BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14892_g1_i1 len=423 path=[1:0-422]

Length=423
                                                                      Score     E

ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3         160   8e-43   
gb|KHG24601.1|  Cucumisin                                               158   4e-42   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3         157   9e-42   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g             155   7e-41   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    152   4e-40   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1     152   7e-40   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg             151   7e-40   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease                152   9e-40   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease                151   1e-39   
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2     150   4e-39   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1     149   6e-39   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like           149   1e-38   
gb|KHN09070.1|  Subtilisin-like protease                                148   1e-38   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like           148   2e-38   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...    146   6e-38   
emb|CDP07365.1|  unnamed protein product                                146   7e-38   
gb|EPS70387.1|  hypothetical protein M569_04373                         138   7e-38   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                       146   1e-37   Glycine max [soybeans]
ref|NP_001236511.1|  subtilisin-type protease precursor                 145   1e-37   
gb|KDP36888.1|  hypothetical protein JCGZ_08179                         145   2e-37   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                          145   3e-37   
dbj|BAJ53097.1|  JHL20J20.3                                             144   3e-37   
gb|AES74057.2|  subtilisin-like serine protease                         142   4e-37   
ref|NP_001238252.1|  subtilisin-type protease precursor                 144   7e-37   
ref|XP_003603806.1|  Subtilisin-like serine protease                    142   1e-36   
emb|CBI19918.3|  unnamed protein product                                142   2e-36   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...    142   2e-36   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like           142   2e-36   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...    142   2e-36   Vitis vinifera
ref|XP_002307740.1|  putative subtilisin precursor family protein       142   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like           142   4e-36   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3         141   4e-36   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...    140   7e-36   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...    140   8e-36   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g             140   8e-36   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease                140   9e-36   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                          140   1e-35   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    138   3e-35   
ref|XP_002893091.1|  subtilase                                          139   4e-35   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                   139   4e-35   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg             139   4e-35   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...    138   5e-35   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...    138   6e-35   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                   137   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...    137   1e-34   
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                      137   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg             137   1e-34   
gb|AAM65424.1|  subtilisin-like serine protease                         137   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003603807.1|  Subtilisin-type protease                           137   2e-34   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like           137   2e-34   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...    136   3e-34   
ref|XP_010229480.1|  PREDICTED: CO(2)-response secreted protease-...    129   6e-34   
emb|CDY44210.1|  BnaC05g15670D                                          135   7e-34   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like           135   7e-34   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease                135   7e-34   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg             134   1e-33   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like           134   1e-33   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                          134   1e-33   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...    134   3e-33   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...    134   3e-33   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...    133   4e-33   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease        133   5e-33   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...    133   5e-33   
ref|XP_003603196.1|  Subtilisin-type protease                           133   5e-33   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3         133   6e-33   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                    131   2e-32   
gb|EMT05539.1|  Subtilisin-like protease                                130   2e-32   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease        131   2e-32   
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like           130   3e-32   
dbj|BAJ93850.1|  predicted protein                                      129   9e-32   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like           127   8e-31   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease        125   2e-30   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3         125   3e-30   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3         123   2e-29   
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g             120   3e-29   
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g             120   6e-29   
ref|XP_002300693.2|  putative subtilisin precursor family protein       121   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             120   2e-28   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...    119   4e-28   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630          119   6e-28   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease                118   9e-28   
gb|KEH19206.1|  subtilisin-like serine protease                         117   2e-27   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...    117   2e-27   
gb|KEH19205.1|  subtilisin-like serine protease                         117   3e-27   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like           117   3e-27   
dbj|BAA13135.1|  subtilisin-like protein                                116   3e-27   Picea abies
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         115   1e-26   Vitis vinifera
emb|CBI34615.3|  unnamed protein product                                115   1e-26   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       115   1e-26   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      114   2e-26   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    114   2e-26   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         114   2e-26   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       114   2e-26   
ref|XP_010092449.1|  Subtilisin-like protease SDD1                      111   3e-26   
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         114   3e-26   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         114   3e-26   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...    114   3e-26   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like      114   4e-26   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         114   4e-26   
ref|XP_002518939.1|  Cucumisin precursor, putative                      113   6e-26   Ricinus communis
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           113   6e-26   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease                113   6e-26   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...    112   8e-26   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...    112   1e-25   
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...    111   1e-25   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                         112   1e-25   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           112   1e-25   
ref|XP_003629621.1|  Subtilisin-like protease                           112   2e-25   
gb|AET04097.2|  subtilisin-like serine protease                         112   2e-25   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    111   2e-25   
ref|XP_010451309.1|  PREDICTED: subtilisin-like protease SBT3.3         107   2e-25   
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    111   2e-25   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    111   2e-25   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                         111   3e-25   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             110   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      110   5e-25   
ref|XP_004165291.1|  PREDICTED: subtilisin-like protease-like           110   5e-25   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    110   5e-25   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             110   5e-25   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like           110   5e-25   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like           110   6e-25   
gb|KEH19202.1|  subtilisin-like serine protease                         110   6e-25   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         110   7e-25   
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                   110   8e-25   
gb|KGN47766.1|  hypothetical protein Csa_6G401370                       109   1e-24   
gb|KDO48659.1|  hypothetical protein CISIN_1g028958mg                   104   1e-24   
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         109   1e-24   
gb|KHN10324.1|  Subtilisin-like protease                                109   1e-24   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             109   2e-24   
emb|CDX77071.1|  BnaC04g38660D                                          108   2e-24   
ref|XP_002891022.1|  subtilase family protein                           108   2e-24   
ref|XP_002528535.1|  Cucumisin precursor, putative                      108   2e-24   Ricinus communis
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          108   3e-24   
gb|EMT21268.1|  Subtilisin-like protease                                108   3e-24   
gb|KDP25228.1|  hypothetical protein JCGZ_20384                         105   3e-24   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4         108   4e-24   
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             108   4e-24   
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    107   4e-24   
ref|XP_010091321.1|  Subtilisin-like protease                           108   5e-24   
ref|XP_002980086.1|  hypothetical protein SELMODRAFT_419592             107   5e-24   
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5         107   6e-24   
ref|XP_002987481.1|  hypothetical protein SELMODRAFT_426260             107   6e-24   
gb|KDO48661.1|  hypothetical protein CISIN_1g0368302mg                  104   7e-24   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         107   7e-24   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             107   7e-24   
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease        107   8e-24   Vitis vinifera
ref|XP_004146802.1|  PREDICTED: subtilisin-like protease-like           107   8e-24   
emb|CDP18817.1|  unnamed protein product                                107   9e-24   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                    107   9e-24   
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...    106   1e-23   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                   106   1e-23   
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460             106   1e-23   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg             106   1e-23   
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5         106   1e-23   
ref|XP_002891021.1|  predicted protein                                  106   1e-23   
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351             106   1e-23   
gb|KFK44142.1|  hypothetical protein AALP_AA1G220500                    106   2e-23   
ref|XP_002893090.1|  predicted protein                                  106   2e-23   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    106   2e-23   
ref|NP_001046517.1|  Os02g0269600                                       105   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32761.1|  Subtilisin-like protease                                105   2e-23   
ref|XP_006416427.1|  hypothetical protein EUTSA_v10006858mg             105   2e-23   
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2     105   2e-23   
ref|XP_006370742.1|  hypothetical protein POPTR_0001s460001g            103   2e-23   
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319             105   2e-23   
gb|KDO48658.1|  hypothetical protein CISIN_1g028958mg                   100   2e-23   
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3         105   3e-23   
ref|XP_002987482.1|  hypothetical protein SELMODRAFT_426261             105   3e-23   
ref|XP_002980084.1|  hypothetical protein SELMODRAFT_419590             105   3e-23   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease                105   3e-23   
ref|XP_002994537.1|  hypothetical protein SELMODRAFT_432452             105   3e-23   
gb|EMS68678.1|  Subtilisin-like protease                                105   3e-23   
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative      105   3e-23   Ricinus communis
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5         105   4e-23   
gb|KCW65828.1|  hypothetical protein EUGRSUZ_G03177                     103   4e-23   
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...    105   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             105   4e-23   
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...    105   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         105   4e-23   
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3         105   5e-23   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    104   5e-23   
gb|EMS61069.1|  Subtilisin-like protease                                104   5e-23   
ref|XP_010477248.1|  PREDICTED: CO(2)-response secreted protease        104   5e-23   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like           104   6e-23   
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg             104   6e-23   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like           104   6e-23   
emb|CDY57477.1|  BnaAnng14590D                                          104   6e-23   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like           104   6e-23   
ref|XP_010908011.1|  PREDICTED: CO(2)-response secreted protease-...    104   6e-23   
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400             104   6e-23   
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg             104   6e-23   
gb|KCW53325.1|  hypothetical protein EUGRSUZ_J02574                     104   7e-23   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...    104   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease                104   7e-23   
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3         104   7e-23   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    105   7e-23   
ref|XP_002317030.2|  hypothetical protein POPTR_0011s14930g             104   8e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010101169.1|  Subtilisin-like protease                           104   8e-23   
ref|NP_567362.1|  subtilisin-like protease                              104   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4         104   8e-23   
ref|NP_001190697.1|  subtilisin-like protease                           104   8e-23   
ref|NP_001078370.1|  subtilisin-like protease                           103   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KEH34337.1|  subtilisin-like serine protease                         103   1e-22   
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564413.2|  subtilase family protein                              103   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                     103   1e-22   
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5         103   1e-22   
ref|XP_010091320.1|  Subtilisin-like protease                           103   1e-22   
ref|XP_002987483.1|  hypothetical protein SELMODRAFT_126179             103   1e-22   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4       102   1e-22   
ref|XP_002986912.1|  hypothetical protein SELMODRAFT_425827             103   1e-22   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg             103   1e-22   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease                103   1e-22   
emb|CBI34614.3|  unnamed protein product                                104   1e-22   
emb|CDP21113.1|  unnamed protein product                                100   1e-22   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    104   1e-22   
ref|XP_002977794.1|  hypothetical protein SELMODRAFT_107394             103   1e-22   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease                103   2e-22   
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         103   2e-22   
dbj|BAE98849.1|  subtilisin-like protease -like protein                 103   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    103   2e-22   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         103   2e-22   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             103   2e-22   Populus trichocarpa [western balsam poplar]
tpg|DAA41966.1|  TPA: putative subtilase family protein                 102   2e-22   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             103   2e-22   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease                103   2e-22   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                103   2e-22   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    102   2e-22   
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    102   2e-22   
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    102   2e-22   
ref|XP_008667162.1|  PREDICTED: putative subtilase family protein...    102   3e-22   
ref|XP_008375386.1|  PREDICTED: subtilisin-like protease                102   3e-22   
tpg|DAA41968.1|  TPA: putative subtilase family protein                 102   3e-22   
gb|ACF86497.1|  unknown                                                 102   3e-22   Zea mays [maize]
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4         102   3e-22   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           102   3e-22   
ref|XP_002451012.1|  hypothetical protein SORBIDRAFT_05g022600          102   3e-22   Sorghum bicolor [broomcorn]
emb|CDX93811.1|  BnaA09g24110D                                          102   3e-22   
dbj|BAC53929.1|  serine protease-like protein                           102   3e-22   Nicotiana tabacum [American tobacco]
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         102   3e-22   
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           102   3e-22   
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             102   3e-22   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         102   3e-22   
ref|XP_002451014.1|  hypothetical protein SORBIDRAFT_05g022620          102   3e-22   Sorghum bicolor [broomcorn]
ref|XP_008794760.1|  PREDICTED: subtilisin-like protease SBT5.3         102   4e-22   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         102   4e-22   
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3         102   4e-22   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       102   4e-22   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       102   4e-22   
ref|XP_010104911.1|  Subtilisin-like protease SDD1                      102   4e-22   
ref|NP_564414.2|  Subtilase family protein SBT3.3                       102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002987480.1|  hypothetical protein SELMODRAFT_126065             102   4e-22   
ref|XP_002986919.1|  hypothetical protein SELMODRAFT_125066             102   4e-22   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like           102   5e-22   
ref|XP_002980085.1|  hypothetical protein SELMODRAFT_111799             102   5e-22   
gb|EMT21267.1|  Subtilisin-like protease                                102   5e-22   
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3         102   5e-22   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...    102   5e-22   
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    102   5e-22   
emb|CDX94043.1|  BnaC07g36770D                                          102   5e-22   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           102   5e-22   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         102   5e-22   
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    102   5e-22   
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg             102   5e-22   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             102   5e-22   
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like           102   5e-22   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    101   6e-22   
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    101   6e-22   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    101   6e-22   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         102   6e-22   
ref|XP_002980088.1|  hypothetical protein SELMODRAFT_111859             101   6e-22   
gb|ABE66081.1|  subtilase family protein                              98.6    6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg             101   6e-22   
ref|XP_009392092.1|  PREDICTED: subtilisin-like protease                100   7e-22   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    101   7e-22   
ref|NP_001046518.1|  Os02g0270200                                       100   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5         101   7e-22   
emb|CDX94251.1|  BnaC02g29110D                                          101   7e-22   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                101   8e-22   
ref|XP_002891020.1|  subtilase family protein                           101   8e-22   
emb|CDY67954.1|  BnaAnng25710D                                          101   8e-22   
emb|CBI37484.3|  unnamed protein product                                101   9e-22   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    101   9e-22   
ref|XP_002263237.2|  PREDICTED: subtilisin-like protease SBT3.5 i...    101   9e-22   
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...    101   9e-22   
ref|XP_010649319.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    101   1e-21   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             101   1e-21   
ref|XP_010649320.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    100   1e-21   
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...    100   1e-21   
ref|NP_001169390.1|  putative subtilase family protein precursor        101   1e-21   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...    100   1e-21   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             100   1e-21   
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             100   1e-21   
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    100   1e-21   
emb|CDX82843.1|  BnaC01g12930D                                          100   1e-21   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             100   1e-21   
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5         100   1e-21   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    100   1e-21   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             100   1e-21   
ref|NP_567632.1|  Subtilase family protein                              100   1e-21   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         100   2e-21   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         100   2e-21   
ref|NP_567633.2|  Subtilase family protein                              100   2e-21   
emb|CDY01388.1|  BnaA07g11610D                                          100   2e-21   
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    100   2e-21   
gb|KDP25528.1|  hypothetical protein JCGZ_20684                         100   2e-21   
gb|EEC72887.1|  hypothetical protein OsI_06697                          100   2e-21   
ref|XP_002867836.1|  subtilase family protein                           100   2e-21   
ref|NP_564412.1|  Subtilase 3.5                                         100   3e-21   
gb|EEE56708.1|  hypothetical protein OsJ_06199                        99.8    3e-21   
ref|XP_009420549.1|  PREDICTED: subtilisin-like protease SBT5.3       99.8    3e-21   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5       99.8    3e-21   
dbj|BAJ94815.1|  predicted protein                                    99.8    3e-21   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease              99.8    3e-21   
emb|CBI38006.3|  unnamed protein product                              99.8    3e-21   
gb|KHN41792.1|  Subtilisin-like protease                              99.8    3e-21   
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3       99.8    3e-21   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3       99.8    3e-21   
emb|CDX79081.1|  BnaA01g11480D                                        99.8    3e-21   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like         99.8    3e-21   
ref|XP_010694663.1|  PREDICTED: CO(2)-response secreted protease-...  99.8    4e-21   
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...  99.4    4e-21   
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...  99.4    4e-21   
ref|XP_006286455.1|  hypothetical protein CARUB_v10000290mg           99.0    4e-21   
ref|XP_008344176.1|  PREDICTED: subtilisin-like protease isoform X2   99.4    4e-21   
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1   99.4    4e-21   
emb|CAN68992.1|  hypothetical protein VITISV_039721                   99.0    4e-21   
emb|CDM82985.1|  unnamed protein product                              99.4    4e-21   
ref|XP_002872522.1|  subtilase family protein                         99.4    4e-21   
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg           99.0    5e-21   
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease              99.4    5e-21   
gb|EEE69927.1|  hypothetical protein OsJ_29791                        97.4    6e-21   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg              99.0    6e-21   
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease              99.0    6e-21   
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4       99.0    6e-21   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4       99.0    6e-21   
ref|XP_003612438.1|  Subtilisin-like protease                         99.0    7e-21   
gb|KEH27645.1|  subtilisin-like serine protease                       98.6    7e-21   
emb|CDP01740.1|  unnamed protein product                              99.0    7e-21   
ref|XP_003572330.1|  PREDICTED: subtilisin-like protease SBT3.5       98.6    7e-21   
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg           98.6    7e-21   
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                  99.4    7e-21   
ref|XP_009400152.1|  PREDICTED: subtilisin-like protease SBT5.4       98.6    7e-21   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  98.6    7e-21   
emb|CDX98690.1|  BnaA03g44750D                                        98.6    7e-21   
ref|NP_193895.2|  Subtilase family protein                            98.6    8e-21   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg           98.6    8e-21   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  98.6    8e-21   
ref|XP_007046423.1|  Subtilisin-like serine endopeptidase family ...  97.4    9e-21   
ref|XP_007039330.1|  Subtilase family protein, putative               99.0    9e-21   
emb|CDY54842.1|  BnaC05g51310D                                        99.0    9e-21   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5       98.2    9e-21   
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like         98.2    1e-20   
gb|KHN38839.1|  Subtilisin-like protease                              98.2    1e-20   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  98.2    1e-20   
gb|EPS69827.1|  hypothetical protein M569_04935                       98.2    1e-20   
ref|NP_001172893.1|  Os02g0270933                                     98.6    1e-20   
gb|EYU31525.1|  hypothetical protein MIMGU_mgv1a001949mg              98.2    1e-20   
gb|KDP25659.1|  hypothetical protein JCGZ_20815                       98.2    1e-20   
emb|CDY67543.1|  BnaCnng55400D                                        98.6    1e-20   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg           98.2    1e-20   
ref|XP_010046680.1|  PREDICTED: subtilisin-like protease              98.2    1e-20   
ref|XP_002872521.1|  predicted protein                                98.2    1e-20   
emb|CAB36809.1|  subtilisin proteinase-like                           97.8    1e-20   
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg           97.8    1e-20   
gb|AAL24366.1|  subtilisin proteinase-like                            97.8    1e-20   
gb|EMT17675.1|  Subtilisin-like protease                              97.8    1e-20   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg           97.8    2e-20   
ref|XP_004165285.1|  PREDICTED: cucumisin-like                        97.8    2e-20   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940        97.8    2e-20   
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease              97.8    2e-20   
ref|XP_002874635.1|  subtilase family protein                         97.8    2e-20   
gb|KHN28302.1|  Subtilisin-like protease                              97.4    2e-20   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg           97.4    2e-20   
gb|EMS63596.1|  Cucumisin                                             97.4    2e-20   
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...  97.4    2e-20   
ref|XP_006857966.1|  hypothetical protein AMTR_s00069p00176100        97.4    2e-20   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                   97.4    2e-20   
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3       97.4    2e-20   
ref|XP_010928976.1|  PREDICTED: subtilisin-like protease SBT3.5       97.4    2e-20   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like         97.4    2e-20   
ref|XP_004153386.1|  PREDICTED: cucumisin-like                        95.1    2e-20   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        97.4    2e-20   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              97.4    2e-20   
ref|NP_001145938.1|  uncharacterized protein LOC100279461 precursor   97.4    2e-20   
ref|XP_004231226.1|  PREDICTED: CO(2)-response secreted protease-...  97.1    2e-20   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5       97.1    3e-20   
ref|XP_008672702.1|  PREDICTED: uncharacterized protein LOC100279...  97.1    3e-20   
ref|XP_002317663.1|  subtilase family protein                         97.1    3e-20   
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g           97.1    3e-20   
gb|EMT19033.1|  Subtilisin-like protease                              97.1    3e-20   
ref|XP_010109770.1|  hypothetical protein L484_008446                 97.1    3e-20   
gb|EMS67122.1|  Subtilisin-like protease                              97.1    3e-20   
emb|CDM82077.1|  unnamed protein product                              97.1    3e-20   
emb|CDX94044.1|  BnaC07g36780D                                        97.1    3e-20   
ref|XP_002509690.1|  Cucumisin precursor, putative                    97.1    3e-20   
dbj|BAJ93156.1|  predicted protein                                    96.7    3e-20   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like         96.7    3e-20   
ref|XP_010919430.1|  PREDICTED: cucumisin-like                        96.7    3e-20   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg           96.7    3e-20   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease              96.7    3e-20   
ref|XP_006645770.1|  PREDICTED: subtilisin-like protease-like         96.3    3e-20   
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  96.7    4e-20   
gb|KHN09069.1|  Cucumisin                                             92.0    4e-20   
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  96.7    4e-20   
ref|XP_004300747.1|  PREDICTED: cucumisin-like                        96.7    4e-20   
gb|EMT13355.1|  Subtilisin-like protease                              96.7    4e-20   
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  96.7    4e-20   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3       96.3    4e-20   
ref|XP_006347851.1|  PREDICTED: subtilisin-like protease-like         96.7    4e-20   
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  96.7    4e-20   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  96.7    4e-20   
ref|XP_009764145.1|  PREDICTED: cucumisin-like                        93.2    4e-20   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  96.7    4e-20   
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3       97.1    4e-20   
ref|XP_011032225.1|  PREDICTED: cucumisin-like                        96.3    4e-20   
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  96.7    4e-20   
ref|XP_011006897.1|  PREDICTED: subtilisin-like protease SBT5.3       94.0    5e-20   
gb|EMS53237.1|  Subtilisin-like protease                              96.3    5e-20   
ref|XP_008667736.1|  PREDICTED: uncharacterized protein LOC100278...  96.3    5e-20   
dbj|BAD35681.1|  putative subtilisin-like serine proteinase           95.9    5e-20   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 96.3    5e-20   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              96.3    5e-20   
ref|XP_002457657.1|  hypothetical protein SORBIDRAFT_03g011300        96.3    5e-20   
ref|XP_002985983.1|  hypothetical protein SELMODRAFT_234928           96.3    5e-20   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              96.3    5e-20   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         96.3    6e-20   
ref|XP_008804320.1|  PREDICTED: subtilisin-like protease SBT5.3       96.3    6e-20   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           95.9    6e-20   
ref|XP_008667735.1|  PREDICTED: uncharacterized protein LOC100278...  95.9    6e-20   
ref|XP_008667730.1|  PREDICTED: uncharacterized protein LOC100278...  95.9    6e-20   
gb|EEE66042.1|  hypothetical protein OsJ_22024                        95.5    6e-20   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760        95.9    6e-20   
ref|XP_002992980.1|  hypothetical protein SELMODRAFT_187138           95.9    6e-20   
emb|CDM80022.1|  unnamed protein product                              95.9    6e-20   
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5       95.9    6e-20   
ref|XP_002887016.1|  subtilase family protein                         95.9    7e-20   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g           95.9    7e-20   
ref|XP_010436456.1|  PREDICTED: subtilisin-like protease SBT3.5       95.1    7e-20   
ref|NP_567359.1|  Subtilase family protein                            95.9    7e-20   
gb|EAZ01729.1|  hypothetical protein OsI_23755                        95.9    7e-20   
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3       95.9    7e-20   
ref|XP_002962719.1|  hypothetical protein SELMODRAFT_61337            95.5    8e-20   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                       95.9    8e-20   
dbj|BAJ90143.1|  predicted protein                                    95.5    8e-20   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g           95.5    8e-20   
ref|XP_002874634.1|  subtilase family protein                         95.5    8e-20   
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                  95.5    9e-20   
gb|EMT05074.1|  Subtilisin-like protease                              95.9    9e-20   
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3       95.5    9e-20   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              95.5    9e-20   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like         95.5    9e-20   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574           95.5    9e-20   
ref|NP_001174909.1|  Os06g0624100                                     95.9    9e-20   
ref|XP_010087293.1|  Subtilisin-like protease                         95.5    9e-20   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  95.5    1e-19   
gb|EMS50759.1|  Subtilisin-like protease                              95.5    1e-19   
gb|EMT05336.1|  Subtilisin-like protease                              95.5    1e-19   
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...  95.5    1e-19   
gb|EMS63058.1|  Subtilisin-like protease                              95.5    1e-19   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3       95.5    1e-19   
ref|XP_002314147.1|  subtilase family protein                         95.1    1e-19   
gb|EMT29371.1|  Cucumisin                                             92.4    1e-19   
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                   95.9    1e-19   
ref|NP_564869.1|  Subtilase-like protein                              95.1    1e-19   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668            95.1    1e-19   
ref|NP_567360.1|  Subtilase family protein                            95.1    1e-19   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3       95.1    1e-19   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3       95.1    1e-19   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4       95.1    1e-19   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative    94.7    2e-19   
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3       94.7    2e-19   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g           94.7    2e-19   
ref|XP_002981073.1|  hypothetical protein SELMODRAFT_113931           94.7    2e-19   
dbj|BAJ87780.1|  predicted protein                                    94.7    2e-19   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  94.7    2e-19   
gb|AAD03430.1|  similar to the subtilase family of serine proteas...  94.7    2e-19   
emb|CDM84531.1|  unnamed protein product                              94.7    2e-19   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3       94.7    2e-19   
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg           94.7    2e-19   
gb|KHN39834.1|  Cucumisin                                             94.7    2e-19   
emb|CAB36808.1|  subtilisin-like protease                             94.7    2e-19   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3       94.7    2e-19   
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3       93.6    2e-19   
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg           94.7    2e-19   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                        94.7    2e-19   
emb|CDX98693.1|  BnaA03g44780D                                        94.4    2e-19   
gb|EEE60418.1|  hypothetical protein OsJ_13612                        94.4    2e-19   
ref|NP_001152427.1|  LOC100286067 precursor                           94.4    2e-19   
tpg|DAA62442.1|  TPA: putative subtilase family protein               93.6    2e-19   
gb|ACN28204.1|  unknown                                               94.4    2e-19   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like         94.4    2e-19   
ref|NP_567361.1|  Subtilase family protein                            94.4    2e-19   
gb|EYU28147.1|  hypothetical protein MIMGU_mgv1a018442mg              94.4    2e-19   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3       94.4    2e-19   
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3       94.4    2e-19   
ref|XP_002990396.1|  hypothetical protein SELMODRAFT_131663           94.0    2e-19   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g           94.4    2e-19   
gb|KDO66671.1|  hypothetical protein CISIN_1g0384741mg                90.5    2e-19   
ref|XP_010105479.1|  Subtilisin-like protease                         94.4    2e-19   



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 111/140 (79%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQAQL++SLI+R +NA+V+SY NGFSGF+ARL+  EA+S+AQ+PGVVSVFPDP+LQLH
Sbjct  48   RHDQAQLISSLIRRNKNAVVHSYKNGFSGFAARLSEAEAKSMAQRPGVVSVFPDPVLQLH  107

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT SWDFL   +D+KI+++     +S   SS  GAD IIGI+DTGIWPES SF+D  MGP
Sbjct  108  TTHSWDFLKYQTDEKINSS----PSSGSDSSLIGADTIIGILDTGIWPESESFNDKDMGP  163

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IPARW G C  G DF SSNC
Sbjct  164  IPARWNGTCMDGQDFGSSNC  183



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 105/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQL++SL+KR +NALV SY NGFSGF+ARL+AEEA SIAQ+ GVVSVFPDP+L+L
Sbjct  46   LRHDHAQLLSSLLKRNKNALVRSYKNGFSGFAARLSAEEAHSIAQRAGVVSVFPDPVLEL  105

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL    + + S  I         S+S  +  IIGI+DTGIWPES SF+D  MG
Sbjct  106  HTTRSWDFL----NYQTSVVIDSNPNPNSNSTSNDSGAIIGILDTGIWPESESFNDKAMG  161

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP+RW G C K  DFN+SNC
Sbjct  162  PIPSRWNGTCAKAQDFNTSNC  182



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 110/140 (79%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQAQL++SLI+R +NA+V+SY NGFSGF+ARL+  EA+S+AQ+PGV+SVFPDP+LQLH
Sbjct  48   RHDQAQLISSLIRRNKNAVVHSYNNGFSGFAARLSEAEAKSMAQRPGVISVFPDPVLQLH  107

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT SWDFL   +D+KI+++     +S   SS  GAD IIGI+DTGIWPES SF+D  MGP
Sbjct  108  TTHSWDFLKYQTDEKINSS----PSSGSDSSLIGADTIIGILDTGIWPESESFNDKDMGP  163

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IPARW G C  G DF SS C
Sbjct  164  IPARWNGTCMDGQDFGSSKC  183



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 5/141 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQL+ ++++R   ALV +Y +GFSGF+ARL+ EEA SIAQKPGVVSVFPDP+L+L
Sbjct  52   LRNDHAQLLNAVLRRNDKALVRNYKHGFSGFAARLSKEEANSIAQKPGVVSVFPDPVLKL  111

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +  KI A  +        +SS  +D+++GI+DTGIWPE+ASF DDGMG
Sbjct  112  HTTRSWDFLKYQTHVKIDANPK-----TLSNSSSSSDVVLGILDTGIWPEAASFSDDGMG  166

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C K  DFNSSNC
Sbjct  167  PVPSRWKGTCMKSHDFNSSNC  187



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQ QLV+SLIKR +N +V+SY NGFSGF+ARL+  EA+SIAQ+PGVVSVFPDP+LQLH
Sbjct  50   RNDQMQLVSSLIKRNKNTVVHSYKNGFSGFAARLSEAEAQSIAQRPGVVSVFPDPVLQLH  109

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  + +++     +S   SS  GAD IIGI+DTGIWPES SF+D GMGP
Sbjct  110  TTRSWDFLKYQTVDETNSS----PSSGSDSSPNGADTIIGILDTGIWPESKSFNDKGMGP  165

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IPARWKG C  G DF +S C
Sbjct  166  IPARWKGTCMDGHDFGASKC  185



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQ QLV+SLIKR +N +V+SY NGFSGF+ARL+  EA+SIAQ+PGVVSVFPDP+LQLH
Sbjct  50   RNDQMQLVSSLIKRNKNTVVHSYKNGFSGFAARLSEAEAQSIAQRPGVVSVFPDPVLQLH  109

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  + +++     +S   SS  GAD IIGI+DTGIWPES SF+D GMGP
Sbjct  110  TTRSWDFLKYQTVDETNSS----PSSGSDSSPNGADTIIGILDTGIWPESKSFNDKGMGP  165

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IPARWKG C  G DF +S C
Sbjct  166  IPARWKGTCMDGHDFGASKC  185



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D A L+ S+++RK NA+V++Y +GFSGF+ARL+ EEARSIA KPGVVSVFPDP+L+L
Sbjct  15   LRNDHALLLKSVLRRKANAVVHTYRHGFSGFAARLSEEEARSIAHKPGVVSVFPDPLLKL  74

Query  243  HTTQSWDFLDSFSDKKISA---AIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            HTTQSW+FL   +  +I +   +I   +      S+ G+D IIGI+DTGIWPES SF+D 
Sbjct  75   HTTQSWEFLKYQTALEIYSNPNSISGAANGFSSVSANGSDTIIGILDTGIWPESESFNDK  134

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
             MGPIP+RWKG C K DDF+SSNC
Sbjct  135  DMGPIPSRWKGTCMKSDDFSSSNC  158



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D A L+ S+++RK NA+V++Y +GFSGF+ARL+ EEARSIA KPGVVSVFPDP+L+L
Sbjct  53   LRNDHALLLKSVLRRKANAVVHTYRHGFSGFAARLSEEEARSIAHKPGVVSVFPDPLLKL  112

Query  243  HTTQSWDFLDSFSDKKISA---AIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            HTTQSW+FL   +  +I +   +I   +      S+ G+D IIGI+DTGIWPES SF+D 
Sbjct  113  HTTQSWEFLKYQTALEIYSNPNSISGAANGFSSVSANGSDTIIGILDTGIWPESESFNDK  172

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
             MGPIP+RWKG C K DDF+SSNC
Sbjct  173  DMGPIPSRWKGTCMKSDDFSSSNC  196



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQL++S++ RK NA+V++Y +GFSGF+ARLT EEARSIA KPGVVSVF DPIL+L
Sbjct  68   LRDDHAQLLSSVVTRKPNAVVHTYKHGFSGFAARLTDEEARSIASKPGVVSVFLDPILKL  127

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimd----tgIWPESASFHD  76
            HTT SWDFL   +  KI + +   +  A    S         +     TGIWPES SF+D
Sbjct  128  HTTHSWDFLKYQTALKIDSNLNSNNYDAADGVSLVTADGSDTIIGILDTGIWPESESFND  187

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
              MGPIP+RWKG C K DDF+SSNC
Sbjct  188  XDMGPIPSRWKGTCMKSDDFSSSNC  212



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQAQL++SLIKR +NA+++ Y NGFSGF+ARL+  EA+SIAQ+PGVVSVFPDP+LQLH
Sbjct  49   RNDQAQLISSLIKRNKNAVIHRYENGFSGFAARLSESEAQSIAQRPGVVSVFPDPVLQLH  108

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  + +++     +S   SS   AD IIGI+DTGIWPESASF+D GM  
Sbjct  109  TTRSWDFLKYQTGDETNSS----PSSRSDSSPNVADTIIGILDTGIWPESASFNDKGMSS  164

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +PARWKG C +G DF +S C
Sbjct  165  VPARWKGICMEGHDFGASKC  184



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQAQL++SLIKR +NA+++ Y NGFSGF+ARL+  EA+SIAQ+PGVVSVFPDP+LQLH
Sbjct  49   RNDQAQLISSLIKRNKNAVIHRYENGFSGFAARLSESEAQSIAQRPGVVSVFPDPVLQLH  108

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  + +++     +S   SS   AD IIGI+DTGIWPESASF+D GM  
Sbjct  109  TTRSWDFLKYQTGDETNSS----PSSRSDSSPNVADTIIGILDTGIWPESASFNDKGMSS  164

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +PARWKG C +G DF +S C
Sbjct  165  VPARWKGICMEGHDFGASKC  184



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 106/141 (75%), Gaps = 5/141 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQ++  +++R  NALV +Y +GFSGF+ARL+ EEA SIA KPGVVSVFPDPIL L
Sbjct  51   LRNDHAQVLNLVLRRNENALVRNYKHGFSGFAARLSKEEAASIAHKPGVVSVFPDPILNL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SW+FL   +  KI         +A  +SS  +DII+G++DTGIWPE+ASF D+GMG
Sbjct  111  HTTRSWEFLKYQTHVKIDT-----KPNAVSNSSSSSDIILGVLDTGIWPEAASFSDEGMG  165

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C K  DFNSSNC
Sbjct  166  PVPSRWKGTCMKSQDFNSSNC  186



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 103/140 (74%), Gaps = 9/140 (6%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQ++ S+++R  NALV +Y +GFSGF+ARL+ +EA SIAQKPGVVSVFPDP+L+LH
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPDPVLKLH  115

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  KI           +P++   +  +IGI+DTGIWPE+ASF D GMGP
Sbjct  116  TTRSWDFLKYQTQVKIDT---------KPNAVSKSSSVIGILDTGIWPEAASFSDKGMGP  166

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RWKG C K  DF SSNC
Sbjct  167  VPSRWKGTCMKSQDFYSSNC  186



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 106/141 (75%), Gaps = 5/141 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D  Q++ S++KR  NA+V +Y +GFSGF+ARL+ EEA SI+QKPGVVSVFPDPIL+L
Sbjct  51   LRNDHVQILNSVLKRNENAIVRNYKHGFSGFAARLSKEEANSISQKPGVVSVFPDPILKL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL S +   I         + + SSS  +D+I+GI+DTGIWPE+ASF D+G G
Sbjct  111  HTTRSWDFLKSQTRVNIDT-----KPNTESSSSSSSDVILGILDTGIWPEAASFSDEGFG  165

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C    DFNSSNC
Sbjct  166  PVPSRWKGTCMTSKDFNSSNC  186



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D  QL++SL+KR +N++V +Y  GFSGF+ARL+ EEA+SIAQ+PGVVSVFPDP+LQLH
Sbjct  12   RTDHTQLLSSLMKRNKNSVVQNYNKGFSGFAARLSEEEAKSIAQRPGVVSVFPDPVLQLH  71

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  KI +       S   SSS GAD IIGI+DTGIWPE+ SF DD M P
Sbjct  72   TTRSWDFLKYQTAVKIDST----PTSPFDSSSAGADTIIGILDTGIWPEAESFIDDDMNP  127

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+ WKGKC +G +F SSNC
Sbjct  128  IPSHWKGKCMEGQNFTSSNC  147



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D  QL+ S++KRK++ +VYSY NGFSGF+ARL+ EEARSIAQ+PGVVSVFPDP+LQLH
Sbjct  47   RNDHDQLLNSMLKRKKD-VVYSYNNGFSGFAARLSEEEARSIAQRPGVVSVFPDPLLQLH  105

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D +I+        S   SSS G D IIGIMDTGIWPES SF+D  +GP
Sbjct  106  TTRSWDFLKYQTDVEIN----LRPTSGSNSSSNGEDTIIGIMDTGIWPESKSFNDKDIGP  161

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP +WKG C +G  F SSNC
Sbjct  162  IPPKWKGSCMQGSGFTSSNC  181



>gb|EPS70387.1| hypothetical protein M569_04373 [Genlisea aurea]
Length=185

 Score =   138 bits (347),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R +   L++S++KRKRNA++++Y+NGFSGF+ARL+ EE  SIAQ P V+SVF DPIL LH
Sbjct  53   RNEHGPLLSSVMKRKRNAVLHTYSNGFSGFAARLSKEEVNSIAQMPEVLSVFKDPILNLH  112

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SW+FL      KI +A           S  GAD+I+GI+DTGIWPES SF D+GM P
Sbjct  113  TTRSWEFLRYQDALKIDSATE---------SYTGADVILGILDTGIWPESESFSDEGMSP  163

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RWKG C +G +F SSNC
Sbjct  164  VPSRWKGTCMEGRNFTSSNC  183



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQ++ S+++R  NALV +Y +GFSGF+ARL+ +EA SIAQKPGVVSVFP P+L+LH
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPGPVLKLH  115

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  KI           +P++   +  +IGI+DTGIWPE+ASF D GMGP
Sbjct  116  TTRSWDFLKYQTQVKIDT---------KPNAVSKSSSVIGILDTGIWPEAASFSDKGMGP  166

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RWKG C K  DF SSNC
Sbjct  167  VPSRWKGTCMKSQDFYSSNC  186



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQ++ S+++R  NALV +Y +GFSGF+ARL+ +EA SIAQKPGVVSVFP P+L+LH
Sbjct  56   RNDHAQVLNSVLRRNENALVRNYKHGFSGFAARLSKKEATSIAQKPGVVSVFPGPVLKLH  115

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +  KI           +P++   +  +IGI+DTGIWPE+ASF D GMGP
Sbjct  116  TTRSWDFLKYQTQVKIDT---------KPNAVSKSSSVIGILDTGIWPEAASFSDKGMGP  166

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RWKG C K  DF SSNC
Sbjct  167  VPSRWKGTCMKSQDFYSSNC  186



>gb|KDP36888.1| hypothetical protein JCGZ_08179 [Jatropha curcas]
Length=705

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 105/141 (74%), Gaps = 10/141 (7%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +  D  QL++S++ RK+N+LV SY NGFSGF+ARL+  E +SIA++PGVVSVFPDP+LQL
Sbjct  8    VENDYVQLLSSILTRKKNSLVRSYRNGFSGFAARLSEAEVQSIAKRPGVVSVFPDPVLQL  67

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D +I ++          S S G+D I+GI+DTGIWPES SF+D  MG
Sbjct  68   HTTRSWDFLKYQTDIEIDSS----------SMSHGSDTIVGIIDTGIWPESESFNDKDMG  117

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP+ WKG C KG +F SSNC
Sbjct  118  PIPSHWKGTCVKGYNFKSSNC  138



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R DQ QL++SL  R++NA+V+SY N FSGF+A L+  EA+SIAQ+PGV+SVFPDP+ QL
Sbjct  47   VRDDQIQLMSSLTTRRKNAVVHSYRNSFSGFAALLSDAEAQSIAQQPGVISVFPDPVFQL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL    D   S      ++S   S+S G D IIGI DTGIWPES SF+D GMG
Sbjct  107  HTTRSWDFLTDQYDLVHS----FPNSSGPNSTSNGVDTIIGIFDTGIWPESESFNDKGMG  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C KG DFNSS+C
Sbjct  163  PVPSRWKGTCTKGYDFNSSSC  183



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 105/141 (74%), Gaps = 10/141 (7%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +  D  QL++S++ RK+N+LV SY NGFSGF+ARL+  E +SIA++PGVVSVFPDP+LQL
Sbjct  41   VENDYVQLLSSILTRKKNSLVRSYRNGFSGFAARLSEAEVQSIAKRPGVVSVFPDPVLQL  100

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D +I ++          S S G+D I+GI+DTGIWPES SF+D  MG
Sbjct  101  HTTRSWDFLKYQTDIEIDSS----------SMSHGSDTIVGIIDTGIWPESESFNDKDMG  150

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP+ WKG C KG +F SSNC
Sbjct  151  PIPSHWKGTCVKGYNFKSSNC  171



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 7/141 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R+D A ++ +++KR   ALV++Y +GFSGF+ARL+  EA SIAQ+PGVVSVFPDPIL+L
Sbjct  51   LREDHAHILNTVLKRNEKALVHNYKHGFSGFAARLSKSEANSIAQQPGVVSVFPDPILKL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL+  +  K+             SS   +DI+IG++DTGIWPE+ASF D GMG
Sbjct  111  HTTRSWDFLEMQTYAKLENMFS-------KSSPSSSDIVIGMLDTGIWPEAASFSDKGMG  163

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP  WKG C    DFNSSNC
Sbjct  164  PIPPSWKGICMTSKDFNSSNC  184



>ref|NP_001238252.1| subtilisin-type protease precursor [Glycine max]
 gb|AAG38994.1|AF160513_1 subtilisin-type protease precursor [Glycine max]
 emb|CAB87246.1| putative pre-pro-subtilisin [Glycine max]
 emb|CAB87247.1| putative subtilisin precursor [Glycine max]
Length=770

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            ++ + AQ++ S+++R  NALV +Y +GFSGF+ARL+ EEA SIAQKPGVVSVFPDPIL+L
Sbjct  56   LKNEHAQILNSVLRRNENALVRNYKHGFSGFAARLSKEEANSIAQKPGVVSVFPDPILKL  115

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL S    +    I     +   SS   +D+I+G++DTGIWPE+ASF D G G
Sbjct  116  HTTRSWDFLKS----QTRVNIDTKPNTLSGSSFSSSDVILGVLDTGIWPEAASFSDKGFG  171

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C    DFNSS C
Sbjct  172  PVPSRWKGTCMTSKDFNSSCC  192



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 7/141 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R+D A ++ +++KR   ALV++Y +GFSGF+ARL+  EA SIAQ+PGVVSVFPDPIL+L
Sbjct  51   LREDHAHILNTVLKRNEKALVHNYKHGFSGFAARLSKSEANSIAQQPGVVSVFPDPILKL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL+  +  K+             SS   +DI+IG++DTGIWPE+ASF D GMG
Sbjct  111  HTTRSWDFLEMQTYAKLENMFS-------KSSPSSSDIVIGMLDTGIWPEAASFSDKGMG  163

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP  WKG C    DFNSSNC
Sbjct  164  PIPPSWKGICMTSKDFNSSNC  184



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQ+++SL+KRK NALV+SY +GFSGF+A LT EEARSIAQKPGVVSVF DP+LQLH
Sbjct  22   RYDHAQILSSLLKRKANALVHSYRHGFSGFAAHLTEEEARSIAQKPGVVSVFEDPVLQLH  81

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D +  +      +     SSG AD IIGI+DTGIWPES SF D  MGP
Sbjct  82   TTRSWDFLHYQTDLETDS---KPGSDGDSQSSGQADTIIGILDTGIWPESESFSDKTMGP  138

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RW+G C + +D +S  C
Sbjct  139  VPSRWRGTCMESNDVDSFKC  158



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            + + AQL++S++KR++NALV+SY +G SGF+ARL+A EA+SIA+ PGVVSVFPDP+ QLH
Sbjct  47   KNEHAQLLSSVLKRRKNALVHSYEHGISGFTARLSAAEAQSIAKNPGVVSVFPDPVYQLH  106

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D KI  +      S    SS G D+IIGI+DTGIWPES SF D  M P
Sbjct  107  TTRSWDFLKYGTDVKIDLS----PNSDSNLSSRGYDVIIGILDTGIWPESKSFSDKDMDP  162

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+ WKG C +  DFNSSNC
Sbjct  163  IPSSWKGTCVEARDFNSSNC  182



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 101/141 (72%), Gaps = 7/141 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D A L+  +++R   ALV +Y +GFSGF+A L+ EEA SIAQ+PGVVSVFPDPIL L
Sbjct  57   LRNDHAHLLNRVLRRNEKALVRNYKHGFSGFAAHLSKEEANSIAQQPGVVSVFPDPILNL  116

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFLD  +  KI+         +  SSS  ++++IGI+DTGIWPE+ASF D GM 
Sbjct  117  HTTRSWDFLDLQTHVKINT-------HSDSSSSSSSNVVIGILDTGIWPEAASFSDKGMD  169

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIPA WKG C    DFNSSNC
Sbjct  170  PIPASWKGSCMNSKDFNSSNC  190



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQ+++SL+KRK NALV+SY +GFSGF+A LT EEARSIAQKPGVVSVF DP+LQLH
Sbjct  47   RYDHAQILSSLLKRKANALVHSYRHGFSGFAAHLTEEEARSIAQKPGVVSVFEDPVLQLH  106

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D +  +      +     SSG AD IIGI+DTGIWPES SF D  MGP
Sbjct  107  TTRSWDFLHYQTDLETDS---KPGSDGDSQSSGQADTIIGILDTGIWPESESFSDKTMGP  163

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RW+G C + +D +S  C
Sbjct  164  VPSRWRGTCMESNDVDSFKC  183



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            + + AQL++S++KR++NALV+SY +G SGF+ARL+A EA+SIA+ PGVVSVFPDP+ QLH
Sbjct  47   KNEHAQLLSSVLKRRKNALVHSYEHGISGFTARLSAAEAQSIAKNPGVVSVFPDPVYQLH  106

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D KI  +      S    SS G D+IIGI+DTGIWPES SF D  M P
Sbjct  107  TTRSWDFLKYGTDVKIDLS----PNSDSNLSSRGYDVIIGILDTGIWPESKSFSDKDMDP  162

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+ WKG C +  DFNSSNC
Sbjct  163  IPSSWKGTCVEARDFNSSNC  182



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 6/147 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D A+L+T L +RK NALV+ Y +GFSGF+ARL+ EEA  +AQKPGVVSVFPD +L+L
Sbjct  51   LRTDHARLLTLLTRRKGNALVHVYRHGFSGFAARLSEEEALLMAQKPGVVSVFPDHLLKL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpss------sggadiiigimdtgIWPESASF  82
            HTT SWDFL   ++ +I++     S +   +       S G+D IIGI+DTGIWPES SF
Sbjct  111  HTTHSWDFLKYQTELEINSFPNSISENNDAAGDDTPPDSKGSDTIIGIIDTGIWPESESF  170

Query  81   HDDGMGPIPARWKGKCEKGDDFNSSNC  1
            +D GMGPIP+RWKG C KG DF SS+C
Sbjct  171  NDKGMGPIPSRWKGTCMKGPDFTSSSC  197



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            ++ +QA L++SLI+RK++A+V+SY NGFSGF+ARL+  EA SIAQKPGV+SVFPDPIL L
Sbjct  47   IKNNQADLMSSLIRRKKDAIVHSYKNGFSGFAARLSEAEANSIAQKPGVISVFPDPILNL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D +IS+           SS  GAD IIGI+DTGIWPES SF D  M 
Sbjct  107  HTTRSWDFLQYQTDVEISSG----PIYGSGSSPNGADTIIGILDTGIWPESESFSDSDMS  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             +P+RW+G C +  DF+SS C
Sbjct  163  AVPSRWRGTCMESHDFSSSKC  183



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            ++ D AQL++SL+KRK NALV++Y +GFSGF+A L+AEEA SIA++PGVVSVFPD +L+L
Sbjct  11   LKDDHAQLLSSLLKRKTNALVHNYKHGFSGFAAVLSAEEAHSIAERPGVVSVFPDSVLEL  70

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +   I +     ++ +  +S   +  IIG++DTGIWPES SF+D  MG
Sbjct  71   HTTRSWDFLKYQTSVVIDS---NPNSDSNSTSDPDSGAIIGVLDTGIWPESESFNDKDMG  127

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP  W G C +  DFN+SNC
Sbjct  128  PIPPGWHGTCAQAQDFNTSNC  148



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            ++ D AQL++SL+KRK NALV++Y +GFSGF+A L+AEEA SIA++PGVVSVFPD +L+L
Sbjct  11   LKDDHAQLLSSLLKRKTNALVHNYKHGFSGFAAVLSAEEAHSIAERPGVVSVFPDSVLEL  70

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +   I +     ++ +  +S   +  IIG++DTGIWPES SF+D  MG
Sbjct  71   HTTRSWDFLKYQTSVVIDS---NPNSDSNSTSDPDSGAIIGVLDTGIWPESESFNDKDMG  127

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP  W G C +  DFN+SNC
Sbjct  128  PIPPGWHGTCAQAQDFNTSNC  148



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQ++ S++KR + ALV +Y +GFSGF+ARL+ EEA SIAQKPGVVSVFPDPIL+L
Sbjct  56   LRNDHAQILNSVLKRDKKALVRNYKHGFSGFAARLSKEEADSIAQKPGVVSVFPDPILKL  115

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SW FL+  +  ++         +   + S  +DII+GI+DTGIW E+ SF+D GMG
Sbjct  116  HTTRSWYFLEQQTRVEVDT-----KPNTLSNFSSSSDIILGIIDTGIWQENESFNDKGMG  170

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP+ WKGKC    DFNSSNC
Sbjct  171  PIPSSWKGKCMTSKDFNSSNC  191



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 107/141 (76%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            ++ +QA+L++SLI+RK++A+V+SY NGFSGF+A L+  EA SIAQKPGV+SVFPDPIL L
Sbjct  47   IKNNQAELMSSLIRRKKDAIVHSYKNGFSGFAAHLSEAEANSIAQKPGVISVFPDPILNL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D +IS+       S   SS  GAD IIGI+DTGIWPES SF D+ M 
Sbjct  107  HTTRSWDFLQYQTDVEISSG----PLSGSDSSPKGADTIIGILDTGIWPESESFSDNDMS  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             +P++WKG C +  DF+SS C
Sbjct  163  AVPSQWKGTCMESHDFSSSKC  183



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 7/141 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R DQ QL+T+   R++NA+V+SY N FSGF+ARL+  EA+SIAQ+PGV+SVFPDP+ QL
Sbjct  47   VRDDQIQLMTT---RRKNAVVHSYRNSFSGFAARLSDAEAQSIAQQPGVISVFPDPVFQL  103

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SW+FL    D   S       +S   S+S GAD IIGI DTGIWPES SF+D GMG
Sbjct  104  HTTRSWEFLTDQYDLVHS----FPYSSGSNSTSKGADTIIGIFDTGIWPESESFNDKGMG  159

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            P+P+RWKG C KG DFNSS+C
Sbjct  160  PVPSRWKGTCTKGYDFNSSSC  180



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R DQ QL++SL  R++NA+V+SY N FSGF+ARL+  EA+SIA++PGVVSVF +P+ QLH
Sbjct  54   RDDQIQLMSSLTTRRKNAVVHSYKNSFSGFAARLSDAEAQSIAEQPGVVSVFLNPVFQLH  113

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL    D           +S   S+S  AD IIGI DTGIWPES  F+D GMGP
Sbjct  114  TTRSWDFLRDQYD----LVHDFSYSSGSNSTSNEADTIIGIFDTGIWPESERFNDKGMGP  169

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P+RWKG C KG DFNSS+C
Sbjct  170  VPSRWKGTCTKGYDFNSSSC  189



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LV++Y +GFSGF+ARLTAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  16   LINTMFKRRANDLVHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  75

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  76   FL------KYQTSVKIDSGPPSSASDGSYDSIVGILDTGIWPESESFNDKDMGPIPSRWK  129

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF SSNC
Sbjct  130  GTCMEAKDFKSSNC  143



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQL+ S++K K+N+++ SY +GFSGF+ARL+AEEA ++++KPGVVS+FPDP+LQL
Sbjct  47   LRDDHAQLLASMLKWKKNSIIRSYKHGFSGFAARLSAEEAHALSKKPGVVSIFPDPVLQL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D  I +      + +  S    +D IIGI+DTG+WPES SF+D  MG
Sbjct  107  HTTRSWDFLKIQTDVLIDSV----PSPSLNSQDQESDTIIGILDTGVWPESESFNDKDMG  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP RWKG C  G+D  S +C
Sbjct  163  PIPTRWKGTCNAGNDNVSFSC  183



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D AQL+ S++K K+N+++ SY +GFSGF+ARL+AEEA ++++KPGVVS+FPDP+LQL
Sbjct  47   LRDDHAQLLASMLKWKKNSIIRSYKHGFSGFAARLSAEEAHALSKKPGVVSIFPDPVLQL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL   +D  I +      + +  S    +D IIGI+DTG+WPES SF+D  MG
Sbjct  107  HTTRSWDFLKIQTDVLIDSV----PSPSLNSQDQESDTIIGILDTGVWPESESFNDKDMG  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP RWKG C  G+D  S +C
Sbjct  163  PIPTRWKGTCNAGNDNVSFSC  183



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 11/141 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQL+ SL+ RK+NA++++Y++GF GF+ARL+ +EA+ IA++PGVVSVFPDP+LQLH
Sbjct  47   RNDHAQLLRSLMNRKKNAVLHTYSHGFLGFAARLSDKEAKLIAKRPGVVSVFPDPVLQLH  106

Query  240  TTQSWDFLDSF-SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            TT SWDFL    S  K+             SSS G D IIG +DTGIWPES SF+D+G+G
Sbjct  107  TTHSWDFLKYLDSTPKVPT----------DSSSSGEDTIIGFLDTGIWPESESFNDEGIG  156

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP+RWKG C +G++F SS+C
Sbjct  157  AIPSRWKGTCMEGENFTSSSC  177



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 11/141 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D AQL+ SL+ RK+NA++++Y++GF GF+ARL+ +EA+ IA++PGVVSVFPDP+LQLH
Sbjct  47   RNDHAQLLRSLMNRKKNAVLHTYSHGFLGFAARLSDKEAKLIAKRPGVVSVFPDPVLQLH  106

Query  240  TTQSWDFLDSF-SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            TT SWDFL    S  K+             SSS G D IIG +DTGIWPES SF+D+G+G
Sbjct  107  TTHSWDFLKYLDSTPKVPT----------DSSSSGEDTIIGFLDTGIWPESESFNDEGIG  156

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP+RWKG C +G++F SS+C
Sbjct  157  AIPSRWKGTCMEGENFTSSSC  177



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N L+++Y +GFSGF+ARLTAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  16   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  75

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  76   FL------KYQTSVKVDSGPPSSASDGSYDSIVGILDTGIWPESESFNDKDMGPIPSRWK  129

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF SSNC
Sbjct  130  GTCMEAKDFKSSNC  143



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = -1

Query  414  DQAQ-LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
            ++AQ L+ ++ KR+ NA+++ Y +GFSGF+ARLTAEEA ++A+K GVVSVFPDP  QLHT
Sbjct  41   NKAQILINTMFKRRENAVLHVYKHGFSGFAARLTAEEAETLAKKQGVVSVFPDPTFQLHT  100

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL      + +  I  G  S+  S S   D IIGI+DTGIWPESASF+D  MGPI
Sbjct  101  TRSWDFL----KYQTAVKIDSGPRSSSGSDSSSYDSIIGILDTGIWPESASFYDKEMGPI  156

Query  57   PARWKGKCEKGDDFNSSNC  1
            P+RWKG C +  DFNSSNC
Sbjct  157  PSRWKGTCVEAKDFNSSNC  175



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N L+++Y +GFSGF+ARLTAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  55   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  114

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  115  FL------KYQTSVKVDSGPPSSASDGSYDSIVGILDTGIWPESESFNDKDMGPIPSRWK  168

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF SSNC
Sbjct  169  GTCMEAKDFKSSNC  182



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 98/134 (73%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LV++Y +GF+GF+ARLTAEEA++IA+KPGV+SVFPDP  QLHTT SWD
Sbjct  56   LINTMFKRRANDLVHTYKHGFTGFAARLTAEEAKAIAKKPGVISVFPDPNFQLHTTHSWD  115

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  116  FL------KYQTSVKIDSGPPSTASDGSYDSIVGILDTGIWPESESFNDKDMGPIPSRWK  169

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF S+NC
Sbjct  170  GTCMEAKDFKSTNC  183



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N L+++Y +GFSGF+ARLTAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  55   LINTMFKRRANDLLHTYKHGFSGFAARLTAEEAKVIAKKPGVVSVFPDPHFQLHTTHSWD  114

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  115  FL------KYQTSVKVDSGPPSSASDGXYDSIVGILDTGIWPESESFNDKDMGPIPSRWK  168

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF SSNC
Sbjct  169  GTCMEAKDFKSSNC  182



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 103/141 (73%), Gaps = 7/141 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +RKD A +++++++R   ALV++Y  GFSGF+ARL+  E   +AQ+PGVVSVFPDPIL+L
Sbjct  51   LRKDHAYVLSTVLRRNEKALVHNYKYGFSGFAARLSKNEVNLVAQQPGVVSVFPDPILKL  110

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            +TT+SWDFLD  ++ + +  +         S+S  ++++IG++D+GIWPE+ASF D GMG
Sbjct  111  YTTRSWDFLDLQTNAETNNTL-------FNSTSSSSNVVIGMLDSGIWPEAASFSDKGMG  163

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP  WKG C    DFNSSNC
Sbjct  164  PIPPGWKGTCMASKDFNSSNC  184



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R D A L+  +++R   ALV +Y +GFSGF+A L+ EEA SIAQ+PGVVSVFPDPIL L
Sbjct  56   LRNDHAHLLNRVLRRNEKALVRNYKHGFSGFAAHLSKEEANSIAQQPGVVSVFPDPILNL  115

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFLD  +  KI       S S+  +SS  ++++IG++DTGIWPE+ SF D GM 
Sbjct  116  HTTRSWDFLDLQTHVKIDT----HSDSSSSASSSSSNVVIGLLDTGIWPEAVSFSDKGMD  171

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP+ WKG C K  DFNSSNC
Sbjct  172  SIPSSWKGSCMKSIDFNSSNC  192



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 103/145 (71%), Gaps = 18/145 (12%)
 Frame = -1

Query  414  DQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            D  QL++SL  R++NA+V+SY + FSGF+ARL+ +EA+SIAQ PGVVSVFPDP+ QLHTT
Sbjct  42   DHIQLMSSLTTRRKNAVVHSYKHSFSGFAARLSDDEAQSIAQHPGVVSVFPDPVFQLHTT  101

Query  234  QSWDF-------LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +SWDF       L +F D   S +           +S GAD IIGI DTGIWPES SF+D
Sbjct  102  RSWDFLRDQYNLLHNFPDSSHSNS-----------TSKGADTIIGIFDTGIWPESESFND  150

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             G+GP+P+RWKG C +G DF SS+C
Sbjct  151  KGIGPVPSRWKGTCTRGYDFKSSSC  175



>ref|XP_010229480.1| PREDICTED: CO(2)-response secreted protease-like, partial [Brachypodium 
distachyon]
Length=228

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 104/154 (68%), Gaps = 13/154 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK--RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +++   +LV S++K +  RN +V  Y +GFSGF+ARL+ EEA ++ +KPGVVSVFPDP+ 
Sbjct  48   LQETHLRLVGSVLKGQVARNVVVQQYNHGFSGFAARLSKEEAAALRRKPGVVSVFPDPVY  107

Query  249  QLHTTQSWDFLDSFSDKKISAAI-----------RpgsasaqpsssggadiiigimdtgI  103
            QLHTT+SWDFL       +   I           +P +AS+  S++   D IIG++D+GI
Sbjct  108  QLHTTRSWDFLQQQQQTDVVVKIGSSAKSRHSPNKPSAASSSSSATTAGDTIIGLLDSGI  167

Query  102  WPESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            WPES SF D G GP+PARWKG C  GDDFNSSNC
Sbjct  168  WPESPSFDDAGFGPVPARWKGTCMSGDDFNSSNC  201



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N +V++Y +GF+GF+ARL+AEEA+ IA+K GVVSVFPDP  QLHTT SWD
Sbjct  57   LINTMFKRRANDIVHTYKHGFTGFAARLSAEEAKVIAKKTGVVSVFPDPNYQLHTTHSWD  116

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   A++  S+      +G  D IIGI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  117  FL------KYQTAVKIDSSPPSSPEAGSYDSIIGILDTGIWPESESFNDKDMGPIPSRWK  170

Query  42   GKCEKGDDFNSSNC  1
            G C +  DFNSSNC
Sbjct  171  GTCMEAKDFNSSNC  184



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  DQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            D   L++SL  R++NA+V+SY N FSGF+ARL+ +EA+SIAQ PGVVSVFPDP+ QLHTT
Sbjct  42   DHIHLMSSLTTRRKNAVVHSYKNSFSGFAARLSDDEAQSIAQHPGVVSVFPDPVFQLHTT  101

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SW+FL      + +       +S   S+S GAD IIGI DTGIWPES SF+D G+GP+P
Sbjct  102  RSWEFL----RDQYNLVHNFPYSSHSNSTSNGADTIIGIFDTGIWPESESFNDKGIGPVP  157

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF SS+C
Sbjct  158  SRWKGTCTRGYDFKSSSC  175



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N +V++Y +GF+GF+ARL+AEEA+ IA+K GVVSVFPDP  QLHTT SWD
Sbjct  57   LINTMFKRRANDIVHTYKHGFTGFAARLSAEEAKVIAKKTGVVSVFPDPNYQLHTTHSWD  116

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   A++  S+      +G  D IIGI+DTGIWPES SF+D  MGPIP+RWK
Sbjct  117  FL------KYQTAVKIDSSPPSSPEAGSYDSIIGILDTGIWPESESFNDKDMGPIPSRWK  170

Query  42   GKCEKGDDFNSSNC  1
            G C +  DFNSSNC
Sbjct  171  GTCMEAKDFNSSNC  184



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N +V++Y +GF+GF+ARLTAEEA  IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  51   LINTMFKRRGNDIVHTYKHGFTGFAARLTAEEATVIAKKPGVVSVFPDPNYQLHTTHSWD  110

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      KI +        +  +S G  D IIGI+DTGIWPE+ SF+D  MGPIP+RWK
Sbjct  111  FLKYQEAVKIDSG-----PPSSAASGGSYDSIIGILDTGIWPEAESFNDKDMGPIPSRWK  165

Query  42   GKCEKGDDFNSSNC  1
            G C +  DFNSSNC
Sbjct  166  GTCMEAKDFNSSNC  179



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 5/140 (4%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D  +L+ S+   +RNA+V++Y +GF+GF+A L+  EA+++ Q PGVVSVFPDP+L+LH
Sbjct  50   RTDFLRLLNSV--NRRNAVVHTYKHGFTGFAAHLSEHEAQAMRQSPGVVSVFPDPLLKLH  107

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT SWDFL S +  KI A  +   +    SSS   D IIGI+DTGIWPES SF+D GMGP
Sbjct  108  TTHSWDFLVSQTSVKIDANPK---SDPPASSSQPYDTIIGILDTGIWPESESFNDMGMGP  164

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+RWKG C  GDDF SSNC
Sbjct  165  IPSRWKGTCMTGDDFTSSNC  184



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 5/140 (4%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            R D  +L+ S+   +RNA+V++Y +GF+GF+A L+  EA+++ Q PGVVSVFPDP+L+LH
Sbjct  55   RTDFLRLLNSV--NRRNAVVHTYKHGFTGFAAHLSEHEAQAMRQSPGVVSVFPDPLLKLH  112

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT SWDFL S +  KI A  +   +    SSS   D IIGI+DTGIWPES SF+D GMGP
Sbjct  113  TTHSWDFLVSQTSVKIDANPK---SDPPASSSQPYDTIIGILDTGIWPESESFNDMGMGP  169

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+RWKG C  GDDF SSNC
Sbjct  170  IPSRWKGTCMTGDDFTSSNC  189



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LV++Y +GF+GF+A +TAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  70   LINTMFKRRANDLVHTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  129

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGP+P+RWK
Sbjct  130  FL------KYQTSVKIDSGPPSTASDGSYDSIVGILDTGIWPESESFNDKDMGPVPSRWK  183

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF S+NC
Sbjct  184  GTCMEAKDFKSTNC  197



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LV++Y +GF+GF+A +TAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  70   LINTMFKRRANDLVHTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  129

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     +S G  D I+GI+DTGIWPES SF+D  MGP+P+RWK
Sbjct  130  FL------KYQTSVKIDSGPPSTASDGSYDSIVGILDTGIWPESESFNDKDMGPVPSRWK  183

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF S+NC
Sbjct  184  GTCMEAKDFKSTNC  197



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score =   133 bits (335),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 6/134 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LVY+Y +GF+GF+A +TAEEA+ IA+KPGVVSVFPDP  QLHTT SWD
Sbjct  55   LINTMFKRRANDLVYTYKHGFTGFAAHMTAEEAKVIAKKPGVVSVFPDPNFQLHTTHSWD  114

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      K   +++  S     ++ G  D I+GI+DTGIWPES SF+D  +GPIP+RWK
Sbjct  115  FL------KYQTSVKIDSGPPSTTADGSYDSIVGILDTGIWPESESFNDKDLGPIPSRWK  168

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF S+NC
Sbjct  169  GTCMEAKDFKSTNC  182



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            +  QA+L++SLIKRK++A+V+SY NGFSGF+ARL+  EA+SIAQKPGV+SVFPDPILQLH
Sbjct  48   KNQQAELMSSLIKRKKDAVVHSYNNGFSGFAARLSEAEAKSIAQKPGVISVFPDPILQLH  107

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   ++ + S+      + +  +S  G D IIGI+DTGIWPES SF D+ M  
Sbjct  108  TTRSWDFLQYQTEVESSSG---PISGSDNASPKGVDTIIGILDTGIWPESESFSDNDMSE  164

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P++WKG C    D  S  C
Sbjct  165  VPSKWKGTCMGSHDSISFKC  184



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 7/142 (5%)
 Frame = -1

Query  417  KDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQ  247
            +D  QL++S+++R    +  LVYSY NGFSGF+A LT EEA ++ QKPGVVSVF DP+LQ
Sbjct  55   EDHIQLLSSVLERTEAMQERLVYSYRNGFSGFAAHLTEEEAGAMVQKPGVVSVFEDPVLQ  114

Query  246  LHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGM  67
            LHTT+SWDFL   +D K  +      +S   + + G+D IIGI+DTGIWPES SF D  M
Sbjct  115  LHTTRSWDFLQYQTDLKRDS----NPSSDSDTLTQGSDTIIGILDTGIWPESESFKDTNM  170

Query  66   GPIPARWKGKCEKGDDFNSSNC  1
            GP+P+RWKG C +G DF++SNC
Sbjct  171  GPVPSRWKGVCMEGRDFSASNC  192



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -1

Query  411  QAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
             A ++ ++++R   ALV++Y +GFSGF+ARL+  EA SIAQ+PGVVSVFPDPIL+LHTT 
Sbjct  49   NAHVLNTVLRRNEKALVHNYKHGFSGFAARLSKNEAASIAQQPGVVSVFPDPILKLHTTH  108

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDFL   +  KI +       S   S S  +DI+IG++D+GIWPE+ SF D+GM PIP+
Sbjct  109  SWDFLKLQTHVKIDST-----LSNSSSQSSSSDIVIGMLDSGIWPEATSFSDNGMDPIPS  163

Query  51   RWKGKCEKGDDFNSSNC  1
             WKG C   +DFNSSNC
Sbjct  164  GWKGICMTSNDFNSSNC  180



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 5/141 (4%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +R + AQL++SL KRK   +V+SY+   SGF+ARL+ EEARSIAQKPGV+SVF DP+L L
Sbjct  47   LRYEHAQLLSSL-KRKGTTVVHSYSRSLSGFAARLSEEEARSIAQKPGVISVFKDPLLPL  105

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL      +I   I    +S    S+   D IIGIMDTGIWPES SF D  +G
Sbjct  106  HTTRSWDFL----KYQIDLEIDSSPSSDPDFSTQEYDTIIGIMDTGIWPESKSFDDKDLG  161

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP RWKGKC +G+DF+ SNC
Sbjct  162  VIPPRWKGKCMEGNDFHQSNC  182



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            L+ ++ KR+ N LV++Y +GF+GF+ARLTAEEA+ IA+K GVVSVFPDP  QLHTT SWD
Sbjct  57   LINTMFKRRGNDLVHTYKHGFTGFAARLTAEEAKLIAKKQGVVSVFPDPNYQLHTTHSWD  116

Query  222  FLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
            FL      + S  I  G  S+  +S G  D IIGI+DTGIWPES SF D  MGPIP+RWK
Sbjct  117  FL----KYQTSVKIDSGPPSSAAASDGSYDTIIGILDTGIWPESESFSDKDMGPIPSRWK  172

Query  42   GKCEKGDDFNSSNC  1
            G C +  DF SSNC
Sbjct  173  GTCMEAKDFKSSNC  186



>gb|EMT05539.1| Subtilisin-like protease [Aegilops tauschii]
Length=604

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R+   +LV +++KR + A   +V  Y +GFSGF+ARL+ +EA ++  KPGVVSVF DP+
Sbjct  45   LRQSHLRLVGTILKRGKLAQSVVVQQYKHGFSGFAARLSKDEAAALRHKPGVVSVFADPV  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             QLHTT+SWDFL     K  SA  R    +A  +S+   D IIG++D+GIWPES SF D 
Sbjct  105  YQLHTTRSWDFLQQTDVKIDSAKRRSPRPTAASTSAPTTDTIIGLLDSGIWPESPSFDDA  164

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G GP+P++WKG C  GDDFN+SNC
Sbjct  165  GFGPVPSKWKGVCMAGDDFNTSNC  188



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 5/135 (4%)
 Frame = -1

Query  402  LVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWD  223
            +++SL++R +NALV+SY +GFSGF+A L+  EA  +  +PGVVSVFPDP+ QLHTT+SWD
Sbjct  46   ILSSLLRRNKNALVHSYKHGFSGFAAHLSDSEAHQLTNEPGVVSVFPDPVYQLHTTRSWD  105

Query  222  FLDSFSDKKISAAIRpg-sasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            FL     ++IS        ++A   SS G+D IIGI+DTGIWPES SF D  MGPIP+RW
Sbjct  106  FL----QREISLLTDSQPRSNAPVLSSQGSDTIIGILDTGIWPESESFIDKDMGPIPSRW  161

Query  45   KGKCEKGDDFNSSNC  1
            KGKC +G DF+SSNC
Sbjct  162  KGKCMEGSDFSSSNC  176



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            +  +A+L++SLI+RK++A+V+SY+NGFSGF+ARL+  EA+SIAQKPGV+SVFPDPILQLH
Sbjct  48   KNQRAELMSSLIRRKKDAVVHSYSNGFSGFAARLSEAEAKSIAQKPGVISVFPDPILQLH  107

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   ++ + S+      + +  +S  G D IIGI+DTGIWPES SF D+ M  
Sbjct  108  TTRSWDFLQYQTEVESSSG---PISGSDNASPKGVDTIIGILDTGIWPESESFSDNDMSE  164

Query  60   IPARWKGKCEKGDDFNSSNC  1
            +P++WKG C    D  S  C
Sbjct  165  VPSKWKGTCMASHDSISFKC  184



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R+   +LV +++KR + A   +V  Y + FSGF+ARL+ +EA ++  KPGVVSVF DP+
Sbjct  53   LRQSHIRLVGTILKRGKVAQSVVVQQYKHAFSGFAARLSKDEAAALRHKPGVVSVFADPV  112

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             QLHTT+SWDFL     K  SA  R    +A  +S+   + IIG++D+GIWPES SF D 
Sbjct  113  YQLHTTRSWDFLQQTDVKIDSARHRSSKTTAASTSAPTTETIIGLLDSGIWPESPSFDDA  172

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G GP+P++WKG C  GDDFN+SNC
Sbjct  173  GFGPVPSKWKGVCMAGDDFNTSNC  196



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 97/148 (66%), Gaps = 7/148 (5%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +++   +LV++++KR R A   +V  Y +GFSGF+ARL+  EA ++ +KPGVVSVF DP+
Sbjct  44   LQESHLRLVSTVLKRGRRAGSVVVRQYKHGFSGFAARLSEVEAAALRRKPGVVSVFADPV  103

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimd----tgIWPESAS  85
              LHTT+SWDFL   + K  +AA R G+     +++  +      +     +GIWPES S
Sbjct  104  YHLHTTRSWDFLQQAAVKIDAAARRRGAHKPAAAAADPSSSSPDTIIGLLDSGIWPESPS  163

Query  84   FHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            F+D G GP+P RWKG C  GDDFNSSNC
Sbjct  164  FNDAGFGPVPGRWKGVCMAGDDFNSSNC  191



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            + D AQL++S++KR++NALV SY +G SGF+ARL+A EA+SIA+ PGVVSVFPDP+ QLH
Sbjct  46   KNDHAQLLSSVLKRRKNALVQSYEHGISGFAARLSAAEAQSIARNPGVVSVFPDPVYQLH  105

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D      I     S   SSSGG D IIGI+DTGI PES SF    MGP
Sbjct  106  TTRSWDFLKYGTD----VVIDSSPNSNSSSSSGGYDSIIGILDTGISPESESFSGKDMGP  161

Query  60   IPARWKGKCEKGDDF  16
            IP+RW G C    DF
Sbjct  162  IPSRWNGTCVDAHDF  176



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 8/144 (6%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +++   QL+ S+++R ++A   L+ SY +GFSGF+ARL+ EEA +I +K GVVSVF DPI
Sbjct  50   LKESHLQLLASVLQRGQHAEKTLIRSYRHGFSGFAARLSKEEALAIGRKAGVVSVFVDPI  109

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             QLHTT+SWDFL     ++      P   S   SS+  +D IIGI+DTGIWPES SF D+
Sbjct  110  YQLHTTRSWDFL-----QQTMVETDPNPDSDPASSTQASDTIIGILDTGIWPESESFSDE  164

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG IP+RW G C KG DFN+SNC
Sbjct  165  GMGAIPSRWNGTCMKGTDFNASNC  188



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 10/144 (7%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            ++++  QL+ S+++R ++A   L+ SY +GFSGF+ARL+ EEA +I++K GVVSVF DPI
Sbjct  80   LKENHLQLLASVLQRGQHAEKTLIRSYRHGFSGFAARLSEEEALAISRKEGVVSVFVDPI  139

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             QLHTT+SWDFL                 S   SS+  +D IIGI+DTGIWPES SF D 
Sbjct  140  YQLHTTRSWDFLQQMETDP-------NPDSDPASSTQASDTIIGILDTGIWPESESFSDK  192

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG IP+RW G C +G DFN+SNC
Sbjct  193  GMGAIPSRWNGTCMEGTDFNASNC  216



>ref|XP_007131420.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03414.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=510

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +++++YSY +GFSGF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+        SA           +S+ G   IIG++DTGIWPESASF+D+G
Sbjct  115  KLHTTRSWDFIGIHHSTSKSA---------LSNSNLGEGAIIGVIDTGIWPESASFNDEG  165

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MG IP+RWKG C+ G+ FNS+NC
Sbjct  166  MGQIPSRWKGVCQVGEHFNSTNC  188



>ref|XP_007131422.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03416.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=563

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +++++YSY +GFSGF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+        SA           +S+ G   IIG++DTGIWPESASF+D+G
Sbjct  115  KLHTTRSWDFIGIHHSTSKSA---------LSNSNLGEGAIIGVIDTGIWPESASFNDEG  165

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MG IP+RWKG C+ G+ FNS+NC
Sbjct  166  MGQIPSRWKGVCQVGEHFNSTNC  188



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            + D AQL++S++KR++NALV SY +G SGF+ARL+A EA+SIA+ PGVVSVF DP+ QLH
Sbjct  46   KNDHAQLLSSVLKRRKNALVQSYVHGISGFAARLSATEAQSIAKTPGVVSVFRDPVYQLH  105

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL   +D      I     S   SSSGG D IIGI+DTGI PES SF    +GP
Sbjct  106  TTRSWDFLKYGTD----VVIDSSPNSDSNSSSGGYDSIIGILDTGISPESESFSGKDLGP  161

Query  60   IPARWKGKCEKGDDF  16
            IP+RW G C    DF
Sbjct  162  IPSRWNGTCVDAHDF  176



>ref|XP_007131421.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03415.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=775

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +++++YSY +GFSGF+ARLT  +A +IA+ PGVVSV P+ I 
Sbjct  55   KKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAEAIAKFPGVVSVIPNGIH  114

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+        SA           +S+ G   IIG++DTGIWPESASF+D+G
Sbjct  115  KLHTTRSWDFIGIHHSTSKSA---------LSNSNLGEGAIIGVIDTGIWPESASFNDEG  165

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MG IP+RWKG C+ G+ FNS+NC
Sbjct  166  MGQIPSRWKGVCQVGEHFNSTNC  188



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+I   + +R +L++SY +   GFSA LT +EA S++    VVSVFPDP+LQLHTT
Sbjct  56   QLLSSIIPSEESQRLSLIHSYNHAIKGFSAMLTEKEASSLSGHEKVVSVFPDPVLQLHTT  115

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLDS  +  I + I+   AS+          I        WPES SF+D+GMG IP
Sbjct  116  RSWDFLDS--ESGIRSGIKYPQASSDVIIGIIDTGI--------WPESPSFNDEGMGEIP  165

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  166  SRWKGVCMEGSDFKKSNC  183



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 86/148 (58%), Gaps = 21/148 (14%)
 Frame = -1

Query  414  DQAQLVTSLIKRKR----NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQ  247
            D  +L++S+   K+      LV SY NGFSGF+ARLTA+ A ++A++P VVSVF DP LQ
Sbjct  58   DHLELISSITASKKPHSQGLLVRSYMNGFSGFAARLTAQHAAAMAKQPQVVSVFVDPFLQ  117

Query  246  LHTTQSWDFL------DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESAS  85
            LHTT+SWDFL      + +SD    +  R  + +       G            WPES S
Sbjct  118  LHTTRSWDFLQEHTELEPYSDMDSDSGSRNNTNTIIGLLDTGV-----------WPESPS  166

Query  84   FHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            F D  MG IPARWKG C +G DFNSS C
Sbjct  167  FDDMDMGAIPARWKGVCMEGKDFNSSYC  194



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 100/144 (69%), Gaps = 8/144 (6%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRN---ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R++  QL++S+++R ++    L++SY +GFSGF+ARL+ EEA +I++K GVVSVF DPI
Sbjct  48   LRENHLQLLSSVLRRGQSPEKTLLWSYRHGFSGFAARLSKEEAVAISEKAGVVSVFLDPI  107

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             QLHTT+SWDFL     ++ S            SS   +D IIG +DTG+WPES+SF+D 
Sbjct  108  YQLHTTRSWDFL-----RQTSLETDSKPDEEAASSPQTSDTIIGFLDTGVWPESSSFNDK  162

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
             MG +P RWKG C  G +F++S+C
Sbjct  163  EMGAVPGRWKGVCMAGSNFSASSC  186



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -1

Query  411  QAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
              +L++S+I   + +R  L++ Y + FSGFSA LT  EA +++   GVVSVFPDPIL+LH
Sbjct  46   HIELLSSIIPSEESERIKLIHHYNHAFSGFSAMLTQSEASALSGHDGVVSVFPDPILELH  105

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFLDS    K S  +               DIII ++DTGIWPES SF D+G+G 
Sbjct  106  TTRSWDFLDSDLGMKPSTNV-------LTHQHSSNDIIIALIDTGIWPESPSFTDEGIGK  158

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+RWKG C +G DF  SNC
Sbjct  159  IPSRWKGICMEGHDFKKSNC  178



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 98/143 (69%), Gaps = 8/143 (6%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +++  QL+ S+++R ++    L+  Y +GFSGF+ARL+ EEA +I++K GVVSVF DPI 
Sbjct  50   KENHLQLLASVLQRGQHVEKTLIRRYRHGFSGFAARLSKEEALAISRKAGVVSVFVDPIY  109

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            QLHTT+SWDFL     ++          S   SS+  +D IIG++DTGIWPES SF D+ 
Sbjct  110  QLHTTRSWDFL-----QQTMVETNSNPDSDPSSSTQASDTIIGLLDTGIWPESESFSDEA  164

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M  IP+RWKG C +G DFN+SNC
Sbjct  165  MDAIPSRWKGTCMEGTDFNASNC  187



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -1

Query  411  QAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
              +L++S+I   + +R  L++ Y + FSGFSA LT  EA +++   GVVSVFPDPIL+LH
Sbjct  46   HIELLSSIIPSEESERIKLIHHYNHAFSGFSAMLTQSEASALSGHDGVVSVFPDPILELH  105

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFLDS    K S  +               DIII ++DTGIWPES SF D+G+G 
Sbjct  106  TTRSWDFLDSDLGMKPSTNV-------LTHQHSSNDIIIALIDTGIWPESPSFTDEGIGK  158

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP+RWKG C +G DF  SNC
Sbjct  159  IPSRWKGICMEGHDFKKSNC  178



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 95/138 (69%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            +L++S+I   + +R AL++ Y++ FSGFSA LT  EA +++   GVVSVFPDPILQLHTT
Sbjct  53   ELLSSIIPSEESERIALIHHYSHAFSGFSAMLTHTEASALSGHDGVVSVFPDPILQLHTT  112

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLDS    K  +  +         S    DIIIG++DTGIWPES SF D+G+G +P
Sbjct  113  RSWDFLDSDLGMKPPSTTQ---------SHSSTDIIIGLIDTGIWPESPSFRDEGIGKVP  163

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  S+C
Sbjct  164  SRWKGVCMEGHDFKKSDC  181



>dbj|BAA13135.1| subtilisin-like protein [Picea abies]
Length=779

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 23/150 (15%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +     ++++S+++  R+A   LV SYT  F+GF+A L+ E+A ++  KPGV+SVFPD +
Sbjct  44   LVTSHLEVLSSVLESPRHAKQSLVRSYTYAFNGFAAVLSKEQATTLVGKPGVLSVFPDTV  103

Query  252  LQLHTTQSWDFLD------SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPES  91
            L LHTT SWD+L+       FS +K  ++              G DII+G +DTGIWPE+
Sbjct  104  LNLHTTHSWDYLEKDLSMPGFSYRKPKSS--------------GTDIILGFLDTGIWPEA  149

Query  90   ASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            ASF D GMGP+P+RWKG C KG++FN SNC
Sbjct  150  ASFSDKGMGPVPSRWKGACVKGENFNVSNC  179



>ref|XP_002278450.2| PREDICTED: subtilisin-like protease SBT3.3 [Vitis vinifera]
Length=787

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 97/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            ++K   +++++L+  K   +++++YSY +GFSGF+A+LT  +A  IA  PGVV V P+ I
Sbjct  62   IKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGFPGVVQVIPNRI  121

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +LHTT+SWDFL    D   +             ++ G  +IIG++D+G+WPES SF D+
Sbjct  122  HRLHTTRSWDFLGLQHDYPTNVLTE---------TNLGRGVIIGVIDSGVWPESESFKDE  172

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMGPIP+RWKG C+ G+ FNS+NC
Sbjct  173  GMGPIPSRWKGICQHGERFNSTNC  196



>emb|CBI34615.3| unnamed protein product [Vitis vinifera]
Length=737

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 97/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            ++K   +++++L+  K   +++++YSY +GFSGF+A+LT  +A  IA  PGVV V P+ I
Sbjct  12   IKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGFPGVVQVIPNRI  71

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +LHTT+SWDFL    D   +             ++ G  +IIG++D+G+WPES SF D+
Sbjct  72   HRLHTTRSWDFLGLQHDYPTNVLTE---------TNLGRGVIIGVIDSGVWPESESFKDE  122

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMGPIP+RWKG C+ G+ FNS+NC
Sbjct  123  GMGPIPSRWKGICQHGERFNSTNC  146



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +    +++++L+  K   +N+++YSY +GFSGF+ARLT  +A  IA  PGVV V P+ I 
Sbjct  52   KMSHHKMLSTLLGSKEAAKNSMLYSYKHGFSGFAARLTESQAEEIAAFPGVVHVIPNRIH  111

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L   S K +              S+ G   IIG++D+G+WPES SF+D
Sbjct  112  RLHTTRSWEFMGLKYHSSKNL-----------LTQSNMGEGTIIGVIDSGVWPESESFND  160

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             GMGPIP+RWKG C++G  FNSSNC
Sbjct  161  RGMGPIPSRWKGTCQEGQLFNSSNC  185



>ref|XP_010100157.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB81608.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++  +  K   + +++YSY +GFSG +ARLT  EA++IA+ PGVV V PD I+
Sbjct  59   KKSHYKMLSDFLGSKEAAKQSILYSYRHGFSGIAARLTDAEAKAIAKIPGVVKVIPDYIV  118

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            + HTT+SWDFL               S  +  S++ G   IIG++D+G+WPES SF DDG
Sbjct  119  KAHTTRSWDFL---------GVPHKYSPQSPLSNNLGQGTIIGVVDSGVWPESESFKDDG  169

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M PIP RWKG CEKG  FNS+NC
Sbjct  170  MPPIPKRWKGICEKGQQFNSTNC  192



>ref|XP_003524182.2| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Glycine 
max]
Length=793

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 28/146 (19%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            ++++SL+  K   +N+++YSY +GFSGF+ARLT  +A +IA+ PGVVSV P+ I +LHTT
Sbjct  79   KMLSSLLGSKEAAKNSILYSYKHGFSGFAARLTKYQAEAIAKFPGVVSVIPNGIHKLHTT  138

Query  234  QSWDFLD--------SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFH  79
            +SWDF+         +FSD  +                     IIG++DTGIWPES SF+
Sbjct  139  RSWDFMGVHHSTSKIAFSDSNLGEG-----------------TIIGVIDTGIWPESPSFN  181

Query  78   DDGMGPIPARWKGKCEKGDDFNSSNC  1
            D+ MG IP+RWKG C+ G  FNS+NC
Sbjct  182  DEAMGQIPSRWKGICQGGKHFNSTNC  207



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 97/145 (67%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++ +L+  K   R++++YSY +GFSGF+A+LT  +A  IA+ PGVV V P+ I 
Sbjct  59   KKIHYEMLLTLLGSKEAARSSILYSYRHGFSGFAAKLTESQAEDIAEFPGVVQVIPNGIH  118

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L+  S + +              S+ G   IIG++D+G+WPES SFHD
Sbjct  119  KLHTTRSWEFIGLNHHSPQNL-----------LKQSNMGQGTIIGVIDSGVWPESKSFHD  167

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +GMGP+P+ WKG C++G+ FN SNC
Sbjct  168  EGMGPVPSHWKGICQQGESFNLSNC  192



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +    +++++L+  K   +N+++YSY +GFSGF+ARLT  +A  IA  PGVV V P+ I 
Sbjct  145  KMSHHKMLSTLLGSKEAAKNSMLYSYKHGFSGFAARLTESQAEEIAAFPGVVHVIPNRIH  204

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L   S K +              S+ G   IIG++D+G+WPES SF+D
Sbjct  205  RLHTTRSWEFMGLKYHSSKNL-----------LTQSNMGEGTIIGVIDSGVWPESESFND  253

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             GMGPIP+RWKG C++G  FNSSNC
Sbjct  254  RGMGPIPSRWKGTCQEGQLFNSSNC  278



>ref|XP_010092449.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB51215.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=403

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++  +  K   + +++YSY +GFSG +ARLT  EA++IA+ PGVV V PD I+
Sbjct  59   KKSHYKMLSDFLGSKEAAKQSILYSYRHGFSGIAARLTDAEAKAIAKIPGVVKVIPDYIV  118

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            + HTT+SWDFL               S  +  S++ G   IIG++D+G+WPES SF DDG
Sbjct  119  KAHTTRSWDFL---------GVPHKYSPQSPLSNNLGQGTIIGVIDSGVWPESESFKDDG  169

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M PIP RWKG C+ G +FNS+NC
Sbjct  170  MPPIPKRWKGICQTGKEFNSTNC  192



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 96/145 (66%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++++L+  K  A   ++YSY +GFSGF+AR+TA +A  IA+ PGVV V P+ I 
Sbjct  59   KKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIH  118

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L+  S + +              S+ G   IIG++D+G+WPES SFHD
Sbjct  119  KLHTTRSWEFIGLEHHSPQNL-----------LTQSNMGQGTIIGVIDSGVWPESKSFHD  167

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +GMGP+P+ WKG C++G+ F S NC
Sbjct  168  EGMGPVPSHWKGICQQGEHFKSYNC  192



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 96/145 (66%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++++L+  K  A   ++YSY +GFSGF+AR+TA +A  IA+ PGVV V P+ I 
Sbjct  59   KKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIH  118

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L+  S + +              S+ G   IIG++D+G+WPES SFHD
Sbjct  119  KLHTTRSWEFIGLEHHSPQNL-----------LTQSNMGQGTIIGVIDSGVWPESKSFHD  167

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +GMGP+P+ WKG C++G+ F S NC
Sbjct  168  EGMGPVPSHWKGICQQGEHFKSYNC  192



>ref|XP_007028364.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08866.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=762

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 87/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  414  DQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            D  QL++++I R+   R +L++ Y +   GFSA LT  EA  +A   GVVS+FPD +LQL
Sbjct  47   DHLQLLSTVIPRQDSGRISLIHHYNHALRGFSAMLTENEASELAGHDGVVSLFPDSVLQL  106

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL+  S  + S                  D+IIG++D GIWPES SF D+GMG
Sbjct  107  HTTRSWDFLEGQSRPRFSHG--------SYQHKSSYDVIIGMIDGGIWPESPSFRDEGMG  158

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP RWKG C +G DF  SNC
Sbjct  159  EIPTRWKGVCMEGPDFKKSNC  179



>ref|XP_004309569.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 95/143 (66%), Gaps = 13/143 (9%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKR---NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++T+L+  K    N+++YSY +GFSGF+ARLT  +A +IA+ PGV+ V P+ + 
Sbjct  105  KKFHHKMLTNLLGSKEAAYNSILYSYKHGFSGFAARLTESQAETIAEFPGVLQVIPNRVH  164

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+           I   S       S G   IIG++D+G+WPES SF+D+G
Sbjct  165  KLHTTRSWDFI----------GIHQHSPENHLRRSMGKGTIIGVIDSGVWPESESFNDEG  214

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M PIP+ WKG C++G+ FNS+NC
Sbjct  215  MDPIPSHWKGICQQGELFNSTNC  237



>ref|XP_009348700.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++T+L+  K +A   ++YSY  GFSGF+ARLT  +A  IA+ P VV V P+ + 
Sbjct  60   KKFHHKMLTTLLGSKEDAYRSIIYSYNYGFSGFAARLTESQAEEIAEFPEVVQVIPNRVH  119

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+           I   S+    + S G   IIG++D+G+WPES SF+DD 
Sbjct  120  KLHTTRSWDFI----------GIHRYSSDNLLTKSMGKGTIIGVIDSGVWPESESFNDDA  169

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MGPIP+ WKG C++G+ FNS+NC
Sbjct  170  MGPIPSHWKGICQQGEYFNSTNC  192



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 98/145 (68%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   Q++++L+  K   +++++YSY +GFSGF+ARLT  +A  IA+ PGV+ V P+ I 
Sbjct  26   KKSHHQMLSTLLGSKEAAKSSILYSYKHGFSGFAARLTEAQAVKIAEFPGVIQVIPNRIH  85

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L+  S K + A            S+ G   IIG++D+GIWPES SF+D
Sbjct  86   KLHTTRSWEFIGLNHHSSKNLLA-----------QSNMGEGTIIGVIDSGIWPESKSFND  134

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             GMGP+P+ WKG C++G+ FN SNC
Sbjct  135  RGMGPVPSHWKGICQEGECFNYSNC  159



>ref|XP_008392654.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=785

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++T+L   K++A   ++YSY  GFSGF+ARLT  +A  IA+ P VV V P+ + 
Sbjct  67   KKFHHKMLTTLFGSKQDAYRSIIYSYKYGFSGFAARLTESQAEEIAEFPEVVQVIPNRVH  126

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+           I   S+    + S G   IIG++D+G+WPES SF+DD 
Sbjct  127  KLHTTRSWDFI----------GIHKYSSDNLLTKSMGKGTIIGVIDSGVWPESESFNDDA  176

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MGPIP+ WKG C++G+ FNS+NC
Sbjct  177  MGPIPSHWKGICQQGEYFNSTNC  199



>ref|XP_008445401.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 92/147 (63%), Gaps = 14/147 (10%)
 Frame = -1

Query  414  DQAQLVTSLIKRK---------RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFP  262
            D  QL++S+I  +         R+ +++ Y + F GFSA LT EEA S++   G+VSVFP
Sbjct  15   DYLQLLSSVIPSRKEKEKENGSRDVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFP  74

Query  261  DPILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASF  82
            DP LQLHTT+SWDFLDS S  +                   +D+I+G++DTGIWPES SF
Sbjct  75   DPTLQLHTTRSWDFLDSISGLRPPTP-----LPPPHFYPSSSDVIVGVIDTGIWPESQSF  129

Query  81   HDDGMGPIPARWKGKCEKGDDFNSSNC  1
            +D+G+G IP++WKG C +  DF  SNC
Sbjct  130  NDEGVGEIPSKWKGVCMEAPDFKKSNC  156



>ref|XP_011020517.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=788

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 92/141 (65%), Gaps = 13/141 (9%)
 Frame = -1

Query  414  DQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            D  QL++S+I   + +R +L+  Y++ F GFSA LT  EA  +A   G+VS+F DPILQL
Sbjct  69   DHLQLLSSIIPSHESERISLIRHYSHAFKGFSAMLTENEASLLAGHGGIVSIFRDPILQL  128

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL++ S  +                   +D+IIG++DTGIWPES SF+DDG+G
Sbjct  129  HTTRSWDFLEAASGMQ----------YKHEHPPMSSDVIIGMIDTGIWPESPSFNDDGIG  178

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP+RWKG C +G DF  SNC
Sbjct  179  EIPSRWKGVCMEGYDFKKSNC  199



>ref|XP_010543788.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Tarenaya 
hassleriana]
Length=766

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 14/138 (10%)
 Frame = -1

Query  405  QLVTSLIKRKRN---ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+ S+I R+ N    +V+ Y + F GFSA LT +EA   ++   VVS+FPDP LQLHTT
Sbjct  61   QLLASVIPREENDRVKVVHHYKHAFKGFSAMLTDDEAAFFSEHDEVVSIFPDPTLQLHTT  120

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+S S    ++ +            G +D+I+G++DTGIWPES+SF+D+GMG IP
Sbjct  121  RSWDFLESISGPISNSPMH-----------GSSDVIVGVIDTGIWPESSSFNDEGMGEIP  169

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G +F  SNC
Sbjct  170  SRWKGICMEGPNFTKSNC  187



>ref|XP_004504377.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=599

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +N+L+YSY +GFSGF+AR+T  +A  IA+ P V+SV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEAAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVISVIPNSIH  118

Query  249  QLHTTQSWDFLDSF--SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SWDF+     S K +                 G   IIG++DTGIWPESASF+D
Sbjct  119  KLHTTRSWDFIGVHHPSSKNV-----------YTKRDLGEGTIIGVIDTGIWPESASFND  167

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            + MG IP RWKG C+ G  FNS+NC
Sbjct  168  EAMGKIPTRWKGVCQVGQHFNSTNC  192



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 93/138 (67%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+TS+I   + +R +L++ Y + F+GFSA LT  EA  +++   V+SVF DPIL+LHTT
Sbjct  58   QLLTSIIPSQESERISLIHHYNHAFNGFSAMLTESEASELSENEEVISVFKDPILKLHTT  117

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL++ S  +IS             S   +D+IIG++DTGIWPES SF D G+G IP
Sbjct  118  RSWDFLEAKSGMQIS----------HQYSHLSSDVIIGMIDTGIWPESPSFDDKGIGEIP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  168  SRWKGICMEGHDFKKSNC  185



>ref|XP_008245809.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=779

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 93/143 (65%), Gaps = 13/143 (9%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   Q++T+L+  K  A   ++YSY +GFSGF+ARLT  +A +I + PGVV V  + I 
Sbjct  60   KKFHHQMLTTLLGSKEAAYKSIIYSYKHGFSGFAARLTDSQAEAIVEFPGVVQVIRNRIH  119

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+           I    +    ++S G   IIG++D+G+WPES SF+D+G
Sbjct  120  KLHTTRSWDFI----------GIHQHLSGNLLTNSMGKGTIIGLIDSGVWPESKSFNDEG  169

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M PIP  WKG C++G+ FNS+NC
Sbjct  170  MDPIPTHWKGICQQGEHFNSTNC  192



>ref|XP_003629621.1| Subtilisin-like protease [Medicago truncatula]
Length=797

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 97/143 (68%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +N+L+YSY +GFSGF+AR+T  +A  IA+ P VVSV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVVSVIPNGIH  118

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+             P S +    S+ G   IIG++DTGIWPESASF+D+ 
Sbjct  119  KLHTTRSWDFI---------GVHHPSSKTVFTESNLGQGTIIGVIDTGIWPESASFNDEA  169

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MG IP++WKG C+ G+ FNS+NC
Sbjct  170  MGKIPSKWKGVCQVGEKFNSTNC  192



>gb|AET04097.2| subtilisin-like serine protease [Medicago truncatula]
Length=781

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 97/143 (68%), Gaps = 12/143 (8%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +N+L+YSY +GFSGF+AR+T  +A  IA+ P VVSV P+ I 
Sbjct  60   KKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVVSVIPNGIH  119

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+             P S +    S+ G   IIG++DTGIWPESASF+D+ 
Sbjct  120  KLHTTRSWDFI---------GVHHPSSKTVFTESNLGQGTIIGVIDTGIWPESASFNDEA  170

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            MG IP++WKG C+ G+ FNS+NC
Sbjct  171  MGKIPSKWKGVCQVGEKFNSTNC  193



>ref|XP_004504376.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=773

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   ++++SL+  K   +N+L+YSY +GFSGF+AR+T  +A  IA+ P V+SV P+ I 
Sbjct  59   KKYHHKMLSSLLGSKEAAKNSLLYSYKHGFSGFAARMTKSQAEDIAKFPEVISVIPNSIH  118

Query  249  QLHTTQSWDFLDSF--SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SWDF+     S K +                 G   IIG++DTGIWPESASF+D
Sbjct  119  KLHTTRSWDFIGVHHPSSKNV-----------YTKRDLGEGTIIGVIDTGIWPESASFND  167

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            + MG IP RWKG C+ G  FNS+NC
Sbjct  168  EAMGKIPTRWKGVCQVGQHFNSTNC  192



>ref|XP_010451309.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=230

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ SL++ K   RN+++YSY +GFSGF+A LT+ +A+ I++ P VV V P+ IL+L TT
Sbjct  68   QMLESLLQSKEDARNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVVHVIPNRILKLKTT  127

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            ++WD L   S      +           ++ G++ IIG++DTGIWPES  F+D G+GPIP
Sbjct  128  RTWDHL-GISPIPTPFSSSSAVKGLLHDTNLGSEAIIGVLDTGIWPESKVFNDQGLGPIP  186

Query  54   ARWKGKCEKGDDFNSS  7
             RW+GKCE G++FN++
Sbjct  187  KRWRGKCESGEEFNAT  202



>ref|XP_010919043.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Elaeis 
guineensis]
Length=741

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 95/137 (69%), Gaps = 12/137 (9%)
 Frame = -1

Query  402  LVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++T+L+  K   +++++YSY + FSGF+ARLT  +A  +A+ PG+V V P+ + +LHTT+
Sbjct  76   VLTTLLGSKEAAKDSILYSYKHSFSGFAARLTKSQAERLAEFPGIVQVIPNKVRKLHTTR  135

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDF+    + + S             S  G ++IIG++D+GIWPES SF+D+GMGPIP+
Sbjct  136  SWDFIGLHPNSRDS---------LLSESRMGKELIIGVIDSGIWPESESFNDEGMGPIPS  186

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG CE G+ F+S+NC
Sbjct  187  RWKGTCEHGELFDSTNC  203



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 95/137 (69%), Gaps = 12/137 (9%)
 Frame = -1

Query  402  LVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++T+L+  K   +++++YSY + FSGF+ARLT  +A  +A+ PG+V V P+ + +LHTT+
Sbjct  76   VLTTLLGSKEAAKDSILYSYKHSFSGFAARLTKSQAERLAEFPGIVQVIPNKVRKLHTTR  135

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDF+    + + S             S  G ++IIG++D+GIWPES SF+D+GMGPIP+
Sbjct  136  SWDFIGLHPNSRDS---------LLSESRMGKELIIGVIDSGIWPESESFNDEGMGPIPS  186

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG CE G+ F+S+NC
Sbjct  187  RWKGTCEHGELFDSTNC  203



>gb|KDP40601.1| hypothetical protein JCGZ_24600 [Jatropha curcas]
Length=765

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 89/138 (64%), Gaps = 9/138 (7%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   + +R +L++SY + F GF A LT +EA  ++    V+SVFPDP LQLHTT
Sbjct  57   QILSSIIPSQESERISLIHSYHHAFRGFCAMLTEDEASLLSDHVEVLSVFPDPKLQLHTT  116

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL S S       I               D+IIG++DTGIWPES SF DD +G IP
Sbjct  117  RSWDFLYSLS------GIGSKLGHQHHHHHLSNDVIIGVIDTGIWPESPSFKDDHIGQIP  170

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG CE+G DFN SNC
Sbjct  171  SRWKGVCEEGSDFNKSNC  188



>ref|XP_002317660.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
 gb|EEE98272.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
Length=786

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 98/153 (64%), Gaps = 24/153 (16%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQK--------PGVV  274
            +K   +++++L+  K   R++++YSY +GFSGF+ARLT  +A  IA          PGVV
Sbjct  59   KKIHYEMLSTLLGSKEAARSSILYSYRHGFSGFAARLTESQAEDIAGTIIVDNSKFPGVV  118

Query  273  SVFPDPILQLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIW  100
             V P+ I +LHTT+SW+F  L+  S + +              S+ G   IIG++D+G+W
Sbjct  119  QVIPNGIHKLHTTRSWEFIGLNHHSPQNL-----------LRQSNMGQGTIIGVIDSGVW  167

Query  99   PESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            PES SFHD+GMGP+P+ WKG C++G+ FNSSNC
Sbjct  168  PESKSFHDEGMGPVPSHWKGICQQGESFNSSNC  200



>ref|XP_006476262.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=777

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 19/149 (13%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   + +++++  K   +++++YSY +GFSGF+ARLT  +A  IA+ PGVV V P+ I
Sbjct  50   ITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGI  109

Query  252  LQLHTTQSWDFLDSF---SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASF  82
            L+LHTT+SW+F+      S K +S             S+ G   IIGI+DTG+WPES SF
Sbjct  110  LKLHTTRSWEFMGLHYYQSSKNLST-----------ESNMGEGTIIGIIDTGVWPESESF  158

Query  81   HDDGMG--PIPARWKGKCEKGDDFNSSNC  1
             D GMG  P+P  WKG C+KG+ FNSSNC
Sbjct  159  SDKGMGQAPVPPHWKGICQKGEKFNSSNC  187



>ref|XP_004165291.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=738

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = -1

Query  414  DQAQLVTSLIKRK--RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            D  QL++S+I     R  +++ Y + F GFSA LT EEA S++   G+VSVFPDP LQLH
Sbjct  15   DYFQLLSSVIPSSGSRAVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDPTLQLH  74

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFLDS S  +              S    +D+I+G++DTGI+PES SF+D+G+G 
Sbjct  75   TTRSWDFLDSISGLRPPTP-----LPPPHSYPSSSDVIVGVIDTGIFPESQSFNDEGIGE  129

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP++WKG C +  DF  SNC
Sbjct  130  IPSKWKGVCMEAPDFKKSNC  149



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            +++++L+  K   R +++YSY +GFSGF+A LT  +A+ IA  PGVV V P+ IL++HTT
Sbjct  50   EILSTLLGSKQAARESILYSYKHGFSGFAALLTQSQAKLIADFPGVVRVIPNRILRVHTT  109

Query  234  QSWDFLD---SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            +SWDFL       D  +S +              G D IIG++DTGIWPES SF DDGMG
Sbjct  110  RSWDFLQLKPEIMDGILSRS------------QSGYDSIIGVLDTGIWPESESFKDDGMG  157

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             +P+RW G C++G++FN+SNC
Sbjct  158  EVPSRWNGVCQEGEEFNASNC  178



>ref|XP_006439186.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
 gb|ESR52426.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
Length=777

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 19/149 (13%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   + +++++  K   +++++YSY +GFSGF+ARLT  +A  IA+ PGVV V P+ I
Sbjct  50   ITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGI  109

Query  252  LQLHTTQSWDFLDSF---SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASF  82
            L+LHTT+SW+F+      S K +S             S+ G   IIGI+DTG+WPES SF
Sbjct  110  LKLHTTRSWEFMGLHYYQSSKNLST-----------ESNMGEGTIIGIIDTGVWPESESF  158

Query  81   HDDGMG--PIPARWKGKCEKGDDFNSSNC  1
             D GMG  P+P  WKG C+KG+ FNSSNC
Sbjct  159  SDKGMGQAPVPPHWKGICQKGEKFNSSNC  187



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (65%), Gaps = 8/144 (6%)
 Frame = -1

Query  423  MRKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +      L++S+I   + +R AL + +++ FSGFSA LT  EA +++    VVSVFPDP+
Sbjct  50   LESSHLHLLSSIIPSEQSERIALTHHFSHAFSGFSALLTEGEASALSGHDSVVSVFPDPV  109

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            LQLHTT+SWDFL+S    K          + +      +DIIIG++DTGIWPES SF D+
Sbjct  110  LQLHTTRSWDFLESDLGMK-----PYSYGTPKLHQHSSSDIIIGVIDTGIWPESPSFRDE  164

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+G IP+RWKG C +G DF  SNC
Sbjct  165  GIGEIPSRWKGVCMEGSDFKKSNC  188



>ref|XP_003541562.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=778

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 92/138 (67%), Gaps = 7/138 (5%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++ +I   + +R AL + +++ FSGFSA LT  EA +++   GVVSVFPDP+L+LHTT
Sbjct  56   QLLSLIIPSEESERIALTHHFSHAFSGFSAMLTESEASALSGHDGVVSVFPDPVLELHTT  115

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+S    ++         +         DIIIG++DTGIWPES SF D+G+G IP
Sbjct  116  RSWDFLES----ELGMKPYYSHGTPTLHKHPSTDIIIGVIDTGIWPESPSFRDEGIGEIP  171

Query  54   ARWKGKCEKGDDFNSSNC  1
            ++WKG C +G DF  SNC
Sbjct  172  SKWKGVCMEGRDFKKSNC  189



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 11/137 (8%)
 Frame = -1

Query  402  LVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            L++S+I   + +R AL++ Y++ F+GFSA LT  EA ++A   GVVSVF DPIL+LHTT+
Sbjct  58   LLSSIIPSEESERIALIHHYSHAFNGFSAMLTQSEASALAGNDGVVSVFEDPILELHTTR  117

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDFL+S    +    ++              DIIIG++DTGIWPES SF D+G+G IP+
Sbjct  118  SWDFLESDLGMRPHGILK--------HQHSSNDIIIGVIDTGIWPESPSFKDEGIGKIPS  169

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C +  DF  SNC
Sbjct  170  RWKGVCMEAHDFKKSNC  186



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 9/125 (7%)
 Frame = -1

Query  375  RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKK  196
            R +++YSY +GFSGF+A L+  +A++IA  PGV+ V P+ IL +HTT+SWDFL   S+  
Sbjct  77   RASILYSYKHGFSGFAAVLSQSQAKAIADFPGVIRVVPNRILNVHTTRSWDFLQLKSEII  136

Query  195  ISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDF  16
                 R         S  G   IIG++DTGIWPES SF+DDGMG +P+RW G C++G++F
Sbjct  137  DGILSR---------SQSGDGSIIGVLDTGIWPESESFNDDGMGEVPSRWNGVCQEGEEF  187

Query  15   NSSNC  1
            NSSNC
Sbjct  188  NSSNC  192



>gb|KDO76781.1| hypothetical protein CISIN_1g042478mg [Citrus sinensis]
Length=954

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 19/149 (13%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   + +++++  K   +++++YSY +GFSGF+ARLT  +A  IA+ PGVV V P+ I
Sbjct  50   ITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAEKIAELPGVVQVIPNGI  109

Query  252  LQLHTTQSWDFLDSF---SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASF  82
            L+LHTT+SW+F+      S K +S             S+ G   IIGI+DTG+WPES SF
Sbjct  110  LKLHTTRSWEFMGLHYYQSSKNLST-----------ESNMGEGTIIGIIDTGVWPESESF  158

Query  81   HDDGMG--PIPARWKGKCEKGDDFNSSNC  1
             D GMG  P+P  WKG C+KG+ FNSSNC
Sbjct  159  SDKGMGQAPVPPHWKGICQKGEKFNSSNC  187



>gb|KGN47766.1| hypothetical protein Csa_6G401370 [Cucumis sativus]
Length=789

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = -1

Query  414  DQAQLVTSLIKRK-------RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDP  256
            D  QL++S+I  +       R  +++ Y + F GFSA LT EEA S++   G+VSVFPDP
Sbjct  61   DYFQLLSSVIPSRKEKESGSRAVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDP  120

Query  255  ILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
             LQLHTT+SWDFLDS S  +              S    +D+I+G++DTGI+PES SF+D
Sbjct  121  TLQLHTTRSWDFLDSISGLRPPTP-----LPPPHSYPSSSDVIVGVIDTGIFPESQSFND  175

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +G+G IP++WKG C +  DF  SNC
Sbjct  176  EGIGEIPSKWKGVCMEAPDFKKSNC  200



>gb|KDO48659.1| hypothetical protein CISIN_1g028958mg [Citrus sinensis]
Length=200

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = -1

Query  411  QAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
              QL++S+I   +  R +L++ Y + F GFSA LT +EA  ++    +VSVFPDP+L+LH
Sbjct  63   HLQLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSGHEKIVSVFPDPVLKLH  122

Query  240  TTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            TT+SWDFL++ ++ K + +    + S+    +  +D+IIGI+DTGIWPES SF D GM  
Sbjct  123  TTRSWDFLEAEAEAKATTS----TWSSHKYHNISSDVIIGIIDTGIWPESPSFKDRGMSE  178

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP++WKG C    DF  SNC
Sbjct  179  IPSKWKGVCMDSHDFKKSNC  198



>ref|XP_008775642.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=737

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +     +++T+L+  K   +++++YSY +GFSGF+A+LT  +A  +A+ PG++ V P+ +
Sbjct  12   VESSHHEVLTTLLGSKEAAQDSILYSYKHGFSGFAAKLTKSQADRVAEFPGIIQVIPNRV  71

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +LHTT+SWDF+            R    S    S  G ++IIG++D+GIWPES SF+D 
Sbjct  72   RKLHTTRSWDFIGLH---------RSSGRSLLSESRMGREMIIGVIDSGIWPESESFNDR  122

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMGP+P+RWKG CE G+ FN +NC
Sbjct  123  GMGPVPSRWKGACEHGELFNFTNC  146



>gb|KHN10324.1| Subtilisin-like protease [Glycine soja]
Length=778

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++ +I   + +R AL + +++ FSGFSA LT  EA +++   GVVSVFPDP+L+LHTT
Sbjct  56   QLLSLIIPSEESERIALTHHFSHAFSGFSAMLTESEASALSGHDGVVSVFPDPVLELHTT  115

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+S     +         +         DIIIG++DTGIWPES SF D+G+G IP
Sbjct  116  RSWDFLES----DLGMKPYYSHGTPTLHKHPSTDIIIGLIDTGIWPESPSFRDEGIGEIP  171

Query  54   ARWKGKCEKGDDFNSSNC  1
            ++WKG C +G DF  SNC
Sbjct  172  SKWKGVCMEGRDFKKSNC  189



>ref|XP_007209077.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
 gb|EMJ10276.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
Length=781

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 15/145 (10%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSI--AQKPGVVSVFPDP  256
            +K   Q++T+L+  K  A   ++YSY +GFSGF+ARLT  +A +I  A+ PGVV V  + 
Sbjct  60   KKFHHQMLTTLLGSKEAAYRSIIYSYKHGFSGFAARLTESQAEAIAAAEFPGVVQVIRNR  119

Query  255  ILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            I +LHTT+SWDF+           I   S+    + S G   IIG++D+G+WPES SF+D
Sbjct  120  IHKLHTTRSWDFI----------GIHQHSSGNLLTKSMGKGTIIGLIDSGVWPESKSFND  169

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +GM PIP  WKG C++G+ FNS+NC
Sbjct  170  EGMDPIPTHWKGICQQGEHFNSTNC  194



>emb|CDX77071.1| BnaC04g38660D [Brassica napus]
Length=760

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 90/138 (65%), Gaps = 10/138 (7%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ +L+ R+   R   V+ Y + F GFSA LT EEA +++    VVSVF DP+LQLHTT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLDS S    S  I         S  G +DIIIG++DTGIWPES SF D G G IP
Sbjct  115  RSWDFLDSLSRVSSSFPI-------YNSFHGSSDIIIGVVDTGIWPESPSFSDKGFGEIP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            ++WKG C +G DFN SNC
Sbjct  168  SKWKGICMEGPDFNKSNC  185



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   Q++ SL+  K++A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  45   VTKSHHQMLVSLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGF  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      +    ++ G  +IIG++DTG+WPES SF+D+
Sbjct  105  HELATTRTWDYLG------LSAA---NPKNLLNDTNMGDQVIIGVIDTGVWPESESFNDN  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP +WKG CE G++F S+NC
Sbjct  156  GVGPIPRKWKGGCESGENFRSTNC  179



>ref|XP_002528535.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF33847.1| Cucumisin precursor, putative [Ricinus communis]
Length=761

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            I++ R + +YSY++GF GF+A+LT  +A  IA+ PGVVSVFP+   +LHTT SWDF+   
Sbjct  63   IEQARTSHLYSYSHGFKGFAAKLTDHQASQIAKMPGVVSVFPNLKRKLHTTHSWDFMGLV  122

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    +IIIG +DTGIWPES SF DD M P+P RWKG+C+ 
Sbjct  123  GEETMEIP--------GYSTKNQVNIIIGFIDTGIWPESPSFSDDDMPPVPPRWKGQCQS  174

Query  27   GDDFNSSNC  1
            G+ FNSS+C
Sbjct  175  GEAFNSSSC  183



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R     ++T+L+   +  R ++VYSY  GFSGF+A+LT  +A+ ++   GVV V P+ +
Sbjct  12   VRDLHHSVLTTLLGSAEAARESMVYSYRYGFSGFAAKLTENQAKILSGFEGVVRVLPNRM  71

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +LHTT+SWDFL   + K  S  +R         ++ G  +I+G++D+G+WPES SF+D 
Sbjct  72   YKLHTTRSWDFL-GLNPKLPSTLLR--------KANSGDGVIVGVIDSGVWPESESFNDK  122

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMGPIP RWKG C+ G  FNSSNC
Sbjct  123  GMGPIPRRWKGICQPGKQFNSSNC  146



>gb|EMT21268.1| Subtilisin-like protease [Aegilops tauschii]
Length=740

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 91/137 (66%), Gaps = 8/137 (6%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++TS+   K  AL   VYSY +GFSGF+A LT  +A +IA+ P VV+V P+   + HTT+
Sbjct  51   MLTSVFGSKDEALRSIVYSYKHGFSGFAAMLTESQAETIAKFPEVVTVKPNIFHETHTTR  110

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDFLD   +++               +  G D+I+G++DTGIWPES SF D+G GP+PA
Sbjct  111  SWDFLDLHHNRQ-----PAQQPGLLKKAKYGEDVIVGVIDTGIWPESRSFDDNGYGPVPA  165

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKGKC+ G DFN+++C
Sbjct  166  RWKGKCQTGQDFNATSC  182



>gb|KDP25228.1| hypothetical protein JCGZ_20384 [Jatropha curcas]
Length=335

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 16/145 (11%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K   +++++L+  K   +++++YSY +GFSGF+ARL+  +A  IA  PGV+ V P+ I 
Sbjct  12   KKFHHKMLSTLLGSKEAAKSSILYSYRHGFSGFAARLSESQAVKIADFPGVIRVIPNSIH  71

Query  249  QLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
            +LHTT+SW+F  L+  S + +              S+ G   IIG++D+GIWPES SF+D
Sbjct  72   KLHTTRSWEFIGLNHHSSRNL-----------LTQSNMGEGTIIGVIDSGIWPESKSFND  120

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             GM P+P+ WKG C+ G+ FNSSNC
Sbjct  121  QGMRPVPSHWKGICQGGEHFNSSNC  145



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 91/138 (66%), Gaps = 10/138 (7%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ +L+ R+   R   V+ Y + F GFSA LT EEA +++    VVSVF DP+LQLHTT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLDS S +  S  I         S  G +DIIIG++DTGIWPES SF D G G IP
Sbjct  115  RSWDFLDSLSGESSSFPI-------YNSFHGSSDIIIGVVDTGIWPESPSFSDKGFGEIP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            ++WKG C +G DFN S+C
Sbjct  168  SKWKGICMEGPDFNKSSC  185



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 98/144 (68%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q++++L+  K++A   +VYSY +GFSGF+A+LT  +AR+IA+ P VV V PD +
Sbjct  45   VTESHHQMLSTLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQARTIAELPEVVHVIPDGV  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +S A      +    ++ G  +IIG++DTG+WPES SF+D 
Sbjct  105  YELATTRTWDYLG------LSGA---NPNNLLTDTNMGDQVIIGVIDTGVWPESESFNDK  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP +WKG CE G++F S++C
Sbjct  156  GVGPIPRKWKGGCESGENFRSTDC  179



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   Q++ SL+  K++A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  45   VTKSHHQMLWSLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGF  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      +    ++ G  +IIG++DTG+WPES SF+D+
Sbjct  105  YELATTRTWDYLG------LSAA---SPKNLLNDTNMGDQVIIGVIDTGVWPESESFNDN  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP +WKG CE G++F S+NC
Sbjct  156  GVGPIPRKWKGGCESGENFRSTNC  179



>ref|XP_010091321.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44295.1| Subtilisin-like protease [Morus notabilis]
Length=919

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 91/148 (61%), Gaps = 30/148 (20%)
 Frame = -1

Query  405  QLVTSLIK-----RKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLH  241
            QL++S+IK      +R +++++Y + F GFSA LT  EA  ++    VV+V PD +LQLH
Sbjct  24   QLLSSIIKPSKENYERMSIIHNYNHAFRGFSAMLTELEASVLSDHEEVVTVLPDTMLQLH  83

Query  240  TTQSWDFLDS--------FSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESAS  85
            TT+SWDFL+          SDK +S+ +                 IIGI+DTGIWPES S
Sbjct  84   TTRSWDFLEGKAGRLSTWTSDKHLSSDV-----------------IIGIIDTGIWPESPS  126

Query  84   FHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            FHD GMGP+P+RWKG C +G DF  S+C
Sbjct  127  FHDVGMGPVPSRWKGACMEGFDFKKSHC  154



>ref|XP_002980086.1| hypothetical protein SELMODRAFT_419592 [Selaginella moellendorffii]
 gb|EFJ18956.1| hypothetical protein SELMODRAFT_419592 [Selaginella moellendorffii]
Length=699

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = -1

Query  405  QLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSW  226
            Q++ S+   K ++LV+SY +GF+GFSA LTA EA SIA+ PGVV VF    L LHTT+SW
Sbjct  50   QILASVKGSKESSLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSKKLSLHTTRSW  109

Query  225  DFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            DFLDSFS               Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RW
Sbjct  110  DFLDSFSGGP----------HIQLNSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRW  159

Query  45   KGKCEKGDDFNSSN  4
            KG C+     N S+
Sbjct  160  KGVCDNSKITNHSH  173



>ref|XP_011004403.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=759

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            I++ + + +YSY +GF GF+A+LT E+A  IAQ PGVVSVFP+   +LHTT+SWDF+   
Sbjct  61   IEQAQASHLYSYRHGFRGFAAKLTDEQASQIAQMPGVVSVFPNLKRKLHTTRSWDFMGLL  120

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    ++IIG +DTGIWPES SF D  M P+PARW+G+CE 
Sbjct  121  GEETMEIP--------GHSTENQVNVIIGFIDTGIWPESPSFSDANMPPVPARWRGECEP  172

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  173  GEAFNASSC  181



>ref|XP_002987481.1| hypothetical protein SELMODRAFT_426260 [Selaginella moellendorffii]
 gb|EFJ11568.1| hypothetical protein SELMODRAFT_426260 [Selaginella moellendorffii]
Length=753

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = -1

Query  405  QLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSW  226
            Q++ S+   K ++LV+SY +GF+GFSA LTA EA SIA+ PGVV VF    L LHTT+SW
Sbjct  50   QILASVKGSKESSLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSKKLSLHTTRSW  109

Query  225  DFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            DFLDSFS               Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RW
Sbjct  110  DFLDSFSGGP----------HIQLNSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRW  159

Query  45   KGKCEKGDDFNSSN  4
            KG C+     N S+
Sbjct  160  KGVCDNSKITNHSH  173



>gb|KDO48661.1| hypothetical protein CISIN_1g0368302mg, partial [Citrus sinensis]
Length=408

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 94/152 (62%), Gaps = 27/152 (18%)
 Frame = -1

Query  420  RKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            + +  QL++S+I   + +R +L++ Y + F GFSA LT  EA +++    VVSVFPDP+L
Sbjct  58   KLNHMQLLSSIIPSEESERLSLIHHYKHAFKGFSAILTDSEASALSGHDHVVSVFPDPVL  117

Query  249  QLHTTQSWDFLDS---------FSDKKISAAIRpgsasaqpsssggadiiigimdtgIWP  97
            QLHTT+SWDFL +         F+ K   AA               +DI+IG++DTGIWP
Sbjct  118  QLHTTRSWDFLAAAAKPAKNTWFNHKYHKAA---------------SDIVIGVIDTGIWP  162

Query  96   ESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            ES SF+D GMG IP+RWKG C +  DF  S+C
Sbjct  163  ESPSFNDQGMGEIPSRWKGVCMESPDFKKSHC  194



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 92/138 (67%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++SL+  K +A   +VYSY +GFSGF+ARLT  +A+ +A  P VV V PD   +L TT
Sbjct  49   QMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKELADSPEVVHVMPDGYYELATT  108

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            ++WD+L       +SAA      +    ++ G  +IIG++DTG+WPES SF D+G+G IP
Sbjct  109  RTWDYLG------LSAA---HPKNLLNDTNMGEHVIIGVIDTGVWPESESFSDNGVGAIP  159

Query  54   ARWKGKCEKGDDFNSSNC  1
             RWKG CE G+DF S+NC
Sbjct  160  KRWKGGCEPGEDFKSTNC  177



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = -1

Query  375  RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKK  196
            + +++YSY +GFSGF+A LT  +A+ IA  PGVV V P+ +L LHTT+SW+FL    +  
Sbjct  31   KQSILYSYKHGFSGFAAVLTQSQAKLIADIPGVVHVIPNRVLNLHTTRSWNFLQ--VNSH  88

Query  195  ISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDF  16
            IS  I          S  GA  IIGI+DTGIWPES SF DDGMG +P+RW+G C++G+ F
Sbjct  89   ISNGI-------LSRSQSGAGSIIGIIDTGIWPESVSFRDDGMGDVPSRWRGICQEGERF  141

Query  15   NSSNC  1
            N S+C
Sbjct  142  NRSHC  146



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++++I   + +R +L++SY + F GFSA LT  EA  ++    +VS+FPDP+LQLHTT
Sbjct  57   QLLSAIIPSSESERISLIHSYNHAFKGFSAMLTQGEASILSGHEEIVSIFPDPLLQLHTT  116

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+  S    +              +   D+IIG++DTGIWPES SF D+G+G IP
Sbjct  117  RSWDFLNVESGITSTPLFH---------HNLSRDVIIGVIDTGIWPESPSFSDNGIGEIP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  168  SRWKGVCMEGSDFKKSNC  185



>ref|XP_004146802.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=733

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 5/125 (4%)
 Frame = -1

Query  375  RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKK  196
            R  +++ Y + F GFSA LT EEA S++   G+VSVFPDP LQLHTT+SWDFLDS S  +
Sbjct  25   RAVVIHQYHHAFKGFSAMLTEEEASSLSGIDGIVSVFPDPTLQLHTTRSWDFLDSISGLR  84

Query  195  ISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDF  16
                          S    +D+I+G++DTGI+PES SF+D+G+G IP++WKG C +  DF
Sbjct  85   PPTP-----LPPPHSYPSSSDVIVGVIDTGIFPESQSFNDEGIGEIPSKWKGVCMEAPDF  139

Query  15   NSSNC  1
              SNC
Sbjct  140  KKSNC  144



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+I R+   R ++ +SY + FSGFSA LT +EA  ++    VVSVFPDP+L+LHTT
Sbjct  55   QLLSSIIPREERDRLSIQHSYQHSFSGFSAMLTEDEASILSAHSKVVSVFPDPVLKLHTT  114

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+  S  +++  +              +DII+G++DTGIWPE  SF D G+G IP
Sbjct  115  RSWDFLEQQSKIRLNYHL----------DQISSDIIVGVIDTGIWPELPSFSDRGVGKIP  164

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG+C +G +F  SNC
Sbjct  165  SRWKGECMEGPNFKKSNC  182



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 94/138 (68%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++SL+  K +A   +V+SY +GFSGF+A+LT  +A+ IA  PGVV V PD + +L TT
Sbjct  53   QMLSSLLGSKEDAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPGVVHVVPDSLYKLATT  112

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            ++WD+L       +SA       +     + G  +IIG +DTG+WPES SF+D+G+GPIP
Sbjct  113  RTWDYL------GLSAP---NPKNLLDDVNMGDQVIIGFIDTGVWPESESFNDNGVGPIP  163

Query  54   ARWKGKCEKGDDFNSSNC  1
            ++WKG CE G++F S+NC
Sbjct  164  SKWKGGCESGENFISTNC  181



>ref|XP_006467138.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=726

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ + + VYSY +GF GF+A+LT ++A  IAQ PGVVSVFP+   +LHTT SWDF+   
Sbjct  28   MEQAQASHVYSYKHGFRGFAAKLTDQQASQIAQMPGVVSVFPNMKRRLHTTHSWDFMGLM  87

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    +II+G +DTGIWPES SF D GM P PA+WKG+CE 
Sbjct  88   GEESMEIP--------GFSTKNQVNIIVGFIDTGIWPESPSFSDIGMPPAPAKWKGQCES  139

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  140  GEAFNASSC  148



>gb|KDO71607.1| hypothetical protein CISIN_1g004205mg [Citrus sinensis]
Length=768

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ + + VYSY +GF GF+A+LT ++A  IAQ PGVVSVFP+   +LHTT SWDF+   
Sbjct  70   MEQAQASHVYSYKHGFRGFAAKLTDQQASQIAQMPGVVSVFPNMKRRLHTTHSWDFMGLM  129

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    +II+G +DTGIWPES SF D GM P PA+WKG+CE 
Sbjct  130  GEESMEIP--------GFSTKNQVNIIVGFIDTGIWPESPSFSDIGMPPAPAKWKGQCES  181

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  182  GEAFNASSC  190



>ref|XP_002960359.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
 gb|EFJ37898.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
Length=756

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = -1

Query  369  ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKI-  193
            AL+YSY + FSGF+A+LT E+   I+  PGV+SVFP  I +LHTT SWDFL    D++  
Sbjct  64   ALIYSYKHAFSGFAAKLTDEQVDRISGLPGVISVFPSGISKLHTTASWDFLGLSVDRRGR  123

Query  192  SAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFN  13
              ++     S   ++  G D+IIG +DTG+WPES SF D+GMGP+P+RW+G C+ G  FN
Sbjct  124  KHSLSRVGGSLWKNTDYGKDVIIGSLDTGVWPESESFSDEGMGPVPSRWRGICQAGQAFN  183

Query  12   SSNC  1
            SS C
Sbjct  184  SSLC  187



>ref|XP_006425216.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
 ref|XP_006467137.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 gb|ESR38456.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
Length=768

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ + + VYSY +GF GF+A+LT ++A  IAQ PGVVSVFP+   +LHTT SWDF+   
Sbjct  70   MEQAQASHVYSYKHGFRGFAAKLTDQQASQIAQMPGVVSVFPNMKRRLHTTHSWDFMGLM  129

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    +II+G +DTGIWPES SF D GM P PA+WKG+CE 
Sbjct  130  GEESMEIP--------GFSTKNQVNIIVGFIDTGIWPESPSFSDIGMPPAPAKWKGQCES  181

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  182  GEAFNASSC  190



>ref|XP_010931718.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=740

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 82/150 (55%), Gaps = 38/150 (25%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            L+TS++  K NAL   VYSY +GFSGF+A LT  +A  +A  P V+SV P    +LHTT+
Sbjct  56   LLTSILGSKENALSSIVYSYRHGFSGFAAMLTESQAELLADSPEVISVKPSRTYELHTTR  115

Query  231  SWDFL-------------DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPES  91
            SWDFL              +F D  I   +                       TGIWPES
Sbjct  116  SWDFLGLDYMHPTELLKKSNFGDGVIIGMVD----------------------TGIWPES  153

Query  90   ASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
             SF+DDG GPIP+RWKG C+ G+ F+++NC
Sbjct  154  KSFNDDGYGPIPSRWKGICQVGEAFDANNC  183



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P V+ V PD  
Sbjct  45   VTESHHQMLSSLLGSKDDAHKSMVYSYRHGFSGFAAKLTKSQAKKIADSPEVIHVIPDGY  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L   +D            +     + G   IIG++DTG+WPES SF+D+
Sbjct  105  YELATTRTWDYLGLSADNS---------KNLLNDKNMGDQTIIGVIDTGVWPESESFNDN  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP+ WKG CE G++F S+NC
Sbjct  156  GVGPIPSHWKGGCEPGENFISTNC  179



>ref|XP_002977793.1| hypothetical protein SELMODRAFT_107351 [Selaginella moellendorffii]
 gb|EFJ21131.1| hypothetical protein SELMODRAFT_107351 [Selaginella moellendorffii]
Length=721

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 3/141 (2%)
 Frame = -1

Query  414  DQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            + ++ V S +K  R ++ +SY +GFSGFSARLT E+A  ++  P V+SVF + I  +HTT
Sbjct  2    NSSKFVYSSVKAARESIGFSYRHGFSGFSARLTEEQAAQLSGLPNVLSVFRNEIHTVHTT  61

Query  234  QSWDFLDSFSDKKIS---AAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
             SW+FL  +   + S   A+    S+     S  G D+IIG++D+G+WPES SF D GMG
Sbjct  62   NSWEFLGLYGSGEKSLFGASEATESSWLWKKSKFGKDVIIGVLDSGVWPESESFSDHGMG  121

Query  63   PIPARWKGKCEKGDDFNSSNC  1
            PIP RWKG CE G+ F SS+C
Sbjct  122  PIPERWKGTCETGEQFRSSHC  142



>gb|KFK44142.1| hypothetical protein AALP_AA1G220500 [Arabis alpina]
Length=706

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++S++KR     ++ Y +GFSGF+A L+ +EA  +A++PGVVSVFPD +L LHT
Sbjct  49   NDHVELLSSMLKRNGKTPMHHYKHGFSGFAAHLSEDEAEMMAKQPGVVSVFPDQMLPLHT  108

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL   S ++        + +         D IIG +D+GIWPES SF+D  MGPI
Sbjct  109  TRSWDFLVQESYQR--DTYYTETNTGPKLDVAVGDTIIGFLDSGIWPESQSFNDGHMGPI  166

Query  57   PARWKGKCEKG  25
            P +WKG C +G
Sbjct  167  PTKWKGTCMRG  177



>ref|XP_002893090.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69349.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++S++KR     ++ Y +GFSGF+A L+ +EA  +A++PGVVSVFPD +LQLHT
Sbjct  46   NDHVELLSSMLKRSGKTPMHRYKHGFSGFAAHLSEDEAHLMAKQPGVVSVFPDQMLQLHT  105

Query  237  TQSWDFL--DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            T+SWDFL  +S+      + I       Q S     D IIG +D+GIWPE+ SF+D  MG
Sbjct  106  TRSWDFLVQESYQRDTYFSEIN----YGQESEVHEGDTIIGFLDSGIWPEAQSFNDRHMG  161

Query  63   PIPARWKGKCEKG  25
            P+P +WKG C +G
Sbjct  162  PVPEKWKGTCMRG  174



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 94/144 (65%), Gaps = 21/144 (15%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQK---PGVVSVFPDPILQL  244
            +++++L+  K   R +++YSY +GFSGF+A LT  +A+ IA     PGVV V P+ IL++
Sbjct  50   EILSTLLGSKQAARESILYSYKHGFSGFAALLTQSQAKLIAVNVDFPGVVRVIPNRILRV  109

Query  243  HTTQSWDFLD---SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            HTT+SWDFL       D  +S +              G D IIG++DTGIWPES SF DD
Sbjct  110  HTTRSWDFLQLKPEIMDGILSRS------------QSGYDSIIGVLDTGIWPESESFKDD  157

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG +P+RW G C++G++FN+SNC
Sbjct  158  GMGEVPSRWNGVCQEGEEFNASNC  181



>ref|NP_001046517.1| Os02g0269600 [Oryza sativa Japonica Group]
 dbj|BAD28637.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08431.1| Os02g0269600 [Oryza sativa Japonica Group]
 gb|EAY85318.1| hypothetical protein OsI_06696 [Oryza sativa Indica Group]
 gb|EAZ22529.1| hypothetical protein OsJ_06196 [Oryza sativa Japonica Group]
Length=735

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = -1

Query  399  VTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +T +I  K  A+   VYSY +GFSGF+A LT  +A  +A+ PGV++V P+   + HTT+S
Sbjct  54   LTFVIGSKDGAMKSIVYSYKHGFSGFAAMLTESQAEELAKYPGVINVKPNTYGKAHTTRS  113

Query  228  WDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            WDFL     +K S  ++                I        WPES SF+DDG GP+PAR
Sbjct  114  WDFLGLNYYEK-SGVLKDAMYGEDVIIGVVDTGI--------WPESPSFNDDGYGPVPAR  164

Query  48   WKGKCEKGDDFNSSNC  1
            WKG C+ GD FN++NC
Sbjct  165  WKGVCQTGDAFNTTNC  180



>gb|EMT32761.1| Subtilisin-like protease [Aegilops tauschii]
Length=779

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 89/141 (63%), Gaps = 10/141 (7%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            MR    +++ S++ +++  L +SY + F GF+A LT EEA +++    VVSVF DP+L L
Sbjct  53   MRAAHLEMLASIVPQEQRWLTHSYHHAFEGFAAELTEEEALALSAHERVVSVFRDPVLLL  112

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFLD  S  +              +     D+IIG++DTGIWPES SF+DDGMG
Sbjct  113  HTTRSWDFLDMQSGFRPDGG----------APQASGDVIIGVIDTGIWPESPSFNDDGMG  162

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             +P+RW+G C +G  F  S+C
Sbjct  163  DVPSRWRGLCMQGPSFKKSSC  183



>ref|XP_006416427.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
 gb|ESQ34780.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
Length=779

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++SL KR   +  + Y +GFSGF+A L+ EEAR +A +PGVVSVFPD IL LHT
Sbjct  48   NDHVELLSSLFKRSGKSPTHRYKHGFSGFAAHLSEEEARIMANQPGVVSVFPDQILPLHT  107

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL   S ++          S         D IIG +D+GIWPES SF D  M P+
Sbjct  108  TRSWDFLVQESYQR--ETYFTDMNSQPELDVAVGDTIIGFIDSGIWPESQSFEDRHMRPV  165

Query  57   PARWKGKCEKG  25
            PA+WKG C +G
Sbjct  166  PAKWKGTCMRG  176



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   +++R +L+ SY + F GFSA LT +EA  ++    VVSVFPD ILQLHTT
Sbjct  55   QMLSSVIPSEEKERVSLMQSYHHAFKGFSAMLTEKEAALLSGFDEVVSVFPDRILQLHTT  114

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLD+ S    S  +R             +D+IIGI+DTG+WPES SF+D GMG IP
Sbjct  115  RSWDFLDAESGIG-SQRLR---------RKASSDVIIGIIDTGVWPESPSFNDAGMGRIP  164

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  165  SRWKGICMEGSDFKKSNC  182



>ref|XP_006370742.1| hypothetical protein POPTR_0001s460001g, partial [Populus trichocarpa]
 gb|ERP67311.1| hypothetical protein POPTR_0001s460001g, partial [Populus trichocarpa]
Length=350

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ + + +Y+Y +GF GF+A+LT E+A  IA+ PGVVSVFP+   +LHTT SWDF+   
Sbjct  61   VEQAQASHLYTYRHGFKGFAAKLTDEQASQIAKMPGVVSVFPNSKRKLHTTHSWDFMGLV  120

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    ++IIG +DTGIWPES SF D  M P+PARW+GKC+ 
Sbjct  121  GEETMEIP--------GHSTKNQVNVIIGFIDTGIWPESPSFSDADMPPVPARWRGKCQL  172

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  173  GEAFNASSC  181



>ref|XP_002967356.1| hypothetical protein SELMODRAFT_408319 [Selaginella moellendorffii]
 gb|EFJ31955.1| hypothetical protein SELMODRAFT_408319 [Selaginella moellendorffii]
Length=756

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = -1

Query  369  ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKI-  193
            AL+YSY + FSGF+A+LT E+   I+  PGV+SVFP  I +LHTT SWDFL    D++  
Sbjct  64   ALIYSYKHAFSGFAAKLTDEQVDRISGLPGVISVFPSGISKLHTTASWDFLGLSVDRRGR  123

Query  192  SAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFN  13
              ++     S   ++  G D+IIG +DTG+WPES SF D+GMGP+P+RW+G C+ G  FN
Sbjct  124  KHSLSRVGGSLWKNTDYGKDVIIGSLDTGVWPESESFSDEGMGPVPSRWRGICQAGQAFN  183

Query  12   SSNC  1
            S+ C
Sbjct  184  STLC  187



>gb|KDO48658.1| hypothetical protein CISIN_1g028958mg [Citrus sinensis]
Length=201

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 93/141 (66%), Gaps = 8/141 (6%)
 Frame = -1

Query  411  QAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSI-AQKPGVVSVFPDPILQL  244
              QL++S+I   +  R +L++ Y + F GFSA LT +EA  + A    +VSVFPDP+L+L
Sbjct  63   HLQLLSSIIPSEESDRISLIHHYKHSFKGFSAMLTEKEASVLSAGHEKIVSVFPDPVLKL  122

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL++ ++ K + +    + S+    +  +D+IIGI+DTGIWPES SF D GM 
Sbjct  123  HTTRSWDFLEAEAEAKATTS----TWSSHKYHNISSDVIIGIIDTGIWPESPSFKDRGMS  178

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP++WKG C    DF  SNC
Sbjct  179  EIPSKWKGVCMDSHDFKKSNC  199



>ref|XP_003581342.1| PREDICTED: subtilisin-like protease SBT3.3 [Brachypodium distachyon]
Length=740

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 11/137 (8%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++TS++  K  AL   VYSY +GFSGF+A LT  +A +IA+ P V+SV P+   Q HTT+
Sbjct  51   VLTSVLGSKDEALQSIVYSYKHGFSGFAAMLTKSQAETIAKFPEVISVKPNTYHQAHTTR  110

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SWDFLD    ++ ++ ++         ++ G D IIG++D+GIWPES SF D G GP+PA
Sbjct  111  SWDFLDLDYTQQPASLLQ--------KANYGEDTIIGVIDSGIWPESPSFDDAGYGPVPA  162

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C+ G +FN++ C
Sbjct  163  RWKGTCQTGQEFNATGC  179



>ref|XP_002987482.1| hypothetical protein SELMODRAFT_426261 [Selaginella moellendorffii]
 gb|EFJ11569.1| hypothetical protein SELMODRAFT_426261 [Selaginella moellendorffii]
Length=749

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  405  QLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSW  226
            Q++ S+   K ++LV+SY +GF+GFSA LT  EA SIA+ PGVV VF    L LHTT+SW
Sbjct  50   QILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTRSW  109

Query  225  DFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            DFLDSFS               Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RW
Sbjct  110  DFLDSFSGGP----------HIQINSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRW  159

Query  45   KGKCEKGDDFNSSN  4
            KG C+     N S+
Sbjct  160  KGVCDNSKITNHSH  173



>ref|XP_002980084.1| hypothetical protein SELMODRAFT_419590 [Selaginella moellendorffii]
 gb|EFJ18954.1| hypothetical protein SELMODRAFT_419590 [Selaginella moellendorffii]
Length=752

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  405  QLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSW  226
            Q++ S+   K ++LV+SY +GF+GFSA LT  EA SIA+ PGVV VF    L LHTT+SW
Sbjct  50   QILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTRSW  109

Query  225  DFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            DFLDSFS               Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RW
Sbjct  110  DFLDSFSGGP----------HIQLNSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRW  159

Query  45   KGKCEKGDDFNSSN  4
            KG C+     N S+
Sbjct  160  KGVCDNSKVTNHSH  173



>ref|XP_008231725.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=775

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 93/138 (67%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   + +R ++++ Y + F GFSA LT  EA  ++    VVS+FPD IL+LHTT
Sbjct  59   QMLSSIIPSHEIERISIIHKYNHAFRGFSAMLTETEASILSGHDDVVSIFPDSILELHTT  118

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+S S +  S   +             +D+IIG++DTGIWPES+SF+D+G+G +P
Sbjct  119  RSWDFLESESGRLPSNKYQ---------RGLSSDVIIGMIDTGIWPESSSFNDEGIGAVP  169

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  170  SRWKGVCMEGSDFRKSNC  187



>ref|XP_002994537.1| hypothetical protein SELMODRAFT_432452 [Selaginella moellendorffii]
 gb|EFJ04398.1| hypothetical protein SELMODRAFT_432452 [Selaginella moellendorffii]
Length=749

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  405  QLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSW  226
            Q++ S+   K ++LV+SY +GF+GFSA LT  EA SIA+ PGVV VF    L LHTT+SW
Sbjct  50   QILASVKGSKESSLVHSYKHGFNGFSAFLTEAEADSIAKLPGVVKVFRSKKLSLHTTRSW  109

Query  225  DFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARW  46
            DFLDSFS               Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RW
Sbjct  110  DFLDSFSGGP----------HIQINSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRW  159

Query  45   KGKCEKGDDFNSSN  4
            KG C+     N S+
Sbjct  160  KGVCDNSKITNHSH  173



>gb|EMS68678.1| Subtilisin-like protease [Triticum urartu]
Length=738

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 80/139 (58%), Gaps = 13/139 (9%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++TS+   K  AL   VYSY +GFSGF+A LT  +A +IA+ P VV+V P+   + HTT+
Sbjct  51   MLTSVFGSKDEALRSIVYSYKHGFSGFAAMLTESQAETIAKFPEVVTVKPNTYHETHTTR  110

Query  231  SWDFL--DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            SWDFL  D    ++    +R                I        WPES SF D+G GP+
Sbjct  111  SWDFLGLDHNQARQQPGLLRKAKYGEDVIVGVIDTGI--------WPESRSFDDNGYGPV  162

Query  57   PARWKGKCEKGDDFNSSNC  1
            PARWKGKC+ G DFN+++C
Sbjct  163  PARWKGKCQTGQDFNATSC  181



>ref|XP_002525580.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF36839.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=777

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 92/138 (67%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+I   + +R +LV+ Y++ F+GFSA LT  EA  ++    VVSVF DP L+LHTT
Sbjct  61   QLLSSIIPSHESERISLVHHYSHAFTGFSAMLTEIEASELSGHERVVSVFKDPTLKLHTT  120

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL++ S  + S          Q  S   +D+IIG++DTGIWPES SF D G+G IP
Sbjct  121  RSWDFLEANSGMQSS----------QKYSHLSSDVIIGVIDTGIWPESPSFSDKGLGEIP  170

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  171  SRWKGVCMEGHDFKKSNC  188



>ref|XP_011098007.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=764

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSL----IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDP  256
            +R++  +L+T+L    +++ + + VYSY +GF GF+ARLT E+A  +A+ PGVVSVFP+ 
Sbjct  51   LRQNH-ELLTALHRGSVEQAKASHVYSYRHGFRGFAARLTEEQASEVAEMPGVVSVFPNT  109

Query  255  ILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
               LHTT SWDF+    ++ +             S+    ++IIG +DTGIWPES SF D
Sbjct  110  KRSLHTTHSWDFMGLVGEETMEIP--------GFSTKNQVNVIIGFIDTGIWPESPSFSD  161

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             GM P+P  WKG+C+ G+ FN S C
Sbjct  162  AGMPPVPDGWKGQCQPGEAFNISTC  186



>gb|KCW65828.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=472

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRKRN---ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+  R++N   +L++ Y + F GFSA LT  EA  ++    V+SVFPDP+LQLHTT
Sbjct  58   QLLSSISSRQKNQKVSLLHHYNHAFRGFSAMLTESEASKLSGHEKVLSVFPDPLLQLHTT  117

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+  S  +          +   +     D+IIG++DTGIWPES SF D+G+  +P
Sbjct  118  RSWDFLEVGSSDQ----------ARSQNHHPSNDVIIGVIDTGIWPESPSFGDEGVNEVP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            ARWKG C +  DF  +NC
Sbjct  168  ARWKGTCMEASDFKKANC  185



>gb|AAF79898.1|AC022472_7 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082 [Arabidopsis 
thaliana]
Length=779

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++SL++R     ++ Y +GFSGF+A L+ +EA  IA++PGV+SVFPD +LQLHT
Sbjct  47   NDHVELLSSLLQRSGKTPMHRYKHGFSGFAAHLSEDEAHLIAKQPGVLSVFPDQMLQLHT  106

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL   S ++ +          Q S     D IIG +D+GIWPE+ SF+D  MGP+
Sbjct  107  TRSWDFLVQESYQRDTYFTE--MNYEQESEMHEGDTIIGFLDSGIWPEAQSFNDRHMGPV  164

Query  57   PARWKGKCEKG  25
            P +WKG C +G
Sbjct  165  PEKWKGTCMRG  175



>ref|XP_002986914.1| hypothetical protein SELMODRAFT_425830 [Selaginella moellendorffii]
 gb|EFJ11996.1| hypothetical protein SELMODRAFT_425830 [Selaginella moellendorffii]
Length=768

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -1

Query  399  VTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDF  220
            V   +K  R ++ +SY +GFSGFSARLT E+A  ++  P V+SVF + I  +HTT SW+F
Sbjct  55   VLGSVKAARESIGFSYRHGFSGFSARLTEEQAAKLSGLPNVLSVFRNEIHTVHTTNSWEF  114

Query  219  LDSFSDKKIS---AAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            L  +   + S   A+    S+     S  G D+IIG++D+G+WPES SF D GMGPIP R
Sbjct  115  LGLYGSGEKSLFGASEATESSWLWKKSKFGKDVIIGVLDSGVWPESESFSDHGMGPIPER  174

Query  48   WKGKCEKGDDFNSSNC  1
            WKG CE G+ FN+S+C
Sbjct  175  WKGTCETGEQFNASHC  190



>ref|NP_564106.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AEE29944.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=780

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++SL++R     ++ Y +GFSGF+A L+ +EA  IA++PGV+SVFPD +LQLHT
Sbjct  48   NDHVELLSSLLQRSGKTPMHRYKHGFSGFAAHLSEDEAHLIAKQPGVLSVFPDQMLQLHT  107

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL   S ++ +          Q S     D IIG +D+GIWPE+ SF+D  MGP+
Sbjct  108  TRSWDFLVQESYQRDTYFTE--MNYEQESEMHEGDTIIGFLDSGIWPEAQSFNDRHMGPV  165

Query  57   PARWKGKCEKG  25
            P +WKG C +G
Sbjct  166  PEKWKGTCMRG  176



>ref|XP_011038086.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=761

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ R + +Y+Y +GF GF+A+LT E+A  IA+ PGVVSVFP+   +LHTT SWDF    
Sbjct  63   VEQARASHLYTYRHGFKGFAAKLTDEQASQIAKMPGVVSVFPNSKRKLHTTHSWDF----  118

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
                I  A          S+    ++IIG +DTGIWPES SF D  M P+PARW+GKC+ 
Sbjct  119  ----IGLAGEETMEIPGHSTKNQVNVIIGFIDTGIWPESPSFSDADMPPVPARWRGKCQL  174

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  175  GEAFNASSC  183



>ref|XP_010270603.1| PREDICTED: subtilisin-like protease SBT5.3 [Nelumbo nucifera]
Length=759

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 87/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            I++ + + VYSY +GF GF+A+LT  +A  I++ PGVVSVFP+    LHTT SWDF+   
Sbjct  61   IEQAQASHVYSYRHGFRGFAAKLTDSQALEISRMPGVVSVFPNLKRTLHTTHSWDFMGLV  120

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
            SD+++             S+    ++IIG +DTGIWPES SF D  M P+P+RWKG+C+ 
Sbjct  121  SDEEMEIP--------GYSTKNQENVIIGFIDTGIWPESPSFSDYDMPPVPSRWKGQCQA  172

Query  27   GDDFNSSNC  1
            G++FN+S+C
Sbjct  173  GEEFNASSC  181



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q++ SL+  K   R+++VYSY +GFSGF+A+LT  +A+ +A  PGVV V P   
Sbjct  58   VTESHHQMLWSLLGSKEDARDSMVYSYRHGFSGFAAKLTKSQAKKLADLPGVVHVIPHSF  117

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      +    ++ G  +IIGI+DTG+WPES  F+D+
Sbjct  118  YKLSTTRTWDYLG------LSAA---NPKNLLNETNMGEQMIIGIIDTGVWPESEVFNDN  168

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GP+P+ WKG CE G+ FNSS+C
Sbjct  169  GIGPVPSHWKGGCESGEMFNSSHC  192



>gb|EMS61069.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 80/139 (58%), Gaps = 13/139 (9%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++TS+   K  AL   VYSY +GFSGF+A LT  +A +IA+ P VV+V P+   + H T+
Sbjct  51   MLTSVFGSKDEALRSIVYSYKHGFSGFAAMLTESQAETIAKFPEVVTVKPNTYHETHKTR  110

Query  231  SWDFL--DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            SWDFL  D    ++ S  +R                I        WPES SF D+G GP+
Sbjct  111  SWDFLGLDRNQPRQQSGLLRKAKYGEDVIVGVIDTGI--------WPESRSFDDNGYGPV  162

Query  57   PARWKGKCEKGDDFNSSNC  1
            PARWKGKC+ G DFN+++C
Sbjct  163  PARWKGKCQTGQDFNATSC  181



>ref|XP_010477248.1| PREDICTED: CO(2)-response secreted protease [Camelina sativa]
Length=776

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = -1

Query  417  KDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
             D  +L++S++KR     ++ Y +GFSGF+A L+  EA  +A++PGVVSVFPD +LQLHT
Sbjct  48   NDHVELLSSMLKRSGKTPMHRYKHGFSGFAAHLSEGEAHLMAKQPGVVSVFPDQMLQLHT  107

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T+SWDFL   S ++            Q       D IIG +D+GIWPE+ SF D  MGP+
Sbjct  108  TRSWDFLVQESYQR--ETYFTEMNYQQELDVHAGDTIIGFVDSGIWPEAQSFDDRRMGPV  165

Query  57   PARWKGKCEKG  25
            P RWKG C +G
Sbjct  166  PERWKGTCMRG  176



>ref|XP_004287692.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 8/136 (6%)
 Frame = -1

Query  408  AQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            A + T  I+  + + ++SY +GF GF+ARLT  +A  I++ PGVVSVFP+    LHTT S
Sbjct  58   ASVHTGSIEDAQASHIHSYRHGFKGFAARLTDHQASQISKMPGVVSVFPNSKRSLHTTHS  117

Query  228  WDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            WDF+    ++ +  +          +     ++I+G +DTGIWPES SF+D  M P+PAR
Sbjct  118  WDFMGLLGEQTLEVS--------GFNIKNQVNVIVGFIDTGIWPESPSFNDANMPPVPAR  169

Query  48   WKGKCEKGDDFNSSNC  1
            WKG C+ G+ FNSS C
Sbjct  170  WKGVCQSGEAFNSSTC  185



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q++ SL+  K +A   LVYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  51   VTESHHQMLWSLLGSKEDAHESLVYSYRHGFSGFAAKLTKSQAKKIADVPEVVHVIPDSF  110

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      +    ++ GA  IIG++DTG+WPES  F+D 
Sbjct  111  YKLKTTRTWDYLG------LSAA---NPKNLLNETNMGAQSIIGVIDTGVWPESEVFNDH  161

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GP+P+ WKG CE G+ FNSS+C
Sbjct  162  GIGPVPSHWKGGCESGEAFNSSHC  185



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            ++++S+I   +R+R ++++ Y + F GFSA LT  EA +++    VVS+FPD IL+LHTT
Sbjct  51   EMLSSIIPSHQRERTSIIHKYNHAFRGFSAMLTESEASALSGHADVVSIFPDSILELHTT  110

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDF+        + A   G +     ++   D+IIG++DTGIWPES SF+D+G+G +P
Sbjct  111  RSWDFIQE------AGAEPGGVSYHPRPTTTSDDVIIGVIDTGIWPESPSFNDEGIGAVP  164

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  165  SRWKGVCMEGPDFKKSNC  182



>emb|CDY57477.1| BnaAnng14590D [Brassica napus]
Length=781

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ +L+ R+   R   V+ Y + F GFSA LT EEA +++    VVSVF DP+LQLHTT
Sbjct  55   QMLDTLLPREESERRKGVHHYKHAFRGFSAMLTEEEAAALSGHDEVVSVFEDPMLQLHTT  114

Query  234  QSWDFLDSFSDKK--------------ISAAIRpgsasaqpsssggadiiigimdtgIWP  97
            +SWDFLDS S +               I   +     +   S +        I    IWP
Sbjct  115  RSWDFLDSLSGESSSFPIYNSFHGSSDIIIGVVDTGENTITSLTLLNRDSQEIDSRSIWP  174

Query  96   ESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            ES SF D G G IP++WKG C +G DFN S+C
Sbjct  175  ESPSFSDKGFGEIPSKWKGICMEGPDFNKSSC  206



>ref|XP_006471314.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 94/152 (62%), Gaps = 27/152 (18%)
 Frame = -1

Query  420  RKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            + +  QL++S+I   + +R +L++ Y + F GFSA LT  EA +++    VVSVFPDP+L
Sbjct  58   KLNHMQLLSSIIPSEESERLSLIHHYKHAFKGFSAILTDSEASALSGHDHVVSVFPDPVL  117

Query  249  QLHTTQSWDFLDS---------FSDKKISAAIRpgsasaqpsssggadiiigimdtgIWP  97
            QLHTT+SWDFL +         F+ K   AA               +DI+IG++DTGIWP
Sbjct  118  QLHTTRSWDFLAAAAKPAKNTWFNHKYHKAA---------------SDIVIGVIDTGIWP  162

Query  96   ESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            ES SF+D GMG IP+RWKG C +  DF  S+C
Sbjct  163  ESPSFNDQGMGEIPSRWKGVCMESPDFKKSHC  194



>ref|XP_010908011.1| PREDICTED: CO(2)-response secreted protease-like [Elaeis guineensis]
Length=740

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (65%), Gaps = 13/144 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            ++ D  Q+++S+I   +++R +L+ SY +   GF+A LT +EA  ++   GV+SVF D I
Sbjct  13   IQADHLQMLSSIIPSEEKERVSLIQSYHHALQGFTAMLTEKEATLLSGHDGVLSVFRDRI  72

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            LQLHTT+SWDFL+  S  +          S +      +DIIIGI+DTGIWPES SF D 
Sbjct  73   LQLHTTRSWDFLEKESGLR----------SERLKQRASSDIIIGIVDTGIWPESPSFSDA  122

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG IP+RWKG C +G DF  SNC
Sbjct  123  GMGKIPSRWKGICMEGSDFKKSNC  146



>ref|XP_002991849.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
 gb|EFJ07111.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
Length=753

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -1

Query  405  QLVTSLIK----RKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
            Q+++S+ +    + + ++VYSY +GF GFSARL+ E+A  +++K GVV+VFP    QLHT
Sbjct  18   QVLSSVFQNGYDQAKESMVYSYKHGFRGFSARLSQEQAFDLSKKDGVVAVFPSMPRQLHT  77

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T SW+FL      + S  ++  + S   SS   +++I+G++DTGIWPES+SF D  M P+
Sbjct  78   THSWEFL----GLQQSQGLKHEARSLPHSSKQQSNVIVGVLDTGIWPESSSFSDSLMPPV  133

Query  57   PARWKGKCEKGDDFNSSNC  1
            P+RWKG+CE G+ FN+S+C
Sbjct  134  PSRWKGECEAGELFNASHC  152



>ref|XP_007220237.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
 gb|EMJ21436.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
Length=741

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 93/138 (67%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   + +R ++++ Y + F GFSA LT  EA  ++    VVS+FPD IL+LHTT
Sbjct  25   QMLSSIIPSHEIERLSIIHKYNHAFRGFSAMLTETEASVLSGHDDVVSIFPDSILELHTT  84

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL++ S +  S   +             +D+IIG++DTGIWPES+SF+D+G+G +P
Sbjct  85   RSWDFLEAESGRLPSNKYQ---------RGLSSDVIIGMIDTGIWPESSSFNDEGIGAVP  135

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  136  SRWKGVCMEGSDFRKSNC  153



>gb|KCW53325.1| hypothetical protein EUGRSUZ_J02574 [Eucalyptus grandis]
Length=705

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -1

Query  363  VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKISAA  184
            +YSY +GF GF+A++T ++A  IA+ PGVVSVFP+   +LHTT SWDF+    ++ +   
Sbjct  14   LYSYRHGFRGFAAKITDQQASEIAKMPGVVSVFPNTKRKLHTTHSWDFMGLVGEETMEIP  73

Query  183  IRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFNSSN  4
                      S+    ++I+G +DTGIWPES SF D+GM P+PA+WKG+C+ G+ FN S+
Sbjct  74   --------GYSTKNQVNVIVGFIDTGIWPESPSFSDEGMPPVPAKWKGQCQSGEAFNVSS  125

Query  3    C  1
            C
Sbjct  126  C  126



>gb|AAD03431.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 45.8, E=1.1e-11, n=2) [Arabidopsis thaliana]
Length=751

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   +++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  50   VTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSF  109

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      S    ++ G  IIIG++DTG+WPES  F+D 
Sbjct  110  YKLATTRTWDYLG------LSAA---NPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDS  160

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G GP+P+ WKG CE G++FNSSNC
Sbjct  161  GFGPVPSHWKGGCETGENFNSSNC  184



>ref|XP_008242125.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 88/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  405  QLVTSL----IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHT  238
            QL+ S+    I++ + + +YSY +GF  F+A+LT  +A  I++ PGVVSVFP+    LHT
Sbjct  55   QLLASVHGGSIEQAQESHIYSYRHGFRAFAAKLTDLQAFQISKMPGVVSVFPNLKRSLHT  114

Query  237  TQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPI  58
            T SWDF+    ++ +             S+    ++I+G +DTGIWPES SF+DD M P+
Sbjct  115  THSWDFMGLLGEETMEIT--------GFSTKNQVNVIVGFIDTGIWPESPSFNDDNMPPV  166

Query  57   PARWKGKCEKGDDFNSSNC  1
            PARWKG CE G+ FN+S C
Sbjct  167  PARWKGHCESGEAFNASTC  185



>ref|XP_009355089.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 91/138 (66%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S++   + +R +++++Y + F GFSA LT  EA  ++   G+VS+FPD +LQLHTT
Sbjct  66   QMLSSIVPSHEIERISVIHNYNHAFRGFSAMLTETEASILSGNNGIVSIFPDSMLQLHTT  125

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+S   + +                  +D+IIG++DTGIWPES SF D+G+G +P
Sbjct  126  RSWDFLESELARPLK----------NKYLHPSSDVIIGMIDTGIWPESPSFSDEGIGAVP  175

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  176  SRWKGVCMEGSDFKKSNC  193



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   Q+++SL+  K++A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V  D  
Sbjct  796  VTKSHHQMLSSLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVILDVF  855

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      +    ++ G  +IIG++DTG+WPES SF+D+
Sbjct  856  YKLATTRTWDYLG------LSAA---NPKNLLNDTNMGDQVIIGVIDTGVWPESESFNDN  906

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP +WKG CE G++F S+NC
Sbjct  907  GVGPIPRKWKGGCELGENFRSTNC  930


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ +A  P VV V  D  
Sbjct  46   VTESHHQMLLSLLGSKADAHDSMVYSYRHGFSGFAAKLTDSQAKKLADSPEVVHVMADSF  105

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L   +   I+             ++ G  +IIG +DTG+WPES SF+D+
Sbjct  106  YELATTRTWDYLGLSAANPIN---------LLNDTNMGDQVIIGFIDTGVWPESESFNDN  156

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP+ WKG CE G+ F S+NC
Sbjct  157  GVGPIPSHWKGGCEPGEKFISTNC  180



>ref|XP_002317030.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
 gb|EEE97642.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
Length=759

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            I++ + + +YSY +GF GF+A+LT E+A  IAQ PGVVSVFP+   +LHTT+SWDF+   
Sbjct  61   IEQAQASHLYSYRHGFRGFAAKLTDEQASQIAQMPGVVSVFPNLKRKLHTTRSWDFMGLL  120

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
             ++ +             S+    ++IIG +DTGIWPES SF D  M P+PA W+G+CE 
Sbjct  121  GEETMEIP--------GHSTKNQVNVIIGFIDTGIWPESPSFSDANMPPVPAIWRGECEP  172

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  173  GEAFNASSC  181



>ref|XP_010101169.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB87530.1| Subtilisin-like protease [Morus notabilis]
Length=769

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 80/146 (55%), Gaps = 5/146 (3%)
 Frame = -1

Query  423  MRKDQAQLVTSL----IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDP  256
            + ++  Q++ S+    +++ + + VYSY +GF GF+ARLT ++   I++ PGVVSVFP+ 
Sbjct  42   IMRNNHQILASVHGGSVEQAQASHVYSYRHGFRGFAARLTDDQVSQISKMPGVVSVFPNC  101

Query  255  ILQLHTTQSWDFLDSFSDKKISA-AIRpgsasaqpsssggadiiigimdtgIWPESASFH  79
               LHTT SWDF+    D  +        +                     IWPES SF 
Sbjct  102  KRVLHTTHSWDFMGLLDDDTMEVLGYDTKNQVNIVVGFIDTGKKEESFPNRIWPESPSFS  161

Query  78   DDGMGPIPARWKGKCEKGDDFNSSNC  1
            D GM P+PA WKG+C+ G+ FNSS C
Sbjct  162  DVGMPPVPASWKGRCQPGEAFNSSTC  187



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   +++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  50   VTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSF  109

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      S    ++ G  IIIG++DTG+WPES  F+D 
Sbjct  110  YKLATTRTWDYLG------LSAA---NPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDS  160

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G GP+P+ WKG CE G++FNSSNC
Sbjct  161  GFGPVPSHWKGGCETGENFNSSNC  184



>ref|XP_010033628.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=764

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -1

Query  363  VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKISAA  184
            +YSY +GF GF+A++T ++A  IA+ PGVVSVFP+   +LHTT SWDF+    ++ +   
Sbjct  73   LYSYRHGFRGFAAKITDQQASEIAKMPGVVSVFPNTKRKLHTTHSWDFMGLVGEETMEIP  132

Query  183  IRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFNSSN  4
                      S+    ++I+G +DTGIWPES SF D+GM P+PA+WKG+C+ G+ FN S+
Sbjct  133  --------GYSTKNQVNVIVGFIDTGIWPESPSFSDEGMPPVPAKWKGQCQSGEAFNVSS  184

Query  3    C  1
            C
Sbjct  185  C  185



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   +++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  66   VTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSF  125

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L       +SAA      S    ++ G  IIIG++DTG+WPES  F+D 
Sbjct  126  YKLATTRTWDYLG------LSAA---NPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDS  176

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G GP+P+ WKG CE G++FNSSNC
Sbjct  177  GFGPVPSHWKGGCETGENFNSSNC  200



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 90/137 (66%), Gaps = 12/137 (9%)
 Frame = -1

Query  402  LVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD   +L TT+
Sbjct  1    MLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSFYKLATTR  60

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            +WD+L       +SAA      S    ++ G  IIIG++DTG+WPES  F+D G GP+P+
Sbjct  61   TWDYLG------LSAA---NPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDSGFGPVPS  111

Query  51   RWKGKCEKGDDFNSSNC  1
             WKG CE G++FNSSNC
Sbjct  112  HWKGGCETGENFNSSNC  128



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 76/141 (54%), Gaps = 29/141 (21%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQL  244
            +RKD   ++  +++R   ALV++Y  GFSGF+ARL+  EA SIAQ+PGVVSVF DPIL+L
Sbjct  50   LRKDHDHVLNMVLRRNEKALVHNYKYGFSGFAARLSKNEANSIAQQPGVVSVFLDPILKL  109

Query  243  HTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMG  64
            HTT+SWDFL+S +  +I   +   + S+                                
Sbjct  110  HTTRSWDFLNSQTYVEIDNTLSSSTPSSSDIC----------------------------  141

Query  63   PIPARWKGKCEKGDDFNSSNC  1
             IP  W G C    DFNSSNC
Sbjct  142  -IPTGWNGTCMTSKDFNSSNC  161



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P V+ V PD  
Sbjct  45   VTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKLTKSQAKKIADSPEVIHVIPDSY  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT+ WD+L   +D            +    ++ G   IIG++DTG+WPES SF+D 
Sbjct  105  YELATTRIWDYLGPSADNS---------KNLVSDTNMGDQTIIGVIDTGVWPESESFNDY  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GP+P+ WKG CE G++F S+NC
Sbjct  156  GVGPVPSHWKGGCEPGENFISTNC  179



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P V+ V PD  
Sbjct  45   VTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKLTKSQAKKIADSPEVIHVIPDSY  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT+ WD+L   +D            +    ++ G   IIG++DTG+WPES SF+D 
Sbjct  105  YELATTRIWDYLGPSADNS---------KNLVSDTNMGDQTIIGVIDTGVWPESESFNDY  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GP+P+ WKG CE G++F S+NC
Sbjct  156  GVGPVPSHWKGGCEPGENFISTNC  179



>gb|KCW53324.1| hypothetical protein EUGRSUZ_J02574 [Eucalyptus grandis]
Length=911

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -1

Query  363  VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKISAA  184
            +YSY +GF GF+A++T ++A  IA+ PGVVSVFP+   +LHTT SWDF+    ++ +   
Sbjct  220  LYSYRHGFRGFAAKITDQQASEIAKMPGVVSVFPNTKRKLHTTHSWDFMGLVGEETMEIP  279

Query  183  IRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFNSSN  4
                      S+    ++I+G +DTGIWPES SF D+GM P+PA+WKG+C+ G+ FN S+
Sbjct  280  --------GYSTKNQVNVIVGFIDTGIWPESPSFSDEGMPPVPAKWKGQCQSGEAFNVSS  331

Query  3    C  1
            C
Sbjct  332  C  332



>ref|XP_010931731.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=712

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 93/137 (68%), Gaps = 12/137 (9%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++TSL++ K  AL   VYSY +GFSGF+A LT  +A+ +A+ P V+S+ P    QLHTT+
Sbjct  34   MLTSLLESKEEALASIVYSYRHGFSGFAAMLTESQAKLLAESPEVISIRPSRNYQLHTTR  93

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            SW+FL   ++   +  +R         S+ G  +IIGI+DTGIWPES SF+DDG GP P+
Sbjct  94   SWNFL-GLNNVHPTELLR--------KSNFGDGVIIGIIDTGIWPESKSFNDDGYGPTPS  144

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C+ G+ F+++NC
Sbjct  145  RWKGICQVGEAFDANNC  161



>ref|XP_010091320.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44294.1| Subtilisin-like protease [Morus notabilis]
Length=764

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 86/134 (64%), Gaps = 25/134 (19%)
 Frame = -1

Query  378  KRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFS--  205
            +R +++++Y + F GFSA LT +EA  ++    V+SVFPD +LQLHTT+SWDF++  +  
Sbjct  73   ERISIIHNYKHAFRGFSAMLTEDEAHLLSDHSDVISVFPDTMLQLHTTRSWDFIEGKAGR  132

Query  204  ------DKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWK  43
                  +K +++ I                 IIGI+DTGIWPES SF+D+G+GPIP+RWK
Sbjct  133  LSRWGLEKHVTSDI-----------------IIGILDTGIWPESPSFNDEGIGPIPSRWK  175

Query  42   GKCEKGDDFNSSNC  1
            G C +G DF  SNC
Sbjct  176  GVCLEGSDFKKSNC  189



>ref|XP_002987483.1| hypothetical protein SELMODRAFT_126179 [Selaginella moellendorffii]
 gb|EFJ11570.1| hypothetical protein SELMODRAFT_126179 [Selaginella moellendorffii]
Length=704

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = -1

Query  378  KRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDK  199
            K ++LV+SY +GF+GFSA LTA EA SIA+ PGVV VF    L LHTT+SWDFLDSFS  
Sbjct  4    KESSLVHSYKHGFNGFSAFLTAAEADSIAKLPGVVKVFRSRKLSLHTTRSWDFLDSFSGG  63

Query  198  KISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDD  19
                         Q +SS G+D+I+G++DTG+WPES SF D GMGP+P RWKG C+    
Sbjct  64   P----------HIQLNSSSGSDVIVGVLDTGVWPESKSFDDAGMGPVPKRWKGVCDNSKI  113

Query  18   FNSSN  4
             N S+
Sbjct  114  TNHSH  118



>ref|XP_007042045.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
 gb|EOX97876.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
Length=535

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +     Q+++ ++  K +A   ++YSY +G SGF+A L+  +A+ IA  PGVV V P+ I
Sbjct  46   LEDSHHQILSDILGSKESAKESILYSYKHGLSGFAAVLSQSQAKLIADVPGVVRVVPNRI  105

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            L LHTT+SWDFL      +I   I          S  G   IIG+MDTGIWPES SF D 
Sbjct  106  LSLHTTRSWDFLH--VKPQIVDGI-------LSRSHSGVGTIIGVMDTGIWPESESFKDK  156

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG +P+RWKG C++G+ FN S+C
Sbjct  157  GMGKVPSRWKGICQEGEGFNRSHC  180



>ref|XP_002986912.1| hypothetical protein SELMODRAFT_425827 [Selaginella moellendorffii]
 gb|EFJ11994.1| hypothetical protein SELMODRAFT_425827 [Selaginella moellendorffii]
Length=769

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -1

Query  399  VTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDF  220
            V   +K  R ++ +SY +GFSGFSARLT E+A  ++  P V+SVF + I  +HTT SW+F
Sbjct  55   VLGSVKAARESIGFSYRHGFSGFSARLTEEQASKLSGLPNVLSVFRNEIHTVHTTNSWEF  114

Query  219  LDSFSDKKIS---AAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            L  +   + S   A+    S+     S  G D+IIG++D+G+WPES SF + GMGPIP R
Sbjct  115  LGLYGSGEKSLFGASEATESSWLWKKSKFGKDVIIGVLDSGVWPESESFSEHGMGPIPER  174

Query  48   WKGKCEKGDDFNSSNC  1
            WKG CE G+ FN+S+C
Sbjct  175  WKGACETGEQFNASHC  190



>ref|XP_006432517.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
 gb|ESR45757.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
Length=714

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 27/147 (18%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+I   + +R +L++ Y + F GFSA LT  EA +++    VVSVFPDP+LQLHTT
Sbjct  2    QLLSSIIPSEESERLSLIHHYKHAFKGFSAILTDSEASALSGHDHVVSVFPDPVLQLHTT  61

Query  234  QSWDFLDS---------FSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASF  82
            +SWDFL +         F+ K   AA               +DI+IG++DTGIWPES SF
Sbjct  62   RSWDFLAAAAKPAKNTWFNHKYHKAA---------------SDIVIGVIDTGIWPESPSF  106

Query  81   HDDGMGPIPARWKGKCEKGDDFNSSNC  1
            +D GMG IP+RWKG C +  DF  S+C
Sbjct  107  NDQGMGEIPSRWKGVCMESPDFKKSHC  133



>ref|XP_010067650.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW65827.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=774

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRKRN---ALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+  R++N   +L++ Y + F GFSA LT  EA  ++    V+SVFPDP+LQLHTT
Sbjct  58   QLLSSISSRQKNQKVSLLHHYNHAFRGFSAMLTESEASKLSGHEKVLSVFPDPLLQLHTT  117

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+  S  +          +   +     D+IIG++DTGIWPES SF D+G+  +P
Sbjct  118  RSWDFLEVGSSDQ----------ARSQNHHPSNDVIIGVIDTGIWPESPSFGDEGVNEVP  167

Query  54   ARWKGKCEKGDDFNSSNC  1
            ARWKG C +  DF  +NC
Sbjct  168  ARWKGTCMEASDFKKANC  185



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 14/143 (10%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R     ++ S++  K  A   +VYSY +GFSGF+A+LT  +A+ IA+ PGV+ V P+ +
Sbjct  784  VRDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSL  843

Query  252  LQLHTTQSWDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
             QL TT+SWD+L  SF   K          +   SS+ G  +IIG++DTGIWPES SF+D
Sbjct  844  HQLQTTRSWDYLGLSFQSPK----------NILHSSNMGDGVIIGVLDTGIWPESKSFND  893

Query  75   DGMGPIPARWKGKCEKGDDFNSS  7
            +G GPIP++WKG CE G  FNS+
Sbjct  894  EGFGPIPSQWKGVCESGQQFNST  916


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 88/137 (64%), Gaps = 13/137 (9%)
 Frame = -1

Query  402   LVTSLIKRKR----NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
             ++ S++ RK     +++VYSY +GFSGF+A+LT  +A+ +A  PGVV V P+ + +L TT
Sbjct  1547  ILASVLGRKSKSAFDSMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTT  1606

Query  234   QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
             +SWD+L   S +  S  +          ++ G  IIIG++DTG+ PES  F+D+G GPIP
Sbjct  1607  RSWDYL-GLSSQSPSNLLH--------ETNMGGGIIIGLLDTGVCPESEVFNDEGFGPIP  1657

Query  54    ARWKGKCEKGDDFNSSN  4
             + WKG C  G+ FN++ 
Sbjct  1658  SHWKGGCVSGELFNATT  1674



>emb|CDP21113.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 23/158 (15%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL++S+I R+   R ++ +SY + FSGFSA LT +EA  +     VVSVFPDP+L+LHTT
Sbjct  21   QLLSSIIPREERDRLSIRHSYQHSFSGFSAMLTEDEASILLAHSKVVSVFPDPVLKLHTT  80

Query  234  QSWDFLDS---------FSDKKISAAIRpgsasaqpsssggadiii-----------gim  115
            +SWDFL+          FS KK++ +    S                            +
Sbjct  81   RSWDFLEQHCTIGVRHYFSSKKMTYSHPNASFQKLNRQIVVCGTYTPFFLWKNYFFFVYL  140

Query  114  dtgIWPESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
               IWPE  SF D G+G IP+RWKG+C +G +F  SNC
Sbjct  141  HVYIWPELPSFSDRGVGKIPSRWKGECMEGPNFKKSNC  178



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 14/143 (10%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +R     ++ S++  K  A   +VYSY +GFSGF+A+LT  +A+ IA+ PGV+ V P+ +
Sbjct  58   VRDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSL  117

Query  252  LQLHTTQSWDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
             QL TT+SWD+L  SF   K          +   SS+ G  +IIG++DTGIWPES SF+D
Sbjct  118  HQLQTTRSWDYLGLSFQSPK----------NILHSSNMGDGVIIGVLDTGIWPESKSFND  167

Query  75   DGMGPIPARWKGKCEKGDDFNSS  7
            +G GPIP++WKG CE G  FNS+
Sbjct  168  EGFGPIPSQWKGVCESGQQFNST  190


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = -1

Query  372  NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKKI  193
            +++VYSY +GFSGF+A+LT  +A+ +A  PGVV V P+ + +L TT+SWD+L   S +  
Sbjct  787  DSMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTTRSWDYL-GLSSQSP  845

Query  192  SAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDFN  13
            S  +          ++ G  IIIG++DTG+ PES  F+D+G GPIP+ WKG C  G+ FN
Sbjct  846  SNLLH--------ETNMGGGIIIGLLDTGVCPESEVFNDEGFGPIPSHWKGGCVSGELFN  897

Query  12   SS  7
            ++
Sbjct  898  AT  899



>ref|XP_002977794.1| hypothetical protein SELMODRAFT_107394, partial [Selaginella 
moellendorffii]
 gb|EFJ21132.1| hypothetical protein SELMODRAFT_107394, partial [Selaginella 
moellendorffii]
Length=727

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 88/136 (65%), Gaps = 3/136 (2%)
 Frame = -1

Query  399  VTSLIKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDF  220
            V   +K  R ++ +SY +GFSGFSARLT E+A  ++  P V+SVF + I  +HTT SW+F
Sbjct  12   VLGSVKAARESIGFSYRHGFSGFSARLTEEQASKLSGLPNVLSVFRNEIHTVHTTNSWEF  71

Query  219  LDSFSDKKIS---AAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            L  +   + S   A+    S+     S  G D+IIG++D+G+WPES SF D GMGP P R
Sbjct  72   LGLYGSGEKSLFGASEATESSWLWKKSKFGKDVIIGVLDSGVWPESESFSDHGMGPTPER  131

Query  48   WKGKCEKGDDFNSSNC  1
            WKG CE G+ FN+S+C
Sbjct  132  WKGTCETGEQFNASHC  147



>ref|XP_008776598.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=770

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 13/144 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            ++    Q+++S+I   +++R +L+ SY +   GF+A LT +EA  ++   GVVSVF D I
Sbjct  44   LQAAHLQMLSSIIPSEEKERVSLIQSYHHALKGFTAMLTEKEAALLSGHDGVVSVFRDRI  103

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            LQLHTT+SWDFL+  S  + S  +R             +DIIIGI+DTGIWPES SF D 
Sbjct  104  LQLHTTRSWDFLEKESGLR-SERLR---------RRASSDIIIGIVDTGIWPESPSFSDA  153

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG IP+RWKG C +G DF  SNC
Sbjct  154  GMGKIPSRWKGICMEGSDFKKSNC  177



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 92/138 (67%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSL---IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ SL   I+   +++VYSY +GFSGF+A+LT  +A+ I++ P VV V PD I +L TT
Sbjct  51   QMLWSLLGSIEAAHDSIVYSYRHGFSGFAAKLTESQAQEISELPEVVQVIPDTIYELTTT  110

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            ++WD+L   S     + +          ++ G+ +I+G++DTG+WPES  F+D+G GPIP
Sbjct  111  RTWDYL-GLSPGTPQSLLH--------KTNMGSSVIVGVIDTGVWPESEMFNDNGYGPIP  161

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG CE GD F+ SNC
Sbjct  162  SRWKGACEYGDLFSPSNC  179



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score =   103 bits (256),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 90/137 (66%), Gaps = 12/137 (9%)
 Frame = -1

Query  402  LVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            ++ SL+  K +A   +VYSY +GFSGF+A+LT  +A+ IA  P VV V PD   +L TT+
Sbjct  1    MLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDGFYKLATTR  60

Query  231  SWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            +WD+L       +SAA      S    ++ G  IIIG++DTG+WPES  F+D G GP+P+
Sbjct  61   TWDYLG------LSAA---NPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDSGFGPVPS  111

Query  51   RWKGKCEKGDDFNSSNC  1
             WKG CE G++FNSSNC
Sbjct  112  HWKGGCETGENFNSSNC  128



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 92/140 (66%), Gaps = 16/140 (11%)
 Frame = -1

Query  405  QLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++SLI  + +A   +++SY +GFSGF+A+LT  +A+ IA  PGVV V PD   +L TT
Sbjct  46   QMLSSLIGSEEDAHDSMLHSYRHGFSGFAAKLTESQAKKIADSPGVVHVIPDSFYELATT  105

Query  234  QSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGP  61
            ++WD+  L + S K +   +             G  +IIG++DTG+WPES SF+D+G G 
Sbjct  106  RTWDYLGLSAPSPKNLLNDVN-----------MGDQVIIGVIDTGVWPESESFNDNGFGT  154

Query  60   IPARWKGKCEKGDDFNSSNC  1
            IP++WKG CE G++F S+NC
Sbjct  155  IPSKWKGGCESGENFTSTNC  174



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 90/140 (64%), Gaps = 12/140 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKR---NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + K   +++ S++  K    ++++YSY +GFSGF+A++T  +AR IA+ PGVV V P+ +
Sbjct  64   VTKSHHEMLASVLGSKEATLDSMIYSYRHGFSGFAAKMTDSQARYIAELPGVVQVLPNRL  123

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             ++HTT+SWD+L   S    +  +          ++ G   IIG+ DTG+WPES SF+D 
Sbjct  124  YKMHTTRSWDYL-GLSPHSTTNLLH--------DTNQGDGAIIGVFDTGVWPESESFNDK  174

Query  72   GMGPIPARWKGKCEKGDDFN  13
            G+GPIPA+WKG C  GD FN
Sbjct  175  GLGPIPAKWKGFCTSGDAFN  194



>ref|XP_002298975.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
 gb|EEE83780.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
Length=786

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 93/154 (60%), Gaps = 25/154 (16%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQK---------PGV  277
            +K   +++++L+  K  A   ++YSY +GFSGF+AR+T  +A  IA           PGV
Sbjct  59   KKTHYEMLSTLLGSKEAAQSSILYSYRHGFSGFAARITESQAAEIAGTIISQNSIKFPGV  118

Query  276  VSVFPDPILQLHTTQSWDF--LDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgI  103
            V V P+ I +LHTT+SW+F  L   S + +              S+ G   IIG++D+G+
Sbjct  119  VQVIPNGIHKLHTTRSWEFIGLKHHSPQNL-----------LTQSNMGQGTIIGVIDSGV  167

Query  102  WPESASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
            WPES SFHD+GMGP+P+RWKG C++G+ F   NC
Sbjct  168  WPESKSFHDEGMGPVPSRWKGICQQGEHFKPYNC  201



>tpg|DAA41966.1| TPA: putative subtilase family protein [Zea mays]
Length=576

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = -1

Query  399  VTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +TS++  K  AL   VYSY +GFSGF+A+LT  +A  + + PGVVSV P+    +HTT+S
Sbjct  68   LTSVLGSKDEALRSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRS  127

Query  228  WDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            WDFL  S+ +    ++    S+     +  G D+I+G++D+GIWPES SF D G GP+P 
Sbjct  128  WDFLGMSYGESPSLSS----SSRLLRKAKYGEDVIVGVIDSGIWPESPSFDDSGYGPVPK  183

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C+ G  FN+SNC
Sbjct  184  RWKGVCQTGQAFNASNC  200



>ref|XP_007158047.1| hypothetical protein PHAVU_002G119700g [Phaseolus vulgaris]
 gb|ESW30041.1| hypothetical protein PHAVU_002G119700g [Phaseolus vulgaris]
Length=763

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ R + VYSY +GF GF+A+LT E+A  I++ PGVVSVFP+   +LHTT SWDF+   
Sbjct  65   VEQARASHVYSYRHGFRGFAAKLTNEQAHQISKMPGVVSVFPNTKRKLHTTHSWDFMGLL  124

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
            +++ +             S+    ++IIG +DTGIWPES SF D  M P+P  WKG C+ 
Sbjct  125  NNESME--------IHGYSTKNQENVIIGFIDTGIWPESPSFRDTDMQPVPQGWKGHCQL  176

Query  27   GDDFNSSNC  1
            G+ FN+S+C
Sbjct  177  GEAFNASSC  185



>ref|XP_008346279.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=781

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   + +R +++++Y + F GFSA LT  EA  ++   G+VS+FPD +LQLHTT
Sbjct  66   QILSSIIPIHEIERISVIHNYNHAFRGFSAMLTETEASILSGNDGIVSIFPDSMLQLHTT  125

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL+    + +                  +D+IIG++DTGIWPES SF D+G+G +P
Sbjct  126  RSWDFLEPELARPLK----------NKYLHPSSDVIIGMIDTGIWPESPSFSDEGIGAVP  175

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  176  SRWKGVCMEGSDFKKSNC  193



>ref|XP_008452040.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = -1

Query  405  QLVTSLIKRKR---NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+ +++  K     A+VYSY +GFSGF+A+LT  EA+ +++   VV V P  + ++HTT
Sbjct  57   QLLAAILGSKEKSLEAMVYSYKHGFSGFAAKLTKSEAQKLSEMSRVVRVVPSSLYKVHTT  116

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL   S    S+             + G D+IIG++D+GIWPES SF D G+GPIP
Sbjct  117  RSWDFLGLSSSPSESSN--------LLHRAKGDDVIIGVIDSGIWPESESFKDKGLGPIP  168

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG CE G+ FNS+NC
Sbjct  169  SRWKGTCESGEQFNSTNC  186



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 11/134 (8%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+TS++   K  R++++YSY +GFSGF+ARLT  +A+ IA+ P VV V P+   +LHT 
Sbjct  18   QLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQAKKIAELPDVVHVVPNHFFKLHTR  77

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWD+L        +  +          ++ G  IIIG++DTGIWPES +F+D G+GPIP
Sbjct  78   RSWDYLGLSESSPPTNLLH--------EANMGDGIIIGVLDTGIWPESEAFNDKGLGPIP  129

Query  54   ARWKGKCEKGDDFN  13
            +RWKG C+ GD F+
Sbjct  130  SRWKGHCQSGDKFD  143



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 11/134 (8%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+TS++   K  R++++YSY +GFSGF+ARLT  +A+ IA+ P VV V P+   +LHT 
Sbjct  58   QLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQAKKIAELPDVVHVVPNHFFKLHTR  117

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWD+L        +  +          ++ G  IIIG++DTGIWPES +F+D G+GPIP
Sbjct  118  RSWDYLGLSESSPPTNLLH--------EANMGDGIIIGVLDTGIWPESEAFNDKGLGPIP  169

Query  54   ARWKGKCEKGDDFN  13
            +RWKG C+ GD F+
Sbjct  170  SRWKGHCQSGDKFD  183



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 11/134 (8%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+TS++   K  R++++YSY +GFSGF+ARLT  +A+ IA+ P VV V P+   +LHT 
Sbjct  58   QLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQAKKIAELPDVVHVVPNHFFKLHTR  117

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWD+L        +  +          ++ G  IIIG++DTGIWPES +F+D G+GPIP
Sbjct  118  RSWDYLGLSESSPPTNLLH--------EANMGDGIIIGVLDTGIWPESEAFNDKGLGPIP  169

Query  54   ARWKGKCEKGDDFN  13
            +RWKG C+ GD F+
Sbjct  170  SRWKGHCQSGDKFD  183



>ref|XP_008667162.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
 gb|ACN34723.1| unknown [Zea mays]
 tpg|DAA41967.1| TPA: putative subtilase family protein [Zea mays]
Length=758

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = -1

Query  399  VTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +TS++  K  AL   VYSY +GFSGF+A+LT  +A  + + PGVVSV P+    +HTT+S
Sbjct  68   LTSVLGSKDEALRSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRS  127

Query  228  WDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            WDFL  S+ +    ++    S+     +  G D+I+G++D+GIWPES SF D G GP+P 
Sbjct  128  WDFLGMSYGESPSLSS----SSRLLRKAKYGEDVIVGVIDSGIWPESPSFDDSGYGPVPK  183

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C+ G  FN+SNC
Sbjct  184  RWKGVCQTGQAFNASNC  200



>ref|XP_008375386.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = -1

Query  405  QLVTSLI---KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q+++S+I   + +R ++++ Y + F GFSA LT  EA +++   G+VS+FPD ILQLHTT
Sbjct  61   QMLSSIIPSHEIERISVIHKYNHAFRGFSAMLTETEASTLSGNDGIVSIFPDSILQLHTT  120

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFLD           +   A         +D+IIG++DTGIWPES SF D G+  +P
Sbjct  121  RSWDFLDP----------KSVRAWKNEYLRPSSDVIIGMIDTGIWPESPSFSDKGISAVP  170

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG C +G DF  SNC
Sbjct  171  SRWKGVCMEGSDFKKSNC  188



>tpg|DAA41968.1| TPA: putative subtilase family protein [Zea mays]
Length=710

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = -1

Query  399  VTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +TS++  K  AL   VYSY +GFSGF+A+LT  +A  + + PGVVSV P+    +HTT+S
Sbjct  20   LTSVLGSKDEALRSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAYHHVHTTRS  79

Query  228  WDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            WDFL  S+ +    ++    S+     +  G D+I+G++D+GIWPES SF D G GP+P 
Sbjct  80   WDFLGMSYGESPSLSS----SSRLLRKAKYGEDVIVGVIDSGIWPESPSFDDSGYGPVPK  135

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG C+ G  FN+SNC
Sbjct  136  RWKGVCQTGQAFNASNC  152



>gb|ACF86497.1| unknown [Zea mays]
Length=757

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 9/145 (6%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            M    A L TS++  K  AL   VYSY +GFSGF+A+LT  +A  + + PGVVSV P+  
Sbjct  61   MASHHAAL-TSVLGSKDEALRSIVYSYKHGFSGFAAKLTQPQAEELTKYPGVVSVKPNAY  119

Query  252  LQLHTTQSWDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
              +HTT+SWDFL  S+ +    ++    S+     +  G D+I+G++D+GIWPES SF D
Sbjct  120  HHVHTTRSWDFLGMSYGESPSLSS----SSRLLRKAKYGEDVIVGVIDSGIWPESPSFDD  175

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
             G GP+P RWKG C+ G  FN+SNC
Sbjct  176  SGYGPVPKRWKGVCQTGQAFNASNC  200



>ref|XP_008804316.1| PREDICTED: subtilisin-like protease SBT5.4 [Phoenix dactylifera]
Length=762

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 81/150 (54%), Gaps = 38/150 (25%)
 Frame = -1

Query  402  LVTSLIKRKRNAL---VYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQ  232
            L+TS++  K NAL   VYSY +GFSG +A LT  +A  +A  P V+SV P    +LHTT+
Sbjct  78   LLTSILGSKENALSSIVYSYKHGFSGLAAMLTESQAALLADSPEVISVKPSRKYELHTTR  137

Query  231  SWDFL-------------DSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPES  91
            SWDFL              +F D  I   +                      DTGIWPES
Sbjct  138  SWDFLGLNYMHPTRVLKKSNFGDGIIIGIV----------------------DTGIWPES  175

Query  90   ASFHDDGMGPIPARWKGKCEKGDDFNSSNC  1
             SF+DDG GPIP+RWKG CE G  F+++NC
Sbjct  176  KSFNDDGYGPIPSRWKGICEVGAAFDTNNC  205



>ref|XP_004292430.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=801

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 9/125 (7%)
 Frame = -1

Query  375  RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSFSDKK  196
            R +++YSY +GFSGF+A LT  +A+ IA   GVV V P   L LHTT+SW+FL    D  
Sbjct  86   RESILYSYMHGFSGFAAVLTPSQAKLIADVHGVVHVIPHRFLNLHTTRSWNFLQ--VDSH  143

Query  195  ISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEKGDDF  16
            I   I+         S  G   IIG+MDTGIWPES SF D+GMG IP+RW+G C++G+ F
Sbjct  144  IRNGIQ-------SRSQSGIGSIIGVMDTGIWPESESFRDEGMGDIPSRWRGICQEGEKF  196

Query  15   NSSNC  1
            N S+C
Sbjct  197  NHSHC  201



>ref|XP_002451012.1| hypothetical protein SORBIDRAFT_05g022600 [Sorghum bicolor]
 gb|EES10000.1| hypothetical protein SORBIDRAFT_05g022600 [Sorghum bicolor]
Length=749

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = -1

Query  399  VTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +TS++  K   R ++VYSY +GFSGF+A+LT  +A  + +  GVVSV P+   Q+HTT+S
Sbjct  65   LTSILGSKDEARKSIVYSYKHGFSGFAAKLTEPQAEELKKHHGVVSVKPNTYHQVHTTRS  124

Query  228  WDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPA  52
            WDFL  S+  +  S +    S+     +  G D+I+G++DTGIWPES SF D G GP+P 
Sbjct  125  WDFLGISYGQQPSSLS---SSSRLLRKAKYGEDVIVGVIDTGIWPESRSFDDTGYGPVPK  181

Query  51   RWKGKCEKGDDFNSSNC  1
            RWKG CE G  FN+SNC
Sbjct  182  RWKGVCETGQAFNASNC  198



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 95/145 (66%), Gaps = 14/145 (10%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  +  A   +V+SY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  45   VTESHHQMLSSLLGSEVEAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSF  104

Query  252  LQLHTTQSWDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
             +L TT++WD+L  S S+ K          +    ++ G  +IIG +D+G+WPES SF+D
Sbjct  105  YELATTRTWDYLGLSVSNPK----------NLLNDTNMGDQVIIGFIDSGVWPESESFND  154

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +G+GP+P+ WKG+C+ G++F S+NC
Sbjct  155  NGVGPVPSHWKGECQSGENFMSTNC  179



>dbj|BAC53929.1| serine protease-like protein [Nicotiana tabacum]
Length=580

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSL----IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDP  256
            +R++  Q++T++    +++ + + VYSY +GF GF+A+LT  +A  I++ PGVVSVFP+ 
Sbjct  46   LRQNH-QMLTAIHKGSVEQAKTSHVYSYRHGFKGFAAKLTEAQASEISKMPGVVSVFPNT  104

Query  255  ILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
               LHTT SWDF+    D+ +             S+    ++IIG +DTGIWPES SF D
Sbjct  105  KRSLHTTHSWDFMGLSDDETME--------IPGFSTKNQVNVIIGFIDTGIWPESPSFSD  156

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
              M P+PA WKG+C+ G+ FN+S C
Sbjct  157  TNMPPVPAGWKGQCQSGEAFNASIC  181



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 95/145 (66%), Gaps = 14/145 (10%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  +  A   +V+SY +GFSGF+A+LT  +A+ IA  P VV V PD  
Sbjct  45   VTESHHQMLSSLLGSEVEAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSF  104

Query  252  LQLHTTQSWDFLD-SFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
             +L TT++WD+L  S S+ K          +    ++ G  +IIG +D+G+WPES SF+D
Sbjct  105  YELATTRTWDYLGLSVSNPK----------NLLNDTNMGDQVIIGFIDSGVWPESESFND  154

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
            +G+GP+P+ WKG+C+ G++F S+NC
Sbjct  155  NGVGPVPSHWKGECQSGENFMSTNC  179



>ref|XP_004146562.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004160980.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN53334.1| hypothetical protein Csa_4G047950 [Cucumis sativus]
Length=764

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 10/138 (7%)
 Frame = -1

Query  405  QLVTSLIKRKR---NALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            QL+++++  K     A+VYSY +GFSGF+A+LT  +A+ +++   VV V P  + ++HTT
Sbjct  57   QLLSTILGSKEKSMEAMVYSYKHGFSGFAAKLTKSQAQKLSEMSRVVRVVPSSLYKVHTT  116

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            +SWDFL   S    S+ +          +  G ++IIG++DTGIWPES SF D G+G IP
Sbjct  117  RSWDFLGLSSSPFESSNL-------LHRAQMGENVIIGVIDTGIWPESESFKDKGVGSIP  169

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG CE G+ FNS+NC
Sbjct  170  SRWKGTCESGEQFNSTNC  187



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   102 bits (254),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 59/138 (43%), Positives = 94/138 (68%), Gaps = 12/138 (9%)
 Frame = -1

Query  405  QLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTT  235
            Q++ SL+  K   ++++VYSY +GFSGF+A+LT  +A+ I++ PGVV V P+ + +L TT
Sbjct  51   QILWSLLGSKEAVQDSIVYSYRHGFSGFAAKLTESQAQQISEIPGVVQVIPNALYELTTT  110

Query  234  QSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIP  55
            ++WD+L   S     + ++         ++ G+ +I+G++DTG+WPES  F+D G GPIP
Sbjct  111  RTWDYL-GLSPGNSQSLLQ--------KTNMGSSVIVGVIDTGVWPESEMFNDKGYGPIP  161

Query  54   ARWKGKCEKGDDFNSSNC  1
            +RWKG CE G+ F+ SNC
Sbjct  162  SRWKGVCEYGELFSPSNC  179



>ref|XP_009782970.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=760

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -1

Query  423  MRKDQAQLVTSL----IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDP  256
            +R++  Q++T++    I++ + + VYSY +GF GF+A+LT  +A  I++ PGVVSVFP+ 
Sbjct  46   LRQNH-QMLTAIHKGSIEQAKTSHVYSYRHGFKGFAAKLTEAQASEISKMPGVVSVFPNT  104

Query  255  ILQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHD  76
               LHTT SWDF+    D+ +             S+    ++IIG +DTGIWPES SF D
Sbjct  105  KRSLHTTHSWDFMGLSDDETMEIP--------GFSTKNQINVIIGFIDTGIWPESPSFSD  156

Query  75   DGMGPIPARWKGKCEKGDDFNSSNC  1
              M P+PA WKG+C+ G+ FN+S C
Sbjct  157  TNMPPVPAGWKGQCQSGEAFNASIC  181



>ref|XP_002451014.1| hypothetical protein SORBIDRAFT_05g022620 [Sorghum bicolor]
 gb|EES10002.1| hypothetical protein SORBIDRAFT_05g022620 [Sorghum bicolor]
Length=718

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = -1

Query  399  VTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQS  229
            +TS++  K    N++VYSY +GFSGF+A+LT  +A ++ + PGVV V P+   +LHTT+S
Sbjct  60   LTSILGSKDEALNSIVYSYKHGFSGFAAKLTEAQAEALRKYPGVVRVRPNTYHELHTTRS  119

Query  228  WDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPAR  49
            WDFL   S  + +++    S+     ++ G D+I+GI+D+GIWPES SF D G GP+P R
Sbjct  120  WDFL-GMSYGQQASSSSSSSSRLLRKANYGEDVIVGIIDSGIWPESRSFDDSGYGPVPKR  178

Query  48   WKGKCEKGDDFNSSNC  1
            WKG C+ G  FN+S+C
Sbjct  179  WKGVCQTGQAFNASSC  194



>ref|XP_008794760.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=660

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = -1

Query  423  MRKDQAQLVTSLI--KRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +R    +L+ S++  K+ ++AL YSYT   +GF+A L  EEA  I++ PGV+SVFP+   
Sbjct  53   VRDSHYELLASVLGNKKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVLSVFPNRGY  112

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDFL    D ++         S    +  G DIIIG +DTG+WPES SF DDG
Sbjct  113  KLHTTRSWDFLRLERDGRVP------KESLWTKARFGEDIIIGNLDTGVWPESESFKDDG  166

Query  69   MGPIPARWKGKCEKGDD  19
            MGP+P++WKG C+ G+D
Sbjct  167  MGPVPSKWKGICQIGED  183



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            + +   Q+++SL+  K +A   +VYSY +GFSGF+ARLT  +A+ I+  P VV V PD  
Sbjct  45   VTESHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAKKISYSPEVVHVMPDSY  104

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
             +L TT++WD+L   +             +   +++ G  +IIG++DTG+WPES SF+DD
Sbjct  105  YELATTRTWDYLGLGTANP---------KNLLNNTNMGDQVIIGVVDTGVWPESESFNDD  155

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            G+GPIP+ WKG C  G++F  +NC
Sbjct  156  GVGPIPSHWKGGCIPGENFKLTNC  179



>ref|XP_008796284.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=761

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = -1

Query  387  IKRKRNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPILQLHTTQSWDFLDSF  208
            +++ + + VYSY+NGF GF+A+L+ E+A  IA  P VVSVFP+    LHTT SWDF+   
Sbjct  59   LEKAQASHVYSYSNGFRGFAAKLSKEQACDIAAMPSVVSVFPNLKRSLHTTHSWDFMGLA  118

Query  207  SDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDGMGPIPARWKGKCEK  28
            +++ +             S+    ++IIG +DTGIWPES SF D GM P+P+RWKGKC+ 
Sbjct  119  TNEAMEIP--------GFSTKNQENVIIGFIDTGIWPESPSFSDHGMPPVPSRWKGKCQM  170

Query  27   GDDFNSSNC  1
            GD F + +C
Sbjct  171  GDSFTNFSC  179



>ref|XP_007042042.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97873.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=778

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +     Q+++ ++  K +A   ++YSY +G SGF+A L+  +A+ IA  PGVV V P+ I
Sbjct  46   LEDSHHQILSDILGSKESAKESILYSYKHGLSGFAAVLSQSQAKLIADVPGVVRVVPNRI  105

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            L LHTT+SWDFL      +I   I          S  G   IIG+MDTGIWPES SF D 
Sbjct  106  LSLHTTRSWDFLH--VKPQIVDGI-------LSRSHSGVGTIIGVMDTGIWPESESFKDK  156

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG +P+RWKG C++G+ FN S+C
Sbjct  157  GMGKVPSRWKGICQEGEGFNRSHC  180



>ref|XP_007042044.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
 gb|EOX97875.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
Length=801

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -1

Query  423  MRKDQAQLVTSLIKRKRNA---LVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPI  253
            +     Q+++ ++  K +A   ++YSY +G SGF+A L+  +A+ IA  PGVV V P+ I
Sbjct  46   LEDSHHQILSDILGSKESAKESILYSYKHGLSGFAAVLSQSQAKLIADVPGVVRVVPNRI  105

Query  252  LQLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDD  73
            L LHTT+SWDFL      +I   I          S  G   IIG+MDTGIWPES SF D 
Sbjct  106  LSLHTTRSWDFLH--VKPQIVDGI-------LSRSHSGVGTIIGVMDTGIWPESESFKDK  156

Query  72   GMGPIPARWKGKCEKGDDFNSSNC  1
            GMG +P+RWKG C++G+ FN S+C
Sbjct  157  GMGKVPSRWKGICQEGEGFNRSHC  180



>ref|XP_010104911.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC02147.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=783

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = -1

Query  420  RKDQAQLVTSLIKRK---RNALVYSYTNGFSGFSARLTAEEARSIAQKPGVVSVFPDPIL  250
            +K    L+++L+  K   R ++VYSY +GFSGF+ARLT  EA +IA+ P VV V P+ I 
Sbjct  56   KKSHHILLSNLLGSKEVARRSIVYSYRHGFSGFAARLTEAEAEAIAEFPEVVQVIPNRIY  115

Query  249  QLHTTQSWDFLDSFSDKKISAAIRpgsasaqpsssggadiiigimdtgIWPESASFHDDG  70
            +LHTT+SWDF+           I   S     + + G   IIG++D+G+WPES SF+D+G
Sbjct  116  KLHTTRSWDFI----------GIHHHSPKNALTKNMGKGTIIGVIDSGVWPESESFNDEG  165

Query  69   MGPIPARWKGKCEKGDDFNSSNC  1
            M P P++W+G C++G+ FNS+NC
Sbjct  166  MPPTPSQWRGICQQGEQFNSTNC  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511272866440