sbjct  233  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAVEQGILVICSAGNDGPDGGTVTNTAPWIM  292



>ref|XP_003567246.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=779

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            GVDV+S+S+G S  F  DF +D IA+GAFHA  +GV+VVCSAGN GP   +VVN APWI
Sbjct  283  GVDVISMSVGVSSAFPDDFLSDPIAIGAFHAHRRGVLVVCSAGNDGPVPYTVVNAAPWI  341



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG     K +   D IA+GAFHAVEKG++V+CSAGN GP   +VVN APWI 
Sbjct  266  GVDILSLSLGAPSWAKIELNADPIAIGAFHAVEKGIMVICSAGNDGPGEGTVVNSAPWIL  325



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHAVE+G++V+CSAGN GP   +V N APWI 
Sbjct  272  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAVEQGILVICSAGNDGPDGGTVTNTAPWIM  331



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHAVE+G++V+CSAGN GP   +V N APWI 
Sbjct  272  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAVEQGILVICSAGNDGPDGGTVTNTAPWIM  331



>ref|XP_009391632.1| PREDICTED: subtilisin-like protease isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=826

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA ++GV+V+CS GN GP   +VVN APWI 
Sbjct  336  GVDMISISIGMSSVFQSDFLSDPIAIGAFHAHQRGVLVICSGGNDGPDPYTVVNSAPWIL  395



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA ++GV+V+CS GN GP   +VVN APWI 
Sbjct  285  GVDMISISIGMSSVFQSDFLSDPIAIGAFHAHQRGVLVICSGGNDGPDPYTVVNSAPWIL  344



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLGGS G     T D IALGAFHAVE G+ VVCSAGN GP   SVVN APWIF
Sbjct  275  GVDVLSLSLGGSAGIVRPLTDDPIALGAFHAVEHGITVVCSAGNDGPSSGSVVNFAPWIF  334



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLGGS G     T D IALGAFHAVE G+ VVCSAGN GP   SVVN APWIF
Sbjct  275  GVDVLSLSLGGSAGIVRPLTDDPIALGAFHAVEHGITVVCSAGNDGPSSGSVVNFAPWIF  334



>gb|EMS51782.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=734

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV +G+ VVCSAGNSGPY  +V+N APW+ 
Sbjct  296  PAYVDDVLAIGSFHAVVRGITVVCSAGNSGPYSETVINSAPWVL  339



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV +G+ VVCSAGNSGPY  +V+N APW+ 
Sbjct  295  PAYVDDVLAIGSFHAVVRGITVVCSAGNSGPYSETVINSAPWVL  338



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP   ++VN APWIF
Sbjct  284  GVDIISISIGMSSIFQSDYLNDPIAIGAFHAQQMGVMVICSAGNDGPDPFTIVNSAPWIF  343



>ref|XP_002972076.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
 gb|EFJ26993.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
Length=742

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            PDF  D IALGAFHA++KG+ VVCSAGN GP   SVVN  PWI 
Sbjct  260  PDFFQDGIALGAFHAIQKGITVVCSAGNDGPKVGSVVNLPPWIL  303



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+ VVCSAGNSGPY  +V+N APWI
Sbjct  291  PAYVDDVLSIGSFHAVARGIAVVCSAGNSGPYSETVINSAPWI  333



>ref|XP_002972619.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
 gb|EFJ26705.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
Length=747

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            PDF  D IALGAFHA++KG+ VVCSAGN GP   SVVN  PWI 
Sbjct  264  PDFFQDGIALGAFHAIQKGITVVCSAGNDGPKVGSVVNLPPWIL  307



>gb|EMT21161.1| Cucumisin [Aegilops tauschii]
Length=710

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV +G+ VVCSAGNSGPY  +V+N APW+ 
Sbjct  298  PAYVDDVLAIGSFHAVVRGITVVCSAGNSGPYSETVINSAPWVL  341



>ref|XP_003607044.1| Subtilisin-like protease [Medicago truncatula]
Length=562

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+A+G+FHAV KGV VVCS GNSGPY  +V+N APW+ 
Sbjct  243  PSYVEDVLAIGSFHAVAKGVSVVCSGGNSGPYAQTVINTAPWVI  286



>ref|XP_008346279.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=781

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S+S+G S  F+ D+  D IA+GAFHA + GV+V+CSAGN GP   ++ N APWIF
Sbjct  291  GVDVISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDPYTIANTAPWIF  350



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            + P F TD IA+GAFHAV KG+VV CSAGNSGP   + VN APWI 
Sbjct  305  YAPRFYTDSIAIGAFHAVRKGIVVSCSAGNSGPGEYTAVNIAPWIL  350



>ref|NP_001146035.1| uncharacterized protein LOC100279566 [Zea mays]
 gb|ACL53074.1| unknown [Zea mays]
Length=503

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            + P F TD IA+GAFHAV KG+VV CSAGNSGP   + VN APWI 
Sbjct  21   YAPSFFTDSIAIGAFHAVSKGIVVSCSAGNSGPGEYTAVNIAPWIL  66



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G + +F++D IA+GAFHAVEKG++V CSAGN GP  ++VVN APWI 
Sbjct  276  GVDVLSLSLGSSSGLEVEFSSDPIAIGAFHAVEKGILVSCSAGNDGPGPATVVNVAPWIL  335



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S   + D+  D IA+GAFHA ++GV VVCSAGN GP  ++VVN APWIF
Sbjct  276  GVDIISISIGLSSLMQSDYLNDPIAIGAFHAEQRGVTVVCSAGNDGPDPNTVVNTAPWIF  335



>gb|KEH19203.1| subtilisin-like serine protease [Medicago truncatula]
Length=636

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F  ++ +D IA+GAFHA ++GV+VVCSAGN GP   +VVN APWIF
Sbjct  149  GVDIISISIGFSSEFLSEYLSDPIAIGAFHAEQRGVMVVCSAGNEGPDHYTVVNTAPWIF  208



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S   + D+  D IA+GAFHA ++GV VVCSAGN GP  ++VVN APWIF
Sbjct  276  GVDIISISIGLSSLMQSDYLNDPIAIGAFHAEQRGVTVVCSAGNDGPDPNTVVNTAPWIF  335



>ref|XP_009351289.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Pyrus 
x bretschneideri]
Length=769

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +  D +A+G+FHAV KG+ VVCSAGNSGPY  +V+N APWIF
Sbjct  298  YVEDAMAIGSFHAVAKGISVVCSAGNSGPYPQTVINSAPWIF  339



>ref|XP_008668394.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
Length=630

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+++G+FHAV +G+ VVCSAGNSGPY  +V+N APWI
Sbjct  291  PAYVDDVLSIGSFHAVARGIAVVCSAGNSGPYSETVINSAPWI  333



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +  D +A+G+FHAV KG+ VVCSAGNSGPY  +V+N APWIF
Sbjct  298  YVEDAMAIGSFHAVAKGISVVCSAGNSGPYPQTVINSAPWIF  339



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F  ++ +D IA+GAFHA ++GV+VVCSAGN GP   +VVN APWIF
Sbjct  273  GVDIISISIGFSSEFLSEYLSDPIAIGAFHAEQRGVMVVCSAGNEGPDHYTVVNTAPWIF  332



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            + P F TD IA+GAFHAV KG+VV CSAGNSGP   + VN APWI 
Sbjct  301  YAPSFFTDSIAIGAFHAVSKGIVVSCSAGNSGPGEYTAVNIAPWIL  346



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+++G+ HAV KG+VVVCSAGNSGPY  +V+N APW+ 
Sbjct  295  PAYVDDVLSIGSLHAVMKGIVVVCSAGNSGPYSETVINSAPWVL  338



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHA+E+G++V+CSAGN GP   +V N APWI 
Sbjct  272  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAMEQGILVICSAGNDGPDGGTVTNTAPWIM  331



>ref|XP_009781097.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=754

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +F  DVIA+GAF A+EKG+ V C+AGNSGPYR S  NEAPWI 
Sbjct  289  NFYEDVIAVGAFSAMEKGIFVSCAAGNSGPYRFSTSNEAPWIL  331



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  DV+++G+FHAV KG+ V+CSAGNSG Y  +V+N APWIF
Sbjct  297  PSYVEDVVSIGSFHAVAKGISVICSAGNSGSYPQTVINSAPWIF  340



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG       +  TD IA+GAFHAVE+G++VVCSAGN GP   +VVN APWI 
Sbjct  274  GVDVLSLSLGAPSYAHIELNTDPIAIGAFHAVEQGILVVCSAGNDGPNGGTVVNTAPWIM  333



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG       +  TD IA+GAFHAVE+G++VVCSAGN GP   +VVN APWI 
Sbjct  274  GVDVLSLSLGAPSYAHIELNTDPIAIGAFHAVEQGILVVCSAGNDGPNGGTVVNTAPWIM  333



>emb|CDY57477.1| BnaAnng14590D [Brassica napus]
Length=781

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G +  FK D+ +D IA+GAFHA  KG++V+ SAGN GP  S+V N APW+F
Sbjct  292  GVDIISISIGLNAAFKSDYLSDPIAIGAFHAELKGIMVIASAGNDGPIASTVTNVAPWLF  351



>ref|XP_004292430.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=801

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
             +  DV+++G+FHAV +G+ VVCSAGNSGPY  +V+N APWIF
Sbjct  318  SYIEDVVSIGSFHAVAQGISVVCSAGNSGPYSQTVINSAPWIF  360



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G +  FK D+ +D IA+GAFHA  KG++V+ SAGN GP  S+V N APW+F
Sbjct  271  GVDIISISIGLNAAFKSDYLSDPIAIGAFHAELKGIMVIASAGNDGPIASTVTNVAPWLF  330



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHA+E+G++V+CSAGN GP   +V N APWI 
Sbjct  287  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAMEQGILVICSAGNDGPDVGTVTNTAPWIM  346



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + D  TD IA+GAFHA+E+G++V+CSAGN GP   +V N APWI 
Sbjct  287  GVDVLSLSLGAPAYARIDLNTDPIAIGAFHAMEQGILVICSAGNDGPDVGTVTNTAPWIM  346



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S   + D+  D IA+GAFHA ++GV+VVCSAGN GP   +VVN APWIF
Sbjct  279  GVDIISISIGLSSLMQSDYLNDPIAIGAFHAEQRGVMVVCSAGNDGPDPYTVVNTAPWIF  338



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF  D IA+GAFHA + GV+VVCS GN GP   +VVN APWIF
Sbjct  286  GVDIISISIGMSSIFQSDFLNDPIAIGAFHANQMGVMVVCSGGNDGPDPYTVVNSAPWIF  345



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG S G   D T D I++GAFHAVE+G++VVC+ GN GP  SS+ N++PWI 
Sbjct  279  GVDVLSVSLGASAGEDKDLTKDPISIGAFHAVERGILVVCAGGNDGPTPSSIENDSPWIL  338



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG S G + +F+ D IA+GAFHAVEKG++V CSAGN GP  ++VVN APWI 
Sbjct  276  GVDVLSLSLGSSSGLEVEFSRDPIAIGAFHAVEKGILVSCSAGNDGPGPATVVNVAPWIL  335



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  DV+A+G+FHAV +G+ VVCSAGNSGP+  +V+N APW+
Sbjct  294  PTYIEDVLAIGSFHAVARGITVVCSAGNSGPFSQTVINTAPWV  336



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APWI 
Sbjct  296  PSYVDDTLAIGSFHAVAKGITVVCSGGNSGPYPQTVINTAPWII  339



>ref|XP_009776157.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=748

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  D IALGA+ A ++G++VVCSAGNSGP  SSV+NEAPWI 
Sbjct  278  FHNDPIALGAYSATQRGILVVCSAGNSGPSESSVLNEAPWIL  319



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APWI 
Sbjct  319  PSYVDDTLAIGSFHAVAKGITVVCSGGNSGPYPQTVINTAPWII  362



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + +  TD IA+G+FHAVE+G++VVCSAGN GP   +VVN APWI 
Sbjct  276  GVDVLSLSLGAPSYARIELNTDPIAIGSFHAVEQGILVVCSAGNDGPDVGTVVNTAPWIM  335



>gb|KGN55997.1| hypothetical protein Csa_3G045110 [Cucumis sativus]
Length=632

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF+ DV A+GAFHAV++G+VVVCSAGNSGP   +V N APWI 
Sbjct  163  DFSDDVTAIGAFHAVQQGIVVVCSAGNSGPAPGTVENVAPWII  205



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLSLSLG     + +  TD IA+GAFHA+E+G+VVVCSAGN GP   +V N APWI 
Sbjct  269  GVDVLSLSLGAPSYARIELNTDPIAIGAFHAMEQGIVVVCSAGNDGPDVGTVTNTAPWIM  328



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LSLSLG       DF  D IA+GAFHAVE G+ VVCSAGN GP   +V N APWI 
Sbjct  274  GVDILSLSLGSPASRISDFKEDPIAIGAFHAVENGITVVCSAGNDGPSEKTVSNGAPWIL  333



>ref|XP_002985983.1| hypothetical protein SELMODRAFT_234928 [Selaginella moellendorffii]
 gb|EFJ13160.1| hypothetical protein SELMODRAFT_234928 [Selaginella moellendorffii]
Length=705

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+ TD IA+GAFHAV+ G++VV S GNSGPY S++ N APWI 
Sbjct  272  DYNTDGIAIGAFHAVQNGILVVASGGNSGPYPSTITNTAPWIL  314



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +  D +A+G+FHAV +G+ V+CSAGNSGPY  +V+N APWIF
Sbjct  299  YVEDAVAIGSFHAVARGISVICSAGNSGPYPQTVINSAPWIF  340



>gb|EYU39036.1| hypothetical protein MIMGU_mgv1a026993mg [Erythranthe guttata]
Length=745

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  DVIA+GAF A++KG+ V CSAGNSGP+ +S+ NEAPWI 
Sbjct  282  DFFDDVIAVGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWIL  324



>gb|KCW65828.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=472

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+VVCS GN GP   +VVN APWIF
Sbjct  284  GVDIISISIGSSSTFQADYLHDPIAIGAFHAEQMGVLVVCSGGNDGPDAYTVVNTAPWIF  343



>ref|XP_002985746.1| hypothetical protein SELMODRAFT_424725 [Selaginella moellendorffii]
 gb|EFJ13324.1| hypothetical protein SELMODRAFT_424725 [Selaginella moellendorffii]
Length=412

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N APWIF
Sbjct  138  YSVDVIAIGAYHAVERGIMVSCAGGNSGPFTGSVSNGAPWIF  179



>ref|XP_002985741.1| hypothetical protein SELMODRAFT_424715 [Selaginella moellendorffii]
 gb|EFJ13319.1| hypothetical protein SELMODRAFT_424715 [Selaginella moellendorffii]
Length=536

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N APWIF
Sbjct  190  YSVDVIAIGAYHAVERGIMVSCAGGNSGPFTGSVSNGAPWIF  231



>ref|XP_008449186.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103491136 
[Cucumis melo]
Length=1529

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF+ DV A+GAFHAV++G++VVCSAGNSGP   ++ N APWI 
Sbjct  302  DFSEDVTAIGAFHAVQQGIIVVCSAGNSGPAPGTIENGAPWIL  344


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  129   DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
             DF  D IA+G+FHAV+ G+ VVCSAGNSGP   +V N APWI 
Sbjct  1043  DFGQDSIAIGSFHAVQNGITVVCSAGNSGPAPGTVSNVAPWII  1085



>ref|XP_010694663.1| PREDICTED: CO(2)-response secreted protease-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+SLG     + DF +D IA+ AFHA + GV+VVCSAGN GP   +VVN APWIF
Sbjct  293  GVDIISISLGMDLLLQADFLSDPIAIAAFHANQMGVMVVCSAGNGGPDPYTVVNTAPWIF  352



>ref|XP_002456214.1| hypothetical protein SORBIDRAFT_03g032240 [Sorghum bicolor]
 gb|EES01334.1| hypothetical protein SORBIDRAFT_03g032240 [Sorghum bicolor]
Length=675

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+ TD+ A+GAF AV+ GV VVCSAGNSGP  S+V N APWIF
Sbjct  160  DYLTDLTAIGAFFAVQSGVTVVCSAGNSGPQPSTVTNLAPWIF  202



>ref|XP_010908011.1| PREDICTED: CO(2)-response secreted protease-like [Elaeis guineensis]
Length=740

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF +D IA+GAFHA ++G++VVCS GN GP   +VVN APWI 
Sbjct  249  GVDIISISIGMSSAFQSDFLSDPIAIGAFHANKRGILVVCSGGNDGPDPFTVVNSAPWIL  308



>gb|KDP25554.1| hypothetical protein JCGZ_20710 [Jatropha curcas]
Length=746

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  DVIALGA+ A++KG+ V CSAGNSGP+ SS+ NEAPWI 
Sbjct  292  FYDDVIALGAYAAIQKGIFVSCSAGNSGPWNSSLSNEAPWIL  333



>ref|XP_009781099.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=932

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +F +D IA+GAF A+E+G+ V CSAGNSGPYR ++ NEAPWI 
Sbjct  465  NFYSDNIAVGAFSAMERGIFVSCSAGNSGPYRFTISNEAPWIL  507



>ref|XP_004245672.2| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Solanum lycopersicum]
Length=1453

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
             F  DVIALGAF A+E+G+ V CSAGNSGPY  SV N+APWI 
Sbjct  278  QFYEDVIALGAFSAIERGIFVSCSAGNSGPYTFSVSNDAPWIL  320


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  129   DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
             +F  D +ALGAF A++KG+ V C+AGNSGP   S  NEAPWI 
Sbjct  988   NFYEDNVALGAFSAMQKGIFVSCAAGNSGPSSFSTSNEAPWIL  1030



>ref|XP_002985742.1| hypothetical protein SELMODRAFT_424716 [Selaginella moellendorffii]
 gb|EFJ13320.1| hypothetical protein SELMODRAFT_424716 [Selaginella moellendorffii]
Length=636

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N APWIF
Sbjct  285  YSVDVIAIGAYHAVERGIMVSCAGGNSGPFTGSVSNGAPWIF  326



>ref|XP_002974442.1| hypothetical protein SELMODRAFT_414628 [Selaginella moellendorffii]
 gb|EFJ24664.1| hypothetical protein SELMODRAFT_414628 [Selaginella moellendorffii]
Length=636

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N APWIF
Sbjct  285  YSVDVIAIGAYHAVERGIMVSCAGGNSGPFTGSVSNGAPWIF  326



>ref|XP_002985747.1| hypothetical protein SELMODRAFT_424726 [Selaginella moellendorffii]
 gb|EFJ13325.1| hypothetical protein SELMODRAFT_424726 [Selaginella moellendorffii]
Length=648

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N APWIF
Sbjct  285  YSVDVIAIGAYHAVERGIMVSCAGGNSGPFTGSVSNGAPWIF  326



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLG +    P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APWI 
Sbjct  293  GVDVLSVSLGSAPPLSP-YIEDTLAIGSFHAVAKGIPVVCSGGNSGPYSQTVINTAPWII  351



>ref|XP_002978893.1| hypothetical protein SELMODRAFT_110049, partial [Selaginella 
moellendorffii]
 gb|EFJ19850.1| hypothetical protein SELMODRAFT_110049, partial [Selaginella 
moellendorffii]
Length=710

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ TD IA+GAFHAV+ G++VV S GNSGPY S+++N APWI 
Sbjct  258  EYNTDGIAIGAFHAVQNGILVVASGGNSGPYPSTIINTAPWIL  300



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APW+ 
Sbjct  264  PTYVEDALAIGSFHAVAKGISVVCSGGNSGPYSQTVINTAPWVI  307



>gb|KDO48661.1| hypothetical protein CISIN_1g0368302mg, partial [Citrus sinensis]
Length=408

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+  D IA+GA HA ++GVVV+CSAGN GPY  +V N APW+F
Sbjct  301  DYMNDPIAIGALHAQQRGVVVICSAGNDGPYPFTVANTAPWLF  343



>ref|XP_010067650.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW65827.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=774

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+VVCS GN GP   +VVN APWIF
Sbjct  284  GVDIISISIGSSSTFQADYLHDPIAIGAFHAEQMGVLVVCSGGNDGPDAYTVVNTAPWIF  343



>ref|XP_010091321.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44295.1| Subtilisin-like protease [Morus notabilis]
Length=919

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G +  F+ D+  D IA+GAFHA + GV+V+CSAGN GP   +VVN APW+ 
Sbjct  252  GVDMISISIGMNSLFQSDYLNDPIAIGAFHAEQMGVMVICSAGNDGPDAYTVVNTAPWVL  311



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+++LS+G   G + +F+ + I++GAFHAVEKG++VV SAGN GP R ++VN  PWIF
Sbjct  280  GVDIINLSIGQPAGAEFEFSRNPISIGAFHAVEKGILVVSSAGNDGPLRETIVNVVPWIF  339



>ref|XP_004246134.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
             F  DVIALGAF A+E+G+ V CSAGNSGPY  SV N+APWI 
Sbjct  279  QFYEDVIALGAFSAMERGIFVSCSAGNSGPYTFSVSNDAPWIL  321



>ref|XP_004244590.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=738

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A E+G++V CSAGN+GP +SSV NEAPWI 
Sbjct  276  FHSDSIALGAYSATERGILVSCSAGNTGPSKSSVSNEAPWIL  317



>gb|EYU39035.1| hypothetical protein MIMGU_mgv1a001882mg [Erythranthe guttata]
Length=745

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  DVIA+GAF A++KG+ V CSAGNSGP+  S+ NEAPWI 
Sbjct  282  DFFDDVIAIGAFAAIQKGIFVSCSAGNSGPFDGSLSNEAPWIL  324



>ref|XP_002979023.1| hypothetical protein SELMODRAFT_177291 [Selaginella moellendorffii]
 gb|EFJ19980.1| hypothetical protein SELMODRAFT_177291 [Selaginella moellendorffii]
Length=705

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+S G    +  D+ TD IA+ AFHAV+ G++VV S GNSGPY S+++N APWI 
Sbjct  238  GVDILSISAGMENTY--DYNTDGIAIAAFHAVQNGILVVASGGNSGPYPSTIINTAPWIL  295



>ref|XP_002464801.1| hypothetical protein SORBIDRAFT_01g026900 [Sorghum bicolor]
 gb|EER91799.1| hypothetical protein SORBIDRAFT_01g026900 [Sorghum bicolor]
Length=777

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDVLS+SLGGS  F  +F  D IA+GAF AV KGVVVVC+AGN+GP  SSVVN+APWI 
Sbjct  282  GVDVLSISLGGSLSF--EFDHDPIAVGAFSAVSKGVVVVCAAGNNGPAPSSVVNDAPWIL  339



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  D IA+GAFHAVE G+ VVCSAGN GP   +V N APWI 
Sbjct  289  DFKNDPIAIGAFHAVENGITVVCSAGNDGPSEKTVSNGAPWIL  331



>ref|XP_006358371.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A ++G++V CSAGN+GP+ S+VVNEAPWI 
Sbjct  281  FHSDPIALGAYSATQRGILVSCSAGNNGPFESTVVNEAPWIL  322



>emb|CDP16605.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  DVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D IA+GAFHAVEKG++VVCSAGN GP R SVVN  PW+ 
Sbjct  226  DPIAIGAFHAVEKGILVVCSAGNGGPERESVVNVVPWVL  264



>ref|XP_002984936.1| hypothetical protein SELMODRAFT_121213, partial [Selaginella 
moellendorffii]
 gb|EFJ14186.1| hypothetical protein SELMODRAFT_121213, partial [Selaginella 
moellendorffii]
Length=699

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+S G    +  D+ TD IA+ AFHAV+ G++VV S GNSGPY S+++N APWI 
Sbjct  243  GVDILSISAGMENTY--DYNTDGIAIAAFHAVQNGILVVASGGNSGPYPSTIINTAPWIL  300



>ref|XP_002984832.1| hypothetical protein SELMODRAFT_121107, partial [Selaginella 
moellendorffii]
 gb|EFJ14082.1| hypothetical protein SELMODRAFT_121107, partial [Selaginella 
moellendorffii]
Length=699

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD+LS+S G    +  D+ TD IA+ AFHAV+ G++VV S GNSGPY S+++N APWI 
Sbjct  243  GVDILSISAGMENTY--DYNTDGIAIAAFHAVQNGILVVASGGNSGPYPSTIINTAPWIL  300



>gb|EMT11746.1| Xylem serine proteinase 1 [Aegilops tauschii]
Length=289

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            +F  D I++GAF AV KG++VVC+ GNSGP++ SV NEAPW+ 
Sbjct  201  NFDQDPISIGAFSAVSKGILVVCATGNSGPFQRSVTNEAPWLL  243



>emb|CDP09845.1| unnamed protein product [Coffea canephora]
Length=605

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  D IALGAF A+EKG+ V CSAGN+GP+ SS+ NEAPWI 
Sbjct  284  FYDDNIALGAFSAMEKGIFVSCSAGNNGPFSSSLANEAPWIL  325



>ref|XP_007220237.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
 gb|EMJ21436.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
Length=741

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CS GN GP   ++VN APWIF
Sbjct  251  GVDIISISIGMSSLFQSDYLNDPIAIGAFHAEQMGVMVICSGGNDGPDPYTIVNTAPWIF  310



>ref|XP_008351622.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Malus domestica]
Length=638

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  DVIA+GAF A++KG+   C+AGNSGPY  S+ NEAPWIF
Sbjct  288  FYDDVIAIGAFAAIKKGIFFSCAAGNSGPYHESLSNEAPWIF  329



>ref|XP_002984834.1| hypothetical protein SELMODRAFT_181325 [Selaginella moellendorffii]
 gb|EFJ14084.1| hypothetical protein SELMODRAFT_181325 [Selaginella moellendorffii]
Length=723

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+ TD IA+ AFHAV+ G++VV S GNSGPY S+++N APWI 
Sbjct  253  DYNTDGIAIAAFHAVQNGILVVASGGNSGPYPSTIINTAPWIL  295



>ref|XP_008231725.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=775

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ D+  D IA+GAFHA + GV+V+CS GN GP   ++VN APWIF
Sbjct  285  GVDIISISIGISSLFQSDYLNDPIAIGAFHAEQMGVMVICSGGNDGPDPYTIVNTAPWIF  344



>gb|EYU39028.1| hypothetical protein MIMGU_mgv1a002635mg [Erythranthe guttata]
Length=651

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  D IALGAF A++KG++V CSAGNSGP+  S+ NEAPWI 
Sbjct  182  DFYLDSIALGAFSAMKKGILVSCSAGNSGPFNFSMENEAPWIL  224



>ref|XP_006358372.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=734

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A E+G++V CSAGN+GP +SSV NEAPWI 
Sbjct  272  FHSDPIALGAYSATERGILVSCSAGNTGPSKSSVSNEAPWIL  313



>ref|XP_006432517.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
 gb|ESR45757.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
Length=714

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+  D IA+GA HA ++GVVV+CSAGN GPY  +V N APW+F
Sbjct  240  DYMNDPIAIGALHAQQRGVVVICSAGNDGPYPFTVANTAPWLF  282



>ref|XP_006471314.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+  D IA+GA HA ++GVVV+CSAGN GPY  +V N APW+F
Sbjct  301  DYMNDPIAIGALHAQQRGVVVICSAGNDGPYPFTVANTAPWLF  343



>gb|EMT24493.1| Subtilisin-like protease [Aegilops tauschii]
Length=370

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  D I++GAF AV KG++VVC+AGNSGP + SV NEAPW+ 
Sbjct  199  FDQDPISIGAFSAVSKGILVVCAAGNSGPTQRSVTNEAPWML  240



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APW+
Sbjct  268  PTYVEDALAIGSFHAVAKGISVVCSGGNSGPYPQTVINTAPWL  310



>gb|EPS60118.1| hypothetical protein M569_14685, partial [Genlisea aurea]
Length=200

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            P F  D I++GA+HA E G++VVCSAGN GP   +VVN APWI 
Sbjct  107  PRFDVDPISIGAYHAAENGILVVCSAGNYGPSAETVVNAAPWIL  150



>ref|XP_009767059.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=752

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A ++G++V CSAGN+GP+ S+VVNEAPWI 
Sbjct  281  FHSDPIALGAYSATQRGILVSCSAGNNGPFESTVVNEAPWIL  322



>ref|XP_011085840.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=767

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G S  F+ DF  D IA+GAFHA + GV VVCS GN GP   ++VN APWIF
Sbjct  277  GVDIISISIGVSSIFQSDFLNDPIAIGAFHAEQMGVPVVCSGGNDGPDPYTIVNSAPWIF  336



>ref|XP_006358408.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A ++G++V CSAGNSGP  SSV NEAPWI 
Sbjct  279  FYSDSIALGAYSATQRGILVSCSAGNSGPSESSVANEAPWIL  320



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  132  PDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            P +  D +A+G+FHAV KG+ VVCS GNSGPY  +V+N APW+
Sbjct  297  PTYVEDALAIGSFHAVAKGISVVCSGGNSGPYPQTVINTAPWL  339



>gb|EYU39027.1| hypothetical protein MIMGU_mgv1a019149mg, partial [Erythranthe 
guttata]
Length=720

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  D IALGAF A+EKG++V CSAGN GP+  S  NEAPWI 
Sbjct  251  DFYRDSIALGAFSAMEKGILVSCSAGNRGPFNFSTQNEAPWIL  293



>ref|XP_006423460.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36700.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=623

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D+I++G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  141  YVDDIISIGSFHAVAKGISVVCSAGNSGPYPQTVINTAPWV  181



>ref|XP_009599111.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F     +D IALGA+ A E+G++V CSAGN GPY SS  NEAPWI 
Sbjct  274  FSSPLHSDPIALGAYSATERGILVSCSAGNEGPYNSSTSNEAPWIL  319



>ref|XP_007141642.1| hypothetical protein PHAVU_008G213300g [Phaseolus vulgaris]
 gb|ESW13636.1| hypothetical protein PHAVU_008G213300g [Phaseolus vulgaris]
Length=505

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S S+G S  +K    TD I++G+FHAV K +VVVCSAGN GP  SSV N APW F
Sbjct  295  GVDVISASIGWSTPYKEAMLTDGISIGSFHAVTKNIVVVCSAGNDGPSPSSVTNVAPWSF  354



>gb|EPS59928.1| hypothetical protein M569_14877 [Genlisea aurea]
Length=740

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            FT+D IA+G+FHA + G++ VC+AGNSGPY  S+ N APWI 
Sbjct  284  FTSDAIAIGSFHAAKNGILTVCAAGNSGPYLGSIQNVAPWIL  325



>ref|XP_009776158.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F     +D IALGA+ A E+G++V CSAGN GPY SS  NEAPWI 
Sbjct  277  FSSPLHSDPIALGAYSATERGILVSCSAGNEGPYNSSTSNEAPWIL  322



>gb|KDO40058.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40059.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40060.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40061.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40062.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40063.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40064.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
Length=639

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D+I++G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  157  YVDDIISIGSFHAVAKGISVVCSAGNSGPYPQTVINTAPWV  197



>ref|XP_006363699.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=742

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F +D IALGA+ A E+G++V CSAGNSGP+R SV N APWI 
Sbjct  278  FHSDNIALGAYSATERGILVSCSAGNSGPFRGSVENTAPWIL  319



>ref|XP_007141643.1| hypothetical protein PHAVU_008G213300g [Phaseolus vulgaris]
 gb|ESW13637.1| hypothetical protein PHAVU_008G213300g [Phaseolus vulgaris]
Length=664

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVDV+S S+G S  +K    TD I++G+FHAV K +VVVCSAGN GP  SSV N APW F
Sbjct  295  GVDVISASIGWSTPYKEAMLTDGISIGSFHAVTKNIVVVCSAGNDGPSPSSVTNVAPWSF  354



>emb|CDX77071.1| BnaC04g38660D [Brassica napus]
Length=760

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            GVD++S+S+G +  F  D+ +D IA+GAFHA  KG++V+ SAGN GP  S+V N APW+F
Sbjct  271  GVDIISISIGLNAAFTSDYLSDPIAIGAFHAELKGIMVIASAGNDGPNASTVTNVAPWLF  330



>ref|XP_006487361.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Citrus 
sinensis]
Length=780

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D+I++G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  298  YVDDIISIGSFHAVAKGISVVCSAGNSGPYPQTVINTAPWV  338



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            + + + IA+GAFHAVEKG+VV+CSAGN GP   +VVN APWI 
Sbjct  292  ELSKNPIAIGAFHAVEKGIVVICSAGNGGPDPKTVVNTAPWIL  334



>ref|XP_006423459.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36699.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=780

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D+I++G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  298  YVDDIISIGSFHAVAKGISVVCSAGNSGPYPQTVINTAPWV  338



>ref|XP_006487362.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Citrus 
sinensis]
Length=719

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D+I++G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  237  YVDDIISIGSFHAVAKGISVVCSAGNSGPYPQTVINTAPWV  277



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            + + + IA+GAFHAVEKG+VV+CSAGN GP   +VVN APWI 
Sbjct  292  ELSKNPIAIGAFHAVEKGIVVICSAGNGGPDPKTVVNTAPWIL  334



>ref|XP_009373327.1| PREDICTED: subtilisin-like protease SDD1 [Pyrus x bretschneideri]
Length=637

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  DVIA+GAF A++KG+   C+AGNSGPY  S+ NEAPWIF
Sbjct  288  FYDDVIAIGAFAAIKKGIFFSCAAGNSGPYYESLSNEAPWIF  329



>gb|EMS53854.1| Cucumisin [Triticum urartu]
Length=647

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = -2

Query  180  GVDVlslslggsgGFKPDFTTDVIALGAFHAVEKGVVVVCSAGNSG-PYRSSVVNEAPWI  4
            GVDV+S+S+G S  F  DF +D IALGAFHA ++GV+VVCS G+ G PY  +VVN APWI
Sbjct  398  GVDVISISIGMSSAFASDFLSDPIALGAFHAHQRGVLVVCSGGDDGLPY--TVVNSAPWI  455

Query  3    F  1
             
Sbjct  456  L  456



>gb|EYU39034.1| hypothetical protein MIMGU_mgv1a019276mg, partial [Erythranthe 
guttata]
Length=688

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  D IA+GAF A++KG+ V CSAGNSGP+ +S+ NEAPWI 
Sbjct  234  DFFADGIAIGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWIL  276



>gb|EYU39037.1| hypothetical protein MIMGU_mgv1a021904mg [Erythranthe guttata]
Length=724

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            DF  D IA+GAF A++KG+ V CSAGNSGP+ +S+ NEAPWI 
Sbjct  262  DFFNDGIAIGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWIL  304



>gb|KDP25553.1| hypothetical protein JCGZ_20709 [Jatropha curcas]
Length=743

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F  DVIALGA+ A++KG+ + CSAGNSGP  SS+ NEAPWI 
Sbjct  288  FYDDVIALGAYAAIQKGIFISCSAGNSGPENSSLSNEAPWIL  329



>ref|XP_006304500.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
 gb|EOA37398.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
Length=781

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  132  PD-FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            PD    D +A+G+FHAVE+G+ VVCSAGNSGP   SVVN APW+
Sbjct  289  PDNLLEDPLAIGSFHAVERGITVVCSAGNSGPSSQSVVNAAPWM  332



>ref|XP_004244591.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  FKPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            F   F  D +ALGA+ A E+G++V CSAGNSGP +SS+ NEAPWI 
Sbjct  276  FTRPFYNDPVALGAYTATERGILVSCSAGNSGPAKSSLSNEAPWIL  321



>ref|XP_010477248.1| PREDICTED: CO(2)-response secreted protease [Camelina sativa]
Length=776

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +   D +A+G+FHAVE+G+ VVCSAGNSGP   SVVN APW+
Sbjct  291  NLIEDPLAIGSFHAVERGITVVCSAGNSGPSSQSVVNAAPWM  332



>gb|ABZ89187.1| putative protein [Coffea canephora]
Length=763

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            KP F TD +ALGA+ A+EKG++V CSAGN GP+  S+ NEAPWI 
Sbjct  293  KP-FYTDSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWIL  336



>ref|XP_002985648.1| hypothetical protein SELMODRAFT_424712 [Selaginella moellendorffii]
 gb|EFJ13226.1| hypothetical protein SELMODRAFT_424712 [Selaginella moellendorffii]
Length=163

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            ++ DVIA+GA+HAVE+G++V C+ GNSGP+  SV N A WIF
Sbjct  99   YSVDVIAIGAYHAVERGIMVSCTGGNSGPFTGSVSNGALWIF  140



>emb|CDO99977.1| unnamed protein product [Coffea canephora]
Length=733

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            KP F TD +ALGA+ A+EKG++V CSAGN GP+  S+ NEAPWI 
Sbjct  293  KP-FYTDSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWIL  336



>gb|ADZ55305.1| serine protease [Coffea arabica]
Length=763

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -2

Query  135  KPDFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            KP F TD +ALGA+ A+EKG++V CSAGN GP+  S+ NEAPWI 
Sbjct  293  KP-FYTDSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWIL  336



>ref|XP_010933213.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=776

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  117  DVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            D IA+G+F A+EKGV+V+C+AGN+GP  SSV NEAPWI
Sbjct  306  DSIAIGSFRAMEKGVIVICAAGNNGPVPSSVANEAPWI  343



>ref|XP_010923357.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=780

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            F  D++A+GAF+AV +G++VVCSAGNSGP+ SSV N APWI
Sbjct  322  FDGDLLAIGAFNAVRRGILVVCSAGNSGPFSSSVTNVAPWI  362



>ref|XP_002984931.1| hypothetical protein SELMODRAFT_424020 [Selaginella moellendorffii]
 gb|EFJ14181.1| hypothetical protein SELMODRAFT_424020 [Selaginella moellendorffii]
Length=732

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  DFTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWIF  1
            D+ TD IA+ AFHAV+ G++VV S GNSGPY S++ N APWI 
Sbjct  278  DYNTDGIAIAAFHAVQNGILVVASGGNSGPYPSTITNTAPWIL  320



>ref|XP_010498447.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Camelina 
sativa]
Length=642

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  117  DVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            D +A+G+FHAVE+G+ VVCSAGNSGP   SVVN APW+
Sbjct  161  DPLAIGSFHAVERGITVVCSAGNSGPSSQSVVNAAPWM  198



>gb|KDP41723.1| hypothetical protein JCGZ_26741 [Jatropha curcas]
Length=774

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  126  FTTDVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            +  D +A+G+FHAV KG+ VVCSAGNSGPY  +V+N APW+
Sbjct  295  YVEDPVAIGSFHAVTKGISVVCSAGNSGPYHQTVINTAPWV  335



>ref|XP_010498446.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Camelina 
sativa]
Length=666

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  117  DVIALGAFHAVEKGVVVVCSAGNSGPYRSSVVNEAPWI  4
            D +A+G+FHAVE+G+ VVCSAGNSGP   SVVN APW+
Sbjct  185  DPLAIGSFHAVERGITVVCSAGNSGPSSQSVVNAAPWM  222



Lambda      K        H        a         alpha
   0.314    0.130    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508434916518