BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14892_g2_i1 len=313 path=[801:0-312]

Length=313
                                                                      Score     E

ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3         150   9e-40   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    146   7e-39   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3         147   1e-38   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like           145   6e-38   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                          144   9e-38   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg             143   2e-37   
gb|KEH34337.1|  subtilisin-like serine protease                         143   2e-37   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                          143   3e-37   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease                143   3e-37   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like           142   4e-37   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                          142   5e-37   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease                142   5e-37   
ref|XP_002461867.1|  hypothetical protein SORBIDRAFT_02g009600          141   2e-36   Sorghum bicolor [broomcorn]
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2     140   2e-36   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1     140   3e-36   
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like           140   4e-36   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g             139   6e-36   
ref|XP_003603196.1|  Subtilisin-type protease                           139   7e-36   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...    139   8e-36   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...    139   1e-35   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    138   1e-35   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    139   2e-35   
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    138   2e-35   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1     138   2e-35   
emb|CDY44210.1|  BnaC05g15670D                                          138   2e-35   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease                138   2e-35   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like           137   3e-35   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...    137   4e-35   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like           137   4e-35   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg             137   5e-35   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...    137   6e-35   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like           137   6e-35   
ref|XP_008800195.1|  PREDICTED: xylem serine proteinase 1-like          133   7e-35   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease                137   7e-35   
ref|XP_002510578.1|  Cucumisin precursor, putative                      134   9e-35   Ricinus communis
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like           136   9e-35   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3         136   1e-34   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...    136   1e-34   
ref|NP_001238252.1|  subtilisin-type protease precursor                 136   1e-34   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...    136   1e-34   
gb|KHN09070.1|  Subtilisin-like protease                                135   1e-34   
gb|EYU38295.1|  hypothetical protein MIMGU_mgv1a0026492mg               129   1e-34   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g             135   2e-34   
emb|CDP07365.1|  unnamed protein product                                135   2e-34   
dbj|BAJ93850.1|  predicted protein                                      135   2e-34   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease        135   2e-34   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                    134   4e-34   
ref|NP_001236511.1|  subtilisin-type protease precursor                 134   4e-34   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                       134   4e-34   Glycine max [soybeans]
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg             134   4e-34   
ref|XP_010091320.1|  Subtilisin-like protease                           134   5e-34   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...    134   6e-34   
gb|KHG24601.1|  Cucumisin                                               134   7e-34   
gb|EPS60118.1|  hypothetical protein M569_14685                         127   7e-34   
gb|EAZ09528.1|  hypothetical protein OsI_31804                          134   7e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_002893091.1|  subtilase                                          133   8e-34   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease                133   1e-33   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                   133   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19203.1|  subtilisin-like serine protease                         132   1e-33   
gb|AAM65424.1|  subtilisin-like serine protease                         133   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease        133   2e-33   Vitis vinifera
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                      133   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095549.1|  Subtilisin-like protease                           132   2e-33   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3         132   2e-33   
ref|XP_003603807.1|  Subtilisin-type protease                           132   3e-33   
gb|KEH19202.1|  subtilisin-like serine protease                         132   3e-33   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like           132   3e-33   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...    131   4e-33   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...    131   5e-33   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease        131   5e-33   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease                131   7e-33   
gb|KEH19205.1|  subtilisin-like serine protease                         131   7e-33   
gb|KCW65828.1|  hypothetical protein EUGRSUZ_G03177                     129   7e-33   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3         130   8e-33   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630          130   9e-33   
gb|KEH19206.1|  subtilisin-like serine protease                         130   1e-32   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...    130   1e-32   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like           130   1e-32   
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3         130   1e-32   
gb|AES74057.2|  subtilisin-like serine protease                         128   2e-32   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...    130   2e-32   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like           129   2e-32   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease        129   3e-32   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease                129   3e-32   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...    129   4e-32   Vitis vinifera
ref|XP_002307740.1|  putative subtilisin precursor family protein       129   4e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003603806.1|  Subtilisin-like serine protease                    128   4e-32   
emb|CBI19918.3|  unnamed protein product                                129   4e-32   
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2     129   4e-32   
ref|XP_011085840.1|  PREDICTED: CO(2)-response secreted protease-...    129   5e-32   
gb|KHN10158.1|  Subtilisin-like protease                                128   5e-32   
ref|XP_009391632.1|  PREDICTED: subtilisin-like protease isoform X1     128   6e-32   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like           128   8e-32   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like           127   1e-31   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...    127   1e-31   
ref|XP_006347851.1|  PREDICTED: subtilisin-like protease-like           127   1e-31   
ref|XP_002300693.2|  putative subtilisin precursor family protein       127   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3         127   1e-31   
gb|KHN10324.1|  Subtilisin-like protease                                127   1e-31   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease                127   1e-31   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like           127   2e-31   
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg             127   2e-31   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease                127   2e-31   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like           127   2e-31   
ref|XP_010091321.1|  Subtilisin-like protease                           127   3e-31   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...    126   3e-31   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                         126   4e-31   
ref|NP_001067647.1|  Os11g0261600                                       119   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                   125   7e-31   
ref|XP_010908011.1|  PREDICTED: CO(2)-response secreted protease-...    125   7e-31   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...    125   8e-31   
ref|XP_008375386.1|  PREDICTED: subtilisin-like protease                125   9e-31   
ref|XP_007133571.1|  hypothetical protein PHAVU_011G190300g             124   9e-31   
ref|XP_010498447.1|  PREDICTED: CO(2)-response secreted protease-...    124   1e-30   
ref|XP_010498446.1|  PREDICTED: CO(2)-response secreted protease-...    124   1e-30   
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative      124   1e-30   Ricinus communis
gb|KFK44142.1|  hypothetical protein AALP_AA1G220500                    124   1e-30   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg             124   2e-30   
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg             124   2e-30   
ref|XP_008779567.1|  PREDICTED: cucumisin-like                          124   2e-30   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like           124   2e-30   
ref|XP_008351273.1|  PREDICTED: cucumisin-like isoform X4               122   2e-30   
ref|XP_008392878.1|  PREDICTED: cucumisin-like                          121   2e-30   
gb|EMS53854.1|  Cucumisin                                               123   2e-30   
ref|XP_010477248.1|  PREDICTED: CO(2)-response secreted protease        124   2e-30   
ref|XP_004231226.1|  PREDICTED: CO(2)-response secreted protease-...    124   3e-30   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg             124   3e-30   
ref|XP_008351272.1|  PREDICTED: cucumisin-like isoform X3               123   4e-30   
ref|XP_008351271.1|  PREDICTED: cucumisin-like isoform X2               123   5e-30   
ref|XP_008351270.1|  PREDICTED: cucumisin-like isoform X1               123   5e-30   
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...    123   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...    123   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004165291.1|  PREDICTED: subtilisin-like protease-like           122   6e-30   
gb|KGN47766.1|  hypothetical protein Csa_6G401370                       122   6e-30   
ref|XP_004146802.1|  PREDICTED: subtilisin-like protease-like           122   7e-30   
gb|KHN09068.1|  Subtilisin-like protease                                118   7e-30   
ref|XP_007040097.1|  Subtilase family protein                           122   7e-30   
ref|XP_004967678.1|  PREDICTED: subtilisin-like protease-like           122   8e-30   
ref|XP_010919429.1|  PREDICTED: cucumisin-like                          122   9e-30   
ref|XP_006416427.1|  hypothetical protein EUTSA_v10006858mg             122   9e-30   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                         122   1e-29   
ref|XP_009607188.1|  PREDICTED: subtilisin-like protease SBT5.3         122   1e-29   
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    122   1e-29   
gb|KDP25527.1|  hypothetical protein JCGZ_20683                         122   1e-29   
ref|XP_006850442.1|  hypothetical protein AMTR_s00165p00065060          121   1e-29   
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3         120   1e-29   
emb|CDY01388.1|  BnaA07g11610D                                          122   1e-29   
dbj|BAA13135.1|  subtilisin-like protein                                121   2e-29   Picea abies
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             121   2e-29   
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg             121   2e-29   
ref|XP_002457657.1|  hypothetical protein SORBIDRAFT_03g011300          121   2e-29   Sorghum bicolor [broomcorn]
gb|EPS69827.1|  hypothetical protein M569_04935                         121   2e-29   
gb|EEE63324.1|  hypothetical protein OsJ_18135                          120   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KDP36888.1|  hypothetical protein JCGZ_08179                         121   2e-29   
dbj|BAJ53097.1|  JHL20J20.3                                             121   2e-29   
emb|CDY67543.1|  BnaCnng55400D                                          121   3e-29   
ref|XP_002893090.1|  predicted protein                                  120   4e-29   
ref|XP_008672702.1|  PREDICTED: uncharacterized protein LOC100279...    120   4e-29   
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400             120   4e-29   
ref|XP_010919430.1|  PREDICTED: cucumisin-like                          120   4e-29   
gb|AAX95895.1|  Subtilase family, putative                              120   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KDP25659.1|  hypothetical protein JCGZ_20815                         120   5e-29   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease                120   5e-29   
gb|EEC68285.1|  hypothetical protein OsI_36335                          120   5e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002524250.1|  Cucumisin precursor, putative                      119   6e-29   Ricinus communis
ref|NP_001145938.1|  uncharacterized protein LOC100279461 precursor     120   7e-29   Zea mays [maize]
ref|XP_009391855.1|  PREDICTED: subtilisin-like protease isoform X2     119   8e-29   
ref|XP_009387964.1|  PREDICTED: subtilisin-like protease SBT5.3         119   8e-29   
ref|XP_008391037.1|  PREDICTED: cucumisin-like isoform X2               119   1e-28   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    119   1e-28   
ref|XP_009400152.1|  PREDICTED: subtilisin-like protease SBT5.4         119   1e-28   
gb|EYU17578.1|  hypothetical protein MIMGU_mgv1a0038491mg               117   1e-28   
ref|XP_011081055.1|  PREDICTED: cucumisin-like                          118   2e-28   
ref|XP_008391035.1|  PREDICTED: cucumisin-like isoform X1               118   2e-28   
ref|XP_011086390.1|  PREDICTED: cucumisin-like                          118   3e-28   
gb|KFK32412.1|  hypothetical protein AALP_AA6G238800                    117   3e-28   
emb|CBI24459.3|  unnamed protein product                                117   3e-28   
gb|KDO63610.1|  hypothetical protein CISIN_1g044427mg                   117   3e-28   
ref|XP_002264496.1|  PREDICTED: cucumisin-like                          117   4e-28   Vitis vinifera
emb|CBI31873.3|  unnamed protein product                                117   4e-28   
ref|XP_006477361.1|  PREDICTED: cucumisin-like                          117   4e-28   
ref|XP_010662545.1|  PREDICTED: cucumisin-like                          117   4e-28   
emb|CDP18817.1|  unnamed protein product                                117   5e-28   
ref|XP_008360385.1|  PREDICTED: cucumisin-like                          115   6e-28   
gb|KDO37215.1|  hypothetical protein CISIN_1g038289mg                   112   6e-28   
ref|XP_009387941.1|  PREDICTED: subtilisin-like protease Glyma18g...    115   7e-28   
ref|XP_004171206.1|  PREDICTED: cucumisin-like                          116   8e-28   
ref|XP_002303965.2|  hypothetical protein POPTR_0003s18830g             116   8e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004149947.1|  PREDICTED: cucumisin-like                          116   8e-28   
ref|XP_004173850.1|  PREDICTED: cucumisin-like                          114   8e-28   
ref|XP_007009158.1|  Subtilisin-like serine endopeptidase family ...    117   8e-28   
ref|XP_011036040.1|  PREDICTED: cucumisin-like                          116   9e-28   
ref|XP_008245984.1|  PREDICTED: cucumisin-like                          116   1e-27   
ref|XP_007219654.1|  hypothetical protein PRUPE_ppa025139mg             116   1e-27   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...    116   1e-27   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4         116   1e-27   
ref|XP_006440509.1|  hypothetical protein CICLE_v10023551mg             116   1e-27   
emb|CDY57477.1|  BnaAnng14590D                                          116   1e-27   
emb|CBI24462.3|  unnamed protein product                                115   1e-27   
ref|XP_004164258.1|  PREDICTED: cucumisin-like                          116   1e-27   
ref|XP_004149954.1|  PREDICTED: cucumisin-like                          116   1e-27   
gb|KDO48661.1|  hypothetical protein CISIN_1g0368302mg                  113   1e-27   
ref|XP_008461725.1|  PREDICTED: cucumisin-like                          116   1e-27   
ref|XP_009396946.1|  PREDICTED: cucumisin-like                          115   1e-27   
ref|XP_004149953.1|  PREDICTED: cucumisin-like                          115   2e-27   
ref|XP_008464909.1|  PREDICTED: cucumisin-like                          115   2e-27   
ref|XP_008245823.1|  PREDICTED: cucumisin-like                          116   2e-27   
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          115   2e-27   
gb|EYU39007.1|  hypothetical protein MIMGU_mgv1a020931mg                115   2e-27   
ref|XP_002304456.2|  hypothetical protein POPTR_0003s12010g             115   2e-27   Populus trichocarpa [western balsam poplar]
gb|KDO61088.1|  hypothetical protein CISIN_1g045363mg                   115   2e-27   
ref|XP_010520669.1|  PREDICTED: cucumisin-like                          115   2e-27   
ref|XP_006481881.1|  PREDICTED: xylem serine proteinase 1-like          115   3e-27   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    115   3e-27   
ref|XP_011033825.1|  PREDICTED: cucumisin-like                          115   3e-27   
gb|EMS55531.1|  Subtilisin-like protease                                115   3e-27   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    115   3e-27   
ref|XP_002520491.1|  peptidase, putative                                116   3e-27   Ricinus communis
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         115   3e-27   
ref|XP_008461730.1|  PREDICTED: cucumisin-like isoform X2               115   3e-27   
ref|XP_009392092.1|  PREDICTED: subtilisin-like protease                114   3e-27   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3         115   3e-27   
ref|XP_008461717.1|  PREDICTED: cucumisin-like                          115   4e-27   
emb|CBI38006.3|  unnamed protein product                                115   4e-27   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         115   4e-27   
ref|XP_010683779.1|  PREDICTED: xylem serine proteinase 1               114   4e-27   
ref|XP_008461729.1|  PREDICTED: cucumisin-like isoform X1               114   4e-27   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         114   4e-27   
ref|XP_002275807.1|  PREDICTED: cucumisin-like                          114   5e-27   Vitis vinifera
emb|CBI34765.3|  unnamed protein product                                114   5e-27   
ref|XP_002316252.2|  cucumisin family protein                           114   5e-27   Populus trichocarpa [western balsam poplar]
gb|EAY73513.1|  hypothetical protein OsI_01395                          114   5e-27   Oryza sativa Indica Group [Indian rice]
gb|KHG27800.1|  Cucumisin                                               114   5e-27   
ref|XP_004165775.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     114   5e-27   
ref|XP_004515553.1|  PREDICTED: cucumisin-like                          114   5e-27   
ref|XP_002316254.1|  hypothetical protein POPTR_0010s20420g             114   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010694663.1|  PREDICTED: CO(2)-response secreted protease-...    114   6e-27   
dbj|BAA89562.1|  putative subtilisin-like protein                       114   6e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006430257.1|  hypothetical protein CICLE_v10013548mg             114   6e-27   
gb|KDP25228.1|  hypothetical protein JCGZ_20384                         111   6e-27   
emb|CBI31597.3|  unnamed protein product                                114   6e-27   
gb|AEM42989.1|  cucumisin                                               114   6e-27   
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         114   6e-27   
ref|XP_002277115.3|  PREDICTED: cucumisin                               115   6e-27   Vitis vinifera
gb|KDP25529.1|  hypothetical protein JCGZ_20685                         114   7e-27   
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         114   7e-27   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     114   7e-27   
ref|XP_010658506.1|  PREDICTED: cucumisin isoform X2                    114   8e-27   
ref|XP_010658505.1|  PREDICTED: cucumisin isoform X1                    114   8e-27   
ref|XP_007040096.1|  Subtilase family protein                           114   8e-27   
ref|XP_002509690.1|  Cucumisin precursor, putative                      114   8e-27   Ricinus communis
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          114   8e-27   Sorghum bicolor [broomcorn]
emb|CDP05456.1|  unnamed protein product                                113   9e-27   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    114   1e-26   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    114   1e-26   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg             113   1e-26   
ref|XP_009391857.1|  PREDICTED: subtilisin-like protease SBT5.4         113   1e-26   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like           113   1e-26   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         113   1e-26   
ref|XP_010658658.1|  PREDICTED: cucumisin                               114   1e-26   
gb|KDP25528.1|  hypothetical protein JCGZ_20684                         113   1e-26   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         113   2e-26   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       113   2e-26   
ref|XP_007009160.1|  Subtilisin-like serine endopeptidase family ...    113   2e-26   
emb|CBI31599.3|  unnamed protein product                                112   2e-26   
ref|XP_004153386.1|  PREDICTED: cucumisin-like                          110   2e-26   
ref|XP_008233510.1|  PREDICTED: cucumisin-like                          112   2e-26   
emb|CBI31602.3|  unnamed protein product                                113   2e-26   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       113   2e-26   
emb|CAH66112.1|  OSIGBa0115D20.5                                        109   2e-26   Oryza sativa [red rice]
ref|XP_010658507.1|  PREDICTED: cucumisin-like                          112   2e-26   
gb|AES99459.2|  subtilisin-like serine endopeptidase family protein     110   2e-26   
gb|KGN50589.1|  hypothetical protein Csa_5G187870                       112   2e-26   
ref|XP_004149952.1|  PREDICTED: cucumisin-like                          112   3e-26   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             112   3e-26   
emb|CAN64132.1|  hypothetical protein VITISV_013401                     112   3e-26   Vitis vinifera
emb|CAN62173.1|  hypothetical protein VITISV_027754                     112   3e-26   Vitis vinifera
ref|XP_008810591.1|  PREDICTED: cucumisin-like                          112   3e-26   
ref|XP_007016593.1|  Subtilase 4.13, putative isoform 3                 112   3e-26   
emb|CBI24378.3|  unnamed protein product                                112   3e-26   
ref|XP_007220756.1|  hypothetical protein PRUPE_ppa024105mg             112   3e-26   
ref|XP_007016591.1|  Subtilase family protein, putative isoform 1       112   3e-26   
ref|XP_007016592.1|  Subtilase 4.13, putative isoform 2                 112   3e-26   
emb|CBI31875.3|  unnamed protein product                                112   3e-26   
ref|XP_010651696.1|  PREDICTED: cucumisin-like                          112   4e-26   
ref|XP_011087071.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     112   4e-26   
emb|CAE01298.2|  OSJNBa0020P07.15                                       112   4e-26   
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease                112   4e-26   
ref|XP_010658504.1|  PREDICTED: cucumisin-like                          112   4e-26   
ref|XP_002262979.2|  PREDICTED: cucumisin-like                          112   4e-26   
ref|XP_010662562.1|  PREDICTED: cucumisin-like                          112   4e-26   
ref|XP_003616501.1|  Subtilisin-like serine protease                    110   4e-26   
gb|EYU39005.1|  hypothetical protein MIMGU_mgv1a021060mg                111   5e-26   
emb|CAN72966.1|  hypothetical protein VITISV_025342                     112   5e-26   
ref|XP_006381297.1|  subtilase family protein                           111   5e-26   
ref|XP_008234049.1|  PREDICTED: uncharacterized protein LOC103333026    112   5e-26   
emb|CBI24460.3|  unnamed protein product                                112   5e-26   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             112   5e-26   
emb|CBI31595.3|  unnamed protein product                                111   5e-26   
ref|NP_001052068.2|  Os04g0120000                                       112   5e-26   
gb|AIC80770.1|  subtilase                                               111   6e-26   
ref|XP_006400988.1|  hypothetical protein EUTSA_v10015507mg             111   6e-26   
dbj|BAJ98357.1|  predicted protein                                      107   6e-26   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      111   6e-26   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             111   6e-26   
ref|XP_004494157.1|  PREDICTED: xylem serine proteinase 1-like          111   6e-26   
ref|XP_008245633.1|  PREDICTED: cucumisin-like                          108   6e-26   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             111   6e-26   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...    110   6e-26   
gb|KGN50586.1|  hypothetical protein Csa_5G187840                       110   6e-26   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             111   7e-26   
ref|XP_006279478.1|  hypothetical protein CARUB_v10025945mg             111   7e-26   
ref|XP_004490923.1|  PREDICTED: cucumisin-like                          112   7e-26   
gb|KDP44861.1|  hypothetical protein JCGZ_01361                         112   7e-26   
emb|CDX77071.1|  BnaC04g38660D                                          111   7e-26   
ref|XP_007220684.1|  hypothetical protein PRUPE_ppa020430mg             111   7e-26   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                111   7e-26   
gb|KGN50592.1|  hypothetical protein Csa_5G188880                       110   7e-26   
dbj|BAD53008.1|  subtilisin-like serine proteinase-like protein         108   7e-26   
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5         111   7e-26   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      111   8e-26   
tpg|DAA62442.1|  TPA: putative subtilase family protein                 109   8e-26   
ref|XP_007221063.1|  hypothetical protein PRUPE_ppa016501mg             111   8e-26   
ref|XP_002985741.1|  hypothetical protein SELMODRAFT_424715             110   8e-26   
ref|NP_001169390.1|  putative subtilase family protein precursor        111   8e-26   
emb|CDM82985.1|  unnamed protein product                                111   8e-26   
ref|XP_007016590.1|  Subtilisin serine endopeptidase family prote...    111   9e-26   
ref|XP_010525171.1|  PREDICTED: cucumisin-like                          110   9e-26   
emb|CBI31594.3|  unnamed protein product                                112   9e-26   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         110   9e-26   
ref|XP_006851514.1|  hypothetical protein AMTR_s00040p00163680          107   1e-25   
ref|XP_007210779.1|  hypothetical protein PRUPE_ppa019173mg             110   1e-25   
ref|XP_010658656.1|  PREDICTED: cucumisin-like                          111   1e-25   
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3         110   1e-25   
ref|XP_004165285.1|  PREDICTED: cucumisin-like                          110   1e-25   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           110   1e-25   
gb|KHN45945.1|  Subtilisin-like protease                                109   1e-25   
ref|XP_002974442.1|  hypothetical protein SELMODRAFT_414628             110   1e-25   
ref|XP_002985742.1|  hypothetical protein SELMODRAFT_424716             110   1e-25   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                110   1e-25   
emb|CAH66108.1|  OSIGBa0115D20.1                                        110   1e-25   
ref|XP_002985747.1|  hypothetical protein SELMODRAFT_424726             110   1e-25   
dbj|BAJ99628.1|  predicted protein                                      109   1e-25   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         110   1e-25   
gb|KDO66669.1|  hypothetical protein CISIN_1g037074mg                   110   1e-25   
ref|XP_008238763.1|  PREDICTED: cucumisin-like                          110   1e-25   
gb|KDO69223.1|  hypothetical protein CISIN_1g044513mg                   108   1e-25   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5         110   1e-25   
ref|XP_006424939.1|  hypothetical protein CICLE_v10030060mg             110   1e-25   
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         110   1e-25   
ref|XP_002316255.2|  cucumisin family protein                           110   1e-25   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         110   2e-25   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             110   2e-25   
ref|XP_006424942.1|  hypothetical protein CICLE_v10027939mg             110   2e-25   
gb|EYU28706.1|  hypothetical protein MIMGU_mgv1a001952mg                110   2e-25   
ref|XP_002277563.1|  PREDICTED: cucumisin-like                          110   2e-25   
emb|CBI31593.3|  unnamed protein product                                110   2e-25   
ref|XP_007027679.1|  Subtilisin-like serine endopeptidase family ...    110   2e-25   
emb|CDP00292.1|  unnamed protein product                                110   2e-25   
gb|KDO66666.1|  hypothetical protein CISIN_1g0404622mg                  110   2e-25   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...    110   2e-25   
dbj|BAC53929.1|  serine protease-like protein                           109   2e-25   
tpg|DAA62441.1|  TPA: putative subtilase family protein                 109   2e-25   
ref|XP_006424941.1|  hypothetical protein CICLE_v10027939mg             109   2e-25   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          110   2e-25   
ref|XP_010525169.1|  PREDICTED: cucumisin-like                          110   2e-25   
ref|XP_010532508.1|  PREDICTED: cucumisin-like                          110   2e-25   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like           110   2e-25   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like           110   2e-25   
ref|XP_002447443.1|  hypothetical protein SORBIDRAFT_06g001140          110   2e-25   
emb|CBI31603.3|  unnamed protein product                                110   2e-25   
ref|XP_007009168.1|  Subtilisin-like serine endopeptidase family ...    108   2e-25   
ref|XP_007009166.1|  Subtilisin-like serine endopeptidase family ...    108   2e-25   
ref|XP_006488676.1|  PREDICTED: cucumisin-like                          110   2e-25   
emb|CBI31596.3|  unnamed protein product                                109   2e-25   
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             110   2e-25   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             110   2e-25   
emb|CAE76052.1|  B1248C03.11                                            110   2e-25   
ref|XP_002298973.2|  subtilase family protein                           109   3e-25   
ref|XP_011087067.1|  PREDICTED: cucumisin-like                          110   3e-25   
ref|XP_007009169.1|  Subtilisin-like serine endopeptidase family ...    109   3e-25   
ref|XP_002320086.2|  subtilase family protein                           109   3e-25   
ref|XP_010105478.1|  Subtilisin-like protease                           109   3e-25   
gb|EMS51782.1|  Subtilisin-like protease SDD1                           109   3e-25   
ref|NP_001052071.1|  Os04g0121100                                       109   3e-25   
ref|XP_010532550.1|  PREDICTED: cucumisin-like                          109   3e-25   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             109   3e-25   
gb|KDO50629.1|  hypothetical protein CISIN_1g044745mg                   109   3e-25   
ref|XP_006491889.1|  PREDICTED: cucumisin-like                          109   3e-25   
emb|CAN77548.1|  hypothetical protein VITISV_004712                     109   3e-25   
ref|XP_007009170.1|  Subtilisin-like serine endopeptidase family ...    109   3e-25   
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           109   3e-25   
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         109   3e-25   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           109   3e-25   
gb|EEC67681.1|  hypothetical protein OsI_35120                          109   3e-25   
ref|XP_009391860.1|  PREDICTED: subtilisin-like protease SBT5.3         109   3e-25   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                109   3e-25   
emb|CAH66111.1|  OSIGBa0115D20.4                                        109   3e-25   
gb|EMT21161.1|  Cucumisin                                               109   3e-25   
ref|XP_010105479.1|  Subtilisin-like protease                           109   3e-25   
emb|CAE01678.2|  OSJNBb0089K24.3                                        109   4e-25   
emb|CBI31592.3|  unnamed protein product                                109   4e-25   
ref|XP_007009167.1|  Subtilisin-like serine endopeptidase family ...    108   4e-25   
ref|XP_002891021.1|  predicted protein                                  109   4e-25   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     109   4e-25   
gb|EYU19955.1|  hypothetical protein MIMGU_mgv1a023738mg                108   4e-25   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         109   4e-25   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         109   4e-25   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         109   4e-25   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      109   4e-25   
ref|XP_008461722.1|  PREDICTED: cucumisin-like                          108   4e-25   
ref|XP_002972044.1|  hypothetical protein SELMODRAFT_96495              108   5e-25   
gb|KFK27428.1|  hypothetical protein AALP_AA8G381300                    109   5e-25   
ref|XP_010532507.1|  PREDICTED: cucumisin-like                          108   5e-25   
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...    108   5e-25   
ref|XP_006432273.1|  hypothetical protein CICLE_v10004018mg             108   5e-25   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...    108   5e-25   
ref|XP_007009165.1|  Subtilisin-like serine endopeptidase family ...    108   5e-25   
dbj|BAK05842.1|  predicted protein                                      108   5e-25   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                108   5e-25   
emb|CDP06940.1|  unnamed protein product                                108   5e-25   
ref|XP_002972591.1|  hypothetical protein SELMODRAFT_97292              108   5e-25   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    108   5e-25   
gb|KDP42719.1|  hypothetical protein JCGZ_23659                         108   5e-25   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    108   5e-25   
ref|NP_001063751.1|  Os09g0530800                                       108   5e-25   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    108   5e-25   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         108   5e-25   
ref|XP_006432274.1|  hypothetical protein CICLE_v10000577mg             108   5e-25   
ref|XP_008231574.1|  PREDICTED: cucumisin-like                          108   6e-25   
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             108   6e-25   
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           108   6e-25   
emb|CBI31598.3|  unnamed protein product                                108   6e-25   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   108   6e-25   
ref|XP_002862629.1|  hypothetical protein ARALYDRAFT_359482             106   6e-25   
ref|XP_011076782.1|  PREDICTED: cucumisin-like                          108   6e-25   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         108   6e-25   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    108   6e-25   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    108   6e-25   
ref|XP_006851521.1|  hypothetical protein AMTR_s00040p00169800          106   6e-25   
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    108   6e-25   
gb|KDO69224.1|  hypothetical protein CISIN_1g043420mg                   108   7e-25   
ref|XP_006435587.1|  hypothetical protein CICLE_v10033808mg             108   7e-25   
ref|XP_006486543.1|  PREDICTED: cucumisin-like                          108   7e-25   
ref|XP_011081160.1|  PREDICTED: cucumisin-like                          108   7e-25   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                108   7e-25   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                   107   8e-25   
ref|XP_003625782.1|  Xylem serine proteinase                            108   8e-25   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    108   8e-25   
ref|XP_008461726.1|  PREDICTED: cucumisin-like                          108   8e-25   
ref|XP_006849918.1|  hypothetical protein AMTR_s00022p00110120          108   8e-25   
ref|XP_004307317.1|  PREDICTED: cucumisin-like                          108   8e-25   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             108   8e-25   
ref|XP_002518939.1|  Cucumisin precursor, putative                      108   8e-25   
ref|XP_009409658.1|  PREDICTED: cucumisin-like                          108   8e-25   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      108   9e-25   
ref|XP_007219793.1|  hypothetical protein PRUPE_ppa026521mg             108   9e-25   
ref|XP_006424943.1|  hypothetical protein CICLE_v10029841mg             108   9e-25   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           108   1e-24   
emb|CBI34615.3|  unnamed protein product                                108   1e-24   
ref|XP_008344605.1|  PREDICTED: cucumisin-like                          107   1e-24   
ref|NP_001044505.1|  Os01g0794800                                       107   1e-24   
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         108   1e-24   
emb|CAN79849.1|  hypothetical protein VITISV_028842                     107   1e-24   
gb|EMT21268.1|  Subtilisin-like protease                                107   1e-24   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4       106   1e-24   
gb|KHN20889.1|  Cucumisin                                               107   1e-24   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         108   1e-24   
gb|EYU39004.1|  hypothetical protein MIMGU_mgv1a024251mg                107   1e-24   
gb|EMT00503.1|  Subtilisin-like protease                                107   1e-24   
ref|XP_006486542.1|  PREDICTED: cucumisin-like                          107   1e-24   
ref|XP_008245946.1|  PREDICTED: cucumisin-like                          107   1e-24   
ref|XP_010105482.1|  Subtilisin-like protease                           107   1e-24   
gb|EMT21267.1|  Subtilisin-like protease                                107   1e-24   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           107   1e-24   
ref|XP_003619490.1|  Subtilisin-like serine protease                    107   1e-24   
ref|XP_002316251.2|  hypothetical protein POPTR_0010s20390g             107   1e-24   
ref|XP_010273983.1|  PREDICTED: cucumisin-like                          107   1e-24   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
ref|XP_003544153.2|  PREDICTED: cucumisin-like                          107   1e-24   
ref|XP_002991821.1|  hypothetical protein SELMODRAFT_134229             107   1e-24   
ref|XP_002992980.1|  hypothetical protein SELMODRAFT_187138             107   1e-24   
ref|XP_006653122.1|  PREDICTED: xylem serine proteinase 1-like          107   2e-24   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             107   2e-24   
ref|XP_004300747.1|  PREDICTED: cucumisin-like                          107   2e-24   
emb|CDY67954.1|  BnaAnng25710D                                          107   2e-24   
gb|EMS57180.1|  Subtilisin-like protease                                107   2e-24   
emb|CDX80304.1|  BnaC09g34380D                                          107   2e-24   
emb|CBI30268.3|  unnamed protein product                                107   2e-24   
ref|XP_011019233.1|  PREDICTED: xylem serine proteinase 1-like          106   2e-24   
ref|NP_001052081.1|  Os04g0127200                                       107   2e-24   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         107   2e-24   
ref|XP_009354506.1|  PREDICTED: cucumisin-like                          107   2e-24   
ref|XP_010654056.1|  PREDICTED: xylem serine proteinase 1 isoform X1    107   2e-24   
ref|XP_008375470.1|  PREDICTED: cucumisin-like                          107   2e-24   
ref|XP_008346999.1|  PREDICTED: cucumisin-like                          107   2e-24   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_002271796.2|  PREDICTED: cucumisin-like                          107   2e-24   
ref|XP_004490922.1|  PREDICTED: cucumisin-like                          107   2e-24   
ref|XP_010108373.1|  hypothetical protein L484_010381                   107   2e-24   



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCN+KI+GAR+Y  SDD G  I  +GS RD +GHGTHVASTAAGS V  ASYYGLA
Sbjct  178  FGSSNCNKKIVGARFYEESDDSGIKI--TGSARDENGHGTHVASTAAGSPVAGASYYGLA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA GGSP SRIAMY+VC +FGC GSAI+K FDDAI DGVDVL
Sbjct  236  AGTATGGSPGSRIAMYRVCTTFGCRGSAIMKAFDDAIADGVDVL  279



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score =   146 bits (369),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSS+CNRK+IGAR+Y   DD G     +G+PRDH GHGTHVA+TAAGS V  ASYYGLA
Sbjct  184  FNSSSCNRKLIGARFY---DDGGSPTPVTGTPRDHDGHGTHVAATAAGSPVAGASYYGLA  240

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y++C  +GC GSAI+K FDDA+ DGVD++
Sbjct  241  AGTAKGGSPGSRIAVYRICTPYGCSGSAIMKAFDDALADGVDII  284



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SS CN+KI+GAR+Y  SDD G  I  +GS RD +GHGTHVASTAAGS V  ASYYGLA
Sbjct  178  FGSSKCNKKIVGARFYEESDDSGIKI--AGSARDENGHGTHVASTAAGSPVAGASYYGLA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA GGSP SRIAMY+VC +FGC GSAI+K FDDAI DGVDVL
Sbjct  236  AGTATGGSPGSRIAMYRVCTTFGCRGSAIMKAFDDAIADGVDVL  279



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRK+IGARYY  SD +G      GSPRD  GHGTH +STAAG+ V  ASYYGLA
Sbjct  186  FNSSNCNRKLIGARYYNESDVRGPSQSGGGSPRDDVGHGTHTSSTAAGNAVAGASYYGLA  245

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS SSR+AMY+VC   GC GSAIL GFDDA+ DGVDVL
Sbjct  246  AGTAKGGSASSRVAMYRVCSEEGCSGSAILAGFDDAVADGVDVL  289



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSS+CNRK+IGAR+Y ++ D    +  +G+PRDH GHGTHVA+TAAGS V  ASYYGLA
Sbjct  175  FNSSSCNRKLIGARFYDDAGDSATPV--TGTPRDHDGHGTHVAATAAGSPVAGASYYGLA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y++C  +GC GSAI+K FDDAI DGVD++
Sbjct  233  AGTAKGGSPGSRIAVYRICTPYGCSGSAIMKAFDDAIADGVDII  276



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+SSNCNRK+IGAR+Y  S+       D GSPRD  GHG+HVA+TAAGS+V  ASYYG+A
Sbjct  153  FSSSNCNRKLIGARFYDTSESDDTETED-GSPRDSEGHGSHVAATAAGSIVQGASYYGVA  211

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP+SRIA+Y+VC S GC GSAIL  FDDAI DGVDVL
Sbjct  212  AGTAKGGSPTSRIAVYKVCSSEGCLGSAILAAFDDAIADGVDVL  255



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FNSSNCNRKIIGARYYPN D  GG   D +G+PRD  GHGTH ASTAAG++V  ASY+GL
Sbjct  156  FNSSNCNRKIIGARYYPNLD--GGDDNDVAGTPRDMHGHGTHTASTAAGNVVSGASYFGL  213

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A GTAKGGSP SR+++Y+VC +FGC GSAIL  FDDAI DGVD+L
Sbjct  214  AAGTAKGGSPGSRLSIYKVC-NFGCSGSAILAAFDDAISDGVDIL  257



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FNSS+CNRK+IGAR+Y   DD G      +G+PRDH GHGTHVA+TAAGS V  ASYYGL
Sbjct  178  FNSSSCNRKLIGARFY---DDPGNSPTPVTGTPRDHDGHGTHVAATAAGSPVAGASYYGL  234

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A GTAKGGSP SRIA+Y++C  +GC GSAI+K FDDAI DGVD++
Sbjct  235  ATGTAKGGSPGSRIAVYRICTPYGCSGSAIMKAFDDAIADGVDII  279



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+SSNCNRK+IGAR+Y  S+       D GSPRD  GHG+HVA+TAAGS+V  ASYYG+A
Sbjct  191  FSSSNCNRKLIGARFYDTSESDDTETED-GSPRDSQGHGSHVAATAAGSIVQGASYYGVA  249

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP+SRIA+Y+VC S GC GSAIL  FDDAI DGVDVL
Sbjct  250  AGTAKGGSPTSRIAVYKVCSSEGCLGSAILAAFDDAIADGVDVL  293



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGAR+Y +S+  G   +   SPRD +GHGTHVASTAAGS V +ASYYGLA
Sbjct  179  FTSSNCNRKIIGARFYESSESDG---IRYHSPRDGAGHGTHVASTAAGSAVANASYYGLA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC + GC GS+I+K FDD+I DGVDVL
Sbjct  236  AGTAKGGSPGSRIAMYRVCMADGCRGSSIMKAFDDSIADGVDVL  279



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGAR+Y +S+  G   +   SPRD +GHGTHVASTAAGS V +ASYYGLA
Sbjct  184  FTSSNCNRKIIGARFYESSESDG---IRYHSPRDGAGHGTHVASTAAGSAVANASYYGLA  240

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC + GC GS+I+K FDD+I DGVDVL
Sbjct  241  AGTAKGGSPGSRIAMYRVCMADGCRGSSIMKAFDDSIADGVDVL  284



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--HILDSGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            F++S+CN+K+IGARYY + DD       L   SPRD SGHGTH ASTAAGS V DASYYG
Sbjct  181  FSASSCNKKLIGARYYSSDDDMATPTKWLSGDSPRDASGHGTHTASTAAGSSVMDASYYG  240

Query  176  LAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            LA G AKGGS SSRIAMY+VC   GCPGSAIL GFDDAI+DGVD++
Sbjct  241  LARGIAKGGSTSSRIAMYRVCFEDGCPGSAILAGFDDAIRDGVDLM  286



>ref|XP_002461867.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
 gb|EER98388.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
Length=826

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCN K+IGARYY  S  +G    + GSPRD  GHGTH +STAAGS V  ASYYGLA
Sbjct  216  FNSSNCNNKLIGARYYDLSSVRGPSPSNGGSPRDDVGHGTHTSSTAAGSAVTGASYYGLA  275

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS  SR+AMY+VC  +GC GSAIL GFDDAI DGVDV+
Sbjct  276  SGTAKGGSAGSRVAMYRVCAEYGCAGSAILAGFDDAIADGVDVV  319



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F +S CN+KI+GAR+Y + DD G  I  +G+ RD +GHGTHVASTAAGS V  ASY GLA
Sbjct  179  FGASKCNKKIVGARFYEDFDDSGMKI--NGTARDENGHGTHVASTAAGSHVAGASYNGLA  236

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSPSSRIAMY+VC S GC GSAI+K FDDAI DGVD+L
Sbjct  237  AGTAKGGSPSSRIAMYRVCTSNGCRGSAIMKAFDDAIADGVDIL  280



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F +S CN+KI+GAR+Y + DD G  I  +G+ RD +GHGTHVASTAAGS V  ASY GLA
Sbjct  179  FGASKCNKKIVGARFYEDFDDSGMKI--NGTARDENGHGTHVASTAAGSHVAGASYNGLA  236

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSPSSRIAMY+VC S GC GSAI+K FDDAI DGVD+L
Sbjct  237  AGTAKGGSPSSRIAMYRVCTSNGCRGSAIMKAFDDAIADGVDIL  280



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SS+CNRK+IGAR+Y NSD+    I D+ SPRD  GHGTHVA TAAGS+V  ASYYGLA
Sbjct  192  FTSSSCNRKLIGARFY-NSDEL---IADNDSPRDLVGHGTHVAGTAAGSVVPGASYYGLA  247

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC + GC  SAIL  FDDAI DGVDVL
Sbjct  248  AGTAKGGSPGSRIAMYKVCTAQGCSASAILAAFDDAISDGVDVL  291



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            FNSSNCNRK+IGAR+Y  PN D+         +PRD  GHGTHVASTA G+ V + SYYG
Sbjct  182  FNSSNCNRKLIGARFYSDPNGDE------GDSTPRDSIGHGTHVASTAVGAAVTNVSYYG  235

Query  176  LAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            LA G+AKGGSP SR+A+Y+VC +FGC GSAIL  FDDAI DGVDVL
Sbjct  236  LAAGSAKGGSPESRLAVYRVCSNFGCSGSAILAAFDDAINDGVDVL  281



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGARYYPN +   G    + + RD  GHGTH ASTAAG+ V  ASYYGLA
Sbjct  175  FNSSNCNRKIIGARYYPNLE---GDDRVAATTRDTVGHGTHTASTAAGNAVSGASYYGLA  231

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G AKGGSP SR+A+Y+VC + GC GSAIL  FDDAI DGVDVL
Sbjct  232  EGIAKGGSPESRLAIYKVCSNIGCSGSAILAAFDDAISDGVDVL  275



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRK+IGARYY +  D G  +   G+PRD SGHGTHVASTAAG  V  ASYYGLA
Sbjct  142  FTSSNCNRKVIGARYY-DDPDSGTEL---GTPRDESGHGTHVASTAAGRPVSGASYYGLA  197

Query  182  MGTAKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GGSP SRIAMY+VC    GC GSAILK FDDAI DGVDVL
Sbjct  198  KGTAEGGSPGSRIAMYRVCTPGGGCLGSAILKAFDDAIADGVDVL  242



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SS+CNRKIIGARYY   DD    I   G+PRD+ GHG+HVASTAAG  V  ASYYGLA
Sbjct  172  FTSSSCNRKIIGARYY---DDPELGI--PGTPRDNVGHGSHVASTAAGRPVSGASYYGLA  226

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC S  C GSAILKGFDDAI DGVDVL
Sbjct  227  KGTAKGGSPGSRIAMYRVCPSNFCIGSAILKGFDDAIADGVDVL  270



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F +S CN+KI+GAR+Y   D +G  +  +GS RD +GHGTHVASTAAGS V  ASYYGLA
Sbjct  180  FGASKCNKKIVGARFYEEFDGRGTKM--AGSARDENGHGTHVASTAAGSPVAGASYYGLA  237

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y+VC S GC GSAI+K FDDAI DGVDVL
Sbjct  238  AGTAKGGSPGSRIAVYRVCTSNGCRGSAIMKAFDDAIADGVDVL  281



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCN K+IGARYY  S  +G      GSPRD  GHGTH +STAAGS V  ASYYGLA
Sbjct  211  FNSSNCNNKLIGARYYDLSSVRGPAPSGGGSPRDDVGHGTHTSSTAAGSAVTGASYYGLA  270

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS +SR+AMY+VC   GC GSAIL GFDDAI DGVDV+
Sbjct  271  PGTAKGGSAASRVAMYRVCSQAGCAGSAILAGFDDAIADGVDVI  314



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCN K+IGARYY  S  +G      GSPRD  GHGTH +STAAGS V  ASYYGLA
Sbjct  211  FNSSNCNNKLIGARYYDLSSVRGPAPSGGGSPRDDVGHGTHTSSTAAGSAVTGASYYGLA  270

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS +SR+AMY+VC   GC GSAIL GFDDAI DGVDV+
Sbjct  271  PGTAKGGSAASRVAMYRVCSQAGCAGSAILAGFDDAIADGVDVI  314



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F +S CN+KI+GAR+Y   D +G  +  +GS RD +GHGTHVASTAAGS V  ASYYGLA
Sbjct  180  FGASKCNKKIVGARFYEEFDGRGTKM--AGSARDENGHGTHVASTAAGSPVAGASYYGLA  237

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y+VC S GC GSAI+K FDDAI DGVDVL
Sbjct  238  AGTAKGGSPGSRIAVYRVCTSNGCRGSAIMKAFDDAIADGVDVL  281



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGAR+Y + DD   +     + RD  GHGTH +STAAGS V++ASYYG+A
Sbjct  179  FNSSNCNRKIIGARFYKSPDDDSEYF----TTRDVIGHGTHTSSTAAGSAVENASYYGVA  234

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  235  SGTAKGGSPNARIAMYKVCNPGGCAGSSILAAFDDAIADGVDVL  278



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGAR+Y + DD   +     + RD  GHGTH +STAAGS V++ASYYG+A
Sbjct  179  FNSSNCNRKIIGARFYKSPDDDSEYF----TTRDVIGHGTHTSSTAAGSAVENASYYGVA  234

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  235  SGTAKGGSPNARIAMYKVCNPGGCAGSSILAAFDDAIADGVDVL  278



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRK+IGAR+YP+ D  G +  +  +PRD +GHGTHVASTA    V +AS+YGLA
Sbjct  181  FNSSNCNRKLIGARFYPDPD--GKNDDNDKTPRDSNGHGTHVASTAVCVAVSNASFYGLA  238

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SR+A+Y+VC   GC GSAIL  FDDAI DGVDVL
Sbjct  239  TGTAKGGSPESRLAVYKVCYRNGCRGSAILAAFDDAIADGVDVL  282



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCN+KIIGAR+Y + +D+ G   D  + RD  GHG+HVASTAAG++V++ASYYG+A
Sbjct  170  FNSSNCNKKIIGARFYKDPEDEDG---DYYTSRDVIGHGSHVASTAAGAVVENASYYGVA  226

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG P++RIAMY+VC   GC GS+IL  FDDAI DGVD+L
Sbjct  227  SGTAKGGFPAARIAMYRVCTPDGCAGSSILAAFDDAIADGVDIL  270



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRK+IGARYYPN D +        +PRD  GHGTH ASTAAGS+V  ASYYG+ 
Sbjct  187  FNSSNCNRKLIGARYYPNPDQKDD---PDNTPRDTYGHGTHTASTAAGSVVSGASYYGIG  243

Query  182  MGTAKGGSPSSRIAMYQVC-QSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GGSP SR+A+Y+VC +  GC GS+IL GFDDAI DGV+VL
Sbjct  244  EGTAQGGSPESRLAVYKVCLKDIGCSGSSILAGFDDAIADGVNVL  288



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGAR+Y N DD   +     + RD  GHG+HV+STAAGS V++ASYYG+A
Sbjct  174  FNSSNCNRKIIGARFYKNPDDDSEYF----TTRDVIGHGSHVSSTAAGSAVENASYYGVA  229

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS ++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  230  SGTAKGGSSNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  273



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F++SNCNRK+IGARYY ++    G I +  +PRD  GHGTH ASTAAG  V  ASYYGLA
Sbjct  187  FSASNCNRKLIGARYYNDTTKSKGEIHEQ-TPRDTVGHGTHTASTAAGISVPGASYYGLA  245

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GTAKGGSP SRIA+Y+VC S GC GSAIL  FDDAI DGVDV+
Sbjct  246  VGTAKGGSPGSRIAIYRVCSSNGCRGSAILAAFDDAIGDGVDVM  289



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 9/108 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYP----NSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            FNSSNCNRK+IGAR+Y     N DD+G +     +PRD  GHGTHVASTA G+ V +ASY
Sbjct  181  FNSSNCNRKLIGARFYTDPTGNDDDEGDN-----TPRDSVGHGTHVASTAVGATVTNASY  235

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G+A GGS  SR+A+Y+VC +FGC GSAIL  FDDAI DGVDVL
Sbjct  236  YGLAAGSATGGSSESRLAVYRVCSNFGCRGSAILGAFDDAISDGVDVL  283



>ref|XP_008800195.1| PREDICTED: xylem serine proteinase 1-like [Phoenix dactylifera]
Length=349

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCN+K+IGARYY         +  S SPRD  GHGTH ASTA G  V  ASYYGLA
Sbjct  58   FNASNCNKKLIGARYY--------KVKGSASPRDEVGHGTHTASTAGGDAVMQASYYGLA  109

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG  ++RIAMYQVC   GCPG AIL GFDDAI DGVD+L
Sbjct  110  AGTAKGGFTAARIAMYQVCTYKGCPGYAILAGFDDAIADGVDLL  153



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG-HILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            F+SS CN+K++GAR+Y   DD G  +   SGS RD +GHGTHVASTAAG+ +  ASYYGL
Sbjct  178  FSSSKCNKKLVGARFY---DDSGEDNRKPSGSVRDQNGHGTHVASTAAGNPISGASYYGL  234

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
            A GTAKGGSPSSRIAMY+VC S GC GSAI+K FDDAI DGVDV
Sbjct  235  AAGTAKGGSPSSRIAMYRVCTSDGCRGSAIMKAFDDAIADGVDV  278



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCNRK++GAR+Y + DD    I  +  PRD  GHG+HVASTAAG++V  ASYYGLA
Sbjct  18   FNTSNCNRKLVGARFYDSPDDDEDKIYQT--PRDMIGHGSHVASTAAGAVVPHASYYGLA  75

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G+AKGGSP SRIA Y+VC   GC GS+ILK FDDAI DGV +L
Sbjct  76   EGSAKGGSPGSRIAAYRVCSENGCYGSSILKAFDDAIADGVSIL  119



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
            S  CN+K++GAR+Y +SD+ G  +  SGS RD +GHGTHVASTAAGS +  ASYYGLA G
Sbjct  181  SFKCNKKLVGARFYDDSDEDG--VRPSGSARDENGHGTHVASTAAGSPISGASYYGLASG  238

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
            TAKGGSP SRIAMY+VC + GC GSAI+K FDDAI DGVDV
Sbjct  239  TAKGGSPGSRIAMYRVCMTDGCHGSAIMKAFDDAIADGVDV  279



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+ SNCNRK+IGAR+Y + D+    +    SPRD  GHGTHVASTA GS V DAS+YGLA
Sbjct  177  FHQSNCNRKLIGARFYVDPDE----VTADRSPRDVQGHGTHVASTAGGSAVPDASFYGLA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y+VC   GC GSAIL  FDDAI DGVDV+
Sbjct  233  AGTAKGGSPGSRIAIYRVCSPEGCQGSAILAAFDDAISDGVDVV  276



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F S+NCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  192  FKSTNCNRKIIGARYYKNPDDDSEY----DTTRDVIGHGSHVSSTIAGSAVENASYYGVA  247

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  248  SGTAKGGSPNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  291



>ref|NP_001238252.1| subtilisin-type protease precursor [Glycine max]
 gb|AAG38994.1|AF160513_1 subtilisin-type protease precursor [Glycine max]
 emb|CAB87246.1| putative pre-pro-subtilisin [Glycine max]
 emb|CAB87247.1| putative subtilisin precursor [Glycine max]
Length=770

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSS CNRKIIGAR+YPN +++        + RD +GHGTHV+STA G  V  AS+YGLA
Sbjct  187  FNSSCCNRKIIGARFYPNPEEK--------TARDFNGHGTHVSSTAVGVPVSGASFYGLA  238

Query  182  MGTAKGGSPSSRIAMYQVCQSFG-CPGSAILKGFDDAIKDGVDVL  313
             GTA+GGSP SR+A+Y+VC +FG CPGSAIL GFDDAI DGVD+L
Sbjct  239  AGTARGGSPESRLAVYKVCGAFGSCPGSAILAGFDDAIHDGVDIL  283



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F S+NCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  192  FKSTNCNRKIIGARYYKNPDDDSEY----DTTRDVIGHGSHVSSTIAGSAVENASYYGVA  247

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  248  SGTAKGGSPNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  291



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRK+IGARYY + +D G +     + RD +GHGTHVA TAAG +V +ASYYG+A
Sbjct  181  FYSSNCNRKLIGARYYADPNDSGDN-----TARDSNGHGTHVAGTAAGVMVTNASYYGVA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G AKGGSP SR+A+Y+VC +FGC GS+IL  FDDAI DGVDVL
Sbjct  236  TGCAKGGSPESRLAVYRVCSNFGCRGSSILAAFDDAIADGVDVL  279



>gb|EYU38295.1| hypothetical protein MIMGU_mgv1a0026492mg, partial [Erythranthe 
guttata]
Length=242

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSS-NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FN S NCNRK+IGAR+YPN + Q       GSPRD  GHGTH AS A GS V  ASYYGL
Sbjct  34   FNKSINCNRKLIGARFYPNLETQTNPTQAHGSPRDSVGHGTHTASIAGGSWVPRASYYGL  93

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G A+GG P++RIA Y+ C   GC GS ILK  DDAI+DGVD++
Sbjct  94   ARGAARGGLPAARIASYKACTEEGCAGSIILKAIDDAIRDGVDII  138



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 6/104 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRK+IGAR YP+ D        S SPRD++GHGTHVASTA G++V +AS+YGLA
Sbjct  186  FNSSNCNRKLIGARCYPDEDPH------SISPRDYNGHGTHVASTAVGAVVRNASFYGLA  239

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAK GSP SR+A+Y+VC    C GSAI+  FDDAI DGVDVL
Sbjct  240  AGTAKSGSPESRLAIYKVCPLNFCSGSAIMAAFDDAIADGVDVL  283



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRK+IGARYY    D       SGSPRD +GHGTHVA+TAAGS V+ ASY GLA
Sbjct  176  FTSSNCNRKLIGARYY----DDSESSTSSGSPRDQNGHGTHVAATAAGSPVEGASYRGLA  231

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G AKGGSP SRIAMY+VC   GC GSAILK FDDAI DGVD+L
Sbjct  232  EGIAKGGSPGSRIAMYRVCTLNGCRGSAILKAFDDAIADGVDIL  275



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG-SPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FN+SNCN+K+IGARYY   +   G    SG SPRD +GHGTH +STAAG+ V  ASYYGL
Sbjct  191  FNTSNCNKKLIGARYYDLGEVDSGRTRGSGGSPRDAAGHGTHTSSTAAGNAVTGASYYGL  250

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A GTAKGGS +SR+AMY+VC   GC GSAIL GFDDAI DGVDV+
Sbjct  251  AQGTAKGGSAASRVAMYRVCSDEGCAGSAILAGFDDAIGDGVDVV  295



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
            S  CN+K++GAR+Y +SD+ G  +   GS RD +GHGTHVASTAAGSL+  ASYYGLA G
Sbjct  181  SFKCNKKLVGARFYDDSDEDG--VRPFGSARDDNGHGTHVASTAAGSLISGASYYGLASG  238

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
            TAKGGSP SRIAMY+VC + GC GSAI+K FDDAI DGVDV
Sbjct  239  TAKGGSPGSRIAMYRVCTADGCHGSAIMKAFDDAIADGVDV  279



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGAR+Y N DD   +     + RD  GHG+H +STAAGS V++ASYYG+A
Sbjct  181  FKSSNCNRKIIGARFYKNPDDDSEYY----TTRDVIGHGSHTSSTAAGSAVENASYYGVA  236

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG+P++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  237  SGTAKGGAPNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  280



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRK+IGARYY + +D G +     + RD +GHGTHVA TAAG +V +ASYYG+A
Sbjct  181  FYSSNCNRKLIGARYYADPNDSGDN-----TARDSNGHGTHVAGTAAGVMVTNASYYGVA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G AKGGSP SR+A+Y+VC +FGC GS+IL  FDDAI DGVD+L
Sbjct  236  TGCAKGGSPESRLAVYRVCSNFGCRGSSILAAFDDAIADGVDLL  279



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRK+IGARYY + +D G +     + RD +GHGTHVA TAAG +V +ASYYG+A
Sbjct  181  FYSSNCNRKLIGARYYADPNDSGDN-----TARDSNGHGTHVAGTAAGVMVTNASYYGVA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G AKGGSP SR+A+Y+VC +FGC GS+IL  FDDAI DGVD+L
Sbjct  236  TGCAKGGSPESRLAVYRVCSNFGCRGSSILAAFDDAIADGVDLL  279



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F S+NCNRKIIGARYY N DD   +     + RD  GHG+H +ST AGS V++ASYYG+A
Sbjct  178  FKSTNCNRKIIGARYYKNPDDDSEYY----TTRDVIGHGSHTSSTIAGSAVENASYYGVA  233

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  234  SGTAKGGSPNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  277



>ref|XP_010091320.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44294.1| Subtilisin-like protease [Morus notabilis]
Length=764

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  SNCNRK+IGARYY N +      LDS  PRD  GHGTHVASTAAG+ V +ASY+GLA
Sbjct  184  FKKSNCNRKLIGARYYANEEKT----LDS--PRDSEGHGTHVASTAAGAPVTNASYFGLA  237

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
             GTA+GG+PS+RIA Y+VC S GC G+AIL+G DDA+ DGVDV
Sbjct  238  RGTARGGAPSARIASYKVCSSEGCYGAAILQGIDDAVNDGVDV  280



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F S+NCNRKIIGARYY N +D   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  177  FKSTNCNRKIIGARYYKNPEDDSEY----DTTRDVIGHGSHVSSTIAGSAVENASYYGVA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  233  SGTAKGGSPNARIAMYKVCNPGGCTGSSILAAFDDAIGDGVDVL  276



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCN+KIIGAR Y   +D    ++   SPRD  GHGTHVASTAAGS V   SYYGLA
Sbjct  177  FNTSNCNKKIIGARSY---EDDETSVIKYQSPRDMVGHGTHVASTAAGSEVQGVSYYGLA  233

Query  182  MGTAKGGSPSSRIAMYQVCQ-SFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC  + GC GS+IL  FDDAI DGVDVL
Sbjct  234  EGTAKGGSPGSRIAMYRVCSPNNGCRGSSILAAFDDAIADGVDVL  278



>gb|EPS60118.1| hypothetical protein M569_14685, partial [Genlisea aurea]
Length=200

 Score =   127 bits (318),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 9/102 (9%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
            CNRK+IGAR+YP+       ++ S   +PRD  GHGTHV+STAAG  V  AS+YGLA GT
Sbjct  1    CNRKVIGARFYPDP------LVSSSDATPRDELGHGTHVSSTAAGKPVSGASFYGLANGT  54

Query  191  AKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
            A+GGSP++RIAMY+VC S  GCPGS+ILKGFDDAI DGVDVL
Sbjct  55   ARGGSPNARIAMYKVCFSGRGCPGSSILKGFDDAIADGVDVL  96



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 81/110 (74%), Gaps = 10/110 (9%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG------SPRDHSGHGTHVASTAAGSLVDDA  163
            FNSS+CNRK+IGARYY    D GG            SPRD +GHGTH +STAAG+ V+ A
Sbjct  208  FNSSSCNRKLIGARYY----DVGGEAKRQSARSSGSSPRDEAGHGTHTSSTAAGNAVNGA  263

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            SYYGLA GTAKGGS SSR+AMY+VC   GC GSAIL GFDDA+ DGVDV+
Sbjct  264  SYYGLAAGTAKGGSASSRVAMYRVCSGEGCAGSAILAGFDDAVADGVDVI  313



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  138  FKSSNCNRKIIGARYYKNPDDDSEYY----TTRDVIGHGSHVSSTVAGSAVENASYYGVA  193

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS ++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  194  SGTAKGGSQNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  237



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+SSNCNRK+IGAR+Y   +  G   +DS  PRD  GHG+HVA TAAG+ V DASYYG+A
Sbjct  207  FSSSNCNRKLIGARFYSTPESDGTIEIDS--PRDTVGHGSHVAGTAAGTXVXDASYYGVA  264

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA GGSP SRIAMY+VC   GC GS IL  FDDAI DGVDVL
Sbjct  265  AGTAIGGSPGSRIAMYKVCSEGGCRGSDILAAFDDAIADGVDVL  308



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  138  FKSSNCNRKIIGARYYKNPDDDSEYY----TTRDVIGHGSHVSSTIAGSAVENASYYGVA  193

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS ++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  194  SGTAKGGSQNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  237



>gb|KEH19203.1| subtilisin-like serine protease [Medicago truncatula]
Length=636

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  SNCNRK+IGARYY   D +G       SPRD +GHGTH ASTAAG +V++ASYYGLA
Sbjct  57   FKKSNCNRKLIGARYYNKKDPKG-------SPRDFNGHGTHTASTAAGVIVNNASYYGLA  109

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             GTA+GGSPS+RIA Y+ C   GC G  +LK  DDAIKDGVD
Sbjct  110  KGTARGGSPSARIAAYKACSGEGCSGGTLLKAIDDAIKDGVD  151



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  177  FKSSNCNRKIIGARYYKNPDDDSEYY----TTRDVIGHGSHVSSTIAGSAVENASYYGVA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS ++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  233  SGTAKGGSQNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  276



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--------PNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGARYY        P S     H ++ +GSPRD  GHGTH AS AAG+ +
Sbjct  180  FKKSNCNRKLIGARYYNTPKALIQPKSSSNKSHPINLTGSPRDSVGHGTHTASIAAGAPI  239

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +ASYYGLA GTA+GGSPS+RIA Y+ C   GC GS I+K FDDAIKDGVD++
Sbjct  240  ANASYYGLAPGTARGGSPSARIASYKACSLEGCSGSTIMKAFDDAIKDGVDII  292



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCNRKIIGARYY N DD   +     + RD  GHG+HV+ST AGS V++ASYYG+A
Sbjct  177  FKSSNCNRKIIGARYYKNPDDDSEYY----TTRDVIGHGSHVSSTIAGSAVENASYYGVA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS ++RIAMY+VC   GC GS+IL  FDDAI DGVDVL
Sbjct  233  SGTAKGGSQNARIAMYKVCNPGGCTGSSILAAFDDAIADGVDVL  276



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRK+IGAR+Y   D          + RD  GHGTHVASTAAGS V  ASYYGLA
Sbjct  81   FNSSNCNRKLIGARFYGGDDSDSDE---DQTARDKVGHGTHVASTAAGSTVTGASYYGLA  137

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIAMY+VC   GC GSAIL  FDDAI D VDVL
Sbjct  138  AGTAKGGSPRSRIAMYRVCTEDGCLGSAILAAFDDAISDKVDVL  181



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 82/105 (78%), Gaps = 6/105 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS--DDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            F+SS CN+K++GAR+Y +S  DD+       GS RD +GHGTHVASTAAG+ +  ASYYG
Sbjct  178  FSSSKCNKKLVGARFYDDSGEDDRKPF----GSVRDQNGHGTHVASTAAGNPISGASYYG  233

Query  176  LAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
            LA GTAKGGSP SRIAMY+VC S GC GSAI+K FDDAI DGVDV
Sbjct  234  LAAGTAKGGSPGSRIAMYRVCTSDGCRGSAIMKAFDDAIADGVDV  278



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGARYY   +D        G+ RD  GHGTH ASTAAG++V  ASY+GLA
Sbjct  179  FNSSNCNRKIIGARYYRLDEDDDNV---PGTTRDKDGHGTHTASTAAGNVVSGASYFGLA  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GT KGGSP SR+A+Y+VC  F C GSAIL  FDDAI DGVDVL
Sbjct  236  AGTTKGGSPESRLAIYKVCNMF-CSGSAILAAFDDAISDGVDVL  278



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  SNCNRK+IGARYY   D +G       SPRD +GHGTH ASTAAG +V++ASYYGLA
Sbjct  181  FKKSNCNRKLIGARYYNKKDPKG-------SPRDFNGHGTHTASTAAGVIVNNASYYGLA  233

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             GTA+GGSPS+RIA Y+ C   GC G  +LK  DDAIKDGVD
Sbjct  234  KGTARGGSPSARIAAYKACSGEGCSGGTLLKAIDDAIKDGVD  275



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG---HILDS-GSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  S+CNRK+IGARYY   D  G    HI  + GSPRD  GHGTH +STAAG +V +ASY
Sbjct  176  FKKSDCNRKLIGARYYNTQDTSGNNKTHIEGAKGSPRDSIGHGTHTSSTAAGVIVKNASY  235

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YGLA GTA+GGSPS+RIA Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  236  YGLAKGTARGGSPSTRIAAYKTCSEEGCSGSTILKAIDDAIKDGVD  281



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 80/105 (76%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCNRKIIGAR Y  +DD    ++   SPRD  GHGTHVASTAAGS V   SYYGLA
Sbjct  143  FNTSNCNRKIIGARSY-EADDSS--VIKYHSPRDTIGHGTHVASTAAGSEVQGVSYYGLA  199

Query  182  MGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SR+A+Y+VC S  GC GS+IL  FDDAI DGVDVL
Sbjct  200  EGTAKGGSPGSRLAIYRVCSSHNGCRGSSILAAFDDAIADGVDVL  244



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 80/105 (76%), Gaps = 4/105 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCNRKIIGAR Y  +DD    ++   SPRD  GHGTHVASTAAGS V   SYYGLA
Sbjct  143  FNTSNCNRKIIGARSY-EADDSS--VIKYHSPRDTIGHGTHVASTAAGSEVQGVSYYGLA  199

Query  182  MGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SR+A+Y+VC S  GC GS+IL  FDDAI DGVDVL
Sbjct  200  EGTAKGGSPGSRLAIYRVCSSHNGCRGSSILAAFDDAIADGVDVL  244



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN KIIGAR Y NS D     LD+ +PRD +GHGTHVASTAAG++V DASYYGLA GTAK
Sbjct  177  CNGKIIGARAY-NSPDDDDDGLDN-TPRDTNGHGTHVASTAAGTMVPDASYYGLATGTAK  234

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GGSP SRIAMY+VC  +GC GS+IL  F DAIKDGVD+L
Sbjct  235  GGSPGSRIAMYRVCAQYGCDGSSILAAFSDAIKDGVDIL  273



>ref|XP_008346279.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=781

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY      + DQ      SGSPRD  GHGTH AS AAG  V +ASY
Sbjct  188  FKKSNCNRKLIGARYYNVPVTTNGDQSHLASTSGSPRDSVGHGTHTASIAAGVQVPNASY  247

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA GTAKGGSPS+RIA Y+ C   GC G+ ILK  DDA++DGVDV+
Sbjct  248  YGLAQGTAKGGSPSARIACYKACLDVGCSGATILKAIDDAVRDGVDVI  295



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD----SGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY   D  G +        GSPRD  GHGTH ASTAAG  V++A+Y
Sbjct  173  FKKSNCNRKLIGARYYNTQDTFGSNKTHIGGAKGSPRDTVGHGTHTASTAAGVNVNNANY  232

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YGLA GTA+GGSPS+RIA Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  233  YGLAKGTARGGSPSTRIAAYKTCSEEGCSGSTILKAMDDAIKDGVD  278



>gb|KCW65828.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=472

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  +NCNRK+IGARYY     NS+  G      SGSPRD  GHGTH ASTA G+LV +AS
Sbjct  180  FKKANCNRKLIGARYYGIRSSNSNGTGTESTKASGSPRDSVGHGTHTASTAGGALVANAS  239

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YYGLA GTAKGG PS+RIA Y+ C   GC GS ILK  DDAI+DGVD
Sbjct  240  YYGLAKGTAKGGLPSTRIATYKTCTEEGCSGSLILKAIDDAIRDGVD  286



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHI--LDSGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            FN+SNCN+K+IGARYY +       +    S SPRD  GHGTH ASTA G+ V  ASYYG
Sbjct  183  FNASNCNKKLIGARYYKDDGAAATPVGRATSDSPRDELGHGTHTASTAGGNAVVQASYYG  242

Query  176  LAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            LA GTAKGGS ++RIAMY+VC   GC GSAIL GFDDAI DGVD+L
Sbjct  243  LAAGTAKGGSTAARIAMYRVCTFNGCSGSAILAGFDDAIADGVDLL  288



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYP-NSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FNSS CNRK+IGARYY  NS        D+  PRD  GHGTH +STAAGSLV  A+YYGL
Sbjct  189  FNSSYCNRKLIGARYYKDNSPSVAWTAQDT--PRDTLGHGTHTSSTAAGSLVAGANYYGL  246

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G AKGGSP+SR+A+Y+VC   GC GSAIL  FDDAI DGVD+L
Sbjct  247  AAGIAKGGSPTSRLAVYKVCTEEGCKGSAILAAFDDAIGDGVDIL  291



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD----SGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY   D  G +        GSPRD  GHGTH ASTAAG  V++A+Y
Sbjct  173  FKKSNCNRKLIGARYYNTQDTFGSNKTHIGGAKGSPRDTVGHGTHTASTAAGVNVNNANY  232

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YGLA GTA+GGSPS+RIA Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  233  YGLAKGTARGGSPSTRIAAYKTCSEEGCSGSTILKAMDDAIKDGVD  278



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--------HILDS-GSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGARYY    D  G        H++   GSPRD  GHGTH ASTA G  V
Sbjct  178  FKKSNCNRKLIGARYYTIFSDSTGSKSRGNRTHVIRPIGSPRDSVGHGTHTASTAGGVAV  237

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             +ASYYGLA GTA+GGSPSSRIAMY+ C   GC GS ILK  DDAIKDGVD
Sbjct  238  ANASYYGLAHGTARGGSPSSRIAMYKACSLGGCSGSTILKAIDDAIKDGVD  288



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 79/106 (75%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGAR-YYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FNSSNCNRKIIGAR YY  S+       D  + RD  GHGTH ASTAAG  V DASYYG+
Sbjct  185  FNSSNCNRKIIGARCYYHESEG------DDSTARDIVGHGTHTASTAAGIPVSDASYYGV  238

Query  179  AMGTAKGGSPSSRIAMYQVC-QSFGCPGSAILKGFDDAIKDGVDVL  313
            A GTAKGGSP SR+A+Y+VC + FGC GSAIL  FDDAI DGVDVL
Sbjct  239  ASGTAKGGSPESRLAIYKVCFKEFGCSGSAILAAFDDAIYDGVDVL  284



>ref|XP_009355089.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY      + DQ      SGSPRD  GHGTH AS AAG  V +ASY
Sbjct  188  FKKSNCNRKLIGARYYNVPVTTNGDQSHLASTSGSPRDSVGHGTHTASIAAGVQVPNASY  247

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA++DGVDV+
Sbjct  248  YGLAQGTARGGSPSARIACYKACLDVGCSGATILKAIDDAVRDGVDVI  295



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGARYY + D+         + RD +GHGTH ASTAAG+ V  ASYY LA
Sbjct  179  FNSSNCNRKIIGARYYADPDEYDDET--ENTVRDRNGHGTHTASTAAGNFVSGASYYDLA  236

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SR+A+Y+VC S GC GS +L  FDDAI DGVDVL
Sbjct  237  AGTAKGGSPESRLAIYKVC-SPGCSGSGMLAAFDDAIYDGVDVL  279



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG-----SPRDHSGHGTHVASTAAGSLVDDAS  166
            FN+SNCN+K++GARYY   DD     + +G     +PRD  GHGTH ASTA G+ V  AS
Sbjct  182  FNASNCNKKLVGARYY--KDDDAVMAIPTGRATATTPRDELGHGTHTASTAGGNAVMQAS  239

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YYGLA GTAKGG  ++RIAMY+VC   GC GSAIL GFDDAI DGVD+L
Sbjct  240  YYGLAAGTAKGGYTAARIAMYRVCSYSGCAGSAILAGFDDAIADGVDLL  288



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 80/114 (70%), Gaps = 16/114 (14%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----------PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSL  151
            FNSSNCNRK+IGARYY          P++   G       SPRD +GHGTH +STAAG+ 
Sbjct  205  FNSSNCNRKLIGARYYDLGVGEVKKRPSARSSGS------SPRDEAGHGTHTSSTAAGNA  258

Query  152  VDDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            V  ASYYGLA GTAKGGS +SR+AMY+VC   GC GSAIL GFDDA+ DG DV+
Sbjct  259  VTGASYYGLAPGTAKGGSAASRVAMYRVCSDEGCAGSAILAGFDDAVADGGDVI  312



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 77/102 (75%), Gaps = 4/102 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+SSNC++K+IGARYY   DD    +  S   RD  GHGTHVASTAAG  V +ASYYGLA
Sbjct  171  FSSSNCSKKLIGARYY--KDDDISAVTHSA--RDTLGHGTHVASTAAGVPVANASYYGLA  226

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             G A+GGSPSSRIAMY+VC   GCPGSAIL  FDDAI DGVD
Sbjct  227  RGEARGGSPSSRIAMYRVCYDDGCPGSAILAAFDDAIADGVD  268



>ref|XP_010067650.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW65827.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=774

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  +NCNRK+IGARYY     NS+  G      SGSPRD  GHGTH ASTA G+LV +AS
Sbjct  180  FKKANCNRKLIGARYYGIRSSNSNGTGTESTKASGSPRDSVGHGTHTASTAGGALVANAS  239

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YYGLA GTAKGG PS+RIA Y+ C   GC GS ILK  DDAI+DGVD
Sbjct  240  YYGLAKGTAKGGLPSTRIATYKTCTEEGCSGSLILKAIDDAIRDGVD  286



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            +S  CNRK+IGARYY +SD          + RD  GHGTHVASTAAG+ + D SYYGLA 
Sbjct  179  DSFKCNRKLIGARYYNDSDAASAV---PHTARDMIGHGTHVASTAAGNSLPDVSYYGLAS  235

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTAKGGSP SRIAMY+VC  FGC GS+IL  FDDAI DGVDVL
Sbjct  236  GTAKGGSPGSRIAMYRVCTFFGCRGSSILAAFDDAISDGVDVL  278



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 79/106 (75%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            FNSSNCNRK+IGAR Y  P  DD G       +PRD +GHGTHVASTAAG +V  ASY+G
Sbjct  177  FNSSNCNRKLIGARSYNGPGDDDDGL----VNTPRDMNGHGTHVASTAAGIMVPGASYHG  232

Query  176  LAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            LA GTAKGGS  SRIA+Y++C   GC GS+IL  F DAIKDGVD+L
Sbjct  233  LASGTAKGGSLGSRIAVYRICTPNGCAGSSILAAFSDAIKDGVDIL  278



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGARYY + D+         + RD +GHGTH ASTAAG+ V  ASYY LA
Sbjct  179  FNSSNCNRKIIGARYYADPDEYDDE--TENTVRDRNGHGTHTASTAAGNFVSGASYYDLA  236

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SR+A+Y+VC S GC GS +L  FDDAI DGVDVL
Sbjct  237  AGTAKGGSPESRLAIYKVC-SPGCSGSGMLAAFDDAIYDGVDVL  279



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            +S  CNRK+IGARYY +SD          + RD  GHGTHVASTAAG+ + D SYYGLA 
Sbjct  154  DSFKCNRKLIGARYYNDSDAASAV---PHTARDMIGHGTHVASTAAGNSLPDVSYYGLAS  210

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTAKGGSP SRIAMY+VC  FGC GS+IL  FDDAI DGVDVL
Sbjct  211  GTAKGGSPGSRIAMYRVCTFFGCRGSSILAAFDDAISDGVDVL  253



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD------QGGHILDS---GSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGARYY +  +       G H +     GSPRD  GHGTH +STAAGS+V
Sbjct  177  FKKSNCNRKLIGARYYTSQPESIRPPSNGSHAIKVDAFGSPRDSVGHGTHTSSTAAGSMV  236

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +ASYYGLA G AKGGSPSSR+A+Y+ C   GC GS ++K  DDAI DGVD++
Sbjct  237  PNASYYGLAQGVAKGGSPSSRLAVYKACSLGGCAGSTVMKAIDDAIDDGVDMI  289



>ref|XP_011085840.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=767

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 74/107 (69%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSD-----DQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGAR+Y N D     ++       GSPRD  GHGTH ASTA G  V +AS
Sbjct  173  FKKSNCNRKLIGARFYSNRDISKKRNETSPTQSHGSPRDFVGHGTHTASTAGGVAVANAS  232

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YYGLA GTA+GG PS+RIA Y+ C   GCPGS ILK  DDAIKDGVD
Sbjct  233  YYGLARGTARGGLPSARIASYKACTLDGCPGSIILKAIDDAIKDGVD  279



>gb|KHN10158.1| Subtilisin-like protease [Glycine soja]
Length=721

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY---PNSDDQGGHI-LDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY     S D   HI    GSPRD  GHGTH AS AAG  V++ASY
Sbjct  127  FKKSNCNRKLIGARYYNIQATSGDNQTHIEATKGSPRDSVGHGTHTASIAAGVHVNNASY  186

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA+KDGVD
Sbjct  187  FGLAQGTARGGSPSTRIAAYKTCSDEGCSGATILKAIDDAVKDGVD  232



>ref|XP_009391632.1| PREDICTED: subtilisin-like protease isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=826

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD------QGGHILDS---GSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGARYY +  +       G H +     GSPRD  GHGTH +STAAGS+V
Sbjct  228  FKKSNCNRKLIGARYYTSQPESIRPPSNGSHAIKVDAFGSPRDSVGHGTHTSSTAAGSMV  287

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +ASYYGLA G AKGGSPSSR+A+Y+ C   GC GS ++K  DDAI DGVD++
Sbjct  288  PNASYYGLAQGVAKGGSPSSRLAVYKACSLGGCAGSTVMKAIDDAIDDGVDMI  340



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY---PNSDDQGGHI-LDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY     S D   HI    GSPRD  GHGTH AS AAG  V++ASY
Sbjct  183  FKKSNCNRKLIGARYYNILATSGDNQTHIEATKGSPRDSVGHGTHTASIAAGVHVNNASY  242

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA+KDGVD
Sbjct  243  FGLAQGTARGGSPSTRIAAYKTCSDEGCSGATILKAIDDAVKDGVD  288



>ref|XP_003541562.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=778

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYP---NSDDQGGHILDS-GSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY     S D   HI  + GSPRD  GHGTH AS AAG  V++ASY
Sbjct  184  FKKSNCNRKLIGARYYKIQATSGDNQTHIEAAKGSPRDTVGHGTHTASIAAGVHVNNASY  243

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA+KDGVD
Sbjct  244  FGLAKGTARGGSPSTRIAAYKTCSDEGCSGATILKAIDDAVKDGVD  289



>ref|XP_007028364.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08866.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=762

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY     ++ ++   +    SPRD  GHGTH ASTAAG+ VD+ASY
Sbjct  174  FKKSNCNRKLIGARYYNVLHTSNGNKTTQMRVDKSPRDTVGHGTHTASTAAGAQVDNASY  233

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             GLA GTA+GGSP++RIAMY+ C   GCP S  LK  DDAIKDGVD
Sbjct  234  NGLAQGTARGGSPNARIAMYKACSEDGCPSSTTLKAIDDAIKDGVD  279



>ref|XP_006347851.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=774

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%), Gaps = 9/112 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD--------SGSPRDHSGHGTHVASTAAGSLVD  157
            F+ SNCNRK+IGAR+Y + +DQ  +I          +G+PRD  GHGTH AS AAG+ V 
Sbjct  179  FHKSNCNRKLIGARFY-DIEDQDSNITKLPKNTTKPNGTPRDRVGHGTHTASIAAGAFVP  237

Query  158  DASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +A+YYGLA G A+GGSPSSRIA Y+ C    C GSAILK  DDAIKDGVD++
Sbjct  238  NATYYGLASGIARGGSPSSRIATYKACSEGYCQGSAILKAIDDAIKDGVDII  289



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN KIIGAR Y + DD         +PRD  GHGTHVASTAAG++V DASYYGLA GTAK
Sbjct  177  CNGKIIGARAYNSPDDDDDDDGLDNTPRDMIGHGTHVASTAAGTVVPDASYYGLATGTAK  236

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GGSP SRIAMY+VC  +GC GS+IL  F DAIKDGVD+L
Sbjct  237  GGSPGSRIAMYRVCTRYGCHGSSILAAFSDAIKDGVDIL  275



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+SNCN+K+IGARYY  +         S SPRD  GHGTH ASTA G  V  ASYYGLA
Sbjct  211  FNASNCNKKLIGARYYEGTG--------SASPRDERGHGTHTASTAGGDAVMQASYYGLA  262

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG  ++RIA+Y+VC   GC GSAIL GFDDAI DGVD+L
Sbjct  263  AGTAKGGFTAARIAVYKVCTFNGCSGSAILAGFDDAIADGVDLL  306



>gb|KHN10324.1| Subtilisin-like protease [Glycine soja]
Length=778

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYP---NSDDQGGHILDS-GSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY     S D   HI  + GSPRD  GHGTH AS AAG  V++ASY
Sbjct  184  FKKSNCNRKLIGARYYKIQATSGDNQTHIEAAKGSPRDTVGHGTHTASIAAGVHVNNASY  243

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA+KDGVD
Sbjct  244  FGLAKGTARGGSPSTRIAAYKTCSDEGCSGATILKAIDDAVKDGVD  289



>ref|XP_008776598.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=770

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 75/111 (68%), Gaps = 9/111 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGH---------ILDSGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGAR+Y N+ D             I   GSPRD  GHGTH +STAAGS V
Sbjct  172  FKKSNCNRKLIGARFYNNAPDSVRSPSNSSNIHGITSFGSPRDSVGHGTHTSSTAAGSTV  231

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             +ASYYGLA G AKGGSPSSR+AMY+ C   GC  SA+LK  DDAI DGVD
Sbjct  232  MNASYYGLAQGVAKGGSPSSRLAMYKACSLGGCASSAVLKAIDDAIYDGVD  282



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSD-----DQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGARYY N +     +Q      +GSPRD  GHGTH  STAAG+ V DAS
Sbjct  177  FKKSNCNRKLIGARYY-NVEMTRIGNQSHLAAPNGSPRDSVGHGTHTTSTAAGARVPDAS  235

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YYGLA GT+KGG PS+RIA Y+ C   GC G+ ILK  DDAI+DGVD++
Sbjct  236  YYGLAQGTSKGGLPSARIACYKACSDVGCSGATILKAIDDAIRDGVDMI  284



>ref|XP_007220237.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
 gb|EMJ21436.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
Length=741

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--PNSDD--QGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY  P + D  Q       GSPRD  GHGTH ASTAAG  V +ASY
Sbjct  148  FRKSNCNRKLIGARYYNVPWTRDGNQSSLARTKGSPRDSVGHGTHTASTAAGVQVLNASY  207

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YGLA GTA+GG PS+RIA Y+ C   GC G+ ILK  DDAI+DGVD
Sbjct  208  YGLAQGTARGGLPSARIACYKACSDVGCSGATILKAIDDAIRDGVD  253



>ref|XP_008231725.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=775

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--PNSDD--QGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY  P + D  Q       GSPRD  GHGTH AS AAG  V +ASY
Sbjct  182  FRKSNCNRKLIGARYYNVPWTRDGNQSSLARTKGSPRDSVGHGTHTASIAAGVQVLNASY  241

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YGLA+GTAKGG PS+RIA Y+ C   GC G+ ILK  DDAI+DGVD
Sbjct  242  YGLALGTAKGGLPSARIACYKACSDVGCSGATILKAIDDAIRDGVD  287



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 7/107 (7%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD--SGSPRDHSGHGTHVASTAAGSLVDDASYYG  175
            F SS+CNRK+IGAR+Y    D+ G      +G+PRDH GHGTHVA+ AAG+ V  ASYYG
Sbjct  170  FKSSSCNRKLIGARFY----DEPGEFKTPFTGTPRDHDGHGTHVAAIAAGTPVAGASYYG  225

Query  176  LAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            +A GTAKGGSP SRIA+Y+ C+ + GC GS I+K FDDAI DGVD++
Sbjct  226  IAGGTAKGGSPGSRIAVYRTCKPYSGCSGSDIMKAFDDAIADGVDII  272



>ref|XP_010091321.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44295.1| Subtilisin-like protease [Morus notabilis]
Length=919

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  S+CNRK+IGARYY     +S +Q      +GSPRD  GHGTH ASTAAG  V +ASY
Sbjct  149  FKKSHCNRKLIGARYYNAPLMSSGNQSQEAKSNGSPRDTVGHGTHTASTAAGVRVANASY  208

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GGSPS+RIA Y+ C   GC G+ ILK  DDAIKDGVD++
Sbjct  209  YGLAKGMARGGSPSARIASYKACSPEGCSGATILKAIDDAIKDGVDMI  256



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGAR Y   DD G       +PRD +GHGTHVASTAAG  V  ASY+GLA
Sbjct  177  FNSSNCNRKIIGARSYNGPDDDGL----VNTPRDMNGHGTHVASTAAGIKVPGASYHGLA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGS  SRIA+Y++C   GC GS+IL  F DAIKDGV +L
Sbjct  233  SGTAKGGSLGSRIAVYRICTPNGCAGSSILAAFSDAIKDGVHIL  276



>gb|KDP40601.1| hypothetical protein JCGZ_24600 [Jatropha curcas]
Length=765

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 75/104 (72%), Gaps = 10/104 (10%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN SNCNRK+IGARYY          +  GSPRD  GHGTH AS AAG+ V +AS+YGLA
Sbjct  183  FNKSNCNRKLIGARYY----------ISGGSPRDALGHGTHCASIAAGAPVANASFYGLA  232

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG+P++RIA Y VC+   C GS +LK  DDAIKDGVD++
Sbjct  233  RGTARGGAPAARIASYNVCKGRNCSGSTVLKAIDDAIKDGVDII  276



>ref|NP_001067647.1| Os11g0261600 [Oryza sativa Japonica Group]
 dbj|BAF28010.1| Os11g0261600, partial [Oryza sativa Japonica Group]
Length=214

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG----SPRDHSGHGTHVASTAAGSLVDDASY  169
            F + +CNRKIIGAR+Y  +DD     L++     SPRD  GHGTHVASTAAGS+V + S+
Sbjct  34   FRAKSCNRKIIGARWY--ADDFNKSQLEAAGEFLSPRDFDGHGTHVASTAAGSVVRNVSF  91

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GG+P + IA+Y+ C S GC  + I K  DDAI DGVDVL
Sbjct  92   YGLASGIAQGGAPKAHIAVYKACWSIGCSEATIFKAIDDAIHDGVDVL  139



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
            S +CNRKIIGAR+Y   DD    + +  SPRD  GHGTHVASTAAG  V  ASYYGLA G
Sbjct  180  SFSCNRKIIGARFYDIEDDV---VANGQSPRDMVGHGTHVASTAAGQAVQGASYYGLAAG  236

Query  188  TAKGGSPSSRIAMYQVCQ-SFGCPGSAILKGFDDAIKDGVDVL  313
            TA GGSP SRIA+Y+VC   +GC GS IL  FDDAI DGVDVL
Sbjct  237  TAIGGSPGSRIAVYRVCSPEYGCTGSNILAAFDDAIADGVDVL  279



>ref|XP_010908011.1| PREDICTED: CO(2)-response secreted protease-like [Elaeis guineensis]
Length=740

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD------QGGHI---LDSGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCNRK+IGAR+Y N  D         HI      GSPRD  GHGTH +STAAGS V
Sbjct  141  FKKSNCNRKLIGARFYNNPPDSIQSPSNSSHIYGITSFGSPRDSVGHGTHTSSTAAGSTV  200

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             +A YYGLA G AKGGSPSSR+AMY+ C   GC  SA+LK  DDAI DGVD
Sbjct  201  MNAGYYGLAQGVAKGGSPSSRLAMYKACSLGGCASSAVLKAIDDAIYDGVD  251



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SS+CNRK+IGAR+Y    +     +  G+PRDH GHGTHVA+ AAGS V  ASYYG+A
Sbjct  170  FKSSSCNRKLIGARFYDEPGESKTPFV--GTPRDHDGHGTHVAAIAAGSSVAGASYYGIA  227

Query  182  MGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
             GTA+GGSP SRIA+Y+ C  + GC GS I+K FDDAI DGVD++
Sbjct  228  GGTARGGSPGSRIAVYRTCTPYSGCSGSKIMKAFDDAIADGVDII  272



>ref|XP_008375386.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG---HILDS-GSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGARYY  S    G   H+  + GSPRD  GHGTH  S AAG  V +ASY
Sbjct  183  FKKSNCNRKLIGARYYNVSLTTNGNQSHLASTNGSPRDSFGHGTHTTSIAAGVQVPNASY  242

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GGSPS+RIA Y+ C   GC G+ ILK  DDA++DGVDV+
Sbjct  243  YGLAQGIARGGSPSARIACYKACSDVGCSGATILKAIDDAVRDGVDVI  290



>ref|XP_007133571.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
 gb|ESW05565.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
Length=678

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 77/110 (70%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY-----PNSDDQGGHILDSG-SPRDHSGHGTHVASTAAGSLVDDA  163
            F  SNCNRK+IGARYY     P S+    HI  +  SPRD  GHGTH AS AAG  V++A
Sbjct  84   FKKSNCNRKLIGARYYNIQAAPGSNQT--HIEATKDSPRDSVGHGTHTASIAAGVYVNNA  141

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            SYYGLA GTA+GGSPS+RIA Y+ C   GC G+ ILK  DDA+ DGVDV+
Sbjct  142  SYYGLAPGTARGGSPSARIAAYRTCSEEGCSGATILKAIDDAVNDGVDVI  191



>ref|XP_010498447.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Camelina 
sativa]
Length=642

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG+++ DASYYGLA
Sbjct  49   SLRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGNIISDASYYGLA  103

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G  +GGSP+SRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  104  SGIMRGGSPNSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  147



>ref|XP_010498446.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Camelina 
sativa]
Length=666

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG+++ DASYYGLA
Sbjct  73   SLRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGNIISDASYYGLA  127

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G  +GGSP+SRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  128  SGIMRGGSPNSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  171



>ref|XP_002525580.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF36839.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=777

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGARYY        +   H+   +GSPRD  GHGTH AS A G+ V + S
Sbjct  183  FKKSNCNRKLIGARYYDTILRTYKNNKTHVAKPNGSPRDDIGHGTHTASIAGGAEVANVS  242

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDV  310
            YYGLA GTA+GGSPSSR+A+Y+ C + GC GS IL+  DDAIKDGVDV
Sbjct  243  YYGLARGTARGGSPSSRLAIYKACTTDGCAGSTILQAIDDAIKDGVDV  290



>gb|KFK44142.1| hypothetical protein AALP_AA1G220500 [Arabis alpina]
Length=706

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            S  CNRKIIGARYY +S      +LD    +PRD  GHGTHVAS AAG ++ DASYYGLA
Sbjct  184  SFRCNRKIIGARYYNSS-----FLLDPDYETPRDFLGHGTHVASIAAGKIISDASYYGLA  238

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G  +GGSP+SRIAMY+ C   GC GS++L  FDDAI DGVDV+
Sbjct  239  SGIMRGGSPNSRIAMYRACSLLGCRGSSLLAAFDDAIADGVDVI  282



>ref|XP_006432516.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45756.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=780

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGH----ILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGAR+Y        H       +GSPRD  GHGTH ASTAAG+ V +ASY
Sbjct  185  FKKSNCNRKLIGARFYSIPLTSNNHNTTRTTLAGSPRDSVGHGTHTASTAAGAHVANASY  244

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPSSRIA Y+ C   GC GSAIL+  DDAI DGVD
Sbjct  245  FGLARGTARGGSPSSRIASYKACSEDGCSGSAILQAMDDAIADGVD  290



>ref|XP_006432515.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45755.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=779

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGH----ILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGAR+Y        H       +GSPRD  GHGTH ASTAAG+ V +ASY
Sbjct  184  FKKSNCNRKLIGARFYSIPLTSNNHNTTRTTLAGSPRDSVGHGTHTASTAAGAHVANASY  243

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPSSRIA Y+ C   GC GSAIL+  DDAI DGVD
Sbjct  244  FGLARGTARGGSPSSRIASYKACSEDGCSGSAILQAMDDAIADGVD  289



>ref|XP_008779567.1| PREDICTED: cucumisin-like, partial [Phoenix dactylifera]
Length=710

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
             CN KIIG RYY   + +G +   D  SPRD  GHGTH +STAAG+LV D SY+GLA GT
Sbjct  115  TCNNKIIGGRYY---NSEGIYASTDFKSPRDSEGHGTHTSSTAAGALVPDTSYFGLAFGT  171

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A+GG P +RIAMY+VC SFGC  + IL  FDDAI DGVD+L
Sbjct  172  ARGGVPKARIAMYKVCWSFGCASADILAAFDDAIADGVDIL  212



>ref|XP_006471277.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=806

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGH----ILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  SNCNRK+IGAR+Y        H       +GSPRD  GHGTH ASTAAG+ V +ASY
Sbjct  211  FKKSNCNRKLIGARFYSIPLTSNNHNTTRTTLAGSPRDSVGHGTHTASTAAGAHVANASY  270

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            +GLA GTA+GGSPSSRIA Y+ C   GC GSAIL+  DDAI DGVD
Sbjct  271  FGLARGTARGGSPSSRIASYKACSEDGCSGSAILQAMDDAIADGVD  316



>ref|XP_008351273.1| PREDICTED: cucumisin-like isoform X4 [Malus domestica]
Length=573

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY  S     +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  177  TCNNKIIGARYY-RSQPYPKNSSDVMSPRDTEGHGTHTASTAAGNLVSKASLYGLGLGTA  235

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  236  RGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  275



>ref|XP_008392878.1| PREDICTED: cucumisin-like [Malus domestica]
Length=392

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = +2

Query  14   NCNRKIIGARYY---PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
             CN KIIGARYY   P   +      D  SPRD  GHGTH ASTAAG+LV  AS YGL +
Sbjct  177  TCNNKIIGARYYRXQPXPQNSS----DXXSPRDTXGHGTHTASTAAGNLVSKASLYGLGL  232

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTA+GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  233  GTARGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  275



>gb|EMS53854.1| Cucumisin [Triticum urartu]
Length=647

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 78/115 (68%), Gaps = 11/115 (10%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY--------PNSDDQGGHILD---SGSPRDHSGHGTHVASTAAGS  148
            F  SNCN+K+IGARYY        P S +     +    +GSPRD  GHGTH ASTAAG+
Sbjct  288  FKKSNCNKKLIGARYYGIQPGSAAPTSSNASLGAVTAAMTGSPRDTVGHGTHCASTAAGT  347

Query  149  LVDDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +V DA YYGLA G AKGG+P+SR+A Y+VC   GC  SA+LK  DDA+ DGVDV+
Sbjct  348  VVADADYYGLARGAAKGGAPASRVATYKVCTMGGCSSSALLKAIDDAVSDGVDVI  402



>ref|XP_010477248.1| PREDICTED: CO(2)-response secreted protease [Camelina sativa]
Length=776

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG+++ DASYYGLA
Sbjct  183  SFRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGNIISDASYYGLA  237

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G  +GGSP+SRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  238  SGIMRGGSPNSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  281



>ref|XP_004231226.1| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=772

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDS-----GSPRDHSGHGTHVASTAAGSLVDDAS  166
            F+ SNCNRK+IGAR+Y   D+    + ++     G+PRD  GHGT+ AS AAG+ V +A+
Sbjct  179  FHKSNCNRKLIGARFYDIKDEDSTKLPETTRKPNGTPRDRVGHGTNTASIAAGAFVPNAT  238

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YYGLA G A+GGSP SRIA Y+ C    C GSAILK  DDAIKDGVD++
Sbjct  239  YYGLASGIARGGSPFSRIATYKACSEGYCQGSAILKAIDDAIKDGVDII  287



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
            S +CNRKIIGAR+Y   DD    +    SPRD  GHGTHVASTAAG  V  ASYYGLA G
Sbjct  180  SFSCNRKIIGARFYDIEDDV---VAKGQSPRDMVGHGTHVASTAAGQAVQGASYYGLAAG  236

Query  188  TAKGGSPSSRIAMYQVCQ-SFGCPGSAILKGFDDAIKDGVDVL  313
            TA GGSP SRIA+Y+VC   +GC GS +L  FDDAI DGVDVL
Sbjct  237  TAIGGSPGSRIAVYRVCSPQYGCTGSNVLAAFDDAIADGVDVL  279



>ref|XP_008351272.1| PREDICTED: cucumisin-like isoform X3 [Malus domestica]
Length=705

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY  S     +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  140  TCNNKIIGARYY-RSQPYPKNSSDVMSPRDTEGHGTHTASTAAGNLVSKASLYGLGLGTA  198

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  199  RGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  238



>ref|XP_008351271.1| PREDICTED: cucumisin-like isoform X2 [Malus domestica]
Length=711

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY  S     +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  146  TCNNKIIGARYY-RSQPYPKNSSDVMSPRDTEGHGTHTASTAAGNLVSKASLYGLGLGTA  204

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  205  RGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  244



>ref|XP_008351270.1| PREDICTED: cucumisin-like isoform X1 [Malus domestica]
Length=742

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY  S     +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  177  TCNNKIIGARYY-RSQPYPKNSSDVMSPRDTEGHGTHTASTAAGNLVSKASLYGLGLGTA  235

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  236  RGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  275



>ref|NP_564106.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AEE29944.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=780

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            +S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG ++ +ASYYGL
Sbjct  182  DSFRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGQIIANASYYGL  236

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G  +GGSPSSRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  237  ASGIMRGGSPSSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  281



>gb|AAF79898.1|AC022472_7 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082 [Arabidopsis 
thaliana]
Length=779

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            +S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG ++ +ASYYGL
Sbjct  181  DSFRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGQIIANASYYGL  235

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G  +GGSPSSRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  236  ASGIMRGGSPSSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  280



>ref|XP_004165291.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=738

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--HI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYY  172
            F  SNCNRK+IGARYY   +  G   H+    G+PRD  GHGTH +S AAG+ V +ASY+
Sbjct  144  FKKSNCNRKLIGARYYNVVELNGNDSHVGPPKGTPRDSHGHGTHTSSIAAGARVPNASYF  203

Query  173  GLAMGTAKGG-SPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            GLA GTA+GG SPS+RIA Y+VC   GC G+AILK  DDAIKDGVD
Sbjct  204  GLARGTARGGGSPSTRIASYKVCAGVGCSGAAILKAIDDAIKDGVD  249



>gb|KGN47766.1| hypothetical protein Csa_6G401370 [Cucumis sativus]
Length=789

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--HI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYY  172
            F  SNCNRK+IGARYY   +  G   H+    G+PRD  GHGTH +S AAG+ V +ASY+
Sbjct  195  FKKSNCNRKLIGARYYNVVELNGNDSHVGPPKGTPRDSHGHGTHTSSIAAGARVPNASYF  254

Query  173  GLAMGTAKGG-SPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            GLA GTA+GG SPS+RIA Y+VC   GC G+AILK  DDAIKDGVD
Sbjct  255  GLARGTARGGGSPSTRIASYKVCAGVGCSGAAILKAIDDAIKDGVD  300



>ref|XP_004146802.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=733

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--HI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYY  172
            F  SNCNRK+IGARYY   +  G   H+    G+PRD  GHGTH +S AAG+ V +ASY+
Sbjct  139  FKKSNCNRKLIGARYYNVVELNGNDSHVGPPKGTPRDSHGHGTHTSSIAAGARVPNASYF  198

Query  173  GLAMGTAKGG-SPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            GLA GTA+GG SPS+RIA Y+VC   GC G+AILK  DDAIKDGVD
Sbjct  199  GLARGTARGGGSPSTRIASYKVCAGVGCSGAAILKAIDDAIKDGVD  244



>gb|KHN09068.1| Subtilisin-like protease [Glycine soja]
Length=279

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FNSSNCNRKIIGARYYP  D QG    +  +PRD +GHGTHVASTAAG+ V  ASYYG+A
Sbjct  18   FNSSNCNRKIIGARYYP--DPQGDS--EYVTPRDKNGHGTHVASTAAGATVPGASYYGVA  73

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAIL  271
             G+A+ GSP SR+A+Y+VC  + CPGSA+L
Sbjct  74   AGSAQSGSPKSRLAIYKVCFKYECPGSAVL  103



>ref|XP_007040097.1| Subtilase family protein [Theobroma cacao]
 gb|EOY24598.1| Subtilase family protein [Theobroma cacao]
Length=773

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KI+GARYY NS++      D  SPRD  GHGTH +STAAG+ V DASYYGLA G A
Sbjct  170  TCNNKIVGARYY-NSEEWYSDT-DFKSPRDSEGHGTHTSSTAAGNRVADASYYGLANGIA  227

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P +RIAMY+VC SFGC  + IL  FDDAI DGVD++
Sbjct  228  RGGVPGARIAMYKVCWSFGCATADILAAFDDAIADGVDII  267



>ref|XP_004967678.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=781

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGH------ILDSGSPRDHSGHGTHVASTAAGSLVDDA  163
            FN S+CN+K+IGARYY    +   +      +  +GSPRD  GHGTH ASTAAG+ V DA
Sbjct  181  FNKSSCNKKLIGARYYSVQPESASNSNTPRAVAATGSPRDTVGHGTHTASTAAGAEVADA  240

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +YGLA G AKGG+P+SR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  241  DFYGLARGAAKGGAPASRVAVYRACSLGGCSSSAVLKAVDDAVADGVDVI  290



>ref|XP_010919429.1| PREDICTED: cucumisin-like [Elaeis guineensis]
Length=731

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
             CN KIIGARYY   + +G +   D  SPRD  GHGTH ASTAAG LV D SY+GLA GT
Sbjct  136  TCNNKIIGARYY---NSEGLYTSTDFKSPRDSIGHGTHTASTAAGVLVPDTSYFGLANGT  192

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A+GG P +R+AMY+VC +FGC  + IL  FDDAI DGVD+L
Sbjct  193  ARGGVPKARVAMYKVCWAFGCGTADILAAFDDAIADGVDIL  233



>ref|XP_006416427.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
 gb|ESQ34780.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
Length=779

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 7/105 (7%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            +S  CN+K+IGARYY +S      ++D    +PRD  GHGTHVAS AAG ++ DASYYGL
Sbjct  182  DSFRCNKKLIGARYYNSS-----FLIDPDYETPRDFLGHGTHVASIAAGRIISDASYYGL  236

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G  +GGSPSSRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  237  AGGIMRGGSPSSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  281



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----PNSDDQGGHILD-SGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGARYY        +   H+   SGSPRD+ GHGTH  S A GS V + S
Sbjct  180  FKKSNCNRKLIGARYYDTYQRTYKNNKTHVPKPSGSPRDYIGHGTHTTSIAGGSEVANVS  239

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YYGLA GTA+GGSPS+R+A+Y+ C   GC GS ILK  +DAIKDGVD
Sbjct  240  YYGLAAGTARGGSPSTRLAIYKACSLDGCSGSIILKAMEDAIKDGVD  286



>ref|XP_009607188.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=792

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 13/116 (11%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD------------SGSPRDHSGHGTHVASTAAG  145
            F  SNCNRK+IGAR+Y N +DQ                  +G+PRD  GHGT+ AS AAG
Sbjct  180  FYKSNCNRKLIGARFY-NIEDQESTFTKLPNISTTIPSKPNGTPRDKVGHGTNTASIAAG  238

Query  146  SLVDDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            ++V +A+YYGLA GTA+GG PS+RIA Y+ C    C GSAILK  DDAIKDGVD++
Sbjct  239  AIVPNANYYGLANGTARGGLPSARIATYKACSEGNCQGSAILKAIDDAIKDGVDII  294



>ref|XP_009103352.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
 ref|XP_009103353.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=784

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
            CNRK+IGARYY +S      +LD    +PRD  GHGTHVAS AAG  + DASYYGLA G 
Sbjct  193  CNRKLIGARYYNSS-----FLLDPDYETPRDFLGHGTHVASIAAGRTISDASYYGLAGGI  247

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +GGSP+SRIAMY+ C   GC GS+IL  FDDAI DGVD++
Sbjct  248  MRGGSPTSRIAMYRACSLLGCRGSSILAAFDDAIADGVDII  288



>gb|KDP25527.1| hypothetical protein JCGZ_20683 [Jatropha curcas]
Length=770

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY NS+D      D  SPRD  GHGTH ASTAAG  V  ASY+GLA G A
Sbjct  167  TCNNKIIGARYY-NSEDWYFET-DFKSPRDSEGHGTHTASTAAGQEVQGASYFGLAEGVA  224

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P +RIA+Y+VC SFGC  + IL  FDDAI DGVD+L
Sbjct  225  RGGVPHARIAVYKVCWSFGCSSADILAAFDDAIADGVDIL  264



>ref|XP_006850442.1| hypothetical protein AMTR_s00165p00065060 [Amborella trichopoda]
 gb|ERN12023.1| hypothetical protein AMTR_s00165p00065060 [Amborella trichopoda]
Length=725

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN+K+IGAR+Y  +D Q   ILD  SPRD  GHGTH ASTAAG +V D S +GLA+G+A
Sbjct  144  TCNKKLIGARFY-KADKQFDPILDDPSPRDTIGHGTHTASTAAGRVVSDTSLFGLALGSA  202

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +G  PS+RIA+Y+VC S GC  + +L  FDDAI DGVDV+
Sbjct  203  RGAVPSARIAVYKVCWSDGCSDADMLAAFDDAIADGVDVI  242



>ref|XP_009392091.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 9/109 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD----QGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASY  169
            F  ++CNRKIIGAR+Y    D    +GG+     SPRD  GHGTH ASTAAGSLV DAS+
Sbjct  182  FTVNHCNRKIIGARWYAGGVDPSLIEGGY----QSPRDSEGHGTHTASTAAGSLVTDASF  237

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
            +GL  GTA+GG+P +R+A+Y+ C +  GCP +A+LK  DDAI DGVD+L
Sbjct  238  HGLGAGTARGGAPRARLAIYKACWAKAGCPDAAVLKAIDDAIHDGVDIL  286



>emb|CDY01388.1| BnaA07g11610D [Brassica napus]
Length=777

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
            CNRK+IGARYY +S      +LD    +PRD  GHGTHVAS AAG  + DASYYGLA G 
Sbjct  186  CNRKLIGARYYNSS-----FLLDPDYETPRDFLGHGTHVASIAAGRTISDASYYGLAGGI  240

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +GGSP+SRIAMY+ C   GC GS+IL  FDDAI DGVD++
Sbjct  241  MRGGSPTSRIAMYRACSLLGCRGSSILAAFDDAIADGVDII  281



>dbj|BAA13135.1| subtilisin-like protein [Picea abies]
Length=779

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 11/115 (10%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD-------QGGHIL-DSGSPRDHSGHGTHVASTAAGSLVD  157
            FN SNCNRKIIGARYY   +D       +   I  +S + RD+ GHGT+ A+TAAGS VD
Sbjct  174  FNVSNCNRKIIGARYYSGGEDDDLKKNSKPKSIWPESRTARDYQGHGTYTAATAAGSFVD  233

Query  158  DASYYGLAMGTAKGGSPSS--RIAMYQVC-QSFGCPGSAILKGFDDAIKDGVDVL  313
            +A+Y GLA GTA+GGS SS  RIAMY+VC   +GCPG  IL  FDDA+KDGVD++
Sbjct  234  NANYNGLANGTARGGSASSSTRIAMYRVCGLDYGCPGVQILAAFDDAVKDGVDIV  288



>ref|XP_002993007.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
 gb|EFJ05953.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
Length=755

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPN--SDDQGGHI-------LDSGSPRDHSGHGTHVASTAAGSLV  154
            FN+S+CNRK++GARYY    + + GG +       LD  SPRD SGHGTH AST AG  V
Sbjct  149  FNASHCNRKLVGARYYLRGLASEMGGPLASAKDGGLDYISPRDASGHGTHTASTVAGRYV  208

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             DAS++GL  G+A GG+P +R+A+Y+VC S GC  + IL  FDDAIKDGVDV+
Sbjct  209  TDASFFGLGKGSAVGGAPRARLAVYKVCWSSGCFDADILAAFDDAIKDGVDVM  261



>ref|XP_006304500.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
 gb|EOA37398.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
Length=781

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +2

Query  8    SSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            S +CNRK+IGARYY +S     + LD    +PRD  GHGTHVAS AAG ++ DASYYGLA
Sbjct  183  SFHCNRKLIGARYYNSS-----YFLDPDYETPRDFLGHGTHVASIAAGQIISDASYYGLA  237

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             G  +GGS +SRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  238  SGIMRGGSTNSRIAMYRACSVLGCRGSSILAAFDDAIADGVDVI  281



>ref|XP_002457657.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
 gb|EES02777.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
Length=790

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD---------SGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCN+K+IGARYY    +                +GSPRD  GHGTH ASTAAG++V
Sbjct  186  FKKSNCNKKLIGARYYGVQPESSAPNASSSAMATPAATGSPRDTVGHGTHTASTAAGAVV  245

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             DA YYGLA G AKGG+PSSR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  246  SDADYYGLARGAAKGGAPSSRVAVYRACSLGGCSTSAVLKAIDDAVGDGVDVI  298



>gb|EPS69827.1| hypothetical protein M569_04935, partial [Genlisea aurea]
Length=721

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  +NCNRK+IGAR+Y N     G      SPRD  GHGTH AS A G+ V +ASYYGLA
Sbjct  136  FTKTNCNRKLIGARFYKNRLVSTG----DASPRDLIGHGTHTASIAGGASVSNASYYGLA  191

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
             GTA+GG PS+RIA Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  192  KGTARGGHPSARIAAYKACLLEGCSGSVILKAIDDAIKDGVD  233



>gb|EEE63324.1| hypothetical protein OsJ_18135 [Oryza sativa Japonica Group]
Length=574

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG----SPRDHSGHGTHVASTAAGSLVDDASY  169
            F + +CNRKIIGAR+Y  +DD     L++     SPRD  GHGTHVASTAAGS+V + S+
Sbjct  185  FRAKSCNRKIIGARWY--ADDFNKSQLEAAGEFLSPRDFDGHGTHVASTAAGSVVRNVSF  242

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GG+P + IA+Y+ C S GC  + I K  DDAI DGVDVL
Sbjct  243  YGLASGIAQGGAPKAHIAVYKACWSIGCSEATIFKAIDDAIHDGVDVL  290



>gb|KDP36888.1| hypothetical protein JCGZ_08179 [Jatropha curcas]
Length=705

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCN+KIIGAR+Y + +D    I  +  PRD  GHGTHVA+TAAG++V +ASYYGLA
Sbjct  133  FKSSNCNKKIIGARFYDSPEDDEDEIYQT--PRDAIGHGTHVAATAAGAVVSNASYYGLA  190

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y+VC   GC GS IL  FDDAI DGVDVL
Sbjct  191  EGTAKGGSPMSRIAVYRVCSENGCYGSNILAAFDDAIADGVDVL  234



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F SSNCN+KIIGAR+Y + +D    I  +  PRD  GHGTHVA+TAAG++V +ASYYGLA
Sbjct  166  FKSSNCNKKIIGARFYDSPEDDEDEIYQT--PRDAIGHGTHVAATAAGAVVSNASYYGLA  223

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGGSP SRIA+Y+VC   GC GS IL  FDDAI DGVDVL
Sbjct  224  EGTAKGGSPMSRIAVYRVCSENGCYGSNILAAFDDAIADGVDVL  267



>emb|CDY67543.1| BnaCnng55400D [Brassica napus]
Length=898

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
            CNRK+IGARYY +S      +LD    +PRD  GHGTHVAS AAG ++ DASYYGLA G 
Sbjct  307  CNRKLIGARYYNSS-----FLLDPDYETPRDFLGHGTHVASIAAGRIISDASYYGLAGGI  361

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +GGSP+SRIAMY+ C   GC GS+IL  FDDAI D VD++
Sbjct  362  MRGGSPTSRIAMYRACSLLGCRGSSILAAFDDAIADRVDII  402



>ref|XP_002893090.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69349.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDS--GSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            +S  CNRK+IGARYY +S       LD    +PRD  GHGTHVAS AAG ++ DASYYGL
Sbjct  180  DSFRCNRKLIGARYYNSS-----FFLDPDYETPRDFLGHGTHVASIAAGQIISDASYYGL  234

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A G  +GGS +SRIAMY+ C   GC GS+IL  FDDAI DGVDV+
Sbjct  235  ASGIMRGGSTNSRIAMYRACSLLGCRGSSILAAFDDAIADGVDVI  279



>ref|XP_008672702.1| PREDICTED: uncharacterized protein LOC100279461 isoform X1 [Zea 
mays]
 tpg|DAA54193.1| TPA: putative subtilase family protein [Zea mays]
Length=782

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD---------SGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCN+K+IGAR+Y    +                +GSPRD  GHGTH ASTAAG++V
Sbjct  179  FKKSNCNKKLIGARFYGVQPESSASNASSSAVATPAATGSPRDTVGHGTHTASTAAGAVV  238

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             DA YYGLA G AKGG+PSSR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  239  SDADYYGLARGAAKGGAPSSRVAVYRACSLGGCSASAVLKAIDDAVGDGVDVI  291



>ref|XP_002991849.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
 gb|EFJ07111.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
Length=753

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPN--SDDQGGHI-------LDSGSPRDHSGHGTHVASTAAGSLV  154
            FN+S+CNRK++GARYY    + + GG +       LD  SPRD SGHGTH AST  G  V
Sbjct  147  FNASHCNRKLVGARYYLRGLASEMGGPLASAKDGGLDYISPRDASGHGTHTASTVTGRYV  206

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             DAS++GL  G+A GG+P +R+A+Y+VC S GC  + IL  FDDAIKDGVDV+
Sbjct  207  TDASFFGLGKGSAVGGAPRARLAVYKVCWSSGCFDADILAAFDDAIKDGVDVM  259



>ref|XP_010919430.1| PREDICTED: cucumisin-like [Elaeis guineensis]
Length=710

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGH-ILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
             CN KIIGARYY   + +G +   D  SPRD  GHGTH +STAAG+LV +ASY+GLA G 
Sbjct  115  TCNNKIIGARYY---NSEGFYDPTDFKSPRDSEGHGTHTSSTAAGALVPNASYFGLANGI  171

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A+GG P +RIAMY+VC +FGC  + IL  FDDAI DGVDV+
Sbjct  172  ARGGVPKARIAMYKVCWAFGCGTADILAAFDDAIADGVDVI  212



>gb|AAX95895.1| Subtilase family, putative [Oryza sativa Japonica Group]
 gb|AAX96793.1| Subtilase family, putative [Oryza sativa Japonica Group]
 gb|ABA92456.1| Subtilase family protein, expressed [Oryza sativa Japonica Group]
Length=736

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG----SPRDHSGHGTHVASTAAGSLVDDASY  169
            F + +CNRKIIGAR+Y  +DD     L++     SPRD  GHGTHVASTAAGS+V + S+
Sbjct  117  FRAKSCNRKIIGARWY--ADDFNKSQLEAAGEFLSPRDFDGHGTHVASTAAGSVVRNVSF  174

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GG+P + IA+Y+ C S GC  + I K  DDAI DGVDVL
Sbjct  175  YGLASGIAQGGAPKAHIAVYKACWSIGCSEATIFKAIDDAIHDGVDVL  222



>gb|KDP25659.1| hypothetical protein JCGZ_20815 [Jatropha curcas]
Length=773

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY NS++      D  SPRD  GHGTH ASTAAG  V+ ASY+GLA G A
Sbjct  171  TCNNKIIGARYY-NSENWYFET-DFKSPRDSEGHGTHTASTAAGRKVEGASYFGLAEGVA  228

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P +RIA+Y+VC SFGC  + IL  FDDAI DGVD+L
Sbjct  229  RGGVPFARIAVYKVCWSFGCATADILAAFDDAIADGVDIL  268



>ref|XP_008445401.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGG--HI-LDSGSPRDHSGHGTHVASTAAGSLVDDASYY  172
            F  SNCNRK+IGARYY   +  G   H+    G+PRD  GHG+H +S AAG+ V +ASY+
Sbjct  151  FKKSNCNRKLIGARYYNVVELNGNDSHVGPPKGTPRDSLGHGSHTSSIAAGARVPNASYF  210

Query  173  GLAMGTAKGG-SPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            GLA GTA+GG +PS+RIA Y+VC   GC G+AILK  DDAIKDGVD
Sbjct  211  GLARGTARGGGTPSTRIASYKVCAGVGCSGAAILKAIDDAIKDGVD  256



>gb|EEC68285.1| hypothetical protein OsI_36335 [Oryza sativa Indica Group]
Length=774

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG----SPRDHSGHGTHVASTAAGSLVDDASY  169
            F + +CNRKIIGAR+Y  +DD     L++     SPRD  GHGTHVASTAAGS+V + S+
Sbjct  185  FTAKSCNRKIIGARWY--ADDFNKSQLEAAGEFLSPRDFDGHGTHVASTAAGSVVRNVSF  242

Query  170  YGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            YGLA G A+GG+P + IA+Y+ C S GC  + I K  DDAI DGVD+L
Sbjct  243  YGLASGVAQGGAPKAHIAVYKACWSIGCSEATIFKAIDDAIHDGVDIL  290



>ref|XP_002524250.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38174.1| Cucumisin precursor, putative [Ricinus communis]
Length=727

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY +SD +    L+  SPRD  GHGTH ASTAAG +V  AS  GL +GTA
Sbjct  160  TCNNKIIGARYY-HSDGKVDPRLEFDSPRDSEGHGTHTASTAAGDIVSQASLLGLGLGTA  218

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C S+GC  + IL  FDDAI DGVD++
Sbjct  219  RGGVPSARIAVYKICWSYGCTDADILAAFDDAIADGVDII  258



>ref|NP_001145938.1| uncharacterized protein LOC100279461 precursor [Zea mays]
 gb|ACL52885.1| unknown [Zea mays]
Length=803

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILD---------SGSPRDHSGHGTHVASTAAGSLV  154
            F  SNCN+K+IGAR+Y    +                +GSPRD  GHGTH ASTAAG++V
Sbjct  179  FKKSNCNKKLIGARFYGVQPESSASNASSSAVATPAATGSPRDTVGHGTHTASTAAGAVV  238

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             DA YYGLA G AKGG+PSSR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  239  SDADYYGLARGAAKGGAPSSRVAVYRACSLGGCSASAVLKAIDDAVGDGVDVI  291



>ref|XP_009391855.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  ++CNRKIIGAR+Y    D      D  SPRD  GHGTH ASTAAGSLV DAS++GL 
Sbjct  96   FTVNHCNRKIIGARWYAGGVDPSLIEGDYQSPRDSEGHGTHTASTAAGSLVSDASFHGLG  155

Query  182  MGTAKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG+P +R+A+Y+VC +  GC  +A+LK  DDAI DGVD+L
Sbjct  156  AGTARGGAPRARLAIYKVCWAEAGCRDAAVLKAIDDAIHDGVDIL  200



>ref|XP_009387964.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  ++CNRKIIGAR+Y    D      D  SPRD  GHGTH ASTAAGSLV DAS++GL 
Sbjct  182  FTVNHCNRKIIGARWYAGGVDPSLIEGDYQSPRDSEGHGTHTASTAAGSLVSDASFHGLG  241

Query  182  MGTAKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG+P +R+A+Y+ C +  GCP +++LK  DDAI DGVD+L
Sbjct  242  AGTARGGAPRARLAIYKACWAKAGCPYASVLKAIDDAIHDGVDIL  286



>ref|XP_008391037.1| PREDICTED: cucumisin-like isoform X2 [Malus domestica]
Length=672

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY        +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  177  TCNNKIIGARYY-RXQPYPQNSSDILSPRDTDGHGTHTASTAAGNLVSKASLYGLGLGTA  235

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC   GCP + IL  FDDAI DGVD+L
Sbjct  236  RGGVPSARIAVYKVCWXDGCPDADILAAFDDAIADGVDIL  275



>ref|XP_009391854.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=744

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  ++CNRKIIGAR+Y    D      D  SPRD  GHGTH ASTAAGSLV DAS++GL 
Sbjct  182  FTVNHCNRKIIGARWYAGGVDPSLIEGDYQSPRDSEGHGTHTASTAAGSLVSDASFHGLG  241

Query  182  MGTAKGGSPSSRIAMYQVCQS-FGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG+P +R+A+Y+VC +  GC  +A+LK  DDAI DGVD+L
Sbjct  242  AGTARGGAPRARLAIYKVCWAEAGCRDAAVLKAIDDAIHDGVDIL  286



>ref|XP_009400152.1| PREDICTED: subtilisin-like protease SBT5.4 [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDD------QGGHILDS---GSPRDHSGHGTHVASTAAGSLV  154
            F   +CNRK+IGARYY +  +       G H +     GS RD  GHGTH ASTAAG++V
Sbjct  141  FKKPDCNRKLIGARYYTSQAESIRPATNGSHTIKVNGFGSARDSVGHGTHTASTAAGTVV  200

Query  155  DDASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +ASYYG+A G AKGGSPSS++A+Y+ C   GC  S +LK  DDAI DGVDV+
Sbjct  201  QNASYYGIAQGEAKGGSPSSKLAIYKACSLGGCASSTVLKAIDDAIDDGVDVI  253



>gb|EYU17578.1| hypothetical protein MIMGU_mgv1a0038491mg, partial [Erythranthe 
guttata]
Length=501

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 7/96 (7%)
 Frame = +2

Query  26   KIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAKGGS  205
            KIIGA+YY + D          +PRD SGHGTHVASTAAG+ V  ASYYGLA GTA+GGS
Sbjct  1    KIIGAKYYTDPDAYD-------TPRDGSGHGTHVASTAAGAPVSGASYYGLAKGTAQGGS  53

Query  206  PSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             +SRIAMY+VC   GC GSAI+KGFDDAI DGV VL
Sbjct  54   TASRIAMYRVCVDGGCSGSAIMKGFDDAIADGVHVL  89



>ref|XP_011081055.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=775

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY NSD+   +  D  SPRD  GHGTH ASTAAG  V+ ASY+GLA G A
Sbjct  168  TCNNKIIGARYY-NSDNSFRYD-DIPSPRDTEGHGTHTASTAAGVEVE-ASYFGLAKGIA  224

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P SRIA+Y+VC +FGC  + ILK FDDAI DGVD++
Sbjct  225  RGGVPKSRIAVYKVCWAFGCSSADILKAFDDAIADGVDII  264



>ref|XP_008391035.1| PREDICTED: cucumisin-like isoform X1 [Malus domestica]
Length=744

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY        +  D  SPRD  GHGTH ASTAAG+LV  AS YGL +GTA
Sbjct  177  TCNNKIIGARYY-RXQPYPQNSSDILSPRDTDGHGTHTASTAAGNLVSKASLYGLGLGTA  235

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC   GCP + IL  FDDAI DGVD+L
Sbjct  236  RGGVPSARIAVYKVCWXDGCPDADILAAFDDAIADGVDIL  275



>ref|XP_011086390.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=756

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 70/100 (70%), Gaps = 4/100 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN K+IGARYY +  DQ       GS RD  GHGTH ASTAAG+ V DAS+YG+A GTA
Sbjct  188  TCNNKLIGARYYNSHQDQPS----DGSARDSEGHGTHTASTAAGNYVKDASFYGIAKGTA  243

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA Y+VC S GC    IL  FDDAI DGVD+L
Sbjct  244  RGGVPSARIAAYKVCYSEGCREVDILAAFDDAIADGVDIL  283



>gb|KFK32412.1| hypothetical protein AALP_AA6G238800 [Arabis alpina]
Length=706

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN S+CNRK+IGARYY ++         + S RD  GHGTH ASTAAG+ VD  S  GLA
Sbjct  127  FNKSHCNRKLIGARYYTSTG--------ATSARDVDGHGTHTASTAAGAHVDGVSDRGLA  178

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG P  RIA Y+VC S GCPGSA+LK  DDA+ DGVD++
Sbjct  179  RGTAKGGQPGCRIAAYKVCNSDGCPGSALLKAMDDAVNDGVDLI  222



>emb|CBI24459.3| unnamed protein product [Vitis vinifera]
Length=736

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N+  CN KIIGAR+Y ++D+    + D+ SPRD  GHG+H ASTAAG  V++ASYYG+A 
Sbjct  131  NNFTCNNKIIGARFY-DTDNLADPLRDTKSPRDTLGHGSHTASTAAGRAVENASYYGIAS  189

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            G A+GG P++R+A+Y+VC   GC  + IL  FDDAI DGVD+L
Sbjct  190  GVARGGVPNARLAVYKVCWGGGCSPADILAAFDDAIADGVDIL  232



>gb|KDO63610.1| hypothetical protein CISIN_1g044427mg [Citrus sinensis]
Length=734

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY NS++    + D  SPRD  GHGTH +STAAG  V  ASYYGLA GTA
Sbjct  135  TCNNKIIGARYY-NSENIY-EVTDFHSPRDSEGHGTHTSSTAAGREVPHASYYGLAEGTA  192

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RI+MY+VC S GC  + IL  FDDAI DGVD++
Sbjct  193  RGGVPNARISMYKVCWSDGCATADILAAFDDAIADGVDII  232



>ref|XP_002264496.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=773

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N+  CN KIIGAR+Y ++D+    + D+ SPRD  GHG+H ASTAAG  V++ASYYG+A 
Sbjct  168  NNFTCNNKIIGARFY-DTDNLADPLRDTKSPRDTLGHGSHTASTAAGRAVENASYYGIAS  226

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            G A+GG P++R+A+Y+VC   GC  + IL  FDDAI DGVD+L
Sbjct  227  GVARGGVPNARLAVYKVCWGGGCSPADILAAFDDAIADGVDIL  269



>emb|CBI31873.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N+  CN KIIGAR+Y ++D+    + D+ SPRD  GHG+H ASTAAG  V++ASYYG+A 
Sbjct  183  NNFTCNNKIIGARFY-DTDNLADPLRDTKSPRDTLGHGSHTASTAAGRAVENASYYGIAS  241

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            G A+GG P++R+A+Y+VC   GC  + IL  FDDAI DGVD+L
Sbjct  242  GIARGGVPNARLAVYKVCWGGGCSPADILAAFDDAIADGVDIL  284



>ref|XP_006477361.1| PREDICTED: cucumisin-like [Citrus sinensis]
Length=767

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY NS++    + D  SPRD  GHGTH +STAAG  V  ASYYGLA GTA
Sbjct  168  TCNNKIIGARYY-NSENIY-EVTDFHSPRDSEGHGTHTSSTAAGREVPHASYYGLAEGTA  225

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RI+MY+VC S GC  + IL  FDDAI DGVD++
Sbjct  226  RGGVPNARISMYKVCWSDGCATADILAAFDDAIADGVDII  265



>ref|XP_010662545.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=736

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N+  CN KIIGAR+Y ++D+    + D+ SPRD  GHG+H ASTAAG  V++ASYYG+A 
Sbjct  168  NNFTCNNKIIGARFY-DTDNLADPLRDTKSPRDTLGHGSHTASTAAGRAVENASYYGIAS  226

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            G A+GG P++R+A+Y+VC   GC  + IL  FDDAI DGVD+L
Sbjct  227  GIARGGVPNARLAVYKVCWGGGCSPADILAAFDDAIADGVDIL  269



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHI-----LDSGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRKIIGAR+Y + D     +        GSPRD  GHGTH AS  AG+ V +AS
Sbjct  177  FKKSNCNRKIIGARFYDDFDLSTKPLGNKPNKRQGSPRDAVGHGTHTASIVAGAAVANAS  236

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            YYGLA G AKGG PS+RIA Y+ C + GC GS ILK  +DA+ DGVD
Sbjct  237  YYGLARGKAKGGVPSARIAAYKACSTDGCSGSTILKAIEDALSDGVD  283



>ref|XP_008360385.1| PREDICTED: cucumisin-like, partial [Malus domestica]
Length=533

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY        +  D  SPRD   HGTH ASTAAG+LV  AS YG  +GTA
Sbjct  40   TCNNKIIGARYY-RXQPYPKNSSDVMSPRDTEXHGTHTASTAAGNLVSKASLYGXGLGTA  98

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y+VC S GCP + IL  FDDAI DGVD+L
Sbjct  99   RGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDIL  138



>gb|KDO37215.1| hypothetical protein CISIN_1g038289mg, partial [Citrus sinensis]
Length=226

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +2

Query  23   RKIIGARYYPNSDDQGGH----ILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
            RK+IGAR+Y        H       +GSPRD  GHGTH ASTAAG+ V +ASY+GLA GT
Sbjct  11   RKLIGARFYSIPLTSNNHNTTRTTLAGSPRDSVGHGTHTASTAAGAHVANASYFGLARGT  70

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            A+GGSPSSRIA Y+ C   GC GSAIL+  DDAI DGVD
Sbjct  71   ARGGSPSSRIASYKACSEDGCSGSAILQAMDDAIADGVD  109



>ref|XP_009387941.1| PREDICTED: subtilisin-like protease Glyma18g48580, partial [Musa 
acuminata subsp. malaccensis]
Length=521

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  ++CNRKIIGAR+Y    D     +D  SPRD  GHGTH ASTAAGS V +AS++GL 
Sbjct  191  FTVNHCNRKIIGARWYAGGVDDSDISVDYRSPRDFQGHGTHTASTAAGSFVGNASFHGLG  250

Query  182  MGTAKGGSPSSRIAMYQVC--QSFGCPGSAILKGFDDAIKDGVDVL  313
             G A+GG+P +R+A+Y+ C   +  CP +A+LK  DDA+ DGVD+L
Sbjct  251  AGVARGGAPRARLAIYKACWGNNIRCPDAALLKAIDDAVHDGVDIL  296



>ref|XP_004171206.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=683

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y    D+     D  SPRD  GHGTH AST AG LV+ AS YGLA+GTA+
Sbjct  116  CNRKIIGARAY--RSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLALGTAR  173

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  174  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  212



>ref|XP_002303965.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
 gb|EEE78944.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
Length=646

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPN-----SDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGARYY +     S+++        SPRD  GHGTH  S AAG+ V + S
Sbjct  52   FKKSNCNRKLIGARYYDSIQRTYSNNKTHMAKPDDSPRDFDGHGTHTTSIAAGAKVANVS  111

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            Y+ LA GTA+GGSPSSRIA+Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  112  YHDLAGGTARGGSPSSRIAIYKACTLDGCSGSTILKAIDDAIKDGVD  158



>ref|XP_004149947.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN50590.1| hypothetical protein Csa_5G187880 [Cucumis sativus]
Length=704

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
            +CNRKIIGAR Y    D+     D  SPRD  GHGTH AST AG LV+ AS YGLA+GTA
Sbjct  136  HCNRKIIGARAY--RSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLALGTA  193

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  194  RGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  233



>ref|XP_004173850.1| PREDICTED: cucumisin-like, partial [Cucumis sativus]
Length=419

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN+KIIGAR Y    D      D  SPRD +GHGTH AST AG LV  AS YGLA+GTA+
Sbjct  137  CNKKIIGARAY--RSDNVFPTEDIPSPRDSNGHGTHTASTVAGGLVSQASLYGLALGTAR  194

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  195  GGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDII  233



>ref|XP_007009158.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY17968.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=1325

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY      G    D  SPRD  GHGTH +STAAG+LV  AS +GLA GTA
Sbjct  755  TCNNKIIGARYYRADGTFGPD--DIQSPRDSEGHGTHTSSTAAGALVSKASLFGLASGTA  812

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C S GCP   IL  FDDAI DGVD++
Sbjct  813  RGGVPSARIAVYKICWSDGCPDEDILAAFDDAIADGVDII  852


 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGA+YY    D      D  SPRD  GHG+H AS AAG LV  AS YG   GTA
Sbjct  135  TCNNKIIGAKYYRADGDCPSE--DFKSPRDSEGHGSHTASIAAGGLVSRASLYGFRTGTA  192

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C   GC    IL  FDDAI DGVD++
Sbjct  193  RGGVPSARIAVYKICWFDGCADEDILAAFDDAIADGVDII  232



>ref|XP_011036040.1| PREDICTED: cucumisin-like [Populus euphratica]
Length=699

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHIL--DSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
            +CN KIIGARYY       G +   D  SPRD  GHGTH ASTAAG LV DAS  GLA G
Sbjct  134  SCNNKIIGARYY----HSEGKVYPGDFASPRDSEGHGTHTASTAAGRLVRDASLLGLATG  189

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            TA+GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  190  TARGGVPSARIAVYKICWSNGCSDADILAAFDDAIADGVDII  231



>ref|XP_008245984.1| PREDICTED: cucumisin-like [Prunus mume]
Length=726

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 11/100 (11%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY           D+G+  D  GHGTH ASTAAG+ V D S+YGLA GTA
Sbjct  175  TCNNKIIGARYY----------TDAGA-SDAVGHGTHTASTAAGNPVKDVSFYGLAQGTA  223

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA Y+VC   GCP  AIL+GFDDAI DGVD++
Sbjct  224  RGGVPSARIAAYKVCSVSGCPTEAILQGFDDAIADGVDII  263



>ref|XP_007219654.1| hypothetical protein PRUPE_ppa025139mg, partial [Prunus persica]
 gb|EMJ20853.1| hypothetical protein PRUPE_ppa025139mg, partial [Prunus persica]
Length=695

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 11/100 (11%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY  +DD            D  GHGTH ASTAAG+ V D S+YGLA GTA
Sbjct  144  TCNNKIIGARYY--TDDGAS---------DAVGHGTHTASTAAGNPVKDVSFYGLAQGTA  192

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA Y+VC   GCP  AIL+GFDDAI DGVD++
Sbjct  193  RGGVPSARIAAYKVCSVSGCPTEAILQGFDDAIADGVDII  232



>ref|XP_011020517.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=788

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPN-----SDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDAS  166
            F  SNCNRK+IGARYY +     S+++        SPRD  GHGTH  S AAG+ V + S
Sbjct  194  FKKSNCNRKLIGARYYDSIQRTYSNNKTHMAKPDDSPRDFDGHGTHTTSIAAGAKVANVS  253

Query  167  YYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVD  307
            Y+ LA GTA+GGSPSSRIA+Y+ C   GC GS ILK  DDAIKDGVD
Sbjct  254  YHDLAGGTARGGSPSSRIAIYKACTLDGCSGSTILKAIDDAIKDGVD  300



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN S+CNRK+IGARYY ++         + S RD +GHGTH ASTAAG+ V +AS  GLA
Sbjct  180  FNKSSCNRKLIGARYYKSTG--------ATSARDSNGHGTHTASTAAGAHVVEASDRGLA  231

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG P  RIA Y+ C + GCPGSA+LK  DDA+ DGVD++
Sbjct  232  RGTAKGGQPGCRIAAYKTCTADGCPGSAMLKAMDDAVHDGVDII  275



>ref|XP_006440509.1| hypothetical protein CICLE_v10023551mg [Citrus clementina]
 gb|ESR53749.1| hypothetical protein CICLE_v10023551mg [Citrus clementina]
Length=727

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F+SS    KIIGARYY NS++    + D  SPRD  GHGTH +STAAG  V  ASYYGLA
Sbjct  119  FSSSPSYFKIIGARYY-NSENIY-EVTDFHSPRDSEGHGTHTSSTAAGREVPHASYYGLA  176

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG P++RIAMY+VC S GC  + IL  FDDAI DGVD++
Sbjct  177  EGTARGGVPNARIAMYKVCWSDGCATADILAAFDDAIADGVDII  220



>emb|CDY57477.1| BnaAnng14590D [Brassica napus]
Length=781

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN S+CNRK+IGARYY ++         + S RD +GHGTH ASTAAG+ V +AS  GLA
Sbjct  201  FNKSSCNRKLIGARYYKSTG--------ATSARDSNGHGTHTASTAAGAHVVEASDRGLA  252

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTAKGG P  RIA Y+ C + GCPGSA+LK  DDA+ DGVD++
Sbjct  253  RGTAKGGQPGCRIAAYKTCTADGCPGSAMLKAMDDAVHDGVDII  296



>emb|CBI24462.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N+  CN KIIGARYY NS++Q  +  D  SPRD  GHGTH ASTAAG  V  ASYYGLA 
Sbjct  124  NNFTCNNKIIGARYY-NSENQY-YDGDIKSPRDSEGHGTHTASTAAGREVAGASYYGLAE  181

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            G A+GG P +RIA+Y+VC   GC  + IL  FDDAI DGVD++
Sbjct  182  GLARGGHPKARIAVYKVCWVIGCAVADILAAFDDAIADGVDII  224



>ref|XP_004164258.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=752

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y +     G+I    SPRD  GHGTH AST AG LV +AS YGL  GTA+
Sbjct  178  CNRKIIGARTYRSEKLPPGNI---QSPRDSEGHGTHTASTVAGGLVSEASLYGLGFGTAR  234

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  235  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  273



>ref|XP_004149954.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=739

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y +     G+I    SPRD  GHGTH AST AG LV +AS YGL  GTA+
Sbjct  178  CNRKIIGARTYRSEKLPPGNI---QSPRDSEGHGTHTASTVAGGLVSEASLYGLGFGTAR  234

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  235  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  273



>gb|KDO48661.1| hypothetical protein CISIN_1g0368302mg, partial [Citrus sinensis]
Length=408

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  S+CNRK+IGAR+   +        +SGS RD  GHGTH ASTAAG+ V +A Y+GLA
Sbjct  189  FKKSHCNRKLIGARHCSRASTNKD---NSGSSRDPLGHGTHTASTAAGNYVSNAIYFGLA  245

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GGSP SRIA Y+ C+  GC G+AIL+  DDAI DGVD++
Sbjct  246  GGTARGGSPFSRIASYKACKEGGCSGAAILQAIDDAIHDGVDII  289



>ref|XP_008461725.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=755

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN+KIIGAR Y    D      D  SPRD +GHGTH AST AG LV  AS YGLA+GTA
Sbjct  188  TCNKKIIGARAY--RSDNVFPTADIPSPRDSNGHGTHTASTVAGGLVSQASLYGLALGTA  245

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  246  RGGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDII  285



>ref|XP_009396946.1| PREDICTED: cucumisin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396947.1| PREDICTED: cucumisin-like [Musa acuminata subsp. malaccensis]
Length=728

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY + +D         SPRD +GHGTH AST AG  V  AS YGLA GTA
Sbjct  172  KCNNKIIGARYYNSLNDTS----QEESPRDFNGHGTHTASTVAGKSVQGASLYGLAGGTA  227

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+R+A+Y+VC SFGC    IL  FDDAI DGVD++
Sbjct  228  RGGVPSARLAVYKVCWSFGCAEQDILAAFDDAIADGVDII  267



>ref|XP_004149953.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN50588.1| hypothetical protein Csa_5G187860 [Cucumis sativus]
Length=742

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN+KIIGAR Y    D      D  SPRD +GHGTH AST AG LV  AS YGLA+GTA
Sbjct  175  TCNKKIIGARAY--RSDNVFPTEDIPSPRDSNGHGTHTASTVAGGLVSQASLYGLALGTA  232

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  233  RGGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDII  272



>ref|XP_008464909.1| PREDICTED: cucumisin-like, partial [Cucumis melo]
Length=684

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGAR++ +    G    DS SPRD  GHGTH +STA G+LV DA+ +GLA GT+
Sbjct  118  TCNNKIIGARFFRSEPVIG----DSPSPRDTEGHGTHTSSTAGGNLVTDANLFGLAAGTS  173

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG+PS+RIA+Y++C S GCP + IL  FD AI DGVD++
Sbjct  174  RGGAPSARIAVYKICWSNGCPDADILAAFDHAIADGVDII  213



>ref|XP_008245823.1| PREDICTED: cucumisin-like [Prunus mume]
Length=958

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 11/100 (11%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY           D+G+  D  GHGTH ASTAAG+ V D S+YGLA GTA
Sbjct  407  TCNNKIIGARYY----------TDAGA-SDAVGHGTHTASTAAGNPVKDVSFYGLAQGTA  455

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA Y+VC   GCP  AIL+GFDDAI DGVD++
Sbjct  456  RGGVPSARIAAYKVCSVSGCPTEAILQGFDDAIADGVDII  495


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 11/65 (17%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY           D+G+  D  GHGTH ASTAAG+ V D S+YGLA GTA
Sbjct  175  TCNNKIIGARYY----------TDAGA-SDAVGHGTHTASTAAGNPVKDVSFYGLAQGTA  223

Query  194  KGGSP  208
            +GG P
Sbjct  224  RGGVP  228



>ref|XP_006662913.1| PREDICTED: cucumisin-like [Oryza brachyantha]
Length=760

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F++ NCNRKIIGAR+Y +  ++     +  SPRD +GHGTHVASTAAG++V + S YGLA
Sbjct  183  FSAKNCNRKIIGARWYADVVNKSQLEAEFLSPRDFNGHGTHVASTAAGNVVHNISLYGLA  242

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCP-------GSAILKGFDDAIKDGVDVL  313
             G A+GG+P +RIA+Y+ C S   P        +A++K  DDAI DGVD+L
Sbjct  243  SGVAQGGAPKARIAVYKACWSVAAPPAAATCSEAAVIKAIDDAIHDGVDIL  293



>gb|EYU39007.1| hypothetical protein MIMGU_mgv1a020931mg [Erythranthe guttata]
Length=766

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDD--QGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
             CN KIIGARYY + ++  QG    D  SPRD  GHGTH ASTA+G +  DASY+GLA G
Sbjct  164  TCNNKIIGARYYNSENEYYQG----DIPSPRDSEGHGTHTASTASG-IEADASYFGLAKG  218

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             A+GG PSSRIA+Y+VC S GC  + ILK FDDAI DGVD++
Sbjct  219  VARGGVPSSRIAVYKVCWSSGCGSADILKAFDDAIADGVDII  260



>ref|XP_002304456.2| hypothetical protein POPTR_0003s12010g, partial [Populus trichocarpa]
 gb|EEE79435.2| hypothetical protein POPTR_0003s12010g, partial [Populus trichocarpa]
Length=762

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN K+IGAR+Y  + +    I D  SPRD  GHGTH +STAAG  V  ASY+GLA G A
Sbjct  158  TCNNKLIGARWY--NSENFFDITDFPSPRDSEGHGTHTSSTAAGREVQGASYFGLAEGAA  215

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RIAMY+VC S+GC  + IL  +DDAI DGVD++
Sbjct  216  RGGVPNARIAMYKVCWSYGCSSADILAAYDDAIADGVDII  255



>gb|KDO61088.1| hypothetical protein CISIN_1g045363mg [Citrus sinensis]
Length=712

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N + CN+K+IGARYY N D+      D  SP D  GHGTH +STAAG  V  AS YG+A 
Sbjct  137  NFTRCNKKVIGARYY-NLDNALDPNTDQKSPVDTDGHGTHTSSTAAGETVKGASLYGIAQ  195

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTA+GG PS+RIAMY+VC S GC    IL  FDDAI DGVD++
Sbjct  196  GTARGGVPSARIAMYKVCWSGGCADMDILAAFDDAIGDGVDLI  238



>ref|XP_010520669.1| PREDICTED: cucumisin-like [Tarenaya hassleriana]
Length=694

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY      GG I    S RDH GHGTH +STAAG+ V DAS+YGL +GTA
Sbjct  138  TCNNKIIGARYYTR---NGGIIGTPQSARDHIGHGTHTSSTAAGNSVKDASFYGLGLGTA  194

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RIA Y+VC   GC    +L  FDDAI DGVDV+
Sbjct  195  RGGVPAARIAAYKVCDPGGCFSDRLLSAFDDAIADGVDVI  234



>ref|XP_006481881.1| PREDICTED: xylem serine proteinase 1-like [Citrus sinensis]
Length=748

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N + CN+K+IGARYY N D+      D  SP D  GHGTH +STAAG  V  AS YG+A 
Sbjct  173  NFTRCNKKVIGARYY-NLDNALDPNTDQKSPVDTDGHGTHTSSTAAGETVKGASLYGIAQ  231

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTA+GG PS+RIAMY+VC S GC    IL  FDDAI DGVD++
Sbjct  232  GTARGGVPSARIAMYKVCWSGGCADMDILAAFDDAIGDGVDLI  274



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS-DDQGGHILDSG-----SPRDHSGHGTHVASTAAGSLVDDA  163
            FN+SNCNRK+IGAR+Y      + G +  SG     SPRD  GHGTH +STAAG+LV +A
Sbjct  173  FNASNCNRKVIGARWYIKGYAAEFGKLNTSGDVEFLSPRDAVGHGTHTSSTAAGALVGNA  232

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            S+ GLA G A+GG+P++R+++Y+VC S  GC  + +L  FDDAI DGVDVL
Sbjct  233  SFMGLAQGLARGGAPAARLSIYKVCWSTGGCSSADLLAAFDDAISDGVDVL  283



>ref|XP_011033825.1| PREDICTED: cucumisin-like [Populus euphratica]
Length=761

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN K+IGAR+Y NS++    I D  SPRD  GHGTH +STAAG  V  ASY+GLA G A
Sbjct  157  TCNNKLIGARWY-NSENFF-DITDFPSPRDSEGHGTHTSSTAAGHEVQGASYFGLAEGVA  214

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RIAMY+VC S+GC  + IL  +DDAI DGVD++
Sbjct  215  RGGVPNARIAMYKVCWSYGCSSADILAAYDDAIADGVDII  254



>gb|EMS55531.1| Subtilisin-like protease [Triticum urartu]
Length=700

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            FN+++CNRKIIGAR+Y          +D  SPRD +GHGTHVAST AG  V   SY GL 
Sbjct  165  FNTTSCNRKIIGARWYGRGISAESLKIDYKSPRDLNGHGTHVASTIAGGEVQGVSYGGLG  224

Query  182  MGTAKGGSPSSRIAMYQVCQ-SFGCPGSAILKGFDDAIKDGVDVL  313
            MG A+GG+P +R+ +Y+VC    GCP +A+L   DDAI DGVDVL
Sbjct  225  MGVARGGAPRARLGIYKVCWVDEGCPDTAVLAAIDDAIHDGVDVL  269



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS-DDQGGHILDSG-----SPRDHSGHGTHVASTAAGSLVDDA  163
            FN+SNCNRK+IGAR+Y      + G +  SG     SPRD  GHGTH +STAAG+LV +A
Sbjct  176  FNASNCNRKVIGARWYIKGYAAEFGKLNTSGDVEFLSPRDAVGHGTHTSSTAAGALVGNA  235

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            S+ GLA G A+GG+P++R+++Y+VC S  GC  + +L  FDDAI DGVDVL
Sbjct  236  SFMGLAQGLARGGAPAARLSIYKVCWSTGGCSSADLLAAFDDAISDGVDVL  286



>ref|XP_002520491.1| peptidase, putative [Ricinus communis]
 gb|EEF41904.1| peptidase, putative [Ricinus communis]
Length=2072

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN KIIGARYY ++       L   S RD  GHGTH ASTAAG+ V DAS++G+A GTA+
Sbjct  148  CNNKIIGARYYNSTQ------LRIISARDDVGHGTHTASTAAGNKVMDASFFGIARGTAR  201

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RI+ Y+VC   GC G+ +L  FDDAI DGVD++
Sbjct  202  GGVPSARISAYRVCSVEGCSGAEVLAAFDDAIADGVDII  240



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS-DDQGGHILDSGS-----PRDHSGHGTHVASTAAGSLVDDA  163
            FNSSNCNRKIIGAR+Y    + + G +  SGS     PRD  GHGTH +STAAG+LV +A
Sbjct  187  FNSSNCNRKIIGARWYIKGYEAEFGKLNTSGSIEFLSPRDAVGHGTHTSSTAAGALVGNA  246

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            S+ GLA G A+GG+ ++R+A+Y+VC S  GC  + +L  FDDAI DGVDVL
Sbjct  247  SFMGLAQGLARGGASAARLAIYKVCWSTGGCSSADLLAAFDDAIFDGVDVL  297



>ref|XP_008461730.1| PREDICTED: cucumisin-like isoform X2 [Cucumis melo]
Length=684

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y    D+     D  SPRD  GHGTH AST AG LV+ AS YGLA GTA+
Sbjct  117  CNRKIIGARAY--RSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLASGTAR  174

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  175  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  213



>ref|XP_009392092.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=574

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F  ++CNRKIIGARYY    D      D  SPRD +GHGTH ASTAAGSLV D +++GL 
Sbjct  193  FTVNHCNRKIIGARYYSKDVDPSEVARDYDSPRDANGHGTHTASTAAGSLVSDVNFHGLG  252

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSA-ILKGFDDAIKDGVDVL  313
             GTA+GG+P +R+A+Y+VC   G  G A +L+  DDA+ +GVD+L
Sbjct  253  AGTARGGAPRARLAIYKVCWGSGICGEADVLQAIDDAVDNGVDIL  297



>ref|XP_009391853.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F   +CNRKIIGAR+Y    D     +D  SPRD  GHGTH ASTAAGS V +AS++GL 
Sbjct  182  FTVKHCNRKIIGARWYAGGVDDSDISVDYRSPRDFQGHGTHTASTAAGSFVGNASFHGLG  241

Query  182  MGTAKGGSPSSRIAMYQVC--QSFGCPGSAILKGFDDAIKDGVDVL  313
             G A+GG+P +R+A+Y+ C   +  CP +A+LK  DDA+ DGVD+L
Sbjct  242  AGVARGGAPRARLAIYKACWGNNIRCPDAALLKAIDDAVHDGVDIL  287



>ref|XP_008461717.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=740

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y + +   G   ++ SPRD  GHGTH AST AG LV  AS YGL  GTA+
Sbjct  180  CNRKIIGARTYRSENLPPG---NTQSPRDSEGHGTHTASTVAGGLVSQASLYGLGFGTAR  236

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  237  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  275



>emb|CBI38006.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG------SPRDHSGHGTHVASTAAGSLVDDA  163
            FN SNCNRKIIGAR+Y    +     LD+       SPRD  GHGTH AS AAGSLV +A
Sbjct  207  FNRSNCNRKIIGARWYIKGYEADFGKLDTSGGVEFLSPRDAVGHGTHTASIAAGSLVKNA  266

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            ++ GLA G A+GG+PS+++A+Y+VC S  GC  + +L  FDDA+ DGVDVL
Sbjct  267  NFRGLARGLARGGAPSAQLAVYKVCWSTGGCSSADVLAAFDDAVLDGVDVL  317



>ref|XP_010647672.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSG------SPRDHSGHGTHVASTAAGSLVDDA  163
            FN SNCNRKIIGAR+Y    +     LD+       SPRD  GHGTH AS AAGSLV +A
Sbjct  178  FNRSNCNRKIIGARWYIKGYEADFGKLDTSGGVEFLSPRDAVGHGTHTASIAAGSLVKNA  237

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            ++ GLA G A+GG+PS+++A+Y+VC S  GC  + +L  FDDA+ DGVDVL
Sbjct  238  NFRGLARGLARGGAPSAQLAVYKVCWSTGGCSSADVLAAFDDAVLDGVDVL  288



>ref|XP_010683779.1| PREDICTED: xylem serine proteinase 1 [Beta vulgaris subsp. vulgaris]
Length=711

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
             N + CNRK+IGARYY    D G   +D  +P D  GHGTH +STAAG  V+ AS +G+A
Sbjct  137  LNFTGCNRKVIGARYYNLGPDIG---MDP-TPVDTDGHGTHTSSTAAGRSVNGASLFGVA  192

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
             GTA+GG P+SRIAMY+VC +FGC   ++L GFDDAI DGVD++
Sbjct  193  EGTARGGVPNSRIAMYKVCGNFGCSDMSLLAGFDDAIADGVDII  236



>ref|XP_008461729.1| PREDICTED: cucumisin-like isoform X1 [Cucumis melo]
Length=767

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y    D+     D  SPRD  GHGTH AST AG LV+ AS YGLA GTA+
Sbjct  200  CNRKIIGARAY--RSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLASGTAR  257

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  258  GGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDII  296



>ref|XP_009391852.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CNRKIIGARYY    D      D  SPRD +GHGTH ASTAAGSLV DAS++GL  GTA
Sbjct  187  RCNRKIIGARYYSKDADPSEVARDYDSPRDANGHGTHTASTAAGSLVSDASFHGLGAGTA  246

Query  194  KGGSPSSRIAMYQVCQSFGCPGSA-ILKGFDDAIKDGVDVL  313
            +GG+P +R+A+Y+VC   G  G A +L+  DDA+ DGVD+L
Sbjct  247  RGGAPRARLAIYKVCWGSGRCGEADVLQAIDDAVDDGVDIL  287



>ref|XP_002275807.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=766

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGH-ILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
             CN KIIGARYY   + +G + I D  SPRD  GHGTH ASTAAG  VD ASY+GLA GT
Sbjct  169  TCNNKIIGARYY---NSEGYYDISDFKSPRDSLGHGTHTASTAAGREVDGASYFGLAKGT  225

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A+G  P++RIA+Y+VC  +GC  + I   FDDAI DGVD++
Sbjct  226  ARGAVPNARIAVYKVCWYYGCAVADIFAAFDDAIADGVDII  266



>emb|CBI34765.3| unnamed protein product [Vitis vinifera]
Length=732

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGH-ILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGT  190
             CN KIIGARYY   + +G + I D  SPRD  GHGTH ASTAAG  VD ASY+GLA GT
Sbjct  135  TCNNKIIGARYY---NSEGYYDISDFKSPRDSLGHGTHTASTAAGREVDGASYFGLAKGT  191

Query  191  AKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A+G  P++RIA+Y+VC  +GC  + I   FDDAI DGVD++
Sbjct  192  ARGAVPNARIAVYKVCWYYGCAVADIFAAFDDAIADGVDII  232



>ref|XP_002316252.2| cucumisin family protein [Populus trichocarpa]
 gb|EEF02423.2| cucumisin family protein [Populus trichocarpa]
Length=699

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHIL--DSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
             CN KIIGARYY       G +   D  SPRD  GHGTH ASTAAG LV +AS  GLA G
Sbjct  134  TCNNKIIGARYY----HSEGKVEPGDFASPRDSEGHGTHTASTAAGRLVSEASQLGLATG  189

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            TA+GG PS+RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  190  TARGGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDII  231



>gb|EAY73513.1| hypothetical protein OsI_01395 [Oryza sativa Indica Group]
Length=788

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDS-------GSPRDHSGHGTHVASTAAGSLVDD  160
            F  S+CN+K+IGARYY +          +       GSPRD  GHGTH ASTAAG++V  
Sbjct  181  FKKSSCNKKLIGARYYSSQPGSASSSSAAGAVTATGGSPRDAVGHGTHTASTAAGAVVPG  240

Query  161  ASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A YYGLA G AKGG+P+SR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  241  AGYYGLARGAAKGGAPASRVAVYKACSLGGCASSAVLKAIDDAVGDGVDVV  291



>gb|KHG27800.1| Cucumisin [Gossypium arboreum]
Length=630

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY    D   +  D  SPRD  GHGTH +STAAG LV  AS YGLA GTA
Sbjct  174  TCNNKIIGARYYRGKGDYSPY--DYRSPRDSEGHGTHTSSTAAGGLVSKASLYGLAKGTA  231

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG PS+RIA+Y++C   GC    IL  FDDAI DGVD++
Sbjct  232  RGGVPSARIAVYKICWYDGCYDEDILAAFDDAIADGVDII  271



>ref|XP_004165775.1| PREDICTED: LOW QUALITY PROTEIN: cucumisin-like [Cucumis sativus]
Length=747

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN+KIIGAR Y +++D      D  SPRD  GHGTH AST  G LV++AS+YGLA GTA+
Sbjct  179  CNKKIIGARAYRSNNDFPPE--DIRSPRDSDGHGTHTASTVVGGLVNEASFYGLARGTAR  236

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG+PS+ IA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  237  GGTPSACIAVYKICWSDGCYSTDILAAFDDAIADGVDII  275



>ref|XP_004515553.1| PREDICTED: cucumisin-like [Cicer arietinum]
Length=786

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN KIIGARYY + +D      D  SPRD  GHGTH ASTAAG  +  AS  GLA GTA
Sbjct  171  TCNNKIIGARYYLSFEDPLSE-RDIESPRDTEGHGTHTASTAAGIPIKKASMEGLARGTA  229

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG+PS+RIA+Y+VC   GC  S IL  FDDAI DGVD+L
Sbjct  230  RGGAPSARIAVYKVCWVKGCFDSGILAAFDDAIADGVDIL  269



>ref|XP_002316254.1| hypothetical protein POPTR_0010s20420g [Populus trichocarpa]
 gb|EEF02425.1| hypothetical protein POPTR_0010s20420g [Populus trichocarpa]
Length=697

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSD--DQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMG  187
             CN KIIGARYY +    D G    D  SPRD  GHGTH ASTAAG LV +AS  GLA G
Sbjct  134  TCNNKIIGARYYHSEGKVDPG----DFASPRDSEGHGTHTASTAAGRLVSEASLLGLATG  189

Query  188  TAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            TA+GG PS+RIA Y++C S GC  + IL  FDDAI DGVD++
Sbjct  190  TARGGVPSARIAAYKICWSDGCSDADILAAFDDAIADGVDII  231



>ref|XP_010694663.1| PREDICTED: CO(2)-response secreted protease-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 10/111 (9%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHI-------LDSGSPRDHSGHGTHVASTAAGSLVDD  160
            F  S+CNRKIIGAR+Y +   +GG +       +   S RDH  HGTH ASTAAG  V +
Sbjct  190  FKKSDCNRKIIGARHYIH---EGGLLGKASNSTVTKSSSRDHDSHGTHTASTAAGVEVAN  246

Query  161  ASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            ASY+GLA GTA+GG PS+RIA+Y+ C    C GS ILK  DDA+ DGVD++
Sbjct  247  ASYFGLAQGTARGGLPSARIAVYKACTLDNCAGSTILKAIDDAVSDGVDII  297



>dbj|BAA89562.1| putative subtilisin-like protein [Oryza sativa Japonica Group]
Length=795

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDS-------GSPRDHSGHGTHVASTAAGSLVDD  160
            F  S+CN+K+IGARYY +          +       GSPRD  GHGTH ASTAAG++V  
Sbjct  184  FKKSSCNKKLIGARYYGSQPGSASSSSAAGAVTATGGSPRDAVGHGTHTASTAAGAVVPG  243

Query  161  ASYYGLAMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A YYGLA G AKGG+P+SR+A+Y+ C   GC  SA+LK  DDA+ DGVDV+
Sbjct  244  AGYYGLARGAAKGGAPASRVAVYKACSLGGCASSAVLKAIDDAVGDGVDVV  294



>ref|XP_006430257.1| hypothetical protein CICLE_v10013548mg, partial [Citrus clementina]
 gb|ESR43497.1| hypothetical protein CICLE_v10013548mg, partial [Citrus clementina]
Length=718

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N + CN+K+IGARYY N D+      D  SP D  GHGTH +STAAG  V  +S YG+A 
Sbjct  143  NFTRCNKKVIGARYY-NLDNALDTNTDQKSPVDTDGHGTHTSSTAAGETVKGSSLYGIAQ  201

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTA+GG PS+RIAMY+VC S GC    IL  FDDAI DGVD++
Sbjct  202  GTARGGVPSARIAMYKVCWSGGCADMDILAAFDDAIGDGVDLI  244



>gb|KDP25228.1| hypothetical protein JCGZ_20384 [Jatropha curcas]
Length=335

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 16/117 (14%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYY----------PNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSL  151
            FNSSNCN+K+IGAR++          P +       L   SPRD SGHGTH ASTAAG  
Sbjct  140  FNSSNCNKKLIGARWFIKGFKDVISKPVNTTNSMEFL---SPRDGSGHGTHTASTAAGYF  196

Query  152  VDDASYYGLAMGTAKGGSPSSRIAMYQVCQSF---GCPGSAILKGFDDAIKDGVDVL  313
            V+ ASY GLA G A+GG+P + +A+Y+VC      GC  + ILK FD AI+DGVDVL
Sbjct  197  VEKASYKGLAAGVARGGAPLAHLAVYKVCWDIEGGGCSDADILKAFDKAIQDGVDVL  253



>emb|CBI31597.3| unnamed protein product [Vitis vinifera]
Length=787

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F++  CN KIIGA+YY  SD + G   D  SPRD  GHGTH ASTAAG LV  AS  G  
Sbjct  219  FSNFTCNNKIIGAKYY-RSDGEFGR-EDLRSPRDSLGHGTHTASTAAGGLVSMASLMGFG  276

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GTA+GG PS+RIA+Y++C S GC G+ +L  FDDAI DGVD++
Sbjct  277  LGTARGGVPSARIAVYKICWSDGCHGADVLAAFDDAIADGVDII  320



>gb|AEM42989.1| cucumisin [Siraitia grosvenorii]
Length=735

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CNRKIIGAR Y +S    G   D  SPRD  GHGTH AST AG LV  AS YGL +GTA+
Sbjct  177  CNRKIIGARAYRSSTLPPG---DVRSPRDTDGHGTHTASTVAGVLVSQASLYGLGVGTAR  233

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG P +RIA+Y++C S GC  + IL  FDDAI DGVD++
Sbjct  234  GGVPPARIAVYKICWSDGCSDADILAAFDDAIADGVDII  272



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS-DDQGGHI-----LDSGSPRDHSGHGTHVASTAAGSLVDDA  163
            FN+SNC+RKIIGAR+Y    + + G +     ++  SPRD  GHGTH +STAAGSLV+DA
Sbjct  198  FNASNCSRKIIGARWYIKGYEAEFGKLNMTEGVEFLSPRDAVGHGTHTSSTAAGSLVEDA  257

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            S+ GLA G A+GG+P++ +A+Y++C S  GC  + +L  FDDAI DGVDV+
Sbjct  258  SFAGLAQGLARGGAPAAWLAVYKICWSTGGCSSADLLAAFDDAISDGVDVI  308



>ref|XP_002277115.3| PREDICTED: cucumisin [Vitis vinifera]
Length=1359

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  17   CNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAK  196
            CN KIIGARYY ++        D  SPRD  GHGTH ASTAAG++V  AS  GL  GTA+
Sbjct  134  CNNKIIGARYYRSNGKVPPE--DFASPRDSEGHGTHTASTAAGNVVSGASLLGLGAGTAR  191

Query  197  GGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GG+PSSRIA+Y++C + GCP + IL  FDDAI DGVD++
Sbjct  192  GGAPSSRIAVYKICWAGGCPYADILAAFDDAIADGVDII  230


 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +2

Query  5    NSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAM  184
            N ++CN KIIGARYY    +   +  DS  PRD  GHGTH AS  AG LV  AS  G   
Sbjct  796  NFTSCNNKIIGARYYHTGAEVEPNEYDS--PRDSDGHGTHTASIVAGGLVSGASLLGFGS  853

Query  185  GTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            GTA+GG PS+RIA+Y+VC S GC  + +L  FDDAI DGVD++
Sbjct  854  GTARGGVPSARIAVYKVCWSKGCYSADVLAAFDDAIADGVDII  896



>gb|KDP25529.1| hypothetical protein JCGZ_20685 [Jatropha curcas]
Length=770

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  14   NCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTA  193
             CN+KIIGAR+Y  +  +   I +  SPRD  GHGTH +STAAG  V  ASY GLA G A
Sbjct  168  TCNKKIIGARWY--NGLELYDISEIKSPRDTLGHGTHTSSTAAGREVQGASYSGLAEGLA  225

Query  194  KGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GG P++RIA+Y+VC SFGC G+ IL  FDDAI DGVD+L
Sbjct  226  RGGVPNARIAVYKVCWSFGCYGADILAAFDDAIADGVDIL  265



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   114 bits (286),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHIL-DSGSPRDHSGHGTHVASTAAGSLVDDASYYGL  178
            FNS  CN+KIIGA YY     +  H   D  SPRD+ GHGTH ASTAAGS V +AS +G 
Sbjct  140  FNSKLCNKKIIGAYYYSEGSKKSSHKFKDIESPRDYKGHGTHTASTAAGSPVVNASMFGY  199

Query  179  AMGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            A GTA+G + ++RI+ Y+VC S GC G+ IL G D AI DGVDVL
Sbjct  200  AKGTARGIAANARISSYKVCWSTGCSGADILAGIDRAITDGVDVL  244



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNS-DDQGGHI-----LDSGSPRDHSGHGTHVASTAAGSLVDDA  163
            FN+SNC+RKIIGAR+Y    + + G +     ++  SPRD  GHGTH +STAAGSLV+DA
Sbjct  175  FNASNCSRKIIGARWYIKGYEAEFGKLNMTEGVEFLSPRDAVGHGTHTSSTAAGSLVEDA  234

Query  164  SYYGLAMGTAKGGSPSSRIAMYQVCQSF-GCPGSAILKGFDDAIKDGVDVL  313
            S+ GLA G A+GG+P++ +A+Y++C S  GC  + +L  FDDAI DGVDV+
Sbjct  235  SFAGLAQGLARGGAPAAWLAVYKICWSTGGCSSADLLAAFDDAISDGVDVI  285



>ref|XP_010658506.1| PREDICTED: cucumisin isoform X2 [Vitis vinifera]
Length=745

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F++  CN KIIGA+YY +S        D  SPRD  GHGTH ASTAAG LV  AS  G  
Sbjct  177  FSNFTCNNKIIGAKYYRSSGQFRQE--DFQSPRDSEGHGTHTASTAAGGLVSMASLMGFG  234

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GTA+GG PS+RIA+Y++C S GC G+ IL  FDDAI DGVD++
Sbjct  235  LGTARGGVPSARIAVYKICWSDGCFGADILAAFDDAIADGVDII  278



>ref|XP_010658505.1| PREDICTED: cucumisin isoform X1 [Vitis vinifera]
Length=746

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    FNSSNCNRKIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLA  181
            F++  CN KIIGA+YY +S        D  SPRD  GHGTH ASTAAG LV  AS  G  
Sbjct  178  FSNFTCNNKIIGAKYYRSSGQFRQE--DFQSPRDSEGHGTHTASTAAGGLVSMASLMGFG  235

Query  182  MGTAKGGSPSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            +GTA+GG PS+RIA+Y++C S GC G+ IL  FDDAI DGVD++
Sbjct  236  LGTARGGVPSARIAVYKICWSDGCFGADILAAFDDAIADGVDII  279



>ref|XP_007040096.1| Subtilase family protein [Theobroma cacao]
 gb|EOY24597.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +2

Query  26   KIIGARYYPNSDDQGGHILDSGSPRDHSGHGTHVASTAAGSLVDDASYYGLAMGTAKGGS  205
            KIIG RYY NS++      D  SPRD  GHGTH +STAAG  V  ASYYGLA GTA+GG 
Sbjct  163  KIIGGRYY-NSENWYDET-DFKSPRDSEGHGTHTSSTAAGDKVPGASYYGLANGTARGGV  220

Query  206  PSSRIAMYQVCQSFGCPGSAILKGFDDAIKDGVDVL  313
            P +RIAMY+VC SFGC  + IL  FDDAI DGVDV+
Sbjct  221  PGARIAMYKVCWSFGCATADILAAFDDAIADGVDVI  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512023305854