BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14889_g1_i1 len=532 path=[510:0-531]

Length=532
                                                                      Score     E

ref|XP_006354324.1|  PREDICTED: cytosolic sulfotransferase 12-like      185   4e-54   
ref|XP_004237320.1|  PREDICTED: cytosolic sulfotransferase 17-like      178   3e-51   
ref|XP_009796969.1|  PREDICTED: cytosolic sulfotransferase 12-like      173   2e-49   
ref|XP_009617518.1|  PREDICTED: cytosolic sulfotransferase 5-like       173   2e-49   
ref|XP_011079199.1|  PREDICTED: cytosolic sulfotransferase 7-like       164   4e-46   
ref|XP_011100431.1|  PREDICTED: cytosolic sulfotransferase 5-like       162   2e-45   
ref|XP_011079196.1|  PREDICTED: cytosolic sulfotransferase 12-like      157   2e-43   
ref|XP_011021083.1|  PREDICTED: cytosolic sulfotransferase 6-like       152   2e-41   
ref|XP_011021082.1|  PREDICTED: cytosolic sulfotransferase 5-like       151   5e-41   
ref|XP_006373405.1|  hypothetical protein POPTR_0017s13470g             151   5e-41   
gb|EYU39346.1|  hypothetical protein MIMGU_mgv1a027118mg                137   1e-35   
ref|XP_009796970.1|  PREDICTED: cytosolic sulfotransferase 8-like       133   4e-34   
ref|XP_011085669.1|  PREDICTED: cytosolic sulfotransferase 5-like       132   1e-33   
ref|XP_006293532.1|  hypothetical protein CARUB_v10025046mg             128   2e-32   
ref|XP_006411297.1|  hypothetical protein EUTSA_v10017780mg             125   2e-31   
ref|XP_010095979.1|  Flavonol sulfotransferase-like protein             124   7e-31   
ref|XP_010087683.1|  Flavonol sulfotransferase-like protein             124   1e-30   
ref|XP_011085670.1|  PREDICTED: cytosolic sulfotransferase 5-like       122   7e-30   
emb|CDX93182.1|  BnaC04g47140D                                          117   3e-28   
ref|XP_009789857.1|  PREDICTED: flavonol sulfotransferase-like          117   4e-28   
ref|XP_010507662.1|  PREDICTED: cytosolic sulfotransferase 18-like      116   6e-28   
ref|XP_009142138.1|  PREDICTED: cytosolic sulfotransferase 11-like      115   2e-27   
ref|XP_009621634.1|  PREDICTED: flavonol sulfotransferase-like          114   9e-27   
dbj|BAJ92404.1|  predicted protein                                      113   1e-26   
ref|XP_010271910.1|  PREDICTED: cytosolic sulfotransferase 15-like      112   5e-26   
ref|XP_009789859.1|  PREDICTED: flavonol sulfotransferase-like          112   5e-26   
emb|CDX81030.1|  BnaC03g02840D                                          112   5e-26   
gb|AFK33848.1|  unknown                                                 111   6e-26   
ref|XP_004514095.1|  PREDICTED: cytosolic sulfotransferase 15-like      111   6e-26   
dbj|BAJ86339.1|  predicted protein                                      111   7e-26   
ref|XP_011070903.1|  PREDICTED: cytosolic sulfotransferase 12-like      110   1e-25   
ref|XP_010916164.1|  PREDICTED: cytosolic sulfotransferase 12-like      110   2e-25   
ref|XP_010670538.1|  PREDICTED: cytosolic sulfotransferase 15-like      110   2e-25   
ref|XP_006407689.1|  hypothetical protein EUTSA_v10021105mg             110   2e-25   
gb|KEH33293.1|  P-loop nucleoside triphosphate hydrolase superfam...    109   2e-25   
ref|XP_004499637.1|  PREDICTED: cytosolic sulfotransferase 15-like      109   4e-25   
ref|XP_007028479.1|  Sulfotransferase 2A, putative                      108   6e-25   
ref|XP_011102095.1|  PREDICTED: cytosolic sulfotransferase 12-like      108   8e-25   
ref|XP_011102114.1|  PREDICTED: cytosolic sulfotransferase 12-like      108   8e-25   
ref|XP_009130975.1|  PREDICTED: cytosolic sulfotransferase 15-like      108   9e-25   
emb|CDY58879.1|  BnaA03g55570D                                          107   1e-24   
ref|XP_003628738.1|  Flavonol sulfotransferase-like protein             107   1e-24   
ref|XP_004307199.1|  PREDICTED: cytosolic sulfotransferase 15-like      107   2e-24   
ref|XP_004514767.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    107   2e-24   
emb|CDP16517.1|  unnamed protein product                                107   2e-24   
ref|XP_011020444.1|  PREDICTED: cytosolic sulfotransferase 15-like      107   2e-24   
gb|EMS52304.1|  Flavonol sulfotransferase-like protein                  105   3e-24   
ref|XP_002304810.1|  sulfotransferase family protein                    106   4e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006662952.1|  PREDICTED: cytosolic sulfotransferase 8-like       106   5e-24   
ref|XP_007133678.1|  hypothetical protein PHAVU_011G199900g             106   5e-24   
ref|XP_007010821.1|  Sulfotransferase 2A                                106   5e-24   
ref|NP_001067947.1|  Os11g0503900                                       105   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095980.1|  Flavonol sulfotransferase-like protein             105   7e-24   
ref|XP_003542798.1|  PREDICTED: cytosolic sulfotransferase 15-like      105   1e-23   
ref|XP_006445787.1|  hypothetical protein CICLE_v10017680mg             105   1e-23   
ref|XP_006591672.1|  PREDICTED: cytosolic sulfotransferase 15-like      105   1e-23   
gb|KDO65654.1|  hypothetical protein CISIN_1g018736mg                   105   1e-23   
gb|EAY81025.1|  hypothetical protein OsI_36209                          105   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006440813.1|  hypothetical protein CICLE_v10020894mg             105   1e-23   
ref|XP_006289894.1|  hypothetical protein CARUB_v10003509mg             105   1e-23   
gb|KHN26485.1|  Flavonol sulfotransferase-like                          105   1e-23   
ref|XP_008347825.1|  PREDICTED: cytosolic sulfotransferase 15-like      104   2e-23   
ref|XP_010031022.1|  PREDICTED: cytosolic sulfotransferase 15-like      104   2e-23   
ref|XP_009370647.1|  PREDICTED: cytosolic sulfotransferase 15-like      104   2e-23   
ref|XP_011020446.1|  PREDICTED: cytosolic sulfotransferase 15-like      104   2e-23   
ref|XP_010051030.1|  PREDICTED: cytosolic sulfotransferase 12-like      104   2e-23   
ref|XP_010051056.1|  PREDICTED: cytosolic sulfotransferase 12-like      105   3e-23   
gb|KCW81180.1|  hypothetical protein EUGRSUZ_C02547                     103   3e-23   
ref|XP_003598424.1|  Sulfotransferase                                   103   4e-23   
gb|EEC76735.1|  hypothetical protein OsI_14772                          103   4e-23   Oryza sativa Indica Group [Indian rice]
gb|AES68675.2|  sulfotransferase                                        103   4e-23   
ref|NP_001176522.1|  Os11g0450300                                       103   4e-23   
ref|XP_010521619.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    103   4e-23   
gb|ABA93428.2|  Sulfotransferase domain containing protein, expre...    103   4e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90951.1|  predicted protein                                      103   4e-23   
ref|XP_006440811.1|  hypothetical protein CICLE_v10023927mg             103   4e-23   
ref|XP_008240109.1|  PREDICTED: LOW QUALITY PROTEIN: flavonol sul...    103   5e-23   
ref|XP_011001965.1|  PREDICTED: flavonol sulfotransferase-like          103   5e-23   
gb|KEH16899.1|  P-loop nucleoside triphosphate hydrolase superfam...    103   5e-23   
gb|KDO65656.1|  hypothetical protein CISIN_1g041950mg                   103   5e-23   
ref|XP_002538120.1|  Flavonol 4'-sulfotransferase, putative             103   5e-23   Ricinus communis
ref|XP_002873289.1|  sulfotransferase family protein                    103   5e-23   
ref|XP_006302485.1|  hypothetical protein CARUB_v10020580mg             103   5e-23   
gb|ABK95273.1|  unknown                                                 103   5e-23   Populus trichocarpa [western balsam poplar]
gb|AEZ00072.1|  desulfoglucosinolate sulfotransferase                   103   5e-23   
ref|XP_003565988.2|  PREDICTED: cytosolic sulfotransferase 13-like      103   6e-23   
ref|XP_007037642.1|  Flavonol 4'-sulfotransferase, putative             102   8e-23   
ref|XP_003580959.1|  PREDICTED: cytosolic sulfotransferase 5-like       102   8e-23   
gb|KCW81101.1|  hypothetical protein EUGRSUZ_C02479                     102   8e-23   
gb|KEH21569.1|  P-loop nucleoside triphosphate hydrolase superfam...    102   8e-23   
ref|XP_002318367.2|  hypothetical protein POPTR_0012s01280g             102   8e-23   Populus trichocarpa [western balsam poplar]
ref|NP_177549.1|  desulfo-glucosinolate sulfotransferase 18             102   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ00073.1|  desulfoglucosinolate sulfotransferase                   102   9e-23   
gb|ACB73191.1|  desulfo-glucosinolate sulfotransferase                  102   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65627.1|  putative flavonol sulfotransferase                      102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385980.1|  hypothetical protein POPTR_0003s19280g             102   1e-22   
gb|AEZ00077.1|  desulfoglucosinolate sulfotransferase                   102   1e-22   
gb|EYU28890.1|  hypothetical protein MIMGU_mgv1a009426mg                102   1e-22   
ref|XP_002887526.1|  predicted protein                                  102   1e-22   
gb|KDP40565.1|  hypothetical protein JCGZ_24564                         102   1e-22   
ref|XP_006347852.1|  PREDICTED: cytosolic sulfotransferase 15-like      102   1e-22   
ref|XP_010039273.1|  PREDICTED: cytosolic sulfotransferase 5-like       102   1e-22   
ref|XP_010554271.1|  PREDICTED: cytosolic sulfotransferase 11-like      102   1e-22   
gb|AAX95923.1|  transposon protein, putative, unclassified              105   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KDO48723.1|  hypothetical protein CISIN_1g037802mg                   101   2e-22   
ref|XP_002303947.1|  hypothetical protein POPTR_0003s19270g             102   2e-22   Populus trichocarpa [western balsam poplar]
dbj|BAJ87462.1|  predicted protein                                      102   2e-22   
gb|KCW81182.1|  hypothetical protein EUGRSUZ_C02549                     101   2e-22   
ref|XP_010091629.1|  Flavonol sulfotransferase-like protein             101   2e-22   
ref|XP_003530555.2|  PREDICTED: cytosolic sulfotransferase 5-like       101   2e-22   
ref|XP_006348796.1|  PREDICTED: cytosolic sulfotransferase 12-like      101   2e-22   
ref|XP_010320907.1|  PREDICTED: cytosolic sulfotransferase 5-like       101   2e-22   
gb|EEC68220.1|  hypothetical protein OsI_36211                          101   2e-22   Oryza sativa Indica Group [Indian rice]
gb|KHN21542.1|  Flavonol sulfotransferase-like                          101   3e-22   
gb|ADB85371.1|  putative flavonol 3-sulfotransferase                    101   3e-22   Phyllostachys edulis [kikko-chiku]
ref|XP_010499316.1|  PREDICTED: cytosolic sulfotransferase 7-like       101   3e-22   
ref|XP_010048481.1|  PREDICTED: cytosolic sulfotransferase 12-like      101   3e-22   
ref|XP_010534326.1|  PREDICTED: cytosolic sulfotransferase 15-like      101   3e-22   
ref|XP_010554539.1|  PREDICTED: cytosolic sulfotransferase 5-like       101   3e-22   
gb|ABA93903.1|  Sulfotransferase domain containing protein, expre...    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96365.1|  predicted protein                                      101   3e-22   
ref|NP_001176556.1|  Os11g0505200                                       101   3e-22   
gb|EEE52154.1|  hypothetical protein OsJ_33997                          101   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008231647.1|  PREDICTED: cytosolic sulfotransferase 15-like      100   3e-22   
ref|XP_010523117.1|  PREDICTED: cytosolic sulfotransferase 12-like      100   3e-22   
dbj|BAK00237.1|  predicted protein                                      100   3e-22   
ref|XP_010423267.1|  PREDICTED: cytosolic sulfotransferase 15-like      101   4e-22   
ref|XP_010041349.1|  PREDICTED: cytosolic sulfotransferase 15-like      100   4e-22   
ref|XP_011009587.1|  PREDICTED: cytosolic sulfotransferase 12-like      100   4e-22   
ref|NP_568177.1|  sulfotransferase 2A                                   100   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06879.1|  AT5g07010/MOJ9_18                                       100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007010817.1|  Sulfotransferase 2B, putative                    99.4    5e-22   
dbj|BAB11159.1|  steroid sulfotransferase-like protein                  100   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452648.1|  PREDICTED: cytosolic sulfotransferase 15           100   5e-22   
ref|XP_004236073.1|  PREDICTED: flavonol 3-sulfotransferase-like        100   5e-22   
ref|XP_009598362.1|  PREDICTED: cytosolic sulfotransferase 12-like      100   5e-22   
emb|CDY29149.1|  BnaC09g15460D                                          100   6e-22   
ref|XP_010272754.1|  PREDICTED: flavonol sulfotransferase-like          100   7e-22   
ref|XP_009590910.1|  PREDICTED: cytosolic sulfotransferase 15-like      100   7e-22   
ref|XP_002519139.1|  Flavonol 4'-sulfotransferase, putative             100   7e-22   Ricinus communis
ref|XP_010052979.1|  PREDICTED: cytosolic sulfotransferase 12-like      100   7e-22   
ref|XP_006385979.1|  hypothetical protein POPTR_0003s19250g             100   7e-22   
ref|XP_006465789.1|  PREDICTED: cytosolic sulfotransferase 15-like      100   7e-22   
ref|XP_006477735.1|  PREDICTED: cytosolic sulfotransferase 16-like      100   7e-22   
emb|CDY60367.1|  BnaA09g54440D                                          100   7e-22   
emb|CDY05012.1|  BnaAnng01940D                                          100   7e-22   
ref|XP_008240107.1|  PREDICTED: flavonol sulfotransferase-like          100   7e-22   
ref|XP_010428377.1|  PREDICTED: cytosolic sulfotransferase 18-like    99.8    8e-22   
emb|CDY14059.1|  BnaC02g01760D                                          100   8e-22   
gb|KDP44527.1|  hypothetical protein JCGZ_16360                       99.8    8e-22   
ref|XP_003628737.1|  Flavonol sulfotransferase-like protein           99.8    9e-22   
ref|XP_010051057.1|  PREDICTED: cytosolic sulfotransferase 12-like      101   1e-21   
ref|XP_011006876.1|  PREDICTED: flavonol 3-sulfotransferase-like      99.8    1e-21   
ref|XP_007010840.1|  Sulfotransferase 2A, putative                    99.4    1e-21   
ref|XP_006363589.1|  PREDICTED: cytosolic sulfotransferase 7-like...  99.4    1e-21   
ref|XP_004239099.1|  PREDICTED: cytosolic sulfotransferase 5-like     99.4    1e-21   
ref|XP_002444757.1|  hypothetical protein SORBIDRAFT_07g027380        99.4    1e-21   Sorghum bicolor [broomcorn]
gb|KFK25092.1|  hypothetical protein AALP_AA8G065200                  99.4    1e-21   
ref|XP_009615435.1|  PREDICTED: flavonol 3-sulfotransferase-like      99.8    1e-21   
emb|CDP12289.1|  unnamed protein product                              99.4    1e-21   
ref|XP_011070341.1|  PREDICTED: cytosolic sulfotransferase 15-like    99.4    1e-21   
ref|XP_010491300.1|  PREDICTED: cytosolic sulfotransferase 15-like    99.4    1e-21   
gb|EYU36904.1|  hypothetical protein MIMGU_mgv1a009066mg              99.4    1e-21   
ref|XP_010044374.1|  PREDICTED: cytosolic sulfotransferase 5-like     99.4    1e-21   
ref|XP_002888964.1|  sulfotransferase family protein                  99.4    1e-21   
ref|XP_006378523.1|  sulfotransferase family protein                  99.0    1e-21   
ref|XP_010673228.1|  PREDICTED: cytosolic sulfotransferase 17-like    99.0    2e-21   
ref|NP_178472.1|  cytosolic sulfotransferase 13                       99.0    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006348649.1|  PREDICTED: cytosolic sulfotransferase 12-like    99.0    2e-21   
ref|XP_009125671.1|  PREDICTED: cytosolic sulfotransferase 15-like    99.0    2e-21   
gb|EYU24756.1|  hypothetical protein MIMGU_mgv1a010113mg              99.0    2e-21   
gb|KEH21570.1|  P-loop nucleoside triphosphate hydrolase superfam...  99.0    2e-21   
gb|EYU30501.1|  hypothetical protein MIMGU_mgv1a026637mg              99.0    2e-21   
ref|XP_010477038.1|  PREDICTED: cytosolic sulfotransferase 17-lik...  99.0    2e-21   
ref|XP_011020447.1|  PREDICTED: cytosolic sulfotransferase 15-like    98.6    2e-21   
emb|CDP00475.1|  unnamed protein product                              98.6    2e-21   
ref|NP_177550.1|  desulfo-glucosinolate sulfotransferase 16           98.6    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65036.1|  putative flavonol sulfotransferase                    98.6    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208898.1|  hypothetical protein PRUPE_ppa026895mg           98.6    3e-21   
gb|AEZ00070.1|  sulfotransferase 16                                   98.6    3e-21   
gb|KDO44381.1|  hypothetical protein CISIN_1g019118mg                 98.6    3e-21   
ref|XP_006399179.1|  hypothetical protein EUTSA_v10015302mg           98.6    3e-21   
ref|XP_010532214.1|  PREDICTED: cytosolic sulfotransferase 18-like    98.6    3e-21   
ref|XP_010478181.1|  PREDICTED: cytosolic sulfotransferase 7-like     98.2    3e-21   
ref|XP_002303948.2|  hypothetical protein POPTR_0003s19260g           98.2    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009113467.1|  PREDICTED: cytosolic sulfotransferase 18-like    97.1    3e-21   
ref|XP_007029974.1|  Sulfotransferase 2A, putative                    98.2    3e-21   
ref|XP_006291483.1|  hypothetical protein CARUB_v10017618mg           98.2    3e-21   
emb|CDX73051.1|  BnaC06g34990D                                        98.6    3e-21   
ref|XP_010046610.1|  PREDICTED: cytosolic sulfotransferase 12-like    98.2    3e-21   
ref|XP_010670559.1|  PREDICTED: cytosolic sulfotransferase 5-like     98.2    3e-21   
ref|XP_008779205.1|  PREDICTED: flavonol sulfotransferase-like        98.2    3e-21   
ref|XP_007045765.1|  P-loop containing nucleoside triphosphate hy...  98.2    4e-21   
ref|XP_010050823.1|  PREDICTED: cytosolic sulfotransferase 13-like    97.8    4e-21   
ref|XP_007225044.1|  hypothetical protein PRUPE_ppa019825mg           97.4    4e-21   
ref|XP_009106067.1|  PREDICTED: cytosolic sulfotransferase 16         98.2    4e-21   
gb|ACR10265.1|  sulfotransferase 5a                                   97.8    4e-21   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_011009569.1|  PREDICTED: cytosolic sulfotransferase 5-like     97.8    4e-21   
ref|XP_010051374.1|  PREDICTED: cytosolic sulfotransferase 5-like     97.8    4e-21   
ref|XP_010051322.1|  PREDICTED: cytosolic sulfotransferase 12-like    97.8    4e-21   
ref|XP_007010814.1|  Sulfotransferase 2A, putative                    97.8    4e-21   
gb|KDP44529.1|  hypothetical protein JCGZ_16362                       97.8    4e-21   
gb|EEE68990.1|  hypothetical protein OsJ_27924                        97.4    4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009779416.1|  PREDICTED: cytosolic sulfotransferase 15         97.8    4e-21   
emb|CDY26750.1|  BnaA06g12720D                                        97.8    4e-21   
gb|ADX97329.1|  sulfotransferase-like protein                         97.8    4e-21   
ref|XP_011070365.1|  PREDICTED: cytosolic sulfotransferase 15-like    97.8    4e-21   
ref|XP_010523502.1|  PREDICTED: cytosolic sulfotransferase 11         97.8    5e-21   
ref|XP_008779555.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...  97.4    5e-21   
gb|KDO70277.1|  hypothetical protein CISIN_1g019700mg                 97.8    5e-21   
ref|XP_007022041.1|  Sulfotransferase 2A, putative                    97.8    5e-21   
ref|XP_006484253.1|  PREDICTED: cytosolic sulfotransferase 12-like    97.8    5e-21   
gb|ACR10273.1|  sulfotransferase 5c                                   97.8    5e-21   Brassica rapa subsp. pekinensis [bai cai]
emb|CDY22189.1|  BnaC01g39120D                                        97.8    5e-21   
ref|XP_002267209.1|  PREDICTED: cytosolic sulfotransferase 12         97.8    5e-21   Vitis vinifera
ref|XP_010051291.1|  PREDICTED: cytosolic sulfotransferase 12-like    95.9    5e-21   
ref|XP_010023658.1|  PREDICTED: cytosolic sulfotransferase 12-like    97.4    5e-21   
ref|XP_002512030.1|  Flavonol 4'-sulfotransferase, putative           97.8    5e-21   Ricinus communis
ref|XP_010416243.1|  PREDICTED: cytosolic sulfotransferase 18         97.8    5e-21   
emb|CDY19226.1|  BnaC05g14270D                                        97.4    5e-21   
emb|CDX96515.1|  BnaA07g31260D                                        97.4    5e-21   
ref|XP_009123345.1|  PREDICTED: cytosolic sulfotransferase 11-like    97.4    5e-21   
emb|CDX73052.1|  BnaC06g35000D                                        97.4    6e-21   
emb|CDP20151.1|  unnamed protein product                              97.4    6e-21   
ref|XP_006302516.1|  hypothetical protein CARUB_v10020613mg           97.4    6e-21   
ref|XP_006348794.1|  PREDICTED: cytosolic sulfotransferase 12-like    97.4    6e-21   
ref|XP_009106068.1|  PREDICTED: cytosolic sulfotransferase 18-like    97.4    6e-21   
ref|XP_002524376.1|  Flavonol 3-sulfotransferase, putative            97.8    7e-21   Ricinus communis
ref|XP_006437857.1|  hypothetical protein CICLE_v10031848mg           97.4    7e-21   
ref|XP_002890287.1|  sulfotransferase family protein                  97.4    7e-21   
ref|XP_009764805.1|  PREDICTED: flavonol 3-sulfotransferase-like      97.4    7e-21   
ref|XP_004490050.1|  PREDICTED: cytosolic sulfotransferase 15-like    97.4    7e-21   
emb|CDY39902.1|  BnaA09g14840D                                        97.4    7e-21   
ref|XP_002877382.1|  hypothetical protein ARALYDRAFT_484902           96.3    7e-21   
ref|XP_006442535.1|  hypothetical protein CICLE_v10024230mg           97.1    7e-21   
ref|XP_007045763.1|  Flavonol 4'-sulfotransferase, putative           97.4    8e-21   
ref|XP_010459484.1|  PREDICTED: cytosolic sulfotransferase 17         97.1    8e-21   
ref|XP_010418265.1|  PREDICTED: cytosolic sulfotransferase 1-like     96.7    8e-21   
emb|CDP12288.1|  unnamed protein product                              97.1    8e-21   
gb|KFK41855.1|  hypothetical protein AALP_AA2G179800                  97.1    8e-21   
emb|CBI27337.3|  unnamed protein product                              97.4    8e-21   
gb|ACR10269.1|  sulfotransferase 5b                                   97.1    8e-21   Brassica rapa subsp. pekinensis [bai cai]
emb|CDP14958.1|  unnamed protein product                              97.1    9e-21   
ref|XP_006292772.1|  hypothetical protein CARUB_v10019022mg           97.1    9e-21   
ref|XP_002529674.1|  Flavonol 3-sulfotransferase, putative            95.9    9e-21   Ricinus communis
ref|XP_006442533.1|  hypothetical protein CICLE_v10021050mg           97.1    9e-21   
gb|KDP41358.1|  hypothetical protein JCGZ_15765                       96.7    1e-20   
ref|XP_002514611.1|  Flavonol 3-sulfotransferase, putative            96.7    1e-20   Ricinus communis
ref|XP_003572076.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.7    1e-20   
gb|EYU29210.1|  hypothetical protein MIMGU_mgv1a010218mg              96.7    1e-20   
gb|KCW80592.1|  hypothetical protein EUGRSUZ_C01953                   96.3    1e-20   
ref|XP_009142142.1|  PREDICTED: cytosolic sulfotransferase 3          96.7    1e-20   
ref|XP_010523511.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.7    1e-20   
ref|NP_001062233.2|  Os08g0515100                                     96.7    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428379.1|  PREDICTED: cytosolic sulfotransferase 16 iso...  96.7    1e-20   
emb|CDX96514.1|  BnaA07g31250D                                        96.7    1e-20   
ref|XP_009767933.1|  PREDICTED: cytosolic sulfotransferase 12         96.7    1e-20   
ref|XP_009113465.1|  PREDICTED: cytosolic sulfotransferase 18-like    96.7    1e-20   
gb|AFX73362.1|  desulfoglucosinolate sulfotransferase                 96.7    1e-20   
dbj|BAK00174.1|  predicted protein                                    96.7    1e-20   
ref|XP_010430709.1|  PREDICTED: cytosolic sulfotransferase 11-like    95.5    1e-20   
gb|ACD87064.1|  desulfo-glucosinolate sulfotransferase                96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44012.1|  hypothetical protein AALP_AA1G203200                  96.7    1e-20   
ref|XP_010418264.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.7    1e-20   
ref|XP_002265137.1|  PREDICTED: cytosolic sulfotransferase 15         96.7    1e-20   Vitis vinifera
ref|NP_173294.1|  sulfotransferase 17                                 96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99017.1|  BnaC09g48180D                                        96.7    1e-20   
ref|XP_007133559.1|  hypothetical protein PHAVU_011G189100g           96.3    1e-20   
ref|XP_004973902.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.3    1e-20   
ref|XP_010428378.1|  PREDICTED: cytosolic sulfotransferase 16 iso...  96.3    1e-20   
ref|XP_004974845.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.3    1e-20   
dbj|BAK03878.1|  predicted protein                                    96.7    1e-20   
ref|XP_006344965.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.3    1e-20   
ref|XP_010438379.1|  PREDICTED: cytosolic sulfotransferase 18-like    96.3    1e-20   
ref|XP_010034128.1|  PREDICTED: cytosolic sulfotransferase 15-like    96.3    2e-20   
ref|XP_010419185.1|  PREDICTED: cytosolic sulfotransferase 16-like    96.3    2e-20   
ref|XP_009123352.1|  PREDICTED: cytosolic sulfotransferase 11-like    96.3    2e-20   
emb|CDP19484.1|  unnamed protein product                              96.3    2e-20   
gb|KCW81183.1|  hypothetical protein EUGRSUZ_C02550                   94.4    2e-20   
ref|XP_008779204.1|  PREDICTED: cytosolic sulfotransferase 12-like    95.9    2e-20   
ref|XP_006417123.1|  hypothetical protein EUTSA_v10009721mg           96.3    2e-20   
ref|XP_010670589.1|  PREDICTED: cytosolic sulfotransferase 5-like     96.3    2e-20   
ref|XP_009122389.1|  PREDICTED: cytosolic sulfotransferase 15-like    96.3    2e-20   
ref|XP_010502574.1|  PREDICTED: cytosolic sulfotransferase 18-like    95.9    2e-20   
emb|CDP21482.1|  unnamed protein product                              95.9    2e-20   
ref|XP_010514147.1|  PREDICTED: cytosolic sulfotransferase 13-like    95.9    2e-20   
ref|XP_004239101.1|  PREDICTED: cytosolic sulfotransferase 5-like     95.9    2e-20   
gb|EYU35156.1|  hypothetical protein MIMGU_mgv1a026240mg              95.9    2e-20   
ref|XP_010051309.1|  PREDICTED: cytosolic sulfotransferase 12-like    95.9    2e-20   
gb|KDP31403.1|  hypothetical protein JCGZ_11779                       95.9    2e-20   
ref|NP_001175974.1|  Os09g0555150                                     96.3    2e-20   
emb|CDP11706.1|  unnamed protein product                              95.9    2e-20   
emb|CDP16991.1|  unnamed protein product                              95.9    2e-20   
ref|XP_010670590.1|  PREDICTED: cytosolic sulfotransferase 5-like     95.9    2e-20   
gb|EAZ10033.1|  hypothetical protein OsI_32337                        96.3    2e-20   
ref|XP_009105445.1|  PREDICTED: cytosolic sulfotransferase 1-like     95.5    2e-20   
ref|XP_008339761.1|  PREDICTED: cytosolic sulfotransferase 5-like     95.5    2e-20   
ref|XP_002890005.1|  sulfotransferase family protein                  95.9    3e-20   
ref|XP_006304738.1|  hypothetical protein CARUB_v10012097mg           95.5    3e-20   
ref|XP_010523510.1|  PREDICTED: cytosolic sulfotransferase 11-like    95.5    3e-20   
ref|XP_004962267.1|  PREDICTED: cytosolic sulfotransferase 18-like    95.5    3e-20   
ref|XP_010048649.1|  PREDICTED: cytosolic sulfotransferase 5-like     95.5    3e-20   
ref|XP_007022038.1|  Sulfotransferase 2A                              95.5    3e-20   
gb|EYU38464.1|  hypothetical protein MIMGU_mgv1a010211mg              95.5    3e-20   
ref|XP_011070271.1|  PREDICTED: cytosolic sulfotransferase 5-like     95.9    3e-20   
ref|XP_002265863.1|  PREDICTED: cytosolic sulfotransferase 15         95.5    3e-20   
ref|XP_009113327.1|  PREDICTED: cytosolic sulfotransferase 18-like    95.5    3e-20   
ref|XP_011081693.1|  PREDICTED: cytosolic sulfotransferase 15-like    95.1    3e-20   
ref|XP_008352940.1|  PREDICTED: cytosolic sulfotransferase 12-like    95.1    4e-20   
ref|XP_002514613.1|  Flavonol 4'-sulfotransferase, putative           95.1    4e-20   
ref|XP_011070306.1|  PREDICTED: cytosolic sulfotransferase 15-like    95.1    4e-20   
gb|KFK33526.1|  hypothetical protein AALP_AA5G024400                  95.1    4e-20   
ref|XP_010507196.1|  PREDICTED: cytosolic sulfotransferase 5-like     94.4    4e-20   
dbj|BAJ98953.1|  predicted protein                                    95.1    4e-20   
ref|XP_010430710.1|  PREDICTED: cytosolic sulfotransferase 13         94.7    4e-20   
ref|XP_006487458.1|  PREDICTED: cytosolic sulfotransferase 15-like    94.4    4e-20   
emb|CDY45856.1|  BnaC02g22640D                                        95.1    4e-20   
ref|XP_004239453.1|  PREDICTED: cytosolic sulfotransferase 12-like    94.7    4e-20   
ref|XP_002272968.2|  PREDICTED: cytosolic sulfotransferase 13-like    95.1    4e-20   
ref|XP_004292841.1|  PREDICTED: uncharacterized protein LOC101299451  97.8    5e-20   
ref|XP_006416590.1|  hypothetical protein EUTSA_v10008073mg           95.1    5e-20   
gb|KDO38062.1|  hypothetical protein CISIN_1g036194mg                 94.7    5e-20   
ref|XP_011070292.1|  PREDICTED: cytosolic sulfotransferase 15-like    94.7    5e-20   
ref|XP_006658788.1|  PREDICTED: cytosolic sulfotransferase 5-like     94.7    5e-20   
ref|XP_009616636.1|  PREDICTED: cytosolic sulfotransferase 12-like    94.7    5e-20   
gb|AFK46619.1|  unknown                                               94.4    5e-20   
gb|EAZ40590.1|  hypothetical protein OsJ_25050                        94.7    5e-20   
ref|XP_003627666.1|  Steroid sulfotransferase-like protein            95.1    6e-20   
gb|EMT14717.1|  Sulfotransferase 16                                   94.4    6e-20   
emb|CDP07173.1|  unnamed protein product                              94.7    6e-20   
gb|AFK43741.1|  unknown                                               94.7    6e-20   
ref|XP_010050705.1|  PREDICTED: cytosolic sulfotransferase 12-like    94.4    6e-20   
ref|XP_003627983.1|  Flavonol sulfotransferase-like protein           94.7    6e-20   
ref|NP_190093.1|  sulfotransferase 5                                  94.4    6e-20   
ref|XP_008811045.1|  PREDICTED: flavonol 3-sulfotransferase-like      94.4    6e-20   
ref|XP_006391844.1|  hypothetical protein EUTSA_v10024068mg           94.4    7e-20   
ref|XP_006395674.1|  hypothetical protein EUTSA_v10005340mg           94.4    7e-20   
gb|AET02142.2|  sulfotransferase                                      95.1    7e-20   
emb|CDX95973.1|  BnaA07g27580D                                        93.6    7e-20   
emb|CDP11652.1|  unnamed protein product                              94.4    7e-20   
emb|CDY54154.1|  BnaA09g53490D                                        94.4    7e-20   
ref|XP_010458821.1|  PREDICTED: cytosolic sulfotransferase 1-like     94.4    7e-20   
ref|XP_010670561.1|  PREDICTED: cytosolic sulfotransferase 5-like     94.4    8e-20   
ref|XP_004514768.1|  PREDICTED: cytosolic sulfotransferase 15-lik...  94.4    8e-20   
ref|XP_006292192.1|  hypothetical protein CARUB_v10018398mg           94.0    8e-20   
ref|XP_010031026.1|  PREDICTED: cytosolic sulfotransferase 15-like    94.0    9e-20   
emb|CDP11136.1|  unnamed protein product                              94.0    9e-20   
ref|NP_565305.1|  cytosolic sulfotransferase 11                       94.4    9e-20   
gb|AAK17133.1|AF325065_1  putative steroid sulfotransferase           94.0    9e-20   
ref|NP_001060227.1|  Os07g0605800                                     94.0    9e-20   
ref|XP_009339576.1|  PREDICTED: cytosolic sulfotransferase 5-like     94.0    9e-20   
ref|XP_006377318.1|  hypothetical protein POPTR_0011s04850g           92.8    9e-20   
ref|XP_006388018.1|  hypothetical protein POPTR_0396s00220g           94.0    9e-20   
ref|XP_002265783.1|  PREDICTED: cytosolic sulfotransferase 15         94.0    9e-20   
gb|EAZ04648.1|  hypothetical protein OsI_26799                        94.4    9e-20   
ref|XP_010476340.1|  PREDICTED: cytosolic sulfotransferase 9-like     94.0    9e-20   
ref|XP_006390466.1|  hypothetical protein EUTSA_v10018795mg           94.0    9e-20   
ref|XP_010474329.1|  PREDICTED: cytosolic sulfotransferase 16-like    94.0    1e-19   
gb|EMS63801.1|  Sulfotransferase 16                                   94.0    1e-19   
ref|XP_010501514.1|  PREDICTED: cytosolic sulfotransferase 17-like    94.7    1e-19   
ref|XP_010537408.1|  PREDICTED: cytosolic sulfotransferase 16-like    94.0    1e-19   
ref|XP_010686715.1|  PREDICTED: cytosolic sulfotransferase 5-like     94.0    1e-19   
ref|XP_010686741.1|  PREDICTED: cytosolic sulfotransferase 12-like    93.2    1e-19   
ref|XP_009149333.1|  PREDICTED: cytosolic sulfotransferase 17         93.6    1e-19   
ref|NP_172799.1|  sulfotransferase 4B                                 93.6    1e-19   
ref|XP_010686717.1|  PREDICTED: cytosolic sulfotransferase 5-like     93.2    1e-19   
ref|XP_010672565.1|  PREDICTED: cytosolic sulfotransferase 5-like     93.6    1e-19   
ref|XP_006304016.1|  hypothetical protein CARUB_v10009741mg           93.6    1e-19   
ref|XP_009123403.1|  PREDICTED: cytosolic sulfotransferase 1-like     93.6    1e-19   
ref|XP_002514612.1|  Flavonol 4'-sulfotransferase, putative           93.6    1e-19   
dbj|BAJ92757.1|  predicted protein                                    93.6    2e-19   
ref|XP_008785086.1|  PREDICTED: flavonol 3-sulfotransferase-like      93.6    2e-19   
emb|CDY49688.1|  BnaA02g27270D                                        93.2    2e-19   
ref|XP_009114139.1|  PREDICTED: cytosolic sulfotransferase 12-like    93.2    2e-19   
ref|XP_010672352.1|  PREDICTED: cytosolic sulfotransferase 8-like     93.6    2e-19   
gb|ACR10270.1|  sulfotransferase 5b                                   93.2    2e-19   
ref|XP_010260931.1|  PREDICTED: cytosolic sulfotransferase 5-like     93.2    2e-19   
ref|XP_006348647.1|  PREDICTED: cytosolic sulfotransferase 12-like    93.2    2e-19   
emb|CDX73049.1|  BnaC06g34970D                                        93.2    2e-19   
ref|XP_010048646.1|  PREDICTED: cytosolic sulfotransferase 5-like     93.2    2e-19   
ref|XP_002888119.1|  hypothetical protein ARALYDRAFT_338279           93.2    2e-19   
ref|XP_002876895.1|  hypothetical protein ARALYDRAFT_484284           93.2    2e-19   
gb|EMT10642.1|  Flavonol 4'-sulfotransferase                          93.2    2e-19   
ref|XP_008777580.1|  PREDICTED: flavonol sulfotransferase-like        93.2    2e-19   
ref|XP_009113161.1|  PREDICTED: cytosolic sulfotransferase 18-like    93.2    2e-19   
gb|AAY34254.1|  flavonol-sulfotransferase                             93.2    2e-19   
ref|XP_007022039.1|  Sulfotransferase 2A, putative                    95.1    2e-19   
emb|CDY45712.1|  BnaC02g35140D                                        93.2    2e-19   
dbj|BAJ84859.1|  predicted protein                                    93.2    2e-19   
gb|ACH41745.1|  ST5a                                                  93.2    2e-19   
gb|EYU36903.1|  hypothetical protein MIMGU_mgv1a024755mg              92.8    2e-19   
ref|XP_002524372.1|  Flavonol 4'-sulfotransferase, putative           93.2    2e-19   
gb|KHN37710.1|  Flavonol sulfotransferase-like                        92.8    2e-19   
ref|XP_003542799.1|  PREDICTED: cytosolic sulfotransferase 15-like    92.8    2e-19   
gb|KCW50294.1|  hypothetical protein EUGRSUZ_J00079                   92.8    2e-19   
dbj|BAJ89802.1|  predicted protein                                    92.8    2e-19   
ref|XP_010034130.1|  PREDICTED: cytosolic sulfotransferase 15-like    92.8    2e-19   
ref|XP_008781218.1|  PREDICTED: cytosolic sulfotransferase 12-like    92.4    2e-19   
ref|XP_010939140.1|  PREDICTED: flavonol 3-sulfotransferase-like      92.8    3e-19   
ref|XP_010473264.1|  PREDICTED: cytosolic sulfotransferase 18-like    91.3    3e-19   
ref|XP_008777578.1|  PREDICTED: flavonol 4'-sulfotransferase-like     92.8    3e-19   
gb|EMT25770.1|  Sulfotransferase 16                                   95.1    3e-19   
emb|CDY42798.1|  BnaC01g22680D                                        92.4    3e-19   
ref|XP_006418637.1|  hypothetical protein EUTSA_v10002851mg           92.4    3e-19   
ref|XP_006388004.1|  hypothetical protein POPTR_0412s00210g           92.4    3e-19   
gb|ACH41747.1|  ST5a                                                  92.4    3e-19   
gb|ACH41750.1|  ST5a                                                  92.4    3e-19   
ref|XP_010499321.1|  PREDICTED: cytosolic sulfotransferase 7-like     92.4    3e-19   
gb|KFK34056.1|  hypothetical protein AALP_AA5G096300                  92.4    3e-19   
ref|XP_002529982.1|  Flavonol 4'-sulfotransferase, putative           92.4    3e-19   
ref|XP_006291422.1|  hypothetical protein CARUB_v10017560mg           92.4    3e-19   
ref|XP_006417102.1|  hypothetical protein EUTSA_v10008182mg           92.4    3e-19   
ref|XP_010520091.1|  PREDICTED: cytosolic sulfotransferase 15-like    92.4    4e-19   
ref|XP_006377316.1|  hypothetical protein POPTR_0011s04810g           92.4    4e-19   
ref|NP_172800.2|  sulfotransferase 4C                                 92.4    4e-19   
ref|XP_004239020.1|  PREDICTED: cytosolic sulfotransferase 12-like    92.0    4e-19   
ref|XP_010668070.1|  PREDICTED: cytosolic sulfotransferase 5-like     92.0    4e-19   
ref|XP_006301074.1|  hypothetical protein CARUB_v10021467mg           92.4    4e-19   
ref|XP_007022042.1|  Sulfotransferase 2A, putative                    93.2    4e-19   
ref|XP_007029964.1|  Sulfotransferase 2A, putative                    92.8    4e-19   
gb|KCW50290.1|  hypothetical protein EUGRSUZ_J00075                   92.0    4e-19   
ref|XP_008393378.1|  PREDICTED: cytosolic sulfotransferase 13-like    92.0    5e-19   
ref|XP_002890763.1|  hypothetical protein ARALYDRAFT_890352           92.0    5e-19   
ref|XP_010906702.1|  PREDICTED: flavonol 3-sulfotransferase-like      92.0    5e-19   
ref|XP_010050715.1|  PREDICTED: cytosolic sulfotransferase 13-like    92.0    5e-19   
ref|XP_009128026.1|  PREDICTED: cytosolic sulfotransferase 16         92.4    5e-19   
ref|XP_010048648.1|  PREDICTED: cytosolic sulfotransferase 13-like    92.0    5e-19   
ref|XP_010673229.1|  PREDICTED: cytosolic sulfotransferase 5-like     92.0    5e-19   
emb|CDY40480.1|  BnaC09g14380D                                        92.0    6e-19   
ref|XP_008807420.1|  PREDICTED: flavonol sulfotransferase-like        92.0    6e-19   
ref|XP_002463161.1|  hypothetical protein SORBIDRAFT_02g038840        91.7    6e-19   
ref|XP_008339764.1|  PREDICTED: cytosolic sulfotransferase 12-like    91.7    6e-19   
ref|XP_009148006.1|  PREDICTED: cytosolic sulfotransferase 11-like    91.7    6e-19   
gb|KHG26744.1|  Flavonol sulfotransferase-like protein                91.7    6e-19   
ref|XP_002524373.1|  Flavonol 3-sulfotransferase, putative            91.7    6e-19   
ref|NP_001146492.1|  flavonol 4-sulfotransferase                      91.7    7e-19   
gb|AAM62638.1|  steroid sulfotransferase, putative                    91.7    7e-19   
ref|XP_007210773.1|  hypothetical protein PRUPE_ppa019757mg           91.7    7e-19   
ref|XP_010669167.1|  PREDICTED: cytosolic sulfotransferase 12-like    89.4    8e-19   
ref|XP_010545823.1|  PREDICTED: cytosolic sulfotransferase 5-like     91.3    8e-19   
ref|XP_008240108.1|  PREDICTED: flavonol 4'-sulfotransferase-like     91.7    8e-19   
emb|CDP00476.1|  unnamed protein product                              91.3    9e-19   
ref|XP_010430069.1|  PREDICTED: cytosolic sulfotransferase 18-like    91.3    1e-18   
emb|CDX96512.1|  BnaA07g31230D                                        91.3    1e-18   
ref|XP_009106065.1|  PREDICTED: cytosolic sulfotransferase 18         91.3    1e-18   
emb|CDY29154.1|  BnaC09g15510D                                        91.3    1e-18   
ref|XP_011047829.1|  PREDICTED: flavonol sulfotransferase-like        90.9    1e-18   
ref|XP_002890004.1|  sulfotransferase family protein                  90.9    1e-18   
ref|XP_006292601.1|  hypothetical protein CARUB_v10018842mg           90.9    1e-18   
ref|XP_010496748.1|  PREDICTED: cytosolic sulfotransferase 5-like     90.9    1e-18   
ref|XP_011101096.1|  PREDICTED: cytosolic sulfotransferase 5-like     90.9    1e-18   
ref|XP_009398836.1|  PREDICTED: cytosolic sulfotransferase 6-like     92.4    1e-18   
ref|XP_010665242.1|  PREDICTED: cytosolic sulfotransferase 15-like    90.9    1e-18   
ref|XP_004250849.1|  PREDICTED: cytosolic sulfotransferase 12-like    90.5    1e-18   
emb|CDX95244.1|  BnaC09g16260D                                        90.9    1e-18   
ref|XP_004979028.1|  PREDICTED: cytosolic sulfotransferase 5-like     90.5    1e-18   
gb|EYU29209.1|  hypothetical protein MIMGU_mgv1a022523mg              90.5    1e-18   
ref|XP_006348797.1|  PREDICTED: cytosolic sulfotransferase 12-like    90.5    1e-18   
ref|XP_002876897.1|  sulfotransferase family protein                  90.5    1e-18   
ref|XP_002456926.1|  hypothetical protein SORBIDRAFT_03g045670        93.2    2e-18   
ref|XP_006306407.1|  hypothetical protein CARUB_v10012325mg           90.5    2e-18   
ref|NP_001173892.1|  Os04g0359300                                     90.5    2e-18   
dbj|BAB11158.1|  steroid sulfotransferase-like protein                90.5    2e-18   
ref|NP_001140649.1|  uncharacterized protein LOC100272724             90.5    2e-18   
gb|KFK40750.1|  hypothetical protein AALP_AA2G036100                  90.5    2e-18   
ref|NP_001140941.1|  uncharacterized protein LOC100273019             90.5    2e-18   
emb|CDX73045.1|  BnaC06g34930D                                        90.5    2e-18   
ref|XP_010460594.1|  PREDICTED: cytosolic sulfotransferase 7-like     90.5    2e-18   
ref|NP_196317.2|  sulfotransferase 2B                                 90.5    2e-18   
ref|XP_008777577.1|  PREDICTED: cytosolic sulfotransferase 12-like    90.5    2e-18   
ref|XP_006391838.1|  hypothetical protein EUTSA_v10024127mg           90.1    2e-18   
ref|XP_010672200.1|  PREDICTED: flavonol sulfotransferase-like        90.5    2e-18   
ref|XP_009397578.1|  PREDICTED: cytosolic sulfotransferase 8-like     90.5    2e-18   
ref|XP_009789858.1|  PREDICTED: flavonol sulfotransferase-like        90.1    2e-18   
ref|XP_006432398.1|  hypothetical protein CICLE_v10003688mg           90.1    2e-18   
ref|XP_007156373.1|  hypothetical protein PHAVU_003G280800g           90.1    2e-18   
emb|CDY34560.1|  BnaC03g56600D                                        90.1    2e-18   
ref|XP_010686742.1|  PREDICTED: cytosolic sulfotransferase 5-like     90.1    2e-18   
gb|EYU27103.1|  hypothetical protein MIMGU_mgv1a022913mg              90.1    2e-18   
ref|XP_010272734.1|  PREDICTED: cytosolic sulfotransferase 8-like     90.1    2e-18   
ref|NP_190094.1|  cytosolic sulfotransferase 6                        90.1    2e-18   
ref|XP_010523501.1|  PREDICTED: cytosolic sulfotransferase 12-like    90.1    2e-18   
ref|XP_010425370.1|  PREDICTED: cytosolic sulfotransferase 18-like    90.1    2e-18   
ref|XP_010693877.1|  PREDICTED: flavonol sulfotransferase-like        90.1    2e-18   
ref|XP_002533884.1|  Flavonol 3-sulfotransferase, putative            90.1    2e-18   
ref|XP_011081805.1|  PREDICTED: cytosolic sulfotransferase 15-like    90.1    2e-18   
ref|XP_004292840.1|  PREDICTED: cytosolic sulfotransferase 15-like    90.1    2e-18   
ref|XP_007218724.1|  hypothetical protein PRUPE_ppa009048mg           89.7    2e-18   
ref|XP_008231827.1|  PREDICTED: cytosolic sulfotransferase 5-like     89.7    3e-18   
ref|XP_009105059.1|  PREDICTED: cytosolic sulfotransferase 1-like     89.7    3e-18   
ref|XP_006348798.1|  PREDICTED: cytosolic sulfotransferase 12-like    89.7    3e-18   
gb|EMS61659.1|  Sulfotransferase 17                                   89.0    3e-18   
ref|XP_002526483.1|  Flavonol 4'-sulfotransferase, putative           89.7    3e-18   
ref|XP_002525538.1|  Flavonol 4'-sulfotransferase, putative           89.7    3e-18   
ref|XP_006392098.1|  hypothetical protein EUTSA_v10023882mg           90.1    3e-18   
ref|XP_010495506.1|  PREDICTED: cytosolic sulfotransferase 1-like     89.7    3e-18   
emb|CDY67730.1|  BnaCnng56120D                                        89.4    3e-18   
ref|XP_010478184.1|  PREDICTED: cytosolic sulfotransferase 7-like     89.4    3e-18   
ref|XP_002524377.1|  Flavonol 3-sulfotransferase, putative            89.7    3e-18   
ref|XP_010050960.1|  PREDICTED: cytosolic sulfotransferase 5-like     89.4    3e-18   



>ref|XP_006354324.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=313

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 111/144 (77%), Gaps = 6/144 (4%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E WWG   + QIN FWF+P  +P   RVL EF PLP+DVIL SFPKTGTTWLKSL+FSI
Sbjct  15   KENWWGKNCVCQINDFWFLPKFLPSTIRVLNEFKPLPNDVILASFPKTGTTWLKSLVFSI  74

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
            +NRSS +SLVK+NPHDLVP LEVQV+G   +SS  +TH     ++  +TR++STHIPYQL
Sbjct  75   VNRSSKESLVKHNPHDLVPTLEVQVFGTTHQSSSITTH-----DESHSTRLYSTHIPYQL  129

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            LG T  SS+ CRV+Y+ RNPKDTL
Sbjct  130  LGNTFHSSN-CRVIYITRNPKDTL  152



>ref|XP_004237320.1| PREDICTED: cytosolic sulfotransferase 17-like [Solanum lycopersicum]
Length=315

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 110/146 (75%), Gaps = 10/146 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E WWG  ++ QIN FWF+P  +P   RVL EF PLP+DVIL SFPKTGTTWLKSL+FSI
Sbjct  15   KENWWGKNYVCQINNFWFLPKFVPSTIRVLNEFKPLPNDVILASFPKTGTTWLKSLVFSI  74

Query  279  INRSSLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPY  452
            INRSS +S  LVK+N HDLVP LEVQV+G  ++  D+ +H         +TR++STHIPY
Sbjct  75   INRSSKESSLLVKHNAHDLVPTLEVQVFGTTRQYLDNESH-------HSSTRLYSTHIPY  127

Query  453  QLLGKTLESSSGCRVVYVVRNPKDTL  530
            QLL KT +SS+ CRVVY+ RNPKDTL
Sbjct  128  QLLRKTFDSSN-CRVVYITRNPKDTL  152



>ref|XP_009796969.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana sylvestris]
Length=309

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 8/144 (6%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E WW D ++ QI+GFWF+P  +PR  RVL EF P  +DVIL SFPKTGTTWLKSL+FSI
Sbjct  14   KENWWRDNYVCQIDGFWFLPKFVPRTFRVLNEFKPRNNDVILASFPKTGTTWLKSLLFSI  73

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
            I RSS +SLV +NPH+LVP LEVQV+G  + S           E+ D+ R+FSTHIPYQL
Sbjct  74   IYRSSKESLVNHNPHELVPTLEVQVFGGTEPSPIEI-------ENLDSRRLFSTHIPYQL  126

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            +G+TL+SS  CRVVY+ RNPKDTL
Sbjct  127  IGETLDSSH-CRVVYITRNPKDTL  149



>ref|XP_009617518.1| PREDICTED: cytosolic sulfotransferase 5-like [Nicotiana tomentosiformis]
Length=312

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 8/144 (6%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E WW D  + QINGFWF+P  +P   RVL EF PL +DVIL SFPKTGTTWLKSL+FSI
Sbjct  17   KENWWRDNTVCQINGFWFLPKFVPSTFRVLNEFKPLNNDVILASFPKTGTTWLKSLLFSI  76

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
            I RSS +SLV +NPH+LVP LEVQV+G    S  +  ++       D+ R+FSTHIPYQL
Sbjct  77   IYRSSKESLVNHNPHELVPTLEVQVFGRTGPSPIAIDNI-------DSRRLFSTHIPYQL  129

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            +GKTL+SS  CRVVY+ RNPKDTL
Sbjct  130  IGKTLDSSD-CRVVYITRNPKDTL  152



>ref|XP_011079199.1| PREDICTED: cytosolic sulfotransferase 7-like [Sesamum indicum]
Length=319

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 102/146 (70%), Gaps = 9/146 (6%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EKW GD +L Q+ GFW +P  I  ++RV+ +F PLPSD+IL SFPKTGTTWLK+L++SI
Sbjct  17   KEKWLGDDYLFQLGGFWHLPQAIQGVNRVINQFQPLPSDIILASFPKTGTTWLKALLYSI  76

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSS--THVLSSEEDQDTTRIFSTHIPY  452
            +NRSS   L   NPH L+P LE + YG    SS ++   H+       D+ RI STHIPY
Sbjct  77   VNRSSKHRLTTENPHSLIPVLEYKTYGTTHASSTANPPCHI------NDSRRILSTHIPY  130

Query  453  QLLGKTLESSSGCRVVYVVRNPKDTL  530
            QLL KTL SS  CRVVYV RNPKDTL
Sbjct  131  QLLAKTLGSSE-CRVVYVTRNPKDTL  155



>ref|XP_011100431.1| PREDICTED: cytosolic sulfotransferase 5-like [Sesamum indicum]
 ref|XP_011069362.1| PREDICTED: cytosolic sulfotransferase 5-like [Sesamum indicum]
Length=302

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 102/152 (67%), Gaps = 15/152 (10%)
 Frame = +3

Query  84   INLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKS  263
            +N   E KWWGD  L  ++GFW +P  +  I RV+  F PLPSD+IL SFPKTGTTWLKS
Sbjct  3    LNSLSEGKWWGDDCLRHVDGFWLLPQFVEPIDRVVKHFRPLPSDIILASFPKTGTTWLKS  62

Query  264  LIFSIINRSSLDSLVKNNPHDLVPYLEVQVYGDHQE---SSDSSTHVLSSEEDQDTTRIF  434
            L+F+I++R+S   L   NPH+LVP LEVQVY    E   ++  S H           RIF
Sbjct  63   LLFAIVHRTSKHRLAMKNPHELVPNLEVQVYTASDEPLTTNPCSRH-----------RIF  111

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            STHIPYQLL KTL+SS  CR+VYV RNPKDTL
Sbjct  112  STHIPYQLLAKTLDSSD-CRIVYVTRNPKDTL  142



>ref|XP_011079196.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=321

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EKWW D +L+Q+ GFWF+P  I  + RV   F PLPSDVIL SFPKTGTTWLK+L++SI+
Sbjct  18   EKWWADDYLYQLGGFWFLPQSIEGVIRVNKNFRPLPSDVILASFPKTGTTWLKALLYSIV  77

Query  282  NRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            N SS   L   NPH LVP+LE   +  + +    ST V+S + +    RIFSTH+PYQLL
Sbjct  78   NPSSKHRLTVENPHSLVPFLE--YFDSYGKPPYESTTVVSPDANH-CRRIFSTHMPYQLL  134

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             +TL+SS  CRVVYV RNPKDTL
Sbjct  135  ERTLDSSD-CRVVYVTRNPKDTL  156



>ref|XP_011021083.1| PREDICTED: cytosolic sulfotransferase 6-like [Populus euphratica]
 ref|XP_011021084.1| PREDICTED: cytosolic sulfotransferase 6-like [Populus euphratica]
Length=316

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 96/143 (67%), Gaps = 7/143 (5%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EKW GD+ L Q  GFWF    +P   +VL  F PLPSDVIL SFPKTGTTWLK+L++SII
Sbjct  18   EKWRGDEKLFQWKGFWFRLQYLPGTRQVLDNFKPLPSDVILASFPKTGTTWLKALLYSII  77

Query  282  NRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            NRSS   L   +PH LVP LEVQ+YG HQES  +     S        RI +TH+P+QLL
Sbjct  78   NRSSRVCLRTTHPHMLVPTLEVQLYGTHQESFSTFASTRSP------ARILATHLPHQLL  131

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
              T++ S  CR+VYV RNPKDTL
Sbjct  132  ADTVKPSD-CRMVYVTRNPKDTL  153



>ref|XP_011021082.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
Length=314

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK+ GD +L Q NGFWF    +   H+VL  + PLP+D +L S+PKTGTTWLK+L++SI
Sbjct  13   KEKFRGDDYLCQWNGFWFRQPFLEAAHQVLNHYKPLPTDTVLASYPKTGTTWLKALLYSI  72

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
            INRSS DS++ N+PH LVP LE+Q+YG    S DS     +S     + RI +TH+PYQ+
Sbjct  73   INRSSRDSILTNHPHMLVPTLEIQLYGPKTGSFDSFAGTANS-----SARILATHLPYQV  127

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            +  T+ S+  CRVVY+ RNPKDTL
Sbjct  128  ISGTINSTD-CRVVYITRNPKDTL  150



>ref|XP_006373405.1| hypothetical protein POPTR_0017s13470g [Populus trichocarpa]
 gb|ERP51202.1| hypothetical protein POPTR_0017s13470g [Populus trichocarpa]
Length=314

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK+ GD +L Q NGFWF    +   H+VL  + PLP+D +L S+PKTGTTWLK+L++SI
Sbjct  13   KEKFRGDDYLCQWNGFWFRQPFLEAAHQVLNHYKPLPTDTVLASYPKTGTTWLKALLYSI  72

Query  279  INRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
            INRSS DS++ N+PH LVP LE+Q+YG    S DS     +S     + RI +TH+PYQ+
Sbjct  73   INRSSRDSILTNHPHMLVPTLEIQLYGPKTGSFDSFAGTANS-----SARILATHLPYQV  127

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            +  T+ S+  CRVVY+ RNPKDTL
Sbjct  128  ISGTINSTD-CRVVYITRNPKDTL  150



>gb|EYU39346.1| hypothetical protein MIMGU_mgv1a027118mg, partial [Erythranthe 
guttata]
Length=310

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = +3

Query  105  KWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIIN  284
            KW G + L++ NGFWF    +    +VL  F PLP+DVIL SFPKTGTTWLK+L+ SII+
Sbjct  1    KWCGHEFLYKFNGFWFTKTYLKTTQQVLQHFKPLPNDVILASFPKTGTTWLKALLHSIIH  60

Query  285  R---SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQ  455
            R   +S D+L+ N+P +L+P LE  +Y  +     +     +++    ++RI +THIPYQ
Sbjct  61   RHSPNSSDTLLLNHPQELIPSLETNLYVQNGNFIPTIIEDQNNKGGGTSSRILATHIPYQ  120

Query  456  LLGKTLESSSGCRVVYVVRNPKDTL  530
            ++G  L SSS C++VY+ RNPKDTL
Sbjct  121  IIGDLLRSSSTCKIVYITRNPKDTL  145



>ref|XP_009796970.1| PREDICTED: cytosolic sulfotransferase 8-like [Nicotiana sylvestris]
Length=317

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 13/140 (9%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            WG+  L ++NG    P  +P   R L +F PLP+DVIL SFPKTGTTWLKSL+FSI  RS
Sbjct  32   WGNNDLVKLNGVGIDPKYVPNAVRALNDFKPLPNDVILASFPKTGTTWLKSLLFSITYRS  91

Query  291  SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKT  470
              +SL   +PH LVP +EVQ +    E  +SSTH        D+ R+++TH PYQ+LG T
Sbjct  92   FKESLANIHPHVLVPTIEVQGF----EGFESSTH--------DSRRLYATHTPYQILGST  139

Query  471  LESSSGCRVVYVVRNPKDTL  530
                S CR++Y+ RNPKDTL
Sbjct  140  -HDLSNCRIIYITRNPKDTL  158



>ref|XP_011085669.1| PREDICTED: cytosolic sulfotransferase 5-like [Sesamum indicum]
Length=333

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 95/160 (59%), Gaps = 9/160 (6%)
 Frame = +3

Query  75   MENINLS-EEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTT  251
            M  IN S + EKW G + L +  GFWF    +    RV+  F PLP DVIL SFPKTGTT
Sbjct  11   MNEINSSPQREKWCGHEFLFKFRGFWFTQIYLEATKRVVETFKPLPGDVILASFPKTGTT  70

Query  252  WLKSLIFSIINRSSLDS---LVKNNPHDLVPYLEVQVYGDHQES----SDSSTHVLSSEE  410
            WLK+L+ SII+ S   +   L  N+PH L+P LE  +Y +          + T      +
Sbjct  71   WLKALLHSIIHPSPCHANHPLTLNHPHQLIPSLETDLYIEKWREVGGIGSTRTPQFPVVK  130

Query  411  DQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            D +  RI STH+PYQ+LG  L+SS  C++VYV RNPKDTL
Sbjct  131  DPEKARILSTHLPYQILGDILDSSD-CKIVYVTRNPKDTL  169



>ref|XP_006293532.1| hypothetical protein CARUB_v10025046mg [Capsella rubella]
 gb|EOA26430.1| hypothetical protein CARUB_v10025046mg [Capsella rubella]
Length=302

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 14/155 (9%)
 Frame = +3

Query  78   ENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWL  257
            E   LS + KWW D    + NGFWF P  I     + A + PLPSD+IL SFPKTGTTWL
Sbjct  7    EEDKLSPQAKWWVDGQRIRYNGFWFKPEFITASEAIRAHYKPLPSDIILASFPKTGTTWL  66

Query  258  KSLIFSIINRSSLDSLVKN----NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTT  425
            K+L  SI+  SS  S +++    NPH++VP+LE++++G +  S D +        +  + 
Sbjct  67   KALTSSILRHSSASSSIQDLDHLNPHEVVPFLEIEMFGKNP-SKDIT--------ELSSP  117

Query  426  RIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            R+FSTH+P   L +T++ +SGCRV+Y+ R+P DT 
Sbjct  118  RLFSTHLPLSFLPETVK-TSGCRVIYITRHPADTF  151



>ref|XP_006411297.1| hypothetical protein EUTSA_v10017780mg [Eutrema salsugineum]
 gb|ESQ52750.1| hypothetical protein EUTSA_v10017780mg [Eutrema salsugineum]
Length=309

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 15/156 (10%)
 Frame = +3

Query  78   ENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWL  257
            + I+L  + KWW D    +  GFWF P  I     + A + PLPSD+IL SFPKTGTTWL
Sbjct  9    DKISLPPQAKWWVDGQRSRYKGFWFKPEFITASEAIRAHYKPLPSDIILASFPKTGTTWL  68

Query  258  KSLIFSIINRSSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDT  422
            K+L  SI+  SS      D L   NPH++VP+LE++V+G++   S   T + S       
Sbjct  69   KALTSSILRHSSTTHSDHDHLDHLNPHEVVPFLEIEVFGEN--PSKEITEISSP------  120

Query  423  TRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             R+F+TH+P   L +T++ +SGCRV+Y+ R+P DT 
Sbjct  121  -RVFNTHLPLSFLPETVK-TSGCRVIYITRHPADTF  154



>ref|XP_010095979.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB62672.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW  P  I  I      F    +D+IL + PK+GTTWLK+L F++
Sbjct  24   KERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILATMPKSGTTWLKALAFAV  83

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR      S    L+ +NPHDLVP+LE ++Y ++Q    S      S +DQD  R+F T
Sbjct  84   VNRDHFPVDSDKHPLLTSNPHDLVPFLEYKIYANNQIPDLSKL----SADDQDRPRLFGT  139

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIP+  L  +++ S+ CRVVY+ RNP DT 
Sbjct  140  HIPFPSLANSVKKSNSCRVVYLCRNPFDTF  169



>ref|XP_010087683.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXC35772.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW  P  I  I      F    +D+IL + PK+GTTWLK+L F++
Sbjct  24   KERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILATMPKSGTTWLKALAFAV  83

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR      S    L+ +NPHDLVP+LE ++Y ++Q    S      S +DQD  R+F T
Sbjct  84   VNRDHFPVDSDKHPLLTSNPHDLVPFLEYKLYANNQIPDLSKL----SADDQDRPRLFGT  139

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIP+  L  +++ S+ CRVVY+ RNP DT 
Sbjct  140  HIPFPSLANSVKKSNSCRVVYLCRNPFDTF  169



>ref|XP_011085670.1| PREDICTED: cytosolic sulfotransferase 5-like [Sesamum indicum]
Length=340

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 8/151 (5%)
 Frame = +3

Query  96   EEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFS  275
            + EKW G + L +  GFWF    +    RV+    PL  DVIL SFPKTGTTWLK+++ S
Sbjct  28   QREKWCGHQFLFKFQGFWFTKTYLETTKRVVETLKPLTGDVILASFPKTGTTWLKAILHS  87

Query  276  IINRSSLDS---LVKNNPHDLVPYLEVQVYGDHQESSDS---STHVLSSEEDQDTTRIFS  437
            I++ S       L  N+P +LVP LE  +Y D     D    +   L+ ++ Q+  RI +
Sbjct  88   ILHPSPQHQNHPLALNHPQELVPSLETNLYVDKGTELDGGYKNPEFLAVKDPQE-ARILA  146

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIPYQ+LG  L +SS C+VVYV RNPKDTL
Sbjct  147  THIPYQILGDIL-NSSDCKVVYVTRNPKDTL  176



>emb|CDX93182.1| BnaC04g47140D [Brassica napus]
Length=304

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 15/149 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E KWW D    +  GFWF P  I     + A + PLPSD+IL SFPKTGTTWLK+L FSI
Sbjct  15   EAKWWVDGQRIRHKGFWFKPEFITASEAIRAHYTPLPSDIILASFPKTGTTWLKALTFSI  74

Query  279  INRSSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +  SS      D L   NPH++VP+LE++++G++   S  +T +          R+F+TH
Sbjct  75   LRHSSTIHDDRDHLDNLNPHEVVPFLEIELFGEN--PSKDTTKI-------SCPRVFNTH  125

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P   L  T+  +SG +V+Y+ R+P DT 
Sbjct  126  LPLSFLPDTV-MTSGSKVIYITRHPADTF  153



>ref|XP_009789857.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana sylvestris]
Length=346

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 13/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W  +HL+Q   FWF P  I  I RV   F   P+D IL +FPK+GTTW K+LIFS+
Sbjct  31   KEKGWITEHLYQYQSFWFTPEAIKGIKRVQECFKAQPTDAILVTFPKSGTTWFKALIFSL  90

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR   D     L+   PHD +P+LE  +     E+S     +  S        +F+THI
Sbjct  91   MNRDRFDFSSHPLLTKGPHDCIPFLEAII---RNETSYQDYRISCS-----PCCLFATHI  142

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY LL  ++  SSGC++VYV R PKD L
Sbjct  143  PYSLLPASV-MSSGCKIVYVFREPKDVL  169



>ref|XP_010507662.1| PREDICTED: cytosolic sulfotransferase 18-like [Camelina sativa]
Length=309

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 16/153 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            +S + KWW D       GFWF P  I     + A + PLPSD+IL SFPKTGTTWLK+L 
Sbjct  12   VSPQAKWWVDGQRIGYKGFWFKPEFITASEAIRAHYKPLPSDIILASFPKTGTTWLKALT  71

Query  270  FSIINR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRI  431
             SI+        SS+  L   NPH++VP+LE++++GD+   S   T + S        R+
Sbjct  72   SSILRHSSTSSSSSIQDLDHLNPHEVVPFLEIEMFGDN--PSKDITEISSP-------RL  122

Query  432  FSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            FSTH+P   L +T++ +SGCR +Y+ R+P DT 
Sbjct  123  FSTHLPLSFLPETVK-TSGCRFIYITRHPADTF  154



>ref|XP_009142138.1| PREDICTED: cytosolic sulfotransferase 11-like [Brassica rapa]
Length=307

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 91/152 (60%), Gaps = 15/152 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            +S E KWW D    +  GFWF P  I     + A + PLPSD+IL SFPKTGTTWLK+L 
Sbjct  11   ISPEAKWWVDGQRIRHKGFWFRPEFITASEAIRAHYTPLPSDIILASFPKTGTTWLKALT  70

Query  270  FSIINRSSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             SI+  SS      D L   NPH++VP+LE++++G++  +S   T +          R+F
Sbjct  71   SSILRHSSTIHDNHDHLDNLNPHEVVPFLEIELFGEN--ASKDITKI-------SCPRVF  121

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P   L  T+ ++SG +++Y+ R+P DT 
Sbjct  122  NTHLPLSFLPDTV-TTSGSKLIYITRHPADTF  152



>ref|XP_009621634.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
 ref|XP_009621635.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
Length=349

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 83/153 (54%), Gaps = 23/153 (15%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E  W  KHL+Q   FWF P  I  I RV   FN  P+D  L +FPK GTTW K+LIFSI
Sbjct  35   KENGWMVKHLYQYESFWFSPAAIRGIKRVQECFNAQPTDFFLATFPKAGTTWFKALIFSI  94

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQV-----YGDHQESSDSSTHVLSSEEDQDTTRI  431
             NR+  D     L+  +PHD +P++E  +     Y D+Q S                  +
Sbjct  95   TNRARFDFSSHPLLAKSPHDCIPFVESIIQDETSYRDYQISCSPCC-------------L  141

Query  432  FSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            F+THIPY LL  ++  SSGC++VYV R+ KD  
Sbjct  142  FATHIPYSLLPASV-VSSGCKIVYVFRDTKDVF  173



>dbj|BAJ92404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 84/142 (59%), Gaps = 16/142 (11%)
 Frame = +3

Query  123  HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----  290
             L Q  GFW +   +  +  + + F P PSDV+LGSFPK GTTWLK+L F+  NR+    
Sbjct  32   RLRQYGGFWLLEKFLEGVPALHSVFEPRPSDVVLGSFPKCGTTWLKALAFATRNRADHPP  91

Query  291  -SLD-SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
              LD  L + NPHD+V YLE+Q        + S  H L++     + R+F+TH+PY LL 
Sbjct  92   GGLDHPLRRRNPHDIVHYLELQF-------AVSMGHALAA---LPSPRVFATHLPYSLLP  141

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            + + +  GCR+VY+ R+PKD  
Sbjct  142  RRITAGQGCRIVYICRDPKDAF  163



>ref|XP_010271910.1| PREDICTED: cytosolic sulfotransferase 15-like [Nelumbo nucifera]
Length=347

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 90/144 (63%), Gaps = 14/144 (10%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W +  L+Q  GFWF+   +  +    + F     D+IL + PK+GTTWLKSL+F+ +NR+
Sbjct  44   WIEDPLYQHQGFWFIERRLEAVLWFQSNFKSCDRDIILATLPKSGTTWLKSLVFATVNRT  103

Query  291  ----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
                S + L+  NPH+LVP+ E+++Y D+Q         L +  +    R+F+THIPYQL
Sbjct  104  KYSFSDNPLLTANPHELVPFFELKLYTDNQ---------LPNLSNISHPRVFATHIPYQL  154

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            L +T ++S+ CR++Y+ RNP+DT 
Sbjct  155  LPETTKNSN-CRIIYLCRNPRDTF  177



>ref|XP_009789859.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana sylvestris]
Length=347

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 83/148 (56%), Gaps = 13/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W  +HL+Q   FWF P  I  + R    F   P+D IL +FPK+GTTW K+LIFS+
Sbjct  31   KEKGWITEHLYQYQSFWFTPAAIRGVKRAQQCFKAQPTDAILVTFPKSGTTWFKALIFSL  90

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR   +     L+   PHD +P+LE  +     E+S     +  S        + +THI
Sbjct  91   MNRDRFNFSSHPLLTKGPHDCIPFLEAII---QDETSYQDYRISCS-----PCCLLATHI  142

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY LL  ++  SSGC++VYV R PKD L
Sbjct  143  PYSLLPASV-MSSGCKIVYVFREPKDVL  169



>emb|CDX81030.1| BnaC03g02840D [Brassica napus]
Length=359

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 89/161 (55%), Gaps = 15/161 (9%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S   +E ++   +E+ W  +HL+   GFW     I  I      F PLP DVIL + PK+
Sbjct  46   SYEFLEMLDSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKPLPKDVILATIPKS  105

Query  243  GTTWLKSLIFSIINRSSLD-----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSE  407
            GTTWLK+L F+++NR   D      L+ +NPHDLVP+LE ++Y + +    SS       
Sbjct  106  GTTWLKALTFTLLNRHRFDPVSDHPLLTSNPHDLVPFLEYKLYANGEVPDLSSL------  159

Query  408  EDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                + R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  160  ---ASPRTFATHVPFGSLKGSIE-EPGVKVVYLCRNPFDTF  196



>gb|AFK33848.1| unknown [Lotus japonicus]
Length=339

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 87/150 (58%), Gaps = 15/150 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  ++L+   GFW  P  I  I+    +F    SDVI+ ++PK+GTTWLK+L F+++
Sbjct  34   EKGWTVRYLYLFQGFWCNPHRIQPIYTFQKQFQAKDSDVIVATYPKSGTTWLKALTFAVV  93

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGD--HQESSDSSTHVLSSEEDQDTTRIFST  440
            NR +  S     L+ +NPH LVP+ E  +YG+  H +  D S  +          RIF T
Sbjct  94   NRHNFPSSENHPLLTSNPHHLVPFFETSIYGEMIHDQIPDLSNVI--------ERRIFGT  145

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L K+++ +S C+++Y+ RNP D  
Sbjct  146  HVPFPSLAKSIKDNSKCKIIYLCRNPFDNF  175



>ref|XP_004514095.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 81/149 (54%), Gaps = 14/149 (9%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +L+   GFW  P  I  I      F    SDV + + PK+GTTWLK+L F+I+
Sbjct  38   EKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVATVPKSGTTWLKALTFAIV  97

Query  282  NR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR      S    L+  NPHDLVP++E  VYG+H+   + S             R+F TH
Sbjct  98   NRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNFSNF--------HEPRLFGTH  149

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L  +++ SS C++VY+ RNP DT 
Sbjct  150  VPFDSLSNSIKDSSNCKIVYICRNPFDTF  178



>dbj|BAJ86339.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89294.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 83/142 (58%), Gaps = 16/142 (11%)
 Frame = +3

Query  123  HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----  290
             L Q  GFW +   +  +  + + F P PSDV+LGSFPK GTTWLK+L F+  NR+    
Sbjct  32   RLRQYGGFWLLEKFLEGVPALHSVFEPRPSDVVLGSFPKCGTTWLKALAFATRNRADHPP  91

Query  291  -SLD-SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
              LD  L + NPHD+V YLE+Q        + S  H L++     + R+ +TH+PY LL 
Sbjct  92   GGLDHPLRRRNPHDIVHYLELQF-------AVSMGHALAA---LPSPRVLATHLPYSLLP  141

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            + + +  GCR+VY+ R+PKD  
Sbjct  142  RRITAGQGCRIVYICRDPKDAF  163



>ref|XP_011070903.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=356

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 14/149 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   HL+Q  GFW+    +  +      F    SD+ L + PK+GTTWLK++IF++
Sbjct  57   KEKGWLASHLYQYQGFWYAARHLQGVISCQKHFQAQDSDIFLVTIPKSGTTWLKAIIFTL  116

Query  279  INRSSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +NR          L+ +NPHDLVP+LE+++Y D+Q        ++SS     + R+FSTH
Sbjct  117  VNRKRYPVVKNHPLISHNPHDLVPFLEIKLYADNQ-----IPDIVSS----PSPRLFSTH  167

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +PY  L ++ ++SS  ++VY+ RNPKDT 
Sbjct  168  LPYVSLPESAKNSSKSKLVYLCRNPKDTF  196



>ref|XP_010916164.1| PREDICTED: cytosolic sulfotransferase 12-like [Elaeis guineensis]
Length=339

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 85/152 (56%), Gaps = 17/152 (11%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            +L + E W   + L +  GFW     IPR+  + A F P P+DVIL + PK GTTWLK+L
Sbjct  38   SLPKREGWM--RVLRRYQGFWISDVAIPRLMAIQAHFKPRPTDVILVTQPKAGTTWLKAL  95

Query  267  IFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             F+I+NRS    S   L+  NPH+ VP++++   G H     S              R+ 
Sbjct  96   AFAIVNRSNYSFSQHPLLSRNPHECVPFIDLPYVGGHAADYKSLAQ----------PRLL  145

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +THIPY LL  ++ + S CR+VY+ R+PKD L
Sbjct  146  ATHIPYSLLPASV-ADSDCRLVYLCRDPKDVL  176



>ref|XP_010670538.1| PREDICTED: cytosolic sulfotransferase 15-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 88/149 (59%), Gaps = 16/149 (11%)
 Frame = +3

Query  105  KWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIIN  284
            K W  ++L+    FW  P  I  I      F    SDVI+ + PK+GTTWLK+L+F+II+
Sbjct  37   KGWRTQNLYLFQSFWCQPKEIQAIISSQKHFAAQDSDVIIATVPKSGTTWLKALVFAIIS  96

Query  285  RSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            R   D       L+++NPHDLVP+LE +VY + Q         + +  + D+ R F++H+
Sbjct  97   RHRFDVNSKDHPLLRSNPHDLVPFLEYKVYANQQ---------IPTLSNLDSPRFFASHV  147

Query  447  PYQLLGKTL-ESSSGCRVVYVVRNPKDTL  530
            PY  L KT+ +++S C++VY+ RNP DT 
Sbjct  148  PYHSLPKTMTKNNSNCKIVYICRNPFDTF  176



>ref|XP_006407689.1| hypothetical protein EUTSA_v10021105mg [Eutrema salsugineum]
 gb|ESQ49142.1| hypothetical protein EUTSA_v10021105mg [Eutrema salsugineum]
Length=334

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (57%), Gaps = 27/172 (16%)
 Frame = +3

Query  66   ISIMENINLSEE----------EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSD  215
            ++ M++ N+S+E          EK +  K L    G W+ P  +  I      F P  +D
Sbjct  11   LNFMKDDNVSQECKNLISSLPSEKDFMGKSLFSYQGSWYYPNTVQAILNFQKHFRPRDTD  70

Query  216  VILGSFPKTGTTWLKSLIFSIINRS-----SLDS--LVKNNPHDLVPYLEVQVYGDHQES  374
            +IL SFPK+GTTWLK+L F++++R+     +LDS  L+ NNPH+LV +LE+ +Y  +Q  
Sbjct  71   IILASFPKSGTTWLKALAFAVVHRNKYAAYTLDSHPLLSNNPHNLVRFLEIDLYDKNQ--  128

Query  375  SDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   L   E+    R+F+TH+P+Q L +TL  S  C+VVYV RN KD L
Sbjct  129  -------LPDLEELPLPRLFATHMPFQTLNETLRDSP-CKVVYVCRNIKDVL  172



>gb|KEH33293.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=334

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 16/150 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   H HQ  GFW    I+  +      F  L +D++L + PK+GTTWLK+L F++I
Sbjct  34   EKGWISTHFHQYQGFWIGTRILQGVLSCQKHFQALNTDILLVTTPKSGTTWLKALTFALI  93

Query  282  NRSSLDS-------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            NR    +       L+ +NPH LVP+LEV +Y D     + ++            R+F+T
Sbjct  94   NRKKYQNIHNFNHPLLTSNPHVLVPFLEVDLYYDKDYVPNLNS--------LSPPRLFAT  145

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIPY+LL K+++ SS C+VVY+ R+PKDT 
Sbjct  146  HIPYELLPKSVKESS-CKVVYLCRDPKDTF  174



>ref|XP_004499637.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 80/149 (54%), Gaps = 14/149 (9%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +L+   GFW  P  I  I      F    SDV + + PK+GTTWLK+L F+ +
Sbjct  38   EKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVATVPKSGTTWLKALTFATV  97

Query  282  NR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR      S    L+  NPHDLVP++E  VYG+H+   + S             R+F TH
Sbjct  98   NRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNFSNF--------HEPRLFGTH  149

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L  +++ SS C++VY+ RNP DT 
Sbjct  150  VPFDSLSNSIKDSSNCKIVYICRNPFDTF  178



>ref|XP_007028479.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY08981.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=377

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 87/149 (58%), Gaps = 14/149 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +L++  GFW  P  I  I      F    +DVIL + PK+GTTW+K+L+F+ 
Sbjct  78   KEKGWRTPYLYKFQGFWCQPKEIQAIISFQKHFQARATDVILATIPKSGTTWIKALVFAT  137

Query  279  INR-----SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +NR     S+   L+ +NPHDLVP+LE ++Y D++         +    D    R+F+TH
Sbjct  138  MNRQRFGISNCHPLLTSNPHDLVPFLEYKLYADNE---------IPDLSDLPNPRLFATH  188

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L  +++++S  R+VY+ RNP DT 
Sbjct  189  VPFASLQNSIKNNSDRRIVYLCRNPFDTF  217



>ref|XP_011102095.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 88/148 (59%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW+    +  +      F    SD+ L + PK+GTTWLK++IF++
Sbjct  29   KERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIFLVTTPKSGTTWLKAIIFTL  88

Query  279  INRSSLDSLVK------NNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR+    + K      NNPHDLVP+LE+++Y D+Q    SS   L         R+FST
Sbjct  89   VNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFSSFPSL---------RLFST  139

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKD  524
            H P+  L ++++ +S C++VY+ RNPKD
Sbjct  140  HSPHVSLPESIKQNSACKIVYLCRNPKD  167



>ref|XP_011102114.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 88/148 (59%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW+    +  +      F    SD+ L + PK+GTTWLK++IF++
Sbjct  29   KERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIFLVTTPKSGTTWLKAIIFTL  88

Query  279  INRSSLDSLVK------NNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR+    + K      NNPHDLVP+LE+++Y D+Q    SS   L         R+FST
Sbjct  89   VNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFSSFPSL---------RLFST  139

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKD  524
            H P+  L ++++ +S C++VY+ RNPKD
Sbjct  140  HSPHVSLPESIKQNSACKIVYLCRNPKD  167



>ref|XP_009130975.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=360

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 83/150 (55%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W  +HL+Q  GFW     I  I      F  LP DVIL + PK+GTTWLK+L F++
Sbjct  58   KERGWRTRHLYQFQGFWCQAKEIHAIMSFQKHFKTLPKDVILATIPKSGTTWLKALTFTL  117

Query  279  INRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR   D +V +      NPHDLVP+LE ++Y + +    S            + R F+T
Sbjct  118  LNRHRFDPVVSDHPLLTSNPHDLVPFLEYKLYANGEVPDLSGL---------ASPRTFAT  168

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  169  HVPFGSLKGSIE-EPGAKVVYLCRNPFDTF  197



>emb|CDY58879.1| BnaA03g55570D [Brassica napus]
Length=359

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 87/161 (54%), Gaps = 15/161 (9%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S   +E ++   +E+ W  +HL+   GFW     I  I      F  LP DVIL + PK+
Sbjct  46   SYEFLEMLDSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKTLPKDVILATIPKS  105

Query  243  GTTWLKSLIFSIINRSSLD-----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSE  407
            GTTWLK+L F+++NR   D      L+ +NPHDLVP+LE ++Y + +    S        
Sbjct  106  GTTWLKALTFTLLNRHRFDPVSDHPLLTSNPHDLVPFLEYKLYANGEVPDLSGL------  159

Query  408  EDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                + R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  160  ---ASPRTFATHVPFGSLKGSIE-EPGAKVVYLCRNPFDTF  196



>ref|XP_003628738.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03214.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 15/146 (10%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W D   H+  GFWF P I+         F  + +D+IL + PK+GTTWLK+L F++INR+
Sbjct  37   WIDPTFHEYQGFWFAPKILQGALSFQKHFQAIDTDIILVTNPKSGTTWLKALTFALINRN  96

Query  291  SLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPY  452
               ++ KN      NPH LVP++E+ +Y +        T ++         RIFSTH PY
Sbjct  97   KYPNIHKNHPLLTSNPHVLVPFMEINLYYE--------TDIVPELNSLSPPRIFSTHNPY  148

Query  453  QLLGKTLESSSGCRVVYVVRNPKDTL  530
             LL K+L+ S+ C+VVY+ R+PKDT 
Sbjct  149  VLLPKSLKESN-CKVVYLCRDPKDTF  173



>ref|XP_004307199.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 77/148 (52%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   H +Q  GFW     I  I      F    SDV+L S PK+GTTWLK+L F++
Sbjct  29   KEKGWRTLHQYQFQGFWCQAAEIQSIMAFQNHFQASDSDVVLASIPKSGTTWLKALAFAV  88

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR   D     L+ +NPH LVP+LE  +Y D+Q         L         R+F TH+
Sbjct  89   VNRHRFDIKSHPLLTSNPHHLVPFLEYNLYADNQ---------LPDLSKFPEPRLFGTHV  139

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  LG      S C++VY+ RNP DT 
Sbjct  140  PYPSLGTI--KKSNCKIVYICRNPFDTF  165



>ref|XP_004514767.1| PREDICTED: cytosolic sulfotransferase 15-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 79/149 (53%), Gaps = 14/149 (9%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +L+   GFW  P  I  I      F    SDV + + PK+GTTWLK+L F+ +
Sbjct  38   EKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVATVPKSGTTWLKALTFATV  97

Query  282  NR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR      S    L+  NPHDLVP++E  VYG+H+   + S             R+F TH
Sbjct  98   NRQHHFISSKNHPLLSYNPHDLVPFIEYTVYGNHENLPNFSNF--------HEPRLFGTH  149

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L  +++  S C++VY+ RNP DT 
Sbjct  150  VPFDSLSNSIKDFSNCKIVYICRNPFDTF  178



>emb|CDP16517.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 16/162 (10%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E +N   +E+ W  +HL+   GFW  P  I  I  V   F    SDV+L + PK+
Sbjct  23   SEECQELLNTLPKERGWRTQHLYLFQGFWCQPKEIQAIMSVQRNFIAQDSDVVLATIPKS  82

Query  243  GTTWLKSLIFSIINRSSL------DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSS  404
            GTTWLK++ F+I+NR ++        L+  NPH+LVP+LE ++Y D+     S+      
Sbjct  83   GTTWLKAIAFTIVNRKNIPVQNDHHPLLTANPHELVPFLEYKLYADNCIPDFSTI-----  137

Query  405  EEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   ++ +TH+P+  L ++++  SGCRVVY+ RNP DT 
Sbjct  138  ----PCPKLLATHMPFSALPQSVK-ESGCRVVYLARNPFDTF  174



>ref|XP_011020444.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
 ref|XP_011015958.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=337

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 82/149 (55%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W    L++  GFW  P  I  I      F P  +DVIL S PK+GTTWLK+L F+I+
Sbjct  35   EKGWRTACLYKYKGFWCQPKEIQAIISFQKNFQPRDTDVILASIPKSGTTWLKALSFAIM  94

Query  282  NRSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR           L+ +NPHDL P+ E ++Y D Q         LS   D    R+F+TH
Sbjct  95   NRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPD------LSKLPD---PRLFATH  145

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            IP+  L  +++ S+ CR++Y+ RNP DT 
Sbjct  146  IPFASLQDSIKKSN-CRIIYICRNPFDTF  173



>gb|EMS52304.1| Flavonol sulfotransferase-like protein [Triticum urartu]
Length=248

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 82/143 (57%), Gaps = 12/143 (8%)
 Frame = +3

Query  123  HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSS---  293
            HL Q +GFW +   +  +  V + F P PSDV+L SFPK GTTWLK+++F+  NR+    
Sbjct  27   HLRQYDGFWLLEEFLMDVPAVHSVFEPRPSDVLLASFPKCGTTWLKAIVFATRNRAEHPP  86

Query  294  LD---SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
             D    L   NPHD+V YLE+      Q + DS      +     + R+ +TH+PY LL 
Sbjct  87   CDLNHPLRHGNPHDVVRYLEMAF---AQSTDDSGAG--DAFAALPSPRVVATHLPYSLLP  141

Query  465  KTLES-SSGCRVVYVVRNPKDTL  530
            + + +  SGCR+VY+ RNPKD  
Sbjct  142  RRITAEESGCRIVYICRNPKDAF  164



>ref|XP_002304810.1| sulfotransferase family protein [Populus trichocarpa]
 gb|EEE79789.1| sulfotransferase family protein [Populus trichocarpa]
Length=337

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 82/149 (55%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W    L++  GFW  P  I  I      F P  +DVIL S PK+GTTWLK+L F+I+
Sbjct  35   EKGWRTACLYKYKGFWCQPKEIQAIISFQKHFEPRDTDVILASIPKSGTTWLKALSFAIL  94

Query  282  NRSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR           L+ +NPHDL P+ E ++Y D Q         LS   D    R+F+TH
Sbjct  95   NRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPD------LSKLPD---PRLFATH  145

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            IP+  L  +++ S+ CR++Y+ RNP DT 
Sbjct  146  IPFASLQDSIKKSN-CRIIYICRNPFDTF  173



>ref|XP_006662952.1| PREDICTED: cytosolic sulfotransferase 8-like [Oryza brachyantha]
Length=347

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 85/148 (57%), Gaps = 26/148 (18%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----S  293
            L    G+W   +++P +  V A F+P PSDV+L SFPK+GTTWLK+L F++ NR+    S
Sbjct  41   LRLYGGYWLPEWVLPGLEAVHARFDPRPSDVLLASFPKSGTTWLKALAFAVANRADHPPS  100

Query  294  LDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQD------TTRIFSTHIP  449
             D+  L ++ PHD V + E             S+  L+ E   D      + R+ +TH+P
Sbjct  101  GDAHPLRRSGPHDCVRFFE-------------SSFALAGEGGGDIFAASPSPRLLATHMP  147

Query  450  YQLLGKTLESS-SGCRVVYVVRNPKDTL  530
            Y LL + + +S SGCR+VYV R+PKD  
Sbjct  148  YSLLPERITASGSGCRIVYVCRDPKDAF  175



>ref|XP_007133678.1| hypothetical protein PHAVU_011G199900g [Phaseolus vulgaris]
 gb|ESW05672.1| hypothetical protein PHAVU_011G199900g [Phaseolus vulgaris]
Length=326

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 90/157 (57%), Gaps = 13/157 (8%)
 Frame = +3

Query  78   ENINLS-EEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTW  254
            EN+ LS  +E+ W  ++L+    FW     I  ++     F   PSDV++ SFPK+GTTW
Sbjct  13   ENLLLSLPKERGWASRYLYLFQHFWCPSTHIQGVNDFQKNFQAKPSDVLVASFPKSGTTW  72

Query  255  LKSLIFSIINRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQD  419
            LK+L FSIINR    S     L+ +NPH+LVP+L+   + D+ +        LS   +  
Sbjct  73   LKALTFSIINRKRFSSSENHPLLTSNPHELVPFLDFIFHADNLQQK------LSHLSNMS  126

Query  420  TTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              R+F TH+P+  L  +++ S+ C+++Y+ RNP DT 
Sbjct  127  EPRVFGTHVPFPSLSSSIKDSN-CKIIYICRNPFDTF  162



>ref|XP_007010821.1| Sulfotransferase 2A [Theobroma cacao]
 gb|EOY19631.1| Sulfotransferase 2A [Theobroma cacao]
Length=349

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W    ++   GFW  P  I  I      F    SDVIL + PK+GTTW+K+L F+I
Sbjct  46   KEKGWRTPFIYLFQGFWCQPKEIQAIISFQKHFQARDSDVILATIPKSGTTWIKALTFAI  105

Query  279  INRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR    +  KN      NPHDLVP+ E ++Y ++Q         +    +    R+F T
Sbjct  106  MNRKRFTTSSKNHPLLTSNPHDLVPFFEYKLYANNQ---------IPDLSNLPKPRLFGT  156

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L ++++SSS CR++YV RNP DT 
Sbjct  157  HVPFASLQESIKSSS-CRIIYVCRNPFDTF  185



>ref|NP_001067947.1| Os11g0503900 [Oryza sativa Japonica Group]
 gb|ABA93893.1| Sulfotransferase domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28310.1| Os11g0503900 [Oryza sativa Japonica Group]
 gb|EAZ18462.1| hypothetical protein OsJ_33987 [Oryza sativa Japonica Group]
 dbj|BAG87780.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 80/142 (56%), Gaps = 18/142 (13%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD--  299
            L Q  GFW     +P +    A F P PSDV+L SFPK+GTTWLK+L F+ +NR++    
Sbjct  39   LRQHGGFWLPETFLPGLEAARARFEPRPSDVLLASFPKSGTTWLKALAFATLNRAAYPPS  98

Query  300  ----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGK  467
                 L +  PHD V +LE  +       SD     L S       R+ STH+PY LL +
Sbjct  99   GEGHPLRRRGPHDCVQFLESALV-----VSDDMFASLPS------PRLLSTHLPYSLLPE  147

Query  468  TLES-SSGCRVVYVVRNPKDTL  530
             +++ SSGCR+VY+ R+PKD L
Sbjct  148  GVKADSSGCRIVYICRDPKDVL  169



>ref|XP_010095980.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB62673.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=343

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
             L + + + G   L    GFW    I+P +      F     D+IL S PK+GTTWLK+L
Sbjct  29   QLPKTKGFLGLSSLSLYQGFWCPSKIVPNVISFQTHFQAHDQDIILASKPKSGTTWLKAL  88

Query  267  IFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            +FSI+NR+    S   L+ +NPH LVP+LE  ++ DH    +S+   +       + R+F
Sbjct  89   VFSIVNRARYTPSNTPLLISNPHQLVPFLEFTLFADHAIHKNSAAVKVPDLSGIPSPRLF  148

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            STHIPY  L +++++S  CR+VY+ RNP D +
Sbjct  149  STHIPYPSLPESVKNSK-CRIVYICRNPLDVI  179



>ref|XP_003542798.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
 gb|KHN37709.1| Flavonol sulfotransferase-like [Glycine soja]
Length=344

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 89/151 (59%), Gaps = 16/151 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E+ W  ++++   GFW  P  I  I      F    SDVI+ + PK+GTTWLK+L F+I+
Sbjct  42   ERGWRTRYIYLFQGFWCQPLEIQAIITFQKHFQAKDSDVIVATIPKSGTTWLKALTFAIV  101

Query  282  NR------SSLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            NR      +S+ S  L+ +NPH+LVP++E  VYG      ++ +HV  +  +    R+F 
Sbjct  102  NRHTHSITTSMSSHPLLTSNPHELVPFIEYTVYG------NAPSHV-PNLSNMTEPRLFG  154

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP+  L K+++ S+  R++Y+ RNP DT 
Sbjct  155  THIPFHALAKSIKESNS-RIIYICRNPLDTF  184



>ref|XP_006445787.1| hypothetical protein CICLE_v10017680mg [Citrus clementina]
 ref|XP_006485556.1| PREDICTED: cytosolic sulfotransferase 12-like [Citrus sinensis]
 gb|ESR59027.1| hypothetical protein CICLE_v10017680mg [Citrus clementina]
Length=312

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 87/150 (58%), Gaps = 17/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK+W    L+Q++G+W+   +IP +    +EF  L  DVIL S  KTGTTWLK+L   I
Sbjct  15   KEKFWEILDLYQLDGYWYSGDVIPGMLAFKSEFKALSDDVILASSMKTGTTWLKALCICI  74

Query  279  I------NRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +      +R  +D L   NPHD +  LE   Y           ++LS  +D  + R+F+T
Sbjct  75   MGNQRKNDRDEVDQLEVKNPHDHIKCLEYLYY----------FNLLSKLKDMQSPRVFNT  124

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+PY  L +++++S  C++VY+ RNPKDT 
Sbjct  125  HLPYSALPESIKNSE-CKIVYIARNPKDTF  153



>ref|XP_006591672.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=342

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 81/149 (54%), Gaps = 15/149 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +++   GFW  P  I  I      F    SDV++ + PK+GTTWLK+L F+ +
Sbjct  39   EKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLVATVPKSGTTWLKALTFATV  98

Query  282  NRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +R +  S  KN      NPHDLVP+ E  VY  H +  D S        +    R+F TH
Sbjct  99   SRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS--------NMHEPRLFGTH  150

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L K+++ S+ C+V+Y+ RNP DT 
Sbjct  151  VPFASLSKSIKESN-CKVIYICRNPFDTF  178



>gb|KDO65654.1| hypothetical protein CISIN_1g018736mg [Citrus sinensis]
Length=351

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 17/147 (12%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFI-IPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINR  287
            W   HL Q  GFWF P I +  +  V   F P P+DV L + PK+GTTWLK+++FSI+NR
Sbjct  42   WSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWLKAIVFSIMNR  101

Query  288  SSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
               ++      L+K +PH++VP++E+ ++          T  ++  E   + RI +THI 
Sbjct  102  KRYNNFTTDHPLLKFSPHEVVPFMELDLF---------RTTPIADPEILPSPRILATHIA  152

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y +L +++++SS C +VY+ RNPKD  
Sbjct  153  YNMLPESIQNSS-CPIVYICRNPKDVF  178



>gb|EAY81025.1| hypothetical protein OsI_36209 [Oryza sativa Indica Group]
Length=343

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 80/142 (56%), Gaps = 18/142 (13%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD--  299
            L Q  GFW     +P +    A F P PSDV+L SFPK+GTTWLK+L F+ +NR++    
Sbjct  39   LRQHGGFWLPETFLPGLEAAHARFEPRPSDVLLASFPKSGTTWLKALAFATLNRAAYPPS  98

Query  300  ----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGK  467
                 L +  PHD V +LE  +       SD     L S       R+ STH+PY LL +
Sbjct  99   GEGHPLRRRGPHDCVQFLESALV-----VSDDMFASLPS------PRLLSTHLPYSLLPE  147

Query  468  TLES-SSGCRVVYVVRNPKDTL  530
             +++ SSGCR+VY+ R+PKD L
Sbjct  148  GVKADSSGCRIVYICRDPKDVL  169



>ref|XP_006440813.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
 gb|ESR54053.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
Length=351

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 17/147 (12%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFI-IPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINR  287
            W   HL Q  GFWF P I +  +  V   F P P+DV L + PK+GTTWLK+++FSI+NR
Sbjct  42   WSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWLKAIVFSIMNR  101

Query  288  SSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
               ++      L+K +PH++VP++E+ ++          T  ++  E   + RI +THI 
Sbjct  102  KRYNNFTTDHPLLKFSPHEVVPFMELDLF---------RTTPIADPEILPSPRILATHIA  152

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y +L +++++SS C +VY+ RNPKD  
Sbjct  153  YNMLPESIQNSS-CPIVYICRNPKDVF  178



>ref|XP_006289894.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
 gb|EOA22792.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
Length=360

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F P P+DV+L + PK+
Sbjct  44   SYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQRHFRPFPNDVVLATIPKS  103

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L+ +NPHDLVP+ E ++Y D      S     
Sbjct  104  GTTWLKALTFTILNRHRFDPVSSSTDHPLLTSNPHDLVPFFEYKLYADGAVPDLSGLA--  161

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                     R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  162  -------RPRAFATHVPFGSLKDSIE-EPGVKVVYLCRNPFDTF  197



>gb|KHN26485.1| Flavonol sulfotransferase-like [Glycine soja]
Length=342

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 81/149 (54%), Gaps = 15/149 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +++   GFW  P  I  I      F    SDV++ + PK+GTTWLK+L F+ +
Sbjct  39   EKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLVATVPKSGTTWLKALTFATV  98

Query  282  NRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +R +  S  KN      NPHDLVP+ E  VY  H +  D S        +    R+F TH
Sbjct  99   SRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS--------NMHEPRLFGTH  150

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L K+++ S+ C+V+Y+ RNP DT 
Sbjct  151  VPFASLSKSIKDSN-CKVIYICRNPFDTF  178



>ref|XP_008347825.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
 ref|XP_008344564.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
Length=329

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 12/150 (8%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW     I  I      F    +D++L + PK+GTTWLK+L F+ 
Sbjct  22   KERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLATIPKSGTTWLKALAFAT  81

Query  279  INRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR    +      L+ +NPHDLVP+ E ++Y ++Q    ++T++       D  R+F T
Sbjct  82   VNRHRFTTNSKSHPLLXSNPHDLVPFFEYKLYANNQIPDLTTTNL-----PDDQPRLFGT  136

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIP+  L  ++  S+  ++VY+ RNP DT 
Sbjct  137  HIPFASLANSIRKSNS-KIVYICRNPFDTF  165



>ref|XP_010031022.1| PREDICTED: cytosolic sulfotransferase 15-like [Eucalyptus grandis]
 gb|KCW50285.1| hypothetical protein EUGRSUZ_J00069 [Eucalyptus grandis]
Length=341

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 81/151 (54%), Gaps = 17/151 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W  KH++   GFW  P  I  I      F    SD++L + PK+GTTWLK+L F+I
Sbjct  35   KEKGWRTKHIYLFQGFWCQPKEIQSILSFQRHFQAQDSDIVLSTIPKSGTTWLKALAFAI  94

Query  279  INRSSLD-------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
             NR            L+ +NPHDLVP+ E +VY     SSD     L         RIF 
Sbjct  95   ANREKYPISKKKSHPLLTSNPHDLVPFFEYKVYA----SSD-----LPDLSKFPEPRIFG  145

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP+  L + +++S  C++VY+ RNP DT 
Sbjct  146  THIPFPALAEPIKNSQ-CKIVYICRNPFDTF  175



>ref|XP_009370647.1| PREDICTED: cytosolic sulfotransferase 15-like [Pyrus x bretschneideri]
Length=329

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 12/150 (8%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW     I  I      F    +D++L + PK+GTTWLK+L F+ 
Sbjct  22   KERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLATIPKSGTTWLKALAFAT  81

Query  279  INRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR    +      L+ +NPHDLVP+ E ++Y ++Q    ++T++       D  R+F T
Sbjct  82   VNRHRFTTNSKSHPLLTSNPHDLVPFFEYKLYANNQIPDLTTTNL-----PDDQPRLFGT  136

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIP+  L  ++  S+  ++VY+ RNP DT 
Sbjct  137  HIPFASLANSIRKSNS-KIVYICRNPFDTF  165



>ref|XP_011020446.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=330

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 93/173 (54%), Gaps = 26/173 (15%)
 Frame = +3

Query  60   SSISIMENINLSE------------EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNP  203
            S+  I EN NL+E            +EK W   ++++  GFW     IP +      F  
Sbjct  4    STQMITENNNLAETDVIADLLSSLPKEKSWQSGYVYRYQGFWCPEKQIPALIAFQKHFRA  63

Query  204  LPSDVILGSFPKTGTTWLKSLIFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQE  371
              +D IL + PK+GTTWLK+L FSI+NR+    S   L   NPHDLVP+ E  +Y ++Q 
Sbjct  64   QKTDTILVTMPKSGTTWLKALAFSIMNRAKYTPSCSPLNSVNPHDLVPFFEFGLYANNQ-  122

Query  372  SSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              D ST          + R+F+TH+PY  +  +++ +SGCR+VY+ RNP D  
Sbjct  123  IPDLSTF--------QSPRMFATHVPYPSISDSIK-NSGCRIVYLCRNPFDNF  166



>ref|XP_010051030.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=390

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 96/179 (54%), Gaps = 15/179 (8%)
 Frame = +3

Query  9    LSSNQTTINIKIALHY*SSISIMENINLS-EEEKWWGDKHLHQINGFWFMPFIIPRIHRV  185
            LSS +  +  +IAL    +      I+ S   EK W  +HL+   GFW+    +  +   
Sbjct  54   LSSQEELLKEQIALECQGAEKREVAISSSLPREKGWLTQHLYNYQGFWYDNHFLGGVIWA  113

Query  186  LAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQV  353
               F   P+D +L +FPKTG TW+K+L F+I NR + D    +L+  NPH+ VPY+E   
Sbjct  114  QQNFEARPTDTLLATFPKTGLTWIKALSFAIANRHNQDLPRHTLLTKNPHECVPYIEFYA  173

Query  354  YGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y   ++   S+   L S       R+ STHIPY  L +++ ++SGCR+V +VR PKD  
Sbjct  174  Y---EKDPISALDALPS------PRLLSTHIPYASLPRSV-ATSGCRIVCIVREPKDVF  222



>ref|XP_010051056.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=470

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 98/179 (55%), Gaps = 15/179 (8%)
 Frame = +3

Query  9    LSSNQTTINIKIALHY*SSISIMENINLS-EEEKWWGDKHLHQINGFWFMPFIIPRIHRV  185
            LSS +  +  +IAL    +      I+ S   EK W  +HL+   GFW+    +  +   
Sbjct  134  LSSQEELLKEQIALECQGAEKREVAISSSLPREKGWLTQHLYNYQGFWYDNHFLGGVIWA  193

Query  186  LAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQV  353
               F   P+D +L +FPKTG TW+K+L F+I NR + D    +L+  NPH+ VP++E   
Sbjct  194  QQHFEARPTDTLLATFPKTGLTWIKALSFAIANRHNQDLPRHTLLTKNPHECVPFIEFFA  253

Query  354  YGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y   ++   S+ H L S       R+ STHIPY  L +++ ++SGCR+V +VR+PKD  
Sbjct  254  Y---EKDPISALHALPS------PRLLSTHIPYASLPRSV-ATSGCRIVCIVRDPKDVF  302



>gb|KCW81180.1| hypothetical protein EUGRSUZ_C02547, partial [Eucalyptus grandis]
Length=317

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 85/147 (58%), Gaps = 14/147 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  +HL+   GFW+    +  +      F   P+D +L +FPKTG TW+K+L F+I 
Sbjct  13   EKGWLTQHLYNYQGFWYDNHFLGGVIWAQQHFEARPTDTLLATFPKTGLTWIKALSFAIA  72

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NR + D    +L+  NPH+ VP++E   Y   ++   S+ H L S       R+ STHIP
Sbjct  73   NRHNQDLPRHTLLTKNPHECVPFIEFFAY---EKDPISALHALPS------PRLLSTHIP  123

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y  L +++ ++SGCR+V +VR+PKD  
Sbjct  124  YASLPRSV-ATSGCRIVCIVRDPKDVF  149



>ref|XP_003598424.1| Sulfotransferase [Medicago truncatula]
Length=329

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 87/171 (51%), Gaps = 27/171 (16%)
 Frame = +3

Query  69   SIMENINLSEE----------EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDV  218
            SI E   LS+E          EK W   +++   GFW  P  I  I      F    SDV
Sbjct  6    SIEEQGQLSQENKKLILSLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDV  65

Query  219  ILGSFPKTGTTWLKSLIFSIINR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSD  380
             + + PK+GTTWLK+L ++I+NR      S    L+  NPHDLVP++E  VYG H    D
Sbjct  66   FVATVPKSGTTWLKALTYAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPD  125

Query  381  -SSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             S  H           R+F THIP+  L  +++ S+ C++VY+ RNP DT 
Sbjct  126  LSKIH---------EPRLFGTHIPFDSLSNSIKGSN-CKIVYICRNPFDTF  166



>gb|EEC76735.1| hypothetical protein OsI_14772 [Oryza sativa Indica Group]
Length=327

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 80/142 (56%), Gaps = 20/142 (14%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSL---  296
            L Q  GFW +  ++  +      F P PSD++L SFPK GTTWLK+L F+ +NRS+    
Sbjct  15   LRQYGGFWLLEVMLNGVAAAETSFQPRPSDILLSSFPKCGTTWLKALAFATLNRSTYPPS  74

Query  297  ---DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL-G  464
                 L+++NPHDLV +LE+    +  ES  S              R+ STH+PY +L  
Sbjct  75   DEHHPLLEHNPHDLVGFLEIYPKLELYESLPSP-------------RLLSTHLPYSMLPH  121

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            +  E  +GCR+VY+ R+PKD +
Sbjct  122  RIREQETGCRLVYIYRDPKDAM  143



>gb|AES68675.2| sulfotransferase [Medicago truncatula]
Length=340

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 87/171 (51%), Gaps = 27/171 (16%)
 Frame = +3

Query  69   SIMENINLSEE----------EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDV  218
            SI E   LS+E          EK W   +++   GFW  P  I  I      F    SDV
Sbjct  17   SIEEQGQLSQENKKLILSLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDV  76

Query  219  ILGSFPKTGTTWLKSLIFSIINR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSD  380
             + + PK+GTTWLK+L ++I+NR      S    L+  NPHDLVP++E  VYG H    D
Sbjct  77   FVATVPKSGTTWLKALTYAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPD  136

Query  381  -SSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             S  H           R+F THIP+  L  +++ S+ C++VY+ RNP DT 
Sbjct  137  LSKIH---------EPRLFGTHIPFDSLSNSIKGSN-CKIVYICRNPFDTF  177



>ref|NP_001176522.1| Os11g0450300 [Oryza sativa Japonica Group]
 dbj|BAH95250.1| Os11g0450300, partial [Oryza sativa Japonica Group]
Length=335

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 80/142 (56%), Gaps = 20/142 (14%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSL---  296
            L Q  GFW +  ++  +      F P PSD++L SFPK GTTWLK+L F+ +NRS+    
Sbjct  23   LRQYGGFWLLEVMLNGVAAAETSFQPRPSDILLSSFPKCGTTWLKALAFATLNRSTYPPS  82

Query  297  ---DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG-  464
                 L+++NPHDLV +LE+    +  ES  S              R+ STH+PY +L  
Sbjct  83   DEHHPLLEHNPHDLVGFLEIYPKLELYESLPSP-------------RLLSTHLPYSMLPH  129

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            +  E  +GCR+VY+ R+PKD +
Sbjct  130  RIREQETGCRLVYIYRDPKDAM  151



>ref|XP_010521619.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic sulfotransferase 1-like 
[Tarenaya hassleriana]
Length=329

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 92/174 (53%), Gaps = 26/174 (15%)
 Frame = +3

Query  60   SSISIMENINLSEEEKWW-----GDKHLHQIN-----GFWFMPFIIPRIHRVLAEFNPLP  209
            S + IM +  LSEE +        DK    IN     G W+    +  +  V   F PL 
Sbjct  7    SILKIMGDDELSEECRSLISSLPTDKDFEGINLCNYQGHWYYYNSLQAVINVRDHFRPLD  66

Query  210  SDVILGSFPKTGTTWLKSLIFSIINRSS-------LDSLVKNNPHDLVPYLEVQVYGDHQ  368
            +DVIL SFPK+GTTW K+LIF+I+ R            L+  NPH LVP+LE+ +Y D++
Sbjct  67   TDVILASFPKSGTTWXKALIFAIVERKKHRPDPDQTHPLLTRNPHSLVPFLELVLYADNR  126

Query  369  ESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                     +    +  + R+FSTH+P+  L + +  +S C+VVYV RNPKD +
Sbjct  127  ---------VPDLTEYPSPRLFSTHMPFHTLSEAVIKASPCKVVYVCRNPKDVV  171



>gb|ABA93428.2| Sulfotransferase domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=327

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 80/142 (56%), Gaps = 20/142 (14%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSL---  296
            L Q  GFW +  ++  +      F P PSD++L SFPK GTTWLK+L F+ +NRS+    
Sbjct  15   LRQYGGFWLLEVMLNGVAAAETSFQPRPSDILLSSFPKCGTTWLKALAFATLNRSTYPPS  74

Query  297  ---DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG-  464
                 L+++NPHDLV +LE+    +  ES  S              R+ STH+PY +L  
Sbjct  75   DEHHPLLEHNPHDLVGFLEIYPKLELYESLPSP-------------RLLSTHLPYSMLPH  121

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            +  E  +GCR+VY+ R+PKD +
Sbjct  122  RIREQETGCRLVYIYRDPKDAM  143



>dbj|BAJ90951.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  123  HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD-  299
            HL Q  GFWF   ++P I  V   F P PSDV L SFPK+GTTWLK+L F+  +R+    
Sbjct  29   HLRQHGGFWFPETLLPGIVAVRTRFAPRPSDVFLASFPKSGTTWLKALAFATAHRADHPP  88

Query  300  -----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
                  L   NPHD V +LEV    D   ++D+   + S        R+ +TH+PY LL 
Sbjct  89   HAPDHPLRHRNPHDCVEFLEVSYALD--PTADAFAALPS-------PRVIATHLPYPLLP  139

Query  465  KTLES-SSGCRVVYVVRNPKDTL  530
            +   +  +GC+VVYV R+PKD  
Sbjct  140  ERFTAEGAGCKVVYVCRDPKDAF  162



>ref|XP_006440811.1| hypothetical protein CICLE_v10023927mg [Citrus clementina]
 gb|ESR54051.1| hypothetical protein CICLE_v10023927mg [Citrus clementina]
Length=377

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 83/147 (56%), Gaps = 15/147 (10%)
 Frame = +3

Query  105  KWWGDKHLHQINGFWFMPF-IIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            K W  +HL    G W   +  +  +  +   F   P+D+ L +FPK GTTWLK+LIF+ +
Sbjct  79   KGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKCGTTWLKALIFATM  138

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NRS  D     L+  +PHD VP+L+  ++   Q +  SS H L S       R+F+THIP
Sbjct  139  NRSRYDFPSHPLLSASPHDCVPFLDAYIF---QNNPVSSIHSLPS------PRLFATHIP  189

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y LL  ++  SSG R VY+ RNPKD L
Sbjct  190  YDLLPNSM-ISSGSRFVYICRNPKDVL  215



>ref|XP_008240109.1| PREDICTED: LOW QUALITY PROTEIN: flavonol sulfotransferase-like 
[Prunus mume]
Length=330

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 87/152 (57%), Gaps = 10/152 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAE-FNPLPSDVILGSFPKTGTTWLKSLIFS  275
            +E+ W  +HL Q  GFW  P    +   +L   F+  PSD++L +F K+GTT L++L+F+
Sbjct  13   KERGWMTQHLVQYQGFWLSPACAFKGALLLQHHFHARPSDILLATFQKSGTTRLRALMFA  72

Query  276  IINRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
             +NR+  D       L+   PHD  P+L+  ++     S  +S  +LS         +FS
Sbjct  73   TMNRALYDMSSYQHPLLTTGPHDCFPFLDAYIHQTDSISHLNSRPILSHPMMHPA--LFS  130

Query  438  THIPYQLLGKTL-ESSSGCRVVYVVRNPKDTL  530
            TH+PY LL K++  SSSGCR VYV RNPKD L
Sbjct  131  THMPYALLPKSVTASSSGCRCVYVCRNPKDVL  162



>ref|XP_011001965.1| PREDICTED: flavonol sulfotransferase-like [Populus euphratica]
Length=323

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            NL +++ W     L++  GFW+ P ++  +      F P P+D++L S PK+GT WLK+L
Sbjct  23   NLRQDDGWKPVGKLYEYQGFWYGPSLVQNVISAQESFTPQPTDIVLCSSPKSGTAWLKAL  82

Query  267  IFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             FSI++R+    S + L+K  PH++VP+LE+++      + DS+   L        T   
Sbjct  83   AFSIVSRNQVNDSTNPLLKKLPHEIVPFLEIEL------AQDSNNRNLE-------TPFV  129

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +THIPY  L +++  SS C+++Y+ R+PKD L
Sbjct  130  ATHIPYSSLPRSIIDSS-CKIIYICRDPKDVL  160



>gb|KEH16899.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
 gb|AES70035.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 16/150 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HLHQ  GFW     +  +      F    +D+IL + PK GTTWLK+LIF+++
Sbjct  33   EKGWVSTHLHQYQGFWQTKKHLQGVLSFQKHFQAHDTDIILATSPKAGTTWLKALIFALL  92

Query  282  NRSSLDS-------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            NR    +       L+  NPH LVP+LE+ +Y +          +L         R+FST
Sbjct  93   NRKRYPNIHDNNHPLLTTNPHVLVPFLELSLYIEKD--------ILPDINSFSAPRLFST  144

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+PY+ L K+++ S+ C+VVY+ R+PKDT 
Sbjct  145  HVPYKSLPKSIKDST-CKVVYLCRDPKDTF  173



>gb|KDO65656.1| hypothetical protein CISIN_1g041950mg, partial [Citrus sinensis]
Length=307

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 83/147 (56%), Gaps = 15/147 (10%)
 Frame = +3

Query  105  KWWGDKHLHQINGFWFMPF-IIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            K W  +HL    G W   +  +  +  +   F   P+D+ L +FPK GTTWLK+LIF+ +
Sbjct  9    KGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKCGTTWLKALIFATM  68

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NRS  D     L+  +PHD VP+L+  ++   Q +  SS H L S       R+F+THIP
Sbjct  69   NRSRYDFPSHPLLSASPHDCVPFLDAYIF---QNNPVSSIHSLPS------PRLFATHIP  119

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y LL  ++  SSG R VY+ RNPKD L
Sbjct  120  YDLLPNSM-ISSGSRFVYICRNPKDVL  145



>ref|XP_002538120.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF24263.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=326

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 81/146 (55%), Gaps = 16/146 (11%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W   +++Q  GFW  P  I  I      F    +DV++ + PK+GTTWLK+L FSI+NR 
Sbjct  27   WRTPYIYQFQGFWCQPKEIQSILSFQKHFQARNNDVVIATIPKSGTTWLKALTFSILNRK  86

Query  291  SL------DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPY  452
            S         L+ +NPHDLVP+ E +VY + Q    S              R+F+TH+P+
Sbjct  87   SFPLSSKAHPLLNSNPHDLVPFFEYKVYANGQVPDVSKL---------PDPRLFATHLPF  137

Query  453  QLLGKTLESSSGCRVVYVVRNPKDTL  530
              L ++++ SS C++VY+ RNP DT 
Sbjct  138  SSLQESIKKSS-CKIVYICRNPFDTF  162



>ref|XP_002873289.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49548.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  LP+DV+L + PK+
Sbjct  40   SYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMCFQKHFQSLPNDVVLATIPKS  99

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L+ +NPHDLVP+ E ++Y +      SS    
Sbjct  100  GTTWLKALTFTILNRHRFDPVSLSSDHPLLTSNPHDLVPFFEYKLYANGDVPKLSSLA--  157

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   + R F+THIP+  L  ++E   G +VVY+ RNP DT 
Sbjct  158  -------SPRTFATHIPFGSLMDSIE-KPGVKVVYLCRNPFDTF  193



>ref|XP_006302485.1| hypothetical protein CARUB_v10020580mg [Capsella rubella]
 gb|EOA35383.1| hypothetical protein CARUB_v10020580mg [Capsella rubella]
Length=346

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 86/148 (58%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  43   EKGWRAKEPLIEYGGYWWLPPLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  102

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  103  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  152

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R+PKDT 
Sbjct  153  PYELLPDSV-VKSGCKMVYIWRDPKDTF  179



>gb|ABK95273.1| unknown [Populus trichocarpa]
Length=323

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            NL +++ W     L++  GFW+ P ++  +      F P P+D++L S PK+GT WLK+L
Sbjct  23   NLRQDDGWKPVGKLYEYQGFWYGPSLVQNVISAQESFTPQPTDIVLCSSPKSGTAWLKAL  82

Query  267  IFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             FSI++R+    S + L+K  PH++VP+LE+++      + DS+   L        T   
Sbjct  83   AFSIVSRNRVNDSTNPLLKKLPHEIVPFLEIEL------AQDSNNRNLE-------TPFV  129

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +THIPY  L +++  SS C+++Y+ R+PKD L
Sbjct  130  ATHIPYSSLPRSIIDSS-CKIIYICRDPKDVL  160



>gb|AEZ00072.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLSDSV-VKSGCKMVYIWREPKDTF  183



>ref|XP_003565988.2| PREDICTED: cytosolic sulfotransferase 13-like [Brachypodium distachyon]
Length=373

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 78/143 (55%), Gaps = 15/143 (10%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSS---L  296
            L Q NGFW    I+P +    A F P PSDV L S PK+GTTWLK+L  + +NR+     
Sbjct  47   LRQYNGFWIPEPILPGVTAARARFEPRPSDVFLASVPKSGTTWLKALALATLNRAKHPPC  106

Query  297  D---SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL--  461
            D    L   NPHD V +LE  V      S D    V ++     + R+ +TH+P  LL  
Sbjct  107  DPDHPLRHRNPHDCVEFLEAPV----AWSKDGGGGVFAA---LPSPRVIATHLPCSLLPG  159

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
            G T E  SG R+VY+ R+PKDTL
Sbjct  160  GITEEEGSGGRIVYICRDPKDTL  182



>ref|XP_007037642.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
 gb|EOY22143.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
Length=354

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 83/148 (56%), Gaps = 14/148 (9%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMP-FIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            + W   +HL Q  GFW  P   +  +  +  EF   P+D+ L SFPKTGTTWLK+LIF+ 
Sbjct  50   KAWMIAEHLVQYQGFWLSPNLALKAVIWIQDEFKVQPTDIFLASFPKTGTTWLKALIFAT  109

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            INR+  D     L+  +PH+  P+LE  V+  H+         +S  +     R+ +TH 
Sbjct  110  INRTHCDFSTHPLLTRSPHECFPFLEAYVHESHE--------TISGLDALPPPRLLATHF  161

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P+ LL  ++  +SGC+ +Y+ R+PKD L
Sbjct  162  PHTLLPNSM-ITSGCKFIYICRDPKDVL  188



>ref|XP_003580959.1| PREDICTED: cytosolic sulfotransferase 5-like [Brachypodium distachyon]
Length=336

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 79/143 (55%), Gaps = 19/143 (13%)
 Frame = +3

Query  123  HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIIN------  284
             L Q  GFW     +P I  V A F P P D++L SFPK+GTTWLK+L F+ ++      
Sbjct  23   RLRQCGGFWLPETSLPGIAAVHASFAPRPEDILLASFPKSGTTWLKALAFATLHRADHPP  82

Query  285  RSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
            R++   L + NPH  V +LE+ +    Q+    ++ VL            +TH+PY LLG
Sbjct  83   RAADHPLRRLNPHGCVKFLELDLGLPAQDPKGGASGVL------------ATHLPYSLLG  130

Query  465  KTLESS-SGCRVVYVVRNPKDTL  530
            + + +  SGCR+VY+ R+PKD  
Sbjct  131  RRITAEDSGCRIVYICRDPKDAF  153



>gb|KCW81101.1| hypothetical protein EUGRSUZ_C02479, partial [Eucalyptus grandis]
Length=305

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 14/147 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  +HL+   GFW+    +  +      F   P+D +L +FPKTG TW+K+L F+I 
Sbjct  1    EKGWLTQHLYNYQGFWYDNHFLGGVIWAQQNFEARPTDTLLATFPKTGLTWIKALSFAIA  60

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NR + D    +L+  NPH+ VPY+E   Y   ++   S+   L S       R+ STHIP
Sbjct  61   NRHNQDLPRHTLLTKNPHECVPYIEFYAY---EKDPISALDALPS------PRLLSTHIP  111

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y  L +++ ++SGCR+V +VR PKD  
Sbjct  112  YASLPRSV-ATSGCRIVCIVREPKDVF  137



>gb|KEH21569.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=378

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 89/149 (60%), Gaps = 11/149 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E  +G+++ +   GFW  P  I  I     +F    SDV++ S PK+GTTWLK+L F+I
Sbjct  35   KEYGFGNQYYYFFQGFWTTPSQIQSIISFQNDFQAKDSDVVIASMPKSGTTWLKALTFAI  94

Query  279  INR---SSLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            INR   SSL++  L+K NPH+L+P+ E  +Y D          +L+  E     R+F TH
Sbjct  95   INRHHFSSLENHPLLKTNPHELIPFFEFHIYVD-TVCQFPKVDLLNMIE----PRLFGTH  149

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            IP+  L K+++ S+ C+++Y+ RNP DT 
Sbjct  150  IPFTSLAKSIKESN-CKIIYICRNPFDTF  177



>ref|XP_002318367.2| hypothetical protein POPTR_0012s01280g [Populus trichocarpa]
 gb|EEE96587.2| hypothetical protein POPTR_0012s01280g [Populus trichocarpa]
Length=350

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            NL +++ W     L++  GFW+ P ++  +      F P P+D++L S PK+GT WLK+L
Sbjct  50   NLRQDDGWKPVGKLYEYQGFWYGPSLVRNVISAQESFTPQPTDIVLCSSPKSGTAWLKAL  109

Query  267  IFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             FSI++R+    S + L+K  PH++VP+LE+++      + DS+   L        T   
Sbjct  110  AFSIVSRNQVNDSTNPLLKKLPHEIVPFLEIEL------AQDSNNRNLE-------TPFV  156

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +THIPY  L +++  SS C+++Y+ R+PKD L
Sbjct  157  ATHIPYSSLPRSIIDSS-CKIIYICRDPKDVL  187



>ref|NP_177549.1| desulfo-glucosinolate sulfotransferase 18 [Arabidopsis thaliana]
 sp|Q9C9C9.1|SOT18_ARATH RecName: Full=Cytosolic sulfotransferase 18; Short=AtSOT18; AltName: 
Full=Desulfo-glucosinolate sulfotransferase B; AltName: 
Full=Sulfotransferase 5B; Short=AtST5b [Arabidopsis thaliana]
 gb|AAG52515.1|AC016662_9 putative flavonol sulfotransferase; 10175-9123 [Arabidopsis thaliana]
 dbj|BAC42128.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|AAO50517.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|AEE35549.1| desulfo-glucosinolate sulfotransferase 18 [Arabidopsis thaliana]
 gb|AEZ00075.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
 gb|AEZ00076.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLPDSV-VKSGCKMVYIWREPKDTF  183



>gb|AEZ00073.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLPDSV-VKSGCKMVYIWREPKDTF  183



>gb|ACB73191.1| desulfo-glucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLPDSV-VKSGCKMVYIWREPKDTF  183



>gb|AAM65627.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|AEZ00074.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLPDSV-VKSGCKMVYIWREPKDTF  183



>ref|XP_006385980.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
 gb|ERP63777.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
Length=333

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   +++   GFW  P  I  +      F    +D IL S PK+GTTWLK+L+FSI
Sbjct  31   KEEGWVSGYMYLYQGFWCPPKEIHAVVSFQNNFQACNTDTILVSMPKSGTTWLKALVFSI  90

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            INR    +    L   NPHDLVP+ E ++Y ++Q    S+           + RIFSTH+
Sbjct  91   INREKYQTAESPLNSFNPHDLVPFFEYRLYANNQVPDLSAF---------PSPRIFSTHV  141

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L +++ +S+ CRVVY+ RNP D  
Sbjct  142  PYPSLPESIRNST-CRVVYICRNPLDNF  168



>gb|AEZ00077.1| desulfoglucosinolate sulfotransferase [Arabidopsis thaliana]
Length=350

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  47   EKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  106

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  107  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  156

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  157  PYELLPDSV-VKSGCKMVYIWREPKDTF  183



>gb|EYU28890.1| hypothetical protein MIMGU_mgv1a009426mg [Erythranthe guttata]
Length=342

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 91/154 (59%), Gaps = 19/154 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEF-NPLPSDVILGSFPKTGTTWLKSLIFS  275
            +EK W   HL++  GFW+    +  +      F   L SD+ L + PK+GTTWLK++IF+
Sbjct  35   KEKGWLSSHLYRFQGFWYPVRHLQGVIACQKNFVETLDSDIFLVTTPKSGTTWLKAIIFA  94

Query  276  IINRS------SLDS---LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            +  R+      + D    L+ NNPHDLVP+LE+++Y D+Q   D ST          T R
Sbjct  95   LTIRTKHPVATTTDKNHPLLHNNPHDLVPFLEIKLYVDNQ-IPDLSTF--------STPR  145

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +FSTH+P+  L ++++ SS C++VY+ RNPKD  
Sbjct  146  LFSTHLPHVSLPESVKKSSACKIVYLCRNPKDVF  179



>ref|XP_002887526.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63785.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++P ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  43   EKGWRPKEPLIEYGGYWWLPPLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  102

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+               VL   +D+  T +FSTHI
Sbjct  103  ANRSRFDDSSNPLLKRNPHEFVPYIEIDF------PFFPEVDVL---KDKGNT-LFSTHI  152

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL  ++   SGC++VY+ R PKDT 
Sbjct  153  PYELLPDSV-VKSGCKMVYIWREPKDTF  179



>gb|KDP40565.1| hypothetical protein JCGZ_24564 [Jatropha curcas]
Length=346

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 85/150 (57%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   ++++  GFW  P  I  I      F     DV+L + PK+GTTWLK+L+F+I
Sbjct  43   KERGWRTPYIYRFQGFWCQPKEIQAILSFRKHFQARNGDVVLATVPKSGTTWLKALVFAI  102

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR      S+   L+ +NPHDLVP+LE ++Y ++Q    S               IF+T
Sbjct  103  LNRNLYPLNSNSHPLLVSNPHDLVPFLEYKIYANNQIPDLSKF---------PEPGIFAT  153

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  + +++  SS C++VY+ RNP DT 
Sbjct  154  HVPFAAVKESINKSS-CKIVYICRNPFDTF  182



>ref|XP_006347852.1| PREDICTED: cytosolic sulfotransferase 15-like [Solanum tuberosum]
Length=337

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 14/149 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +L    GFW  P  I  I  +   F    +DVIL + PK+GTTWLK+L F+I
Sbjct  37   KEKGWRTPNLFLFQGFWCQPKEIRAIISIQNHFIAQDTDVILATIPKSGTTWLKALTFAI  96

Query  279  INRSSLD-----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +NR++ +      L+ +NPH+LVP+LE ++Y D     D S  +L S       RI +TH
Sbjct  97   VNRNNFNVHHNHPLLTHNPHELVPFLEYKLYADSNRLPDLS--LLPS------PRIVATH  148

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L  ++++S+ C+++Y+ RNP DT 
Sbjct  149  VPFGALPDSIKTSN-CKIIYICRNPFDTF  176



>ref|XP_010039273.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW49987.1| hypothetical protein EUGRSUZ_K03444 [Eucalyptus grandis]
Length=331

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 94/157 (60%), Gaps = 19/157 (12%)
 Frame = +3

Query  84   INLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKS  263
            I+L  EE W     L    GFWF   ++  +      F   PSD++L + PK+GTTWLK+
Sbjct  26   ISLPLEEDWLVPT-LCLYQGFWFPSHLLKGVLAFQNHFQAQPSDILLVTSPKSGTTWLKA  84

Query  264  LIFSIINR---SSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQD  419
            ++FS++NR   S LDS     L+  NPHDLVP+L+V++Y + QE+ D +           
Sbjct  85   VLFSLLNRAKYSDLDSQQPHPLLTQNPHDLVPFLDVKLYLE-QENPDLAAFA--------  135

Query  420  TTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            + R+F+TH+P+  L +++  S+ C++VY+ RNPKD L
Sbjct  136  SPRLFATHLPFSSLPRSVRDST-CKLVYLCRNPKDVL  171



>ref|XP_010554271.1| PREDICTED: cytosolic sulfotransferase 11-like [Tarenaya hassleriana]
Length=335

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 84/143 (59%), Gaps = 16/143 (11%)
 Frame = +3

Query  120  KHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD  299
            ++L   NGFWF    +  +  V   F  L +DVI+ SFPK GTTWLK+L F+I+NRS   
Sbjct  42   RNLCNYNGFWFYSNTLQAVIDVQNHFRTLDTDVIVASFPKAGTTWLKALTFAIVNRSKYR  101

Query  300  S------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            S      L+  NPH LVP+LE+ +Y +++    +            +  +F+TH+P+ LL
Sbjct  102  SNPENHPLLSQNPHTLVPFLEIDLYSENKTPDLAKV---------PSPGLFATHMPFLLL  152

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             ++++ SS C++VYV RN KD +
Sbjct  153  QESVKESS-CKIVYVCRNLKDNV  174



>gb|AAX95923.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=818

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 55/142 (39%), Positives = 80/142 (56%), Gaps = 20/142 (14%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSL---  296
            L Q  GFW +  ++  +      F P PSD++L SFPK GTTWLK+L F+ +NRS+    
Sbjct  24   LRQYGGFWLLEVMLNGVAAAETSFQPRPSDILLSSFPKCGTTWLKALAFATLNRSTYPPS  83

Query  297  ---DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGK  467
                 L+++NPHDLV +LE+    +  ES  S              R+ STH+PY +L  
Sbjct  84   DEHHPLLEHNPHDLVGFLEIYPKLELYESLPSP-------------RLLSTHLPYSMLPH  130

Query  468  TL-ESSSGCRVVYVVRNPKDTL  530
             + E  +GCR+VY+ R+PKD +
Sbjct  131  RIREQETGCRLVYIYRDPKDAM  152



>gb|KDO48723.1| hypothetical protein CISIN_1g037802mg [Citrus sinensis]
Length=312

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 85/150 (57%), Gaps = 17/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK+W    L+Q++G+W+   +IP +    +EF  L  DVIL S  KTGTTWLK+L   I
Sbjct  15   KEKFWEILDLYQLDGYWYSGDVIPGMLAFKSEFEALSDDVILASSMKTGTTWLKALCICI  74

Query  279  INRS------SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +          +D L   NPHD +  LE   Y           ++LS  +D  + R+F+T
Sbjct  75   MGNQRKNDGDEVDQLEVKNPHDHIKCLEYFYY----------FNLLSKLKDMQSPRVFNT  124

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+PY  L +++++S  C++VY+ RNPKDT 
Sbjct  125  HLPYSALPESIKNSE-CKIVYIARNPKDTF  153



>ref|XP_002303947.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
 gb|EEE78926.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
Length=337

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +++   GFW  P  I  +      F    +D IL S PK+GTTWLK+L+FSI
Sbjct  31   KEKDWISCYMYLFQGFWCPPKEIHAVVSFQNNFQSCNTDTILVSMPKSGTTWLKALVFSI  90

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR    +    L   NPHDLVP+ E ++Y ++Q    S+           + RIFSTH+
Sbjct  91   MNREKYQTAESPLNSFNPHDLVPFFEYRLYANNQVPDLSAF---------PSPRIFSTHV  141

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L +++ +S+ CRVVY+ RNP D  
Sbjct  142  PYPSLPESIRNST-CRVVYICRNPLDNF  168



>dbj|BAJ87462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=338

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-----  290
            L Q  GFW+   I+P +    A F P PSDV L SFPK+GTTWLK+L F+ ++R+     
Sbjct  26   LRQYGGFWWPEPILPGVVAARAGFGPRPSDVFLASFPKSGTTWLKALAFATLHRADHPTH  85

Query  291  SLD-SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGK  467
            SLD  L + NPHD V +LE          +     V ++     + R+ +THIPY LL +
Sbjct  86   SLDHPLRRRNPHDCVEFLEGLFA--LSPPAIKGGDVFAA---HPSPRVIATHIPYSLLPE  140

Query  468  TLES-SSGCRVVYVVRNPKDTL  530
             + +  +GC++VYV R+PKD L
Sbjct  141  RVTAEGAGCKLVYVCRDPKDAL  162



>gb|KCW81182.1| hypothetical protein EUGRSUZ_C02549, partial [Eucalyptus grandis]
Length=299

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 84/147 (57%), Gaps = 14/147 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK WG ++L+   GFW+    +  +      F   P+D +L +FPKTG TW+K+L F+I 
Sbjct  1    EKGWGTQNLYNYQGFWYGNHFLGGVIWAQKYFEARPTDTLLATFPKTGMTWIKALSFAIA  60

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NR + D    +L+  NPH+ VP +E   Y   +E   S+   L S       R+ STHIP
Sbjct  61   NRHNQDLPRHTLLTKNPHECVPNIEFFAY---EEDPISALDALPS------PRLLSTHIP  111

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y  L +++ ++SGCR+V ++R+PKD  
Sbjct  112  YASLPRSV-ATSGCRIVCIIRDPKDVF  137



>ref|XP_010091629.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB44895.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=332

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 87/148 (59%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HLHQ  GFW     +  +      F    +DV+L + PK+GTTWLKS++FS+I
Sbjct  35   EKGWVASHLHQYQGFWHTTRQLQGVLACQKHFQSQDTDVLLVTNPKSGTTWLKSILFSLI  94

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            NRS         L+  NPH LVP+LE+ +Y +++  + S +          + R+FSTH+
Sbjct  95   NRSVFTDPKKHPLLTTNPHVLVPFLELDLYVENRRPNISYS---------SSPRLFSTHL  145

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L ++++SS+ C++VY+ R+PKD  
Sbjct  146  PYVSLPESVKSSA-CKLVYLCRSPKDAF  172



>ref|XP_003530555.2| PREDICTED: cytosolic sulfotransferase 5-like [Glycine max]
Length=361

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (57%), Gaps = 16/151 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E+ W   HLHQ  GFW     +  +      F  L +DV++ S PK+GTTWLK+  FS++
Sbjct  59   ERGWVASHLHQYQGFWHTTRQLQGVLSCQKHFKALDTDVLIVSTPKSGTTWLKAWTFSLL  118

Query  282  NRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            +R+  D         L+ NNPH LVP+LE+ +Y D     D ++ + S        R+FS
Sbjct  119  HRNQHDPNTQNQNHPLLFNNPHFLVPFLELDLYIDDNTLPDLTSLITSP-------RLFS  171

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+PY  L K+++ S+ C+++Y+ R+PKD  
Sbjct  172  THLPYVSLPKSVQESA-CKIIYLCRDPKDAF  201



>ref|XP_006348796.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 85/150 (57%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +++   GFW  P +I  +     +F    SD+IL + PK+GTTWLK+L+FS+
Sbjct  33   KEKGWIGSYIYNYQGFWTSPRLIQGVIACQQQFQAQNSDIILVTTPKSGTTWLKALLFSL  92

Query  279  INRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR       +N      NPHDLVP+LE+++Y D Q    SS             RI ST
Sbjct  93   VNRKKYPIFEQNHPLLVKNPHDLVPFLELKLYVDGQVPDFSSF---------TPPRIMST  143

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+PY  L K+++ S   ++VY+ RNP+DT 
Sbjct  144  HLPYDSLPKSVQDSR-TKLVYLCRNPRDTF  172



>ref|XP_010320907.1| PREDICTED: cytosolic sulfotransferase 5-like [Solanum lycopersicum]
Length=321

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 13/152 (9%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + +W +  L+Q  GFW    I+       A F   P+DV+L S  KTGTTWLK++ 
Sbjct  23   LPKTDHFWNNSRLYQWEGFWSTLIILKAAMVFKATFKSEPNDVLLASSMKTGTTWLKAIC  82

Query  270  FSIINRSSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
             SI+   +      D LVK+NPH  VP +EV  Y      S   TH L +     + R+F
Sbjct  83   VSIMQAGNKEVEEEDLLVKDNPHFYVPTIEVMDY-----YSKPLTHDLYT---MPSPRLF  134

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             TH+PY++L  ++++S+ C+++Y+ RNPKDTL
Sbjct  135  HTHLPYRVLPDSIKNSNNCKIIYITRNPKDTL  166



>gb|EEC68220.1| hypothetical protein OsI_36211 [Oryza sativa Indica Group]
Length=359

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 80/160 (50%), Gaps = 25/160 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----S  293
            L Q  G+W   +++P +  V   F P PSDV L SFPK+GTTWLK+L F+ INR+    S
Sbjct  21   LRQYGGYWLPEWVLPGLEAVHTRFEPRPSDVFLASFPKSGTTWLKALAFATINRTTYPPS  80

Query  294  LDS--LVKNNPHDLVPYLE-------------VQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             D+  L    PHD V + E             V V+         +     S   +   R
Sbjct  81   GDAHPLRHRGPHDCVKFFESTFAISGEGGGGDVDVFAALPSPRAVARPGTCSPPSRRRAR  140

Query  429  IFSTHIPYQLLGKTLESS------SGCRVVYVVRNPKDTL  530
            + +THIPY LL + + S+      SGCR+VYV R+PKD  
Sbjct  141  LLATHIPYSLLPERITSAAADDGDSGCRIVYVCRDPKDAF  180



>gb|KHN21542.1| Flavonol sulfotransferase-like [Glycine soja]
Length=304

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (57%), Gaps = 16/151 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E+ W   HLHQ  GFW     +  +      F  L +DV++ S PK+GTTWLK+  FS++
Sbjct  2    ERGWVASHLHQYQGFWHTTRQLQGVLSCQKHFKALDTDVLIVSTPKSGTTWLKAWTFSLL  61

Query  282  NRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            +R+  D         L+ NNPH LVP+LE+ +Y D     D ++ + S        R+FS
Sbjct  62   HRNQHDPNTQNQNHPLLFNNPHFLVPFLELDLYIDDNTLPDLTSLITSP-------RLFS  114

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+PY  L K+++ S+ C+++Y+ R+PKD  
Sbjct  115  THLPYVSLPKSVQESA-CKIIYLCRDPKDAF  144



>gb|ADB85371.1| putative flavonol 3-sulfotransferase [Phyllostachys edulis]
Length=325

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 85/154 (55%), Gaps = 18/154 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
             L   + WW    L++ +  W  P ++     V A+F P P D+IL +FPK GTTWLK+L
Sbjct  22   TLPTRQGWWKPFVLYRSS--WLTPQVVKSAMLVQAQFEPRPDDIILATFPKCGTTWLKAL  79

Query  267  IFSIINRSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             F+ I+RS          L+ N+P DLVP+LE+     H+E      H L+  E   + R
Sbjct  80   AFTTISRSRHAVTGDGHPLLTNHPQDLVPFLELP----HRE-----LHPLADLETITSPR  130

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            + STH+P  LL   + S+ GCRVVY+ R PKD L
Sbjct  131  LLSTHMPLALLPPRV-STLGCRVVYLCREPKDVL  163



>ref|XP_010499316.1| PREDICTED: cytosolic sulfotransferase 7-like [Camelina sativa]
Length=324

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 83/139 (60%), Gaps = 13/139 (9%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLDS-  302
            L +  G W+    +  I     +F P  +D+I+ SFPK+GTTWLK+L  +++ RS   S 
Sbjct  35   LFKYQGCWYNDKTLQAILSFQRDFEPQDTDIIVASFPKSGTTWLKALTVAVLERSKHSSD  94

Query  303  ---LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTL  473
               L+  NPH LVP+ E+++Y   Q S    T +LSS       R+FSTH+P+Q L + L
Sbjct  95   NHPLLLENPHTLVPFFELRLY--MQSSKPDLTKILSS------PRLFSTHVPFQTLKEGL  146

Query  474  ESSSGCRVVYVVRNPKDTL  530
            ++SS C++VYV RN KD L
Sbjct  147  KNSS-CKIVYVCRNMKDVL  164



>ref|XP_010048481.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 ref|XP_010048482.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 ref|XP_010048483.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW80728.1| hypothetical protein EUGRSUZ_C02125 [Eucalyptus grandis]
 gb|KCW80729.1| hypothetical protein EUGRSUZ_C02125 [Eucalyptus grandis]
Length=338

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 84/148 (57%), Gaps = 13/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +++ W   HL Q  G W  P  +  +      F  LP+D++L + PK GTTW K+L+F+I
Sbjct  33   KQRGWMTNHLVQYQGVWLSPSGLKGVMLARDHFKSLPTDILLSTSPKAGTTWFKALLFTI  92

Query  279  INRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR     S   L+  NPHDLV ++EV +  D   SS+   +  SS       R+ STHI
Sbjct  93   MNRRNYPFSSHPLLTTNPHDLVHFIEVMI--DQTPSSNPIKNSFSS------PRLLSTHI  144

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY LL  ++++S  CR+V V R+PKD L
Sbjct  145  PYSLLPNSVKTSC-CRIVNVCRDPKDAL  171



>ref|XP_010534326.1| PREDICTED: cytosolic sulfotransferase 15-like [Tarenaya hassleriana]
Length=367

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 87/150 (58%), Gaps = 15/150 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
             EK W  ++L+Q  GFW     I  I      F  + +D+IL + PK+GTTWLK+L F++
Sbjct  64   REKGWRTRYLYQYQGFWCQAKEIQSIISFQKHFKSVNNDIILATIPKSGTTWLKALTFAL  123

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR      SS   L+ +NPHDLVP+ E ++Y +  +  D S H+ S        R F+T
Sbjct  124  VNRHQFPVSSSDHPLLTSNPHDLVPFFEYKLYANDSDIPDLS-HIPS-------PRTFAT  175

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L  +++SS+  +VVY+ RNP DT 
Sbjct  176  HVPFGSLKDSIKSSN-VKVVYLCRNPFDTF  204



>ref|XP_010554539.1| PREDICTED: cytosolic sulfotransferase 5-like [Tarenaya hassleriana]
Length=328

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 34/168 (20%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E KWW D    +  GFWF P  I     + A F PL SD+IL SFPKTGTTWLK+L  SI
Sbjct  2    EVKWWVDGRRIKHRGFWFKPDFIKASEEIQAHFTPLSSDIILSSFPKTGTTWLKALTTSI  61

Query  279  INRSSLDS------------------------LVKNNPHDLVPYLEVQVYGDHQESSDSS  386
            +  SS  S                        L   NPH ++P+LE++ +G  Q  +   
Sbjct  62   LRHSSSSSNSGTKDCVSYREHNDDDDDDDDDVLGALNPHQVIPFLEIETFG--QSPTRDI  119

Query  387  THVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              + S        R+F+TH+P   L + ++ +SGCR++Y+ RNP DT 
Sbjct  120  AKIPSP-------RVFNTHLPLSFLPEAVK-TSGCRIIYITRNPADTF  159



>gb|ABA93903.1| Sulfotransferase domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=395

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 25/160 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD--  299
            L Q  G+W   +++P +  V   F P PSDV L SFPK+GTTWLK+L F+ INR++    
Sbjct  55   LRQYGGYWLPEWVLPGLEAVHTRFEPRPSDVFLASFPKSGTTWLKALAFATINRTTYPPS  114

Query  300  ----SLVKNNPHDLVPYLE-------------VQVYGDHQESSDSSTHVLSSEEDQDTTR  428
                 L    PHD V + E             V V+         +     S   +   R
Sbjct  115  GDAHPLRHRGPHDCVKFFESTFAISGEGGGGDVDVFAALPSPRAVARPGTCSPPSRRRAR  174

Query  429  IFSTHIPYQLLGKTLESS------SGCRVVYVVRNPKDTL  530
            + +THIPY LL + + S+      SGCR+VYV R+PKD  
Sbjct  175  LLATHIPYSLLPERITSAAADDGDSGCRIVYVCRDPKDAF  214



>dbj|BAJ96365.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 82/146 (56%), Gaps = 24/146 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-----  290
            L Q  GFW     +P +    A F P PSDV+L SFPK+GTTWLK+L F+ ++R+     
Sbjct  35   LRQYGGFWMPEPFLPGMAAARAGFEPRPSDVLLASFPKSGTTWLKALAFATVHRADHPPR  94

Query  291  SLD-SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQ----DTTRIFSTHIPYQ  455
            SLD  L + NPHD V +LE             S  + S  ED      + R+ +TH+P  
Sbjct  95   SLDHPLRRRNPHDCVDFLE-------------SVFLRSPAEDALAALPSPRVIATHMPCS  141

Query  456  LLGKTLESS-SGCRVVYVVRNPKDTL  530
            LL + + ++ +GC+VVY+ R+PKD L
Sbjct  142  LLPERVTANDAGCKVVYICRDPKDAL  167



>ref|NP_001176556.1| Os11g0505200 [Oryza sativa Japonica Group]
 dbj|BAH95284.1| Os11g0505200 [Oryza sativa Japonica Group]
Length=376

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 80/160 (50%), Gaps = 25/160 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----S  293
            L Q  G+W   +++P +  V   F P PSDV L SFPK+GTTWLK+L F+ INR+    S
Sbjct  36   LRQYGGYWLPEWVLPGLEAVHTRFEPRPSDVFLASFPKSGTTWLKALAFATINRTTYPPS  95

Query  294  LDS--LVKNNPHDLVPYLE-------------VQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             D+  L    PHD V + E             V V+         +     S   +   R
Sbjct  96   GDAHPLRHRGPHDCVKFFESTFAISGEGGGGDVDVFAALPSPRAVARPGTCSPPSRRRAR  155

Query  429  IFSTHIPYQLLGKTLESS------SGCRVVYVVRNPKDTL  530
            + +THIPY LL + + S+      SGCR+VYV R+PKD  
Sbjct  156  LLATHIPYSLLPERITSAAADDGDSGCRIVYVCRDPKDAF  195



>gb|EEE52154.1| hypothetical protein OsJ_33997 [Oryza sativa Japonica Group]
Length=361

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 80/160 (50%), Gaps = 25/160 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----S  293
            L Q  G+W   +++P +  V   F P PSDV L SFPK+GTTWLK+L F+ INR+    S
Sbjct  21   LRQYGGYWLPEWVLPGLEAVHTRFEPRPSDVFLASFPKSGTTWLKALAFATINRTTYPPS  80

Query  294  LDS--LVKNNPHDLVPYLE-------------VQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             D+  L    PHD V + E             V V+         +     S   +   R
Sbjct  81   GDAHPLRHRGPHDCVKFFESTFAISGEGGGGDVDVFAALPSPRAVARPGTCSPPSRRRAR  140

Query  429  IFSTHIPYQLLGKTLESS------SGCRVVYVVRNPKDTL  530
            + +THIPY LL + + S+      SGCR+VYV R+PKD  
Sbjct  141  LLATHIPYSLLPERITSAAADDGDSGCRIVYVCRDPKDAF  180



>ref|XP_008231647.1| PREDICTED: cytosolic sulfotransferase 15-like [Prunus mume]
Length=326

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   HL+Q  GFW     I  I      F    +D+++ S PK+GTTWLK+L F++
Sbjct  23   KERGWRTLHLYQFQGFWCQSAEIQSIMSFQKHFQANDTDIVVASIPKSGTTWLKALAFAV  82

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
             NR      S    L+ +NPHDLVP+LE ++Y ++Q         L    +    R+F T
Sbjct  83   SNRHRFIPNSKSHPLLNSNPHDLVPFLEYKLYANNQ---------LPDLTNISEPRLFGT  133

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            HIP+  LG ++++S   ++V++ RNP DT 
Sbjct  134  HIPFASLGNSIKNSDA-KIVFICRNPLDTF  162



>ref|XP_010523117.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=326

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 87/159 (55%), Gaps = 13/159 (8%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++    E+ W +  L+Q  GFW  P  +         F    SD+IL ++PK+
Sbjct  18   SQECREMMSRLPRERGWMNLFLYQYQGFWHPPRQLQATINCQRHFQAQDSDIILVTYPKS  77

Query  243  GTTWLKSLIFSIINRSSLDS---LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEED  413
            GTTWLK+L+FS++NR +L     L+ N+PH LVP+LE+ +Y D      S          
Sbjct  78   GTTWLKALVFSLMNRHNLRDHHPLLTNSPHLLVPFLELDLYFDAHAPDLSQ---------  128

Query  414  QDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              + R+F+TH+P+  L + +  SS C++VY  RNPKDT 
Sbjct  129  MTSPRLFATHLPFVSLPEPIRRSS-CKIVYCYRNPKDTF  166



>dbj|BAK00237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 24/146 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-----  290
            L Q  GFW     +P +    A F P PSDV+L SFPK+GTTWLK+L F+ ++R+     
Sbjct  35   LRQYGGFWMPEPFLPGMAAARAGFEPRPSDVLLASFPKSGTTWLKALAFATVHRADHPPR  94

Query  291  SLD-SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQ----DTTRIFSTHIPYQ  455
            SLD  L + NPHD V +LE             S  + S  ED      + R+ +TH+P  
Sbjct  95   SLDHPLRRRNPHDCVDFLE-------------SVFLRSPAEDALAALPSPRVIATHMPCS  141

Query  456  LLGKTLES-SSGCRVVYVVRNPKDTL  530
            LL + + +  +GC+VVY+ R+PKD L
Sbjct  142  LLPERVTADDAGCKVVYICRDPKDAL  167



>ref|XP_010423267.1| PREDICTED: cytosolic sulfotransferase 15-like [Camelina sativa]
Length=422

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  LP+DV+L + PK+
Sbjct  106  SYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLATIPKS  165

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L+ +NPHDLVP+ E ++Y +      S     
Sbjct  166  GTTWLKALTFTILNRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLSGL---  222

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                     R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  223  ------ARPRTFATHVPFGSLKDSIE-EPGVKVVYLCRNPFDTF  259



>ref|XP_010041349.1| PREDICTED: cytosolic sulfotransferase 15-like [Eucalyptus grandis]
 gb|KCW44422.1| hypothetical protein EUGRSUZ_L02084 [Eucalyptus grandis]
Length=312

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 14/135 (10%)
 Frame = +3

Query  138  NGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD----SL  305
              FW   F++P +      F     D++L S PK+GTTWLK+L+FS++NRS        L
Sbjct  22   QNFWCASFVLPNVITFQRHFEAKHKDIVLASQPKSGTTWLKALVFSVVNRSRFGISDTPL  81

Query  306  VKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSS  485
            + +NPHDLVP+ E Q+YG     + +              R+F+THIPY  L + ++ S 
Sbjct  82   LTSNPHDLVPFFEFQLYGSKLRPNLAGL---------AEPRLFATHIPYPSLPECIKQSD  132

Query  486  GCRVVYVVRNPKDTL  530
             CR++Y+ RNP DT+
Sbjct  133  -CRIIYICRNPLDTV  146



>ref|XP_011009587.1| PREDICTED: cytosolic sulfotransferase 12-like [Populus euphratica]
Length=329

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 84/148 (57%), Gaps = 16/148 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  KHLHQ  GFW     +  +      F     D+ L + PK+G+TWLK+++FS++
Sbjct  33   EKGWMAKHLHQYQGFWHTTRQLTGVLACQKHFQAQDGDIFLVTNPKSGSTWLKAVMFSLV  92

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            NR S        L+ NNPH L+P+LE++  G  +E+ D ++            R+FSTH+
Sbjct  93   NRVSFPDTKQHPLLTNNPHALMPFLEMEYVG--KENLDFTSFTFP--------RLFSTHL  142

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P   L +++E S  C++VY+ RNPKDT 
Sbjct  143  PLLSLPRSVEDSD-CKLVYLCRNPKDTF  169



>ref|NP_568177.1| sulfotransferase 2A [Arabidopsis thaliana]
 sp|Q8L5A7.1|SOT15_ARATH RecName: Full=Cytosolic sulfotransferase 15; Short=AtSOT15; AltName: 
Full=Sulfotransferase 2a; Short=AtST2a [Arabidopsis 
thaliana]
 gb|AAM20660.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAM61557.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAP68286.1| At5g07010 [Arabidopsis thaliana]
 gb|AED91098.1| sulfotransferase 2A [Arabidopsis thaliana]
Length=359

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  L +DV+L + PK+
Sbjct  43   SCEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKS  102

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L  +NPHDLVP+ E ++Y +      S     
Sbjct  103  GTTWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLA--  160

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   + R F+TH+P+  L +T+E   G +VVY+ RNP DT 
Sbjct  161  -------SPRTFATHLPFGSLKETIE-KPGVKVVYLCRNPFDTF  196



>gb|AAL06879.1| AT5g07010/MOJ9_18 [Arabidopsis thaliana]
Length=359

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  L +DV+L + PK+
Sbjct  43   SCEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKS  102

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L  +NPHDLVP+ E ++Y +      S     
Sbjct  103  GTTWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLA--  160

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   + R F+TH+P+  L +T+E   G +VVY+ RNP DT 
Sbjct  161  -------SPRTFATHLPFGSLKETIE-KPGVKVVYLCRNPFDTF  196



>ref|XP_007010817.1| Sulfotransferase 2B, putative [Theobroma cacao]
 gb|EOY19627.1| Sulfotransferase 2B, putative [Theobroma cacao]
Length=237

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 14/139 (10%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----S  293
            L    G W +  ++P +      F  L  D+IL S PK GTTWLK+L F+I+NR+    S
Sbjct  19   LTHFQGHWCLSQLVPNVISFQKHFQALDDDIILASTPKAGTTWLKALAFTIMNRNRFTLS  78

Query  294  LDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTL  473
               L  +NPHDLVPY E+ +Y D Q    +            + R+F+TH+PYQ L +++
Sbjct  79   NSPLNSSNPHDLVPYFEMMLYKDGQIPDFAGV---------SSPRLFATHLPYQALAESI  129

Query  474  ESSSGCRVVYVVRNPKDTL  530
            + S+  R+VY+ RNP D +
Sbjct  130  KQSNS-RIVYIARNPLDVI  147



>dbj|BAB11159.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
Length=354

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  L +DV+L + PK+
Sbjct  38   SCEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKS  97

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+NR   D         L  +NPHDLVP+ E ++Y +      S     
Sbjct  98   GTTWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLA--  155

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   + R F+TH+P+  L +T+E   G +VVY+ RNP DT 
Sbjct  156  -------SPRTFATHLPFGSLKETIE-KPGVKVVYLCRNPFDTF  191



>ref|XP_010452648.1| PREDICTED: cytosolic sulfotransferase 15 [Camelina sativa]
Length=359

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 80/152 (53%), Gaps = 18/152 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W  ++L+   GFW     I  I      F  LP+DV+L + PK+GTTWLK+L F+I
Sbjct  55   KERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLATIPKSGTTWLKALTFTI  114

Query  279  INRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            +NR   D         L+ +NPHDLVP+ E ++Y +      S              R F
Sbjct  115  LNRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLSGLA---------RPRTF  165

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  166  ATHVPFGSLKDSIE-EPGVKVVYLCRNPFDTF  196



>ref|XP_004236073.1| PREDICTED: flavonol 3-sulfotransferase-like [Solanum lycopersicum]
Length=316

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 91/158 (58%), Gaps = 24/158 (15%)
 Frame = +3

Query  78   ENINLSE--EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAE-FNPLPSDVILGSFPKTGT  248
            E I LSE  +E+ W  +H+HQ  GFW+   ++  +  +  + F P P+ V+L SFPK+GT
Sbjct  17   EQIILSELPKERGWLSEHIHQYKGFWYATQVVQGLLALEQQHFKPKPNTVLLASFPKSGT  76

Query  249  TWLKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQ  416
            TWLK+L+F+I NR  +D     L+ +NPH+LVP+LE   + +H  +   +T ++ S    
Sbjct  77   TWLKALLFAIKNRGEIDFNTHPLLSSNPHELVPFLEAYAF-NHPTNPTPNTCLMHS----  131

Query  417  DTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                    H+ Y     +L   + C++VYV R+PKD L
Sbjct  132  --------HLAYN----SLSELADCKIVYVFRDPKDVL  157



>ref|XP_009598362.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana tomentosiformis]
Length=333

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 16/148 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   H++   GFW  P  +  +     +F    SD+IL + PK+GTTWLK+L+F++
Sbjct  33   KERGWLASHIYNYQGFWIAPRHLQGVIACQQQFQAQDSDIILVTSPKSGTTWLKALVFAL  92

Query  279  INRSSL------DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR           L+ NNPHDLVP+LE+++Y D Q  + SS           + R+ ST
Sbjct  93   VNRIRFPFSEQNHPLLVNNPHDLVPFLELKLYIDGQVPNFSSF---------TSPRLLST  143

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKD  524
            H+PY  L K+++ S   ++VY+ RNP+D
Sbjct  144  HLPYGSLPKSVQHSKN-KLVYLCRNPRD  170



>emb|CDY29149.1| BnaC09g15460D [Brassica napus]
Length=342

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 93/151 (62%), Gaps = 22/151 (15%)
 Frame = +3

Query  102  EKWWGDKH-LHQINGFWFMPFIIPRIHRVLAE---FNPLPSDVILGSFPKTGTTWLKSLI  269
            EK W  K+ L Q  G W M    PRI   +     F   P+D++L S+PKTGTTWLK+L 
Sbjct  41   EKGWRPKNPLIQYGGHWLMQ---PRIEGCMYAQEFFQARPTDLLLCSYPKTGTTWLKALT  97

Query  270  FSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            F+I NRS    S + L+K NPH+LVPY+E++          +    + + +D++ T +F+
Sbjct  98   FAISNRSRFNDSTNPLLKRNPHELVPYIEIEF---------AFFPNVDALKDKENT-LFA  147

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+P+ LL +++ + SGC++VY+ R+PKDT 
Sbjct  148  THLPHGLLPESV-ARSGCKMVYIWRDPKDTF  177



>ref|XP_010272754.1| PREDICTED: flavonol sulfotransferase-like [Nelumbo nucifera]
Length=341

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 87/148 (59%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFI-IPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            EK W  + L    GFW++  I +     V   F   P+D++L S PK+GTTW K+LIF+I
Sbjct  39   EKGWISESLVLYQGFWYVSTISLQGAMAVQQHFKARPTDILLTSTPKSGTTWTKALIFAI  98

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            INR++ D     L+ +NPHD VP LE  +Y          T  + + +   + R+FSTHI
Sbjct  99   INRTNYDFTTHPLLIHNPHDCVPTLETNLY---------RTTPIPNPDVLPSPRLFSTHI  149

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L +++ ++S CR++++ RNPKD L
Sbjct  150  PYSSLPESI-TASNCRIIHICRNPKDVL  176



>ref|XP_009590910.1| PREDICTED: cytosolic sulfotransferase 15-like [Nicotiana tomentosiformis]
Length=339

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 84/152 (55%), Gaps = 17/152 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +L    GFW  P  I  I      F    SD+I+ S PK+GTTWLK+L FSI
Sbjct  33   KEKGWRTPNLFFFQGFWCQPKEIRAIISTQQHFKAQNSDLIVASIPKSGTTWLKALTFSI  92

Query  279  INRSSLDSLVKN--------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            +NR   +   KN        NPH+LVP+LE ++Y ++    D S  +L S       R+ 
Sbjct  93   VNRKKFNVQQKNINHPLLTHNPHELVPFLEYKLYAEYNSPPDLS--LLPS------PRLI  144

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+  L  +++++  C++VY+ RNP DT 
Sbjct  145  ATHVPFGALPNSVKTTK-CKIVYICRNPFDTF  175



>ref|XP_002519139.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF43350.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=339

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 20/155 (13%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAE--FNPLPSDVILGSFPKTGTTWLKS  263
            L + + WW D HL Q  GFW    +  +    L +  F   P D++L ++PK GTTWL++
Sbjct  36   LPKSKGWWFD-HLLQYKGFWLSSDVAIKGLMFLQDHHFISKPDDIVLATYPKCGTTWLRA  94

Query  264  LIFSIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRI  431
            LIF+ INR+S D     L+ +NP D VP+LE  V+ D            S  E+    R+
Sbjct  95   LIFATINRTSYDFATHPLLTSNPQDFVPFLEGYVFQDP-----------SVLENLPLPRL  143

Query  432  FSTHIPYQLLGK--TLESSSGCRVVYVVRNPKDTL  530
             STH+PY L  +  T  ++SG R VY+ R+PKD L
Sbjct  144  LSTHLPYSLFPESITAATASGSRFVYICRDPKDVL  178



>ref|XP_010052979.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW77152.1| hypothetical protein EUGRSUZ_D01498 [Eucalyptus grandis]
Length=329

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 87/149 (58%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W    L+Q  GFW  P ++  +      F    +D++L + PK+GTTWLK+++F + 
Sbjct  31   EKGWITPSLYQYQGFWVAPKLLNGVLACQDNFRAQETDILLITGPKSGTTWLKAILFCLS  90

Query  282  NRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR+   +      L+  +PHDLVP+LE+++Y   +  + +S             R+F+TH
Sbjct  91   NRAKYPASMQQHPLLTQSPHDLVPFLELKLYFGQEIPNLNSL---------PPPRLFTTH  141

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +PYQ L ++++  SGC++VY+ RNPKDT 
Sbjct  142  LPYQSLPQSVK-DSGCKLVYLCRNPKDTF  169



>ref|XP_006385979.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
 gb|ERP63776.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
Length=329

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 84/148 (57%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   ++++  GFW     IP +      F    +D IL + PK+GTTWLK+L FSI
Sbjct  28   KEKSWRSGYVYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKSGTTWLKALAFSI  87

Query  279  INRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR+    S   L   NPHDLVP+ E  +Y ++Q   D ST          + R+F+TH+
Sbjct  88   MNRAKYTPSCSPLNSVNPHDLVPFFEFGLYANNQ-LPDLSTF--------PSPRMFATHV  138

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  +  +++ +SGCR+VY+ RNP D  
Sbjct  139  PYPSISDSIK-NSGCRIVYLCRNPFDNF  165



>ref|XP_006465789.1| PREDICTED: cytosolic sulfotransferase 15-like [Citrus sinensis]
Length=346

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 82/154 (53%), Gaps = 19/154 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W    L+Q  G+W     I  I      F    +D+IL S PK+GTTW+K+L F+I
Sbjct  38   KERGWRTAFLYQFQGYWCQAREIQAIMAFQKHFKAKDTDIILASIPKSGTTWMKALSFAI  97

Query  279  INRSSL----------DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            INR +             L+ +NPHDLVP+LE ++Y ++Q        +    +  D  R
Sbjct  98   INRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQ--------IPELSQIADEPR  149

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +F+THIP+  L   L S +  ++VY+ RNP DT 
Sbjct  150  VFATHIPFASLN-LLPSMNNIKIVYICRNPFDTF  182



>ref|XP_006477735.1| PREDICTED: cytosolic sulfotransferase 16-like [Citrus sinensis]
Length=377

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 82/147 (56%), Gaps = 15/147 (10%)
 Frame = +3

Query  105  KWWGDKHLHQINGFWFMPF-IIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            K W  +HL    G W   +  +  +  +   F   P+D+ L +FPK GTTWLK+LIF+ +
Sbjct  79   KGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKCGTTWLKALIFATM  138

Query  282  NRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIP  449
            NRS  D     L+  + HD VP+L+  ++   Q +  SS H L S       R+F+THIP
Sbjct  139  NRSRYDFPSHPLLSASRHDCVPFLDAYIF---QNNPVSSIHSLPS------PRLFATHIP  189

Query  450  YQLLGKTLESSSGCRVVYVVRNPKDTL  530
            Y LL  ++  SSG R VY+ RNPKD L
Sbjct  190  YDLLPNSM-ISSGSRFVYICRNPKDVL  215



>emb|CDY60367.1| BnaA09g54440D [Brassica napus]
Length=330

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 86/164 (52%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E +    +E+ W  +HL+   GFW     I  I      F PL +DV++ + PK+
Sbjct  14   SYEFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKS  73

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L ++++NR   D         L+ +NPHDLVP+LE ++Y +           L
Sbjct  74   GTTWLKALTYTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYAN---GDVPDLFGL  130

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +S       R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  131  AS------PRTFATHVPFGSLKDSIE-KPGVKVVYLCRNPFDTF  167



>emb|CDY05012.1| BnaAnng01940D [Brassica napus]
Length=368

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 84/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E +    +E+ W  +HL+   GFW     I  I      F PL +DV++ + PK+
Sbjct  52   SYEFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKS  111

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L ++++NR   D         L+ +NPHDLVP+ E ++Y +      S     
Sbjct  112  GTTWLKALTYTLLNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGLA--  169

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                   + R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  170  -------SPRTFATHVPFGSLKDSIE-KPGVKVVYLCRNPFDTF  205



>ref|XP_008240107.1| PREDICTED: flavonol sulfotransferase-like [Prunus mume]
Length=336

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 96/180 (53%), Gaps = 19/180 (11%)
 Frame = +3

Query  3    LSLSSNQTTINIKIALHY*SSISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHR  182
            LSLS+ Q     K  L      +  E I+   ++  WG +H +Q  GFW+    +  +  
Sbjct  4    LSLSAYQEQEEKKDVLQ-----NCEEIISTLPKDTGWGTEHYYQYEGFWYPKIFLEGVIW  58

Query  183  VLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQ  350
              A F    +D+ L +FPK GTTW+K+L+F+I NR + D     L+  +PHD VPY+E+ 
Sbjct  59   AQANFRARDNDIFLATFPKCGTTWVKALMFAIQNRENYDFSSHPLLTKSPHDCVPYIELL  118

Query  351  VYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             + D+          +   +   +TR  +THIP++ L K++  +SG ++V V RNPKD L
Sbjct  119  AHHDNP---------IDYLDAMASTRFLATHIPHRSLPKSI-LNSGTKIVSVARNPKDVL  168



>ref|XP_010428377.1| PREDICTED: cytosolic sulfotransferase 18-like [Camelina sativa]
Length=345

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 20/150 (13%)
 Frame = +3

Query  102  EKWWGDKH-LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            EK W +K  L +  G+W++  ++         F   PSD ++ S+PKTGTTWLK+L F+I
Sbjct  42   EKGWREKEPLIEYGGYWWLQPLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAI  101

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQ--VYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
             NRS  D     L+K NPH+ VPY+E+   ++ D          VL   +D+  T +FST
Sbjct  102  ANRSHFDDSSNPLLKRNPHEFVPYIEIDFPLFPD--------VDVL---KDKGNT-LFST  149

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+PY+LL +++   SGC++VY+ R PKDT 
Sbjct  150  HVPYELLPESV-VKSGCKMVYIWREPKDTF  178



>emb|CDY14059.1| BnaC02g01760D [Brassica napus]
Length=368

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 86/164 (52%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E +    +E+ W  +HL+   GFW     I  I      F PL +DV++ + PK+
Sbjct  52   SYEFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKS  111

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L ++++NR   D         L+ +NPHDLVP+LE ++Y +           L
Sbjct  112  GTTWLKALTYTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYAN---GDVPDLFGL  168

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +S       R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  169  AS------PRTFATHVPFGSLKDSIE-KPGVKVVYLCRNPFDTF  205



>gb|KDP44527.1| hypothetical protein JCGZ_16360 [Jatropha curcas]
Length=323

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 78/154 (51%), Gaps = 20/154 (13%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            NL +E  W    +LH+   FW  P  +  +      F P P+D+IL + PK+GTTWLK+L
Sbjct  22   NLPKEISWKLPLNLHKYQEFWCYPNFLEGVMLAQKCFTPQPTDIILCTLPKSGTTWLKAL  81

Query  267  IFSIINR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             F+I  R      S ++ L+K  PHD+VP LE       Q  S               T 
Sbjct  82   CFAIFARSQYSDGSKINPLLKKMPHDIVPVLEFLYCMGRQRDS--------------RTP  127

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            + STH+PY  L K++   S C+V+Y+ R+PKD  
Sbjct  128  LLSTHVPYASLPKSIIKCSTCKVIYMCRDPKDVF  161



>ref|XP_003628737.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03213.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=318

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 19/151 (13%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   H +Q  GFW        +      F  L SD+IL + PK+GTTWLK+L F+++
Sbjct  34   EKAWILTHTYQYQGFWIATKKFQGVLSCQKHFQALDSDIILVTAPKSGTTWLKALTFALL  93

Query  282  NRSSL------DSLVKNNPHDLVPYLEVQVYG--DHQESSDSSTHVLSSEEDQDTTRIFS  437
            NR+          L+ +NPH LVP+LE+ +Y   D+  + +S +H           R+FS
Sbjct  94   NRNKYPIIHNNHPLLISNPHSLVPFLEIDLYSDKDYVPNLNSLSH----------PRLFS  143

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP  LL K+++ S+ C+VVY+ R+PKD  
Sbjct  144  THIPCALLPKSVKEST-CKVVYLCRDPKDMF  173



>ref|XP_010051057.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=500

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (57%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
             EK WG ++L+   GFW+    +  +      F   P+D +L +FPKTG TW+K+L F+I
Sbjct  195  REKGWGTQNLYNYQGFWYGNHFLGGVIWAQKYFEARPTDTLLATFPKTGMTWIKALSFAI  254

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NR + D    +L+  NPH+ VP +E   Y   +E   S+   L S       R+ STHI
Sbjct  255  ANRHNQDLPRHTLLTKNPHECVPNIEFFAY---EEDPISALDALPS------PRLLSTHI  305

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L +++ ++SGCR+V ++R+PKD  
Sbjct  306  PYASLPRSV-ATSGCRIVCIIRDPKDVF  332


 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 82/148 (55%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
             E  W   HL+   GFW+    +  +      F   P+D +L +F KTG TW+K+L F+I
Sbjct  17   REGGWLTHHLYNYQGFWYGNHFLGGVIWAQQHFEARPTDTLLATFRKTGLTWIKALSFAI  76

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NR + D    +L+  NPH+ VPY+E   Y   ++   S+ + L S       R+ STHI
Sbjct  77   ANRHNQDLPGHTLLTKNPHECVPYIEFYAY---EKDPISALNALPS------PRLRSTHI  127

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L +++ +S+GCR+V ++R+PKD  
Sbjct  128  PYASLPRSV-ASAGCRIVSIIRDPKDVF  154



>ref|XP_011006876.1| PREDICTED: flavonol 3-sulfotransferase-like [Populus euphratica]
Length=336

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 81/143 (57%), Gaps = 21/143 (15%)
 Frame = +3

Query  117  DKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSL  296
            D +L+Q  GFW+ PF +  +  V   FNP  +D+ + SFPKTGTTWLK+L F+I+ RS L
Sbjct  43   DYYLYQ--GFWYAPFFLEGLMSVQEHFNPQSTDIFVASFPKTGTTWLKALTFAILTRSRL  100

Query  297  -----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
                  +L+   PHD VP+LE   Y   Q  S+    +           + STH+PY  L
Sbjct  101  SGSTTSALLSKLPHDCVPFLE---YDLAQNPSNRDLAI----------PLVSTHVPYSCL  147

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             K++ S+S C+++Y+ R+ KD  
Sbjct  148  PKSIISAS-CKIIYICRDAKDAF  169



>ref|XP_007010840.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY19650.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=315

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (57%), Gaps = 14/137 (10%)
 Frame = +3

Query  135  INGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-----SLD  299
              GFWF+P ++P I      F  L  D+I+ S  K GTTWLK+L+F+++NR+     S  
Sbjct  29   FQGFWFLPQLVPNIISFQKHFQALDDDIIVASMAKAGTTWLKALVFAVVNRTRYTLLSES  88

Query  300  SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLES  479
             L    PH LVPY E+ ++ +     D +T          + R+FSTH+PY +L ++++ 
Sbjct  89   PLNTATPHQLVPYFEMTLFNEDHGIPDLAT--------IPSPRLFSTHLPYSVLAQSIKQ  140

Query  480  SSGCRVVYVVRNPKDTL  530
            S+  R+VYV RNP D +
Sbjct  141  SNA-RIVYVTRNPLDVI  156



>ref|XP_006363589.1| PREDICTED: cytosolic sulfotransferase 7-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363590.1| PREDICTED: cytosolic sulfotransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=316

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 78/143 (55%), Gaps = 11/143 (8%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII---  281
            W    L+Q  GFW  P I+     + A F  +P+DV+L S  KTG+TWLK++   I+   
Sbjct  26   WNKSDLYQWEGFWCSPSIMKETMDLKATFKSVPNDVLLASSMKTGSTWLKAICVCIMQGN  85

Query  282  NRSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
                 D LVK+NPH  VP +E   Y     + D  T          + R+F TH+PY++L
Sbjct  86   KEEEEDLLVKDNPHFHVPTIEAMKYYTKALAHDLYT--------IPSPRLFHTHLPYRVL  137

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
              + ++S  C+++Y+ RNPKDTL
Sbjct  138  PDSFKNSDNCKIIYITRNPKDTL  160



>ref|XP_004239099.1| PREDICTED: cytosolic sulfotransferase 5-like [Solanum lycopersicum]
Length=317

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 83/146 (57%), Gaps = 13/146 (9%)
 Frame = +3

Query  108  WWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINR  287
            +W +  L+Q  GFW    I+       A F   P+DV+L S  KTG+TWLK++  SI+  
Sbjct  25   FWNNYQLYQWEGFWSTLIILKAAMVFKATFKSKPNDVLLASSMKTGSTWLKAICVSIMQA  84

Query  288  SSL-----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPY  452
             +      D LVK+NPH  VP +E   Y      S + TH L +     + R+F TH+PY
Sbjct  85   GNKEEDEEDLLVKDNPHFYVPTIEAMDY-----YSKTLTHDLYT---MPSPRLFHTHLPY  136

Query  453  QLLGKTLESSSGCRVVYVVRNPKDTL  530
            ++L  ++++S  C+++Y+ RNPKDTL
Sbjct  137  RVLPDSIKNSDNCKIIYITRNPKDTL  162



>ref|XP_002444757.1| hypothetical protein SORBIDRAFT_07g027380 [Sorghum bicolor]
 gb|EES14252.1| hypothetical protein SORBIDRAFT_07g027380 [Sorghum bicolor]
Length=351

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 83/161 (52%), Gaps = 23/161 (14%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
             L   E WW    L +++G W    +   +  V AEF P P DV+L +FPK+GTTWLK+L
Sbjct  32   TLPMREGWWAAAPLFRLHGCWLTARLARSVELVQAEFKPRPDDVLLATFPKSGTTWLKAL  91

Query  267  IFSIINRS--------SLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSE  407
             F++INRS         +D      L+ +NPHDLVP+LE+          D +   ++  
Sbjct  92   AFALINRSRHPVIVTGDVDDDHHHPLLSSNPHDLVPFLEL---------PDRTLRPVAEL  142

Query  408  EDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            E   + R+  TH+P  LL   +  +S  R VY+ R PKD  
Sbjct  143  EALPSPRLLCTHLPPALLPPGMLMTSS-RAVYLCRYPKDVF  182



>gb|KFK25092.1| hypothetical protein AALP_AA8G065200 [Arabis alpina]
Length=353

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E+ W  ++L+   GFW     I  I      F PL +DV+L + PK+GTTWLK+L F+I+
Sbjct  50   ERGWRTRYLYLYQGFWCQSKEIQAIMSFQKHFQPLQNDVVLATIPKSGTTWLKALTFTIL  109

Query  282  NRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            NR   D         L  +NPHDLVP+ E ++Y + +    S            + R F+
Sbjct  110  NRHLFDPVSSSTDHPLFTSNPHDLVPFFEYKLYANGEVPDLSGL---------ASPRTFA  160

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP+  L  ++E   G +VVY+ RNP DT 
Sbjct  161  THIPFGSLKDSIE-KPGVKVVYLCRNPFDTF  190



>ref|XP_009615435.1| PREDICTED: flavonol 3-sulfotransferase-like [Nicotiana tomentosiformis]
Length=396

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 15/156 (10%)
 Frame = +3

Query  81   NINLSE--EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTW  254
            +I LSE  +E+ W   H+HQ   FW+   I+  +  +   F P P+DV+L S+PK+GTTW
Sbjct  67   DIILSELPKERGWLSGHVHQYKEFWYPTGILQGLIALQQHFKPKPNDVLLASYPKSGTTW  126

Query  255  LKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDT  422
            LK+L+F+I NR+  D     L+ +NPH+LVP LE   +  H  +   +T ++ S      
Sbjct  127  LKALLFAITNRTKYDYKTHPLLSSNPHELVPQLEAYAF-KHPTNPTPNTSLMHS------  179

Query  423  TRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              +    +P  ++G   +S+S C++VYV R+PKD L
Sbjct  180  -HLAFNSLPESIVGGE-DSNSKCKIVYVFRDPKDVL  213



>emb|CDP12289.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 88/160 (55%), Gaps = 22/160 (14%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + EKWWG   L++  GFW+    +       + F    +D +L S PK+GTTWLKSL+
Sbjct  30   LPKVEKWWGIYDLYKYGGFWYTLEWLEGAKAAKSNFQAQDNDFLLSSPPKSGTTWLKSLM  89

Query  270  FSIIN-------------RSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEE  410
             SI++             +   D L +N PHDL+P LE++++   + S + +        
Sbjct  90   VSIMDGHPARTFNNINDAKDQYDLLEENFPHDLIPCLEMEIFNPLRASENPNLKA-----  144

Query  411  DQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                 R++ TH+PY +L ++++ +SGC++VY+ R+PKD L
Sbjct  145  ---QPRLYQTHVPYSMLPESVK-NSGCKIVYIARDPKDVL  180



>ref|XP_011070341.1| PREDICTED: cytosolic sulfotransferase 15-like [Sesamum indicum]
Length=319

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 91/155 (59%), Gaps = 14/155 (9%)
 Frame = +3

Query  72   IMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTT  251
            + E +   E++  W  + L + +GFW    ++  I      F    SD+IL S PK+GTT
Sbjct  10   LQELLQTLEQQTNWDGRRLVKYDGFWLSEIVLRPILSAQKYFKAKDSDIILTSIPKSGTT  69

Query  252  WLKSLIFSIINRS--SLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQD  419
            WLK+L+FSI NR+  S+D   L+ +NPH +VP+LE  +Y   QE+ +         +D  
Sbjct  70   WLKALLFSIANRNVISIDQSPLLTSNPHTVVPFLEANLYL-FQENPNL--------QDLP  120

Query  420  TTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKD  524
            + RIF+TH+P+++L  ++  S  C+++Y+ RNP D
Sbjct  121  SPRIFATHMPFKILPDSIRESE-CKIIYICRNPLD  154



>ref|XP_010491300.1| PREDICTED: cytosolic sulfotransferase 15-like [Camelina sativa]
Length=360

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 83/164 (51%), Gaps = 18/164 (11%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F  LP+DV+L + PK+
Sbjct  44   SYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLATIPKS  103

Query  243  GTTWLKSLIFSIINRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            GTTWLK+L F+I+ R   D         L+ +NPHDLVP+ E ++Y +      S     
Sbjct  104  GTTWLKALTFTILKRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLSGLA--  161

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                     R F+TH+P+  L  ++E   G +VVY+ RNP DT 
Sbjct  162  -------RPRTFATHVPFGSLKDSIE-EPGVKVVYLCRNPFDTF  197



>gb|EYU36904.1| hypothetical protein MIMGU_mgv1a009066mg [Erythranthe guttata]
Length=354

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 18/163 (11%)
 Frame = +3

Query  69   SIMENINL--SEEEKWWGDKHLHQINGFWF-MPFIIPRIHRVLAEFNPLPSDVILGSFPK  239
            ++ME   L  SE+   W  + L +  GFW  +PF    +      F    SD+IL S PK
Sbjct  32   NLMEEDELQKSEQRTNWDGRRLVKYQGFWCPLPFF-RLVLSAQKHFKAKASDLILSSLPK  90

Query  240  TGTTWLKSLIFSIINRS---SLDS---LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLS  401
            +GTTWLK+L FS+ NR+   ++D+   L+ +NPH +VP+LE+ +Y + QE+ D      S
Sbjct  91   SGTTWLKALTFSLANRNIYPNIDTQSPLLTSNPHKVVPFLELNLYLN-QENPDLENQEFS  149

Query  402  SEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                  TTRIF+TH+P+  L  ++ S S C+++Y+ RNP D  
Sbjct  150  ------TTRIFATHVPFDALPSSI-SKSECKIIYICRNPLDQF  185



>ref|XP_010044374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW86456.1| hypothetical protein EUGRSUZ_B03123 [Eucalyptus grandis]
Length=337

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 18/151 (12%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E+ W         GFWF  ++   +      F   PSD++L + PK+GTTWLK+++F+++
Sbjct  34   EEGWVATSFCLYQGFWFPTWLFNGVLACQNHFQAQPSDILLVTNPKSGTTWLKAILFALL  93

Query  282  NRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            NR+            L+  NPHDLVP+LEV++Y   QE+ D +T         ++ R+F+
Sbjct  94   NRAKYSDSDSKQRHPLLTQNPHDLVPFLEVKLYL-QQENPDLTTF--------ESPRLFA  144

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+PY  L  ++  S  C++VY+ RNPKD  
Sbjct  145  THLPYSSLPGSVRDSR-CKLVYLCRNPKDMF  174



>ref|XP_002888964.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65223.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 87/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q  G W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  32   LPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFEARPTDFLVCSYPKTGTTWLKALT  91

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   + +VL   ++     +FS
Sbjct  92   YAIVNRSRYDEATNPLLKRNPHEFVPYVEIDF------AFYPTVNVLQDRKNP----LFS  141

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP  LL  ++  +SGC++VY+ R+PKDT 
Sbjct  142  THIPNGLLPDSI-VNSGCKMVYIWRDPKDTF  171



>ref|XP_006378523.1| sulfotransferase family protein [Populus trichocarpa]
 gb|ERP56320.1| sulfotransferase family protein [Populus trichocarpa]
Length=316

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 16/148 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  KHLH+  GFW     +  +      F     D+ L + PK+G+TWLK+++FS++
Sbjct  20   EKGWMAKHLHRYQGFWHSTRQLQGVLVCQKHFQAQDGDIFLVTTPKSGSTWLKAVMFSLV  79

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            NR S        L+ NNPH LVP+LE++  G  +E+ D +             R+FSTH+
Sbjct  80   NRVSFPDTKQHPLLTNNPHALVPFLEMEYIG--KENLDFTNFTFP--------RLFSTHL  129

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P   L +++E S  C++VY+ RNPKDT 
Sbjct  130  PLLSLPRSVEDSD-CKLVYLCRNPKDTF  156



>ref|XP_010673228.1| PREDICTED: cytosolic sulfotransferase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=340

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 17/154 (11%)
 Frame = +3

Query  96   EEEKWWGDKHLHQINGFWFMP-FIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIF  272
            E+ K W  +HL +  G W  P   +  +      F   P+D+ L +FPK+GTTW K++IF
Sbjct  26   EKNKGWITEHLVKYQGIWLTPKGGLKGVIMSQQLFKSKPNDIFLATFPKSGTTWFKAIIF  85

Query  273  SIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            SIINR         L+ ++PH+ VP+LE+ +Y + +  + +  H+ S        RIF+T
Sbjct  86   SIINRKLFSPNEHPLLNSSPHECVPFLEL-LYSNKENLNSTLEHLQSP-------RIFAT  137

Query  441  HIPY----QLLGKTLESSSGCRVVYVVRNPKDTL  530
            H PY    QLLG  L +S   ++VYV RNPKD L
Sbjct  138  HSPYPLFSQLLGSNLTTSPTVKIVYVARNPKDVL  171



>ref|NP_178472.1| cytosolic sulfotransferase 13 [Arabidopsis thaliana]
 sp|Q9ZPQ5.1|SOT13_ARATH RecName: Full=Cytosolic sulfotransferase 13; Short=AtSOT13 [Arabidopsis 
thaliana]
 gb|AAD20079.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AEC05747.1| cytosolic sulfotransferase 13 [Arabidopsis thaliana]
Length=324

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 81/143 (57%), Gaps = 23/143 (16%)
 Frame = +3

Query  120  KHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD  299
            ++L+Q  GFW+ P ++  +      F    SD++L S PK+GTTWLKSL+F++I+R    
Sbjct  37   EYLYQYQGFWYPPNLLEGVLYSQKHFQARDSDIVLASIPKSGTTWLKSLVFALIHRQEFQ  96

Query  300  S------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            +      L+ NNPH LV ++E    G H  + D+S             RIFSTHIP   L
Sbjct  97   TPLVSHPLLDNNPHTLVTFIE----GFHLHTQDTS------------PRIFSTHIPVGSL  140

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             ++++ SS C+VVY  RNPKD  
Sbjct  141  PESVKDSS-CKVVYCCRNPKDAF  162



>ref|XP_006348649.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W   H++   GFW  P  I  +     +F    SD+IL + PK+GTTWLKSL+F +
Sbjct  33   KERGWLASHIYNYQGFWVAPRFIQGVIACQQQFQAQDSDIILVTTPKSGTTWLKSLLFVL  92

Query  279  INRSSLDSLVKN------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR       +N      NPHDL+P+LE+++Y D    + +S           + R+ ST
Sbjct  93   VNRMKYPVFEQNHPLLVKNPHDLIPFLEIKLYVDGLVPNFASF---------TSPRLLST  143

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L K+++ S   ++VY+ RNPKDT 
Sbjct  144  HMPFASLPKSVQDSKT-KLVYLCRNPKDTF  172



>ref|XP_009125671.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=368

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 82/152 (54%), Gaps = 18/152 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W  +HL+   GFW     I  I  +   F PL +DV++ + PK+GTTWLK+L +++
Sbjct  64   KERGWRTRHLYLFQGFWCQSKEIQAIMSIQKHFKPLQNDVVIATIPKSGTTWLKALTYTL  123

Query  279  INRSSLD--------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            +NR   D         L+ +NPHDLVP+ E ++Y +      S            + R F
Sbjct  124  LNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGL---------ASPRTF  174

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+  L  ++E   G +VV++ RNP DT 
Sbjct  175  ATHVPFGSLKDSIE-KPGVKVVHLCRNPFDTF  205



>gb|EYU24756.1| hypothetical protein MIMGU_mgv1a010113mg [Erythranthe guttata]
Length=322

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 14/145 (10%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W  + L +  GFWF    +  +      F    SD+IL + PK+GTTWLK+L+FSI NRS
Sbjct  25   WDGRKLVKYQGFWFPLNYLRPLLSAQKHFKANDSDIILSTLPKSGTTWLKALVFSIANRS  84

Query  291  ---SLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQ  455
               ++D   L+ +NPH LVP++E  +Y +  E +   TH+ S        RIFSTHIP  
Sbjct  85   IYPNIDQSPLLTSNPHKLVPFIEFDLYWN--EENPDLTHIPSP-------RIFSTHIPLN  135

Query  456  LLGKTLESSSGCRVVYVVRNPKDTL  530
             L   +  SS C+++Y+ RNP D  
Sbjct  136  ALPNCILESSECKIIYICRNPLDQF  160



>gb|KEH21570.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=336

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 85/149 (57%), Gaps = 11/149 (7%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E  +G+++ +   GFW     I  I      F    SDV++ + PK+GTTWLK+L F+I
Sbjct  29   KEYGFGNQYFYFFQGFWTTAAQIQSIISFQNHFQAKDSDVVVATVPKSGTTWLKALTFAI  88

Query  279  INRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            INR    S     L+ +NPH+LVP+ E+ +Y D      +   +L+  E     RIF TH
Sbjct  89   INRHHFSSLHNHPLLTSNPHELVPFFELNIYTDISWQF-AKLDLLNMIE----PRIFGTH  143

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            IP+  L K+++ S+ C+++Y+ RNP DT 
Sbjct  144  IPFHSLAKSIKESN-CKIIYICRNPFDTF  171



>gb|EYU30501.1| hypothetical protein MIMGU_mgv1a026637mg [Erythranthe guttata]
Length=322

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 14/145 (10%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W  + L +  GFWF    +  +      F    SD+IL + PK+GTTWLK+L+FSI NRS
Sbjct  25   WDGRKLVKYQGFWFPLNYLRPLLSAQKHFKANDSDIILSTLPKSGTTWLKALVFSIANRS  84

Query  291  ---SLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQ  455
               ++D   L+ +NPH LVP++E  +Y +  E +   TH+ S        RIFSTHIP  
Sbjct  85   IYPNIDQSPLLTSNPHKLVPFIEFDLYWN--EENPDLTHIPSP-------RIFSTHIPLN  135

Query  456  LLGKTLESSSGCRVVYVVRNPKDTL  530
             L   +  SS C+++Y+ RNP D  
Sbjct  136  ALPNCILESSECKIIYICRNPLDQF  160



>ref|XP_010477038.1| PREDICTED: cytosolic sulfotransferase 17-like isoform X1 [Camelina 
sativa]
 ref|XP_010477039.1| PREDICTED: cytosolic sulfotransferase 17-like isoform X2 [Camelina 
sativa]
Length=339

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 85/151 (56%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L  ++ W       +  G W++  ++  +      F   PSD  + S+PKTGTTWLK+L 
Sbjct  34   LPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQKFFKARPSDFFVCSYPKTGTTWLKALT  93

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            F+I NRS  D     L+K NPH+ VPY+E+ +          S  VL  + +    ++FS
Sbjct  94   FAIANRSKFDDSTNPLLKRNPHEFVPYIEIDL------PLFPSVDVLKDQGN----KLFS  143

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIPY LL +++  +SGC++VY+ R+PKDT 
Sbjct  144  THIPYDLLPESV-VNSGCKIVYIWRDPKDTF  173



>ref|XP_011020447.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=329

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 89/169 (53%), Gaps = 26/169 (15%)
 Frame = +3

Query  72   IMENINLSE------------EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSD  215
            I EN NL+E            +EK W   ++++  GFW     IP +      F    +D
Sbjct  7    ITENNNLAETDEIADLLSSLPKEKSWRSGYVYRYQGFWCPEKQIPALIAFQKHFRAQKTD  66

Query  216  VILGSFPKTGTTWLKSLIFSIINRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDS  383
             IL + PK+GTTWLK+L FSI+NR+    S   L   NPHDLVP+ E  +Y + Q   D 
Sbjct  67   TILVTMPKSGTTWLKALAFSIMNRAKYTPSCSPLNYVNPHDLVPFFEYGLYANKQ-IPDL  125

Query  384  STHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            ST          + R+F+TH+PY  L  +++ +SGCR+V + RNP D  
Sbjct  126  STF--------PSPRMFATHVPYPSLPDSIK-NSGCRLVCLCRNPFDNF  165



>emb|CDP00475.1| unnamed protein product [Coffea canephora]
Length=341

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (57%), Gaps = 20/151 (13%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W + HL++  GFW+  +    +      F    +D++L S PK GTTWLK+L F+I
Sbjct  44   KEKGWAEPHLYKYQGFWYPAWQFQGVLECQQHFQAQDTDILLVSAPKCGTTWLKALAFTI  103

Query  279  INRS--SLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            INR+  S+D      L  NNPHDLV  +E++            +H+ +   +  + R+F+
Sbjct  104  INRNSHSIDDPGKHPLFYNNPHDLVHQIELE------------SHIDNPIFNPSSPRLFA  151

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+PY  L K  ++S  C++VY+ RNPKDT 
Sbjct  152  THLPYISLPKCAKNSE-CKLVYICRNPKDTF  181



>ref|NP_177550.1| desulfo-glucosinolate sulfotransferase 16 [Arabidopsis thaliana]
 sp|Q9C9D0.1|SOT16_ARATH RecName: Full=Cytosolic sulfotransferase 16; Short=AtSOT16; AltName: 
Full=Desulfoglucosinolate sulfotransferase A; Short=AtST5a; 
AltName: Full=Protein CORONATINE INDUCED 7 [Arabidopsis 
thaliana]
 gb|AAG52512.1|AC016662_6 putative flavonol sulfotransferase; 7673-8689 [Arabidopsis thaliana]
 gb|AAK68827.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|AAM10102.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|AEE35550.1| sulfotransferase 16 [Arabidopsis thaliana]
 gb|AEZ00068.1| sulfotransferase 16 [Arabidopsis thaliana]
 gb|AEZ00069.1| sulfotransferase 16 [Arabidopsis thaliana]
 gb|AEZ00071.1| sulfotransferase 16 [Arabidopsis thaliana]
Length=338

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q  G W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  32   LPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFEARPTDFLVCSYPKTGTTWLKALT  91

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++     +FS
Sbjct  92   YAIVNRSRYDDAANPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDRKNP----LFS  141

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP  LL  ++  +SGC++VY+ R+PKDT 
Sbjct  142  THIPNGLLPDSI-VNSGCKMVYIWRDPKDTF  171



>gb|AAM65036.1| putative flavonol sulfotransferase [Arabidopsis thaliana]
 gb|ACD87063.1| desulfo-glucosinolate sulfotransferase [Arabidopsis thaliana]
Length=338

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q  G W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  32   LPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFEARPTDFLVCSYPKTGTTWLKALT  91

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++     +FS
Sbjct  92   YAIVNRSRYDDAANPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDRKNP----LFS  141

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP  LL  ++  +SGC++VY+ R+PKDT 
Sbjct  142  THIPNGLLPDSI-VNSGCKMVYIWRDPKDTF  171



>ref|XP_007208898.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 ref|XP_007211062.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
 gb|EMJ10097.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 gb|EMJ12261.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
Length=321

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 87/155 (56%), Gaps = 14/155 (9%)
 Frame = +3

Query  78   ENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWL  257
            E I+   +++ WG +H +Q  GFW+ P  +  +    A F     D+ L +FPK GTTW+
Sbjct  12   EIISTLPKDRGWGTEHYYQYEGFWYPPIFLEGVIWAQANFRARDDDIFLATFPKCGTTWV  71

Query  258  KSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTT  425
            K+L+F+I NR + D     L+  +P D VPY+E+     HQ++       ++S       
Sbjct  72   KALMFAIQNRENYDFLSHPLLTKSPQDCVPYIELLA---HQDNPIDYLDAIAS------P  122

Query  426  RIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            R  +THIP++ L +++  +SG ++V V RNPKD L
Sbjct  123  RFLATHIPHRSLPRSI-LNSGTKIVSVARNPKDVL  156



>gb|AEZ00070.1| sulfotransferase 16 [Arabidopsis thaliana]
Length=338

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q  G W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  32   LPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFEARPTDFLVCSYPKTGTTWLKALT  91

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++     +FS
Sbjct  92   YAIVNRSRYDDAANPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDRKNP----LFS  141

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP  LL  ++  +SGC++VY+ R+PKDT 
Sbjct  142  THIPNGLLPDSI-VNSGCKMVYIWRDPKDTF  171



>gb|KDO44381.1| hypothetical protein CISIN_1g019118mg [Citrus sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 19/154 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+ W    L++  G+W     I  I      F    +D+IL S PK+GTTW+K+L F+I
Sbjct  38   KERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILASIPKSGTTWMKALSFAI  97

Query  279  INRSSL----------DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            INR +             L+ +NPHDLVP+LE ++Y ++Q        +    +  D  R
Sbjct  98   INRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQ--------IPELSQIADEPR  149

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +F+THIP+  L   L S +  ++VY+ RNP DT 
Sbjct  150  VFATHIPFASLN-LLPSMNNIKIVYICRNPFDTF  182



>ref|XP_006399179.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
 gb|ESQ40632.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
Length=364

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 85/165 (52%), Gaps = 19/165 (12%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S    E ++   +E+ W  ++L+   GFW     I  I      F PL +DV++ + PK+
Sbjct  47   SYEFREMLDSLPKERGWRTRYLYLFQGFWCQSKEIQAIISFQKHFQPLQNDVVIATIPKS  106

Query  243  GTTWLKSLIFSIINRSSLD---------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHV  395
            GTTWLK+L F+++NR   D          L+ +NPHDLVP+ E ++Y +      S    
Sbjct  107  GTTWLKALTFTLLNRYRFDPVSSTNTDHPLLTSNPHDLVPFFEYKLYANGGVPDLSGLA-  165

Query  396  LSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                    + R F+THIP+  L  ++E   G +VVY+ RNP DT 
Sbjct  166  --------SPRTFATHIPFGSLKGSIE-KPGVKVVYLCRNPFDTF  201



>ref|XP_010532214.1| PREDICTED: cytosolic sulfotransferase 18-like [Tarenaya hassleriana]
Length=344

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L  ++ W   ++L +  GFW+   ++  +      F   P D ++  FPKTGTTWLK+L 
Sbjct  38   LHHQKGWRPKENLIEFGGFWWQQHLLEGLLHAQENFKARPEDFLVCIFPKTGTTWLKALT  97

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I++RS  D     L+K NPH+ VPY+E+      Q         +   +D+  T +F+
Sbjct  98   YAIVDRSRYDDSSNPLLKRNPHEFVPYVEIDFPFFPQ---------VDVIKDKGNT-LFA  147

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIPY LL +++ ++SGC++VY+ R+PKDT 
Sbjct  148  THIPYGLLPESI-TNSGCKMVYIWRDPKDTF  177



>ref|XP_010478181.1| PREDICTED: cytosolic sulfotransferase 7-like [Camelina sativa]
Length=324

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 82/139 (59%), Gaps = 13/139 (9%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLDS-  302
            L +  G W+    +  I     +F P  +D+I+ SFPK+GTTWLK+L  +++ RS   S 
Sbjct  35   LFKYQGCWYNDKTLQAILSFQRDFEPQDTDIIVASFPKSGTTWLKALTVAVLERSKHSSD  94

Query  303  ---LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTL  473
               L+  NPH LVP+ E+++Y   Q S    T + SS       R+FSTH+P+Q L + L
Sbjct  95   NHPLLLENPHTLVPFFELRLY--MQSSKPDLTKISSS------PRLFSTHVPFQTLKEGL  146

Query  474  ESSSGCRVVYVVRNPKDTL  530
            ++SS C++VYV RN KD L
Sbjct  147  KNSS-CKIVYVCRNMKDVL  164



>ref|XP_002303948.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
 gb|ABK94985.1| unknown [Populus trichocarpa]
 gb|EEE78927.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
Length=330

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 84/148 (57%), Gaps = 14/148 (9%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +L++  GFW     IP +      F    +D IL + PK+GTTWLK+L FSI
Sbjct  29   KEKSWRLGYLYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKSGTTWLKALAFSI  88

Query  279  INRS----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NR+    S   L   NPHDLVP+ E ++Y ++Q   D ST          + R+F+TH+
Sbjct  89   MNRAKYTPSCSPLNSVNPHDLVPFFEFRLYANNQ-LPDLSTF--------PSPRMFATHV  139

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L  +++ +SGCR+V + RNP D  
Sbjct  140  PYPSLPDSIK-NSGCRIVCLCRNPFDNF  166



>ref|XP_009113467.1| PREDICTED: cytosolic sulfotransferase 18-like [Brassica rapa]
Length=216

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 24/152 (16%)
 Frame = +3

Query  102  EKWWGDKH-LHQINGFWFMPFIIPRIHRVLAE---FNPLPSDVILGSFPKTGTTWLKSLI  269
            EK W  K+ L +  G W    I PRI   L     F   PSD++L S+PKTGTTWLK+LI
Sbjct  42   EKGWRPKNPLIKYGGHWL---IKPRIEGCLYAQEFFQARPSDLLLCSYPKTGTTWLKALI  98

Query  270  FSIINRS----SLDSLVKNNPHDLVPYLEVQ-VYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            F+I NRS    S + L+K NPH+LVPY+E++  +  H +       V++++E+     +F
Sbjct  99   FAISNRSRFNDSTNPLLKRNPHELVPYIEIEFAFFLHID-------VINNKENT----LF  147

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+ LL +++ S S C +VY+ R+PKDT 
Sbjct  148  ATHLPHGLLPESV-SRSSCTMVYIWRDPKDTF  178



>ref|XP_007029974.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY10476.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=339

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 84/153 (55%), Gaps = 18/153 (12%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            LS+E  W+G+ HL+   GFW    ++  +      F  L +D+ L S PK GTTW+K+LI
Sbjct  33   LSKERNWYGN-HLYFYQGFWCTSRVLRAMISFQKHFQALDNDIFLTSLPKCGTTWMKALI  91

Query  270  FSIINRSSLDSLVKNN------PHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRI  431
            F+I+NR+  +  +KNN      PH  VPYLE+ +Y  +  S D         E+    RI
Sbjct  92   FTIVNRNHFE--LKNNPLLSLGPHQAVPYLELDLYLKNH-SPDL--------ENIPQPRI  140

Query  432  FSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            FSTH PY  L  +++  S  ++VY+ RNP D  
Sbjct  141  FSTHTPYASLPPSIKECSTPKIVYICRNPMDMF  173



>ref|XP_006291483.1| hypothetical protein CARUB_v10017618mg [Capsella rubella]
 gb|EOA24381.1| hypothetical protein CARUB_v10017618mg [Capsella rubella]
Length=330

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 79/142 (56%), Gaps = 16/142 (11%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSS----  293
            +H   G W+ P ++  +  V   F P  +D+I+ S PK GTTWLKSL+F++++R      
Sbjct  37   IHNYKGCWYYPNLLQAVLDVQKHFKPRDTDIIMASLPKGGTTWLKSLVFAVVHRDEYREN  96

Query  294  --LDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGK  467
              +  L+  NPHDLVP+LEV++Y D +    +            +  IFSTHI  Q L +
Sbjct  97   PQIHPLLSQNPHDLVPFLEVELYADSKAPDLAKF---------PSPMIFSTHIHLQALRE  147

Query  468  -TLESSSGCRVVYVVRNPKDTL  530
             T ++S  C++VYV R  KDT 
Sbjct  148  ATKKASRPCKIVYVCRGIKDTF  169



>emb|CDX73051.1| BnaC06g34990D [Brassica napus]
Length=360

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLH-QINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            EK W  K  + +  G W+  F++         F   P+   + S+PKTGTTWLK+L F+I
Sbjct  41   EKGWRQKEAYIEYGGSWWTQFVLEGCLHAQEFFQARPNHFFVCSYPKTGTTWLKALTFAI  100

Query  279  INRSSL----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NRS      + L+K NPH+LVPY+E  V      SS     VL+   D+    +FSTHI
Sbjct  101  VNRSRFADTSNPLLKRNPHELVPYIEFDV------SSFPQVDVLN---DKGNNTLFSTHI  151

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P++LL  ++ +S  C++VY+ R+PKDT 
Sbjct  152  PHELLPVSVLTSR-CKLVYIWRDPKDTF  178



>ref|XP_010046610.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW86457.1| hypothetical protein EUGRSUZ_B03124 [Eucalyptus grandis]
Length=330

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 90/155 (58%), Gaps = 19/155 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            +L  E+ W G   LH   GFW  P  +  +      F    +D++L + PK+GTTWLK++
Sbjct  26   SLPSEQGWVGTT-LHLYQGFWVGPRHLKGVLACQRHFRAQDTDILLVTTPKSGTTWLKAI  84

Query  267  IFSIINRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDT  422
            +F+++NR+            L+ +NPHDLVP+LE+++Y + Q++ D ++           
Sbjct  85   LFALLNRTKYSGSGSQGQHPLLNHNPHDLVPFLELKLYVE-QDTPDLAS--------LPP  135

Query  423  TRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDT  527
             R+F+TH+PYQ L + +  S  C++VY+ RNPKDT
Sbjct  136  PRLFATHLPYQSLPQPVRDSK-CKLVYLCRNPKDT  169



>ref|XP_010670559.1| PREDICTED: cytosolic sulfotransferase 5-like [Beta vulgaris subsp. 
vulgaris]
Length=345

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 86/163 (53%), Gaps = 19/163 (12%)
 Frame = +3

Query  75   MENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTW  254
            +E + L +++  W +  +    GFW +  I   +     +F  L +D+IL S PKTGTTW
Sbjct  22   LEQLTLPKDQIMWFEYPMQLYQGFWRLNMISEMVPAFQTQFQALDTDIILASLPKTGTTW  81

Query  255  LKSLIFSIINRSSLDSLVK----------NNPHDLVPYLEVQVYGD-HQESSDSSTHVLS  401
            LKSL+F+I+NR      V            NPH+LV + E +VY + H+      T +  
Sbjct  82   LKSLLFTIVNRKKFSVSVNTSISQHPIHTQNPHELVLHFEFEVYKNIHRNDQPDLTKI--  139

Query  402  SEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                    R+F+THIPY  + +++++S  CR+VY+ RNP D  
Sbjct  140  -----PIPRLFATHIPYSSVPESIKTSQ-CRIVYIGRNPLDNF  176



>ref|XP_008779205.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=330

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 80/139 (58%), Gaps = 16/139 (12%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD--  299
            +    GFW    ++PR+  +   F P PSD+IL + PK+GTTWLK+L+F+I+NR++    
Sbjct  42   IRMYKGFWVTESLLPRVLALQDHFKPRPSDLILVTQPKSGTTWLKALLFAIMNRTNYTFA  101

Query  300  --SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTL  473
               L+  NPH+ VP+LE+              +  S  E     R+ +TH+PY +L  ++
Sbjct  102  QHPLLTRNPHECVPFLEIPF-----------RNRFSDLEAIPPPRLLATHLPYSILASSV  150

Query  474  ESSSGCRVVYVVRNPKDTL  530
             +  GCR+VY+ R+PKD +
Sbjct  151  -ADCGCRLVYLCRDPKDVV  168



>ref|XP_007045765.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY01597.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=331

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 86/148 (58%), Gaps = 14/148 (9%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W    L+Q  GFW    I+  I      F    SD+ L + PK+GTTWLK+++F+++
Sbjct  33   EKGWIGPPLYQFQGFWHSSKILSTILTCQKNFQAQDSDIFLTTTPKSGTTWLKAIVFALV  92

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            NR          LV NNPH LV YLE++   D+Q + D+ST + S        R+ +TH+
Sbjct  93   NRRKYPDPINHPLVTNNPHALVRYLELEPRIDYQ-AYDTSTTIASP-------RLIATHL  144

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P+  L +++++S+ C++VY+ RNPKD  
Sbjct  145  PFVSLPESVKNSA-CKLVYLCRNPKDNF  171



>ref|XP_010050823.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80587.1| hypothetical protein EUGRSUZ_C01948 [Eucalyptus grandis]
Length=321

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 18/151 (12%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            +K W +  L    GFWF  ++   +      F    SD+IL + PK+GTTWLK+++F+++
Sbjct  20   DKGWDNPSLILYQGFWFPSWLFDGVLACQKHFQAHNSDIILVTSPKSGTTWLKAILFALL  79

Query  282  NRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            NR+            L   NPHDLVPYLE Q+Y   QE  D +T          + R+ +
Sbjct  80   NRAEYSDPNSERCHPLQTRNPHDLVPYLEFQLYL-QQEDPDHATFA--------SPRLLA  130

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH+PY  L +++  S  C++VY+ RNPKD  
Sbjct  131  THLPYSSLPQSVRDSK-CKLVYLCRNPKDNF  160



>ref|XP_007225044.1| hypothetical protein PRUPE_ppa019825mg [Prunus persica]
 gb|EMJ26243.1| hypothetical protein PRUPE_ppa019825mg [Prunus persica]
Length=257

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 84/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HLHQ  GFW     +  +      F  L +D++L S PK+GTTWLK+++F+++
Sbjct  33   EKGWVSNHLHQYQGFWHATRHMQGVLACQKHFQALDTDILLVSTPKSGTTWLKAILFALV  92

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             R+         L+ N PH LVP+LE+ VY + +E  D +             R+FSTH+
Sbjct  93   KRAQHPDPQQHLLITNIPHVLVPFLELNVYME-KEVPDLTA--------LTPPRLFSTHL  143

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY  L  +++ S+ C+VVY+ R+PKDT 
Sbjct  144  PYVSLPDSVKHSA-CKVVYLCRDPKDTF  170



>ref|XP_009106067.1| PREDICTED: cytosolic sulfotransferase 16 [Brassica rapa]
Length=338

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  ++ L Q NG W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPNEILTQYNGHWWQECLLEGLLHAKDHFQARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++Q    ++S
Sbjct  91   YAIVNRSRFDDATNPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDGKNQ----LYS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L +++  +SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPESI-MNSGCKMVYIWRDPKDTF  170



>gb|ACR10265.1| sulfotransferase 5a [Brassica rapa subsp. pekinensis]
Length=338

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  ++ L Q NG W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPNEILTQYNGHWWQECLLEGLLHAKDHFQARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++Q    ++S
Sbjct  91   YAIVNRSRFDDATNPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDGKNQ----LYS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L +++  +SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPESI-MNSGCKMVYIWRDPKDTF  170



>ref|XP_011009569.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
 ref|XP_011009576.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
Length=329

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 82/146 (56%), Gaps = 16/146 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W  KHLHQ  GFW     +  +      F     D+ L + PK+G+TWLK+++F+++
Sbjct  33   EKGWMAKHLHQYQGFWHTTRQLQGVLACQKHFQAQDGDIFLVTTPKSGSTWLKAVMFALV  92

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            NR S        L+ NNPH L+P+LE++  G  +E+ D +             R+FSTH+
Sbjct  93   NRVSFPDTKQHPLLTNNPHALMPFLEMEYIG--KETLDFTNFTFP--------RLFSTHL  142

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKD  524
            P   L +++E S  C++VY+ RNPKD
Sbjct  143  PLLSLPRSVEDSD-CKLVYLCRNPKD  167



>ref|XP_010051374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW81880.1| hypothetical protein EUGRSUZ_C03239 [Eucalyptus grandis]
Length=315

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 86/154 (56%), Gaps = 20/154 (13%)
 Frame = +3

Query  93   SEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIF  272
            SEE+  W         GFW  P +   I      F   PSD++L + PK+GTTWLK+++F
Sbjct  14   SEED--WITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKAILF  71

Query  273  SIINRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            +++NR+            L+  N HDLVP+LE+ +Y   QE+ D +           + R
Sbjct  72   ALLNRAKYSDSDSQQRHPLLTQNSHDLVPFLELNLYLG-QENPDLTAIA--------SPR  122

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +F+TH+PY LL +++  S+ C++VY+ RNPKDT 
Sbjct  123  LFATHMPYSLLPQSVRDSN-CKLVYLCRNPKDTF  155



>ref|XP_010051322.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW81764.1| hypothetical protein EUGRSUZ_C03130 [Eucalyptus grandis]
Length=315

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 86/154 (56%), Gaps = 20/154 (13%)
 Frame = +3

Query  93   SEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIF  272
            SEE+  W         GFW  P +   I      F   PSD++L + PK+GTTWLK+++F
Sbjct  14   SEED--WITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKAILF  71

Query  273  SIINRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            +++NR+            L+  N HDLVP+LE+ +Y   QE+ D +           + R
Sbjct  72   ALLNRAKYSDSVSQQRHPLLTQNSHDLVPFLELNLYLG-QENPDLTAIA--------SPR  122

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +F+TH+PY LL +++  S+ C++VY+ RNPKDT 
Sbjct  123  LFATHMPYSLLPQSVRDSN-CKLVYLCRNPKDTF  155



>ref|XP_007010814.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY19624.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=323

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 77/137 (56%), Gaps = 13/137 (9%)
 Frame = +3

Query  132  QINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS----SLD  299
            Q  GFW    ++P I      F  L  D+I+ S PK GTTWLK+L+F+I+NR+    S  
Sbjct  34   QFQGFWCRSSLVPNIISFQKHFQALDDDIIVASKPKAGTTWLKALVFTIVNRARFSLSNS  93

Query  300  SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLES  479
             L   NPH L+PYLE+ VYG  Q+     T + S        R+F+TH+P+ +L ++   
Sbjct  94   PLNLTNPHKLIPYLEITVYG--QDHIPDLTSIPSP-------RLFATHLPFAVLAESSIK  144

Query  480  SSGCRVVYVVRNPKDTL  530
             +  R+VYV RNP D +
Sbjct  145  QAKSRIVYVTRNPLDII  161



>gb|KDP44529.1| hypothetical protein JCGZ_16362 [Jatropha curcas]
Length=302

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 84/154 (55%), Gaps = 22/154 (14%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            +L +E  W   ++LH+   FW  P  +  I      F P P+D+I+ + PK+GTTWLK+L
Sbjct  31   DLPKETSWLLSQNLHKYQDFWCYPNFLEGIILAQKYFIPQPTDIIICTLPKSGTTWLKAL  90

Query  267  IFSIINR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             F+I  R      SS++ L+ N PHD+VP++E  +Y   ++S +                
Sbjct  91   CFTIFRRSQHSGGSSINPLLTNMPHDIVPFIEF-LYCKGRDSQNP---------------  134

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            + STH+PY  L +++   S C+++Y+ R+PKD  
Sbjct  135  LLSTHVPYASLPESIVKCSTCKIIYMCRDPKDVF  168



>gb|EEE68990.1| hypothetical protein OsJ_27924 [Oryza sativa Japonica Group]
Length=287

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 81/155 (52%), Gaps = 19/155 (12%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            +L   E WW    L+  +G W  P     +  V A+F P P DV+L ++PK GTTWLK+L
Sbjct  31   SLPTREGWWTAFVLY--HGCWMTPQAATSVSLVRAQFAPRPDDVLLATYPKCGTTWLKAL  88

Query  267  IFSIINRSSLD-------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTT  425
             F I NRS           L+  +P DLVP++E               H LS+ +   + 
Sbjct  89   SFDIANRSRQPVAGAGDHPLLTTHPQDLVPFIETPF---------RHLHPLSALDALPSP  139

Query  426  RIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            R+ STH+P+QLL   + +  GCR+VY+ R PKD +
Sbjct  140  RLLSTHLPHQLLPPRV-AELGCRIVYLCREPKDVV  173



>ref|XP_009779416.1| PREDICTED: cytosolic sulfotransferase 15 [Nicotiana sylvestris]
Length=344

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 84/159 (53%), Gaps = 17/159 (11%)
 Frame = +3

Query  78   ENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWL  257
            E  N   +EK W   +L     FW  P  I  I      F    +D+IL S PK+GTTWL
Sbjct  26   EFFNSLPKEKGWRTPNLFLFQNFWCQPKEIRAIISTQKHFKAQDNDLILASIPKSGTTWL  85

Query  258  KSLIFSIINRSSLDSLVKN--------NPHDLVPYLEVQVYGDHQESSDSSTHVLSSEED  413
            K+L FSI+NR+  +   KN        NPH+LVP+LE ++Y D     D S  +L S   
Sbjct  86   KALTFSIVNRNKFNVQQKNINHPLLTHNPHELVPFLEYKLYADFNSLPDLS--LLPS---  140

Query  414  QDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
                R+ +TH+P+  L  ++++S  C++VY+ RNP D  
Sbjct  141  ---PRLVATHVPFGALPNSVKTSK-CKIVYICRNPFDAF  175



>emb|CDY26750.1| BnaA06g12720D [Brassica napus]
Length=337

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 88/164 (54%), Gaps = 20/164 (12%)
 Frame = +3

Query  51   HY*SSISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGS  230
            HY  +I+ + + N      W       +  G W++  ++  +    + F   P+D  + S
Sbjct  23   HYQETIATLPHQN-----GWRPKDPFVEYGGHWWLQPLLEGLLHAQSFFKARPNDFFVCS  77

Query  231  FPKTGTTWLKSLIFSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            +PKTGTTWLK+L F+I NRS  D     L+K NPH+ VPY+E+            S  VL
Sbjct  78   YPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEIDF------PFFPSVDVL  131

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              E +     +FSTHIPY LL +++   +GC++VY+ R+PKDT 
Sbjct  132  KDEGNT----LFSTHIPYNLLPESI-LKAGCKMVYIWRDPKDTF  170



>gb|ADX97329.1| sulfotransferase-like protein [Mangifera indica]
Length=341

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 17/152 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            ++K W   +L++  GFW     I  I      F    SDVIL + PK+GTTWLK L+FSI
Sbjct  35   KQKGWRTPYLYEFQGFWCQSKKIQAIISFQKHFISRESDVILATIPKSGTTWLKGLVFSI  94

Query  279  INRSSLD-------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            +NR  +D        L+ +NPHDLVP+ E ++Y D+Q         LS   D    R+F+
Sbjct  95   MNRKHIDVKNLKNHPLLHSNPHDLVPFFEYKLYSDNQIPD------LSRLPD---PRLFA  145

Query  438  THIPYQ-LLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP+  L+ +    ++  ++VY+ RNP DT 
Sbjct  146  THIPFNSLMQQNSIKNASPKIVYLCRNPLDTF  177



>ref|XP_011070365.1| PREDICTED: cytosolic sulfotransferase 15-like [Sesamum indicum]
Length=319

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 14/160 (9%)
 Frame = +3

Query  63   SISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKT  242
            S  + E +   E++  W    L + + FW     +  I      F    SD+IL S PK+
Sbjct  7    SNELQELLQTLEQQTNWDGLPLVKYDAFWLPDIALRPILSAQKYFKAKDSDIILASIPKS  66

Query  243  GTTWLKSLIFSIINRS--SLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEE  410
            GTTWLK+L+FSI NR+  S+D   L+ +NPH +VPYLE  +Y  +QE+ +         +
Sbjct  67   GTTWLKALVFSIANRNVISIDQSPLLTSNPHTVVPYLEFNLYS-YQENPNL--------Q  117

Query  411  DQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            D  + RIF+TH+P+++L  ++  S  C+++YV RNP D  
Sbjct  118  DLPSPRIFATHMPFKMLPDSIRESE-CKIIYVCRNPLDQF  156



>ref|XP_010523502.1| PREDICTED: cytosolic sulfotransferase 11 [Tarenaya hassleriana]
Length=332

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  120  KHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD  299
            K+L    GFW+ P     I      F P  +D+IL SFPK GTTWLK+L+F+++ R    
Sbjct  40   KNLCNYKGFWYYPNTFQAILDAKNHFQPRDTDIILSSFPKAGTTWLKALVFALVERGKYR  99

Query  300  S------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            +      L+  NPH L+P+LE+ +Y    ES       L+S       R+F TH+P+  L
Sbjct  100  ANPEIHPLLSQNPHSLIPFLEIDLYA---ESRIPDLAGLAS------PRLFGTHMPFLQL  150

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             +T++ +  C+VVY+ RN KD L
Sbjct  151  QETVKDTP-CKVVYMCRNLKDVL  172



>ref|XP_008779555.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic sulfotransferase 15-like 
[Phoenix dactylifera]
Length=282

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 16/135 (12%)
 Frame = +3

Query  138  NGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD----SL  305
             GFW    ++PR+  +   F P PSD+IL + PK+GTTWLK+L+F+I+NR++       L
Sbjct  3    KGFWVHENMLPRVMALQDHFKPCPSDLILVTQPKSGTTWLKALLFAIMNRTNYTFAQHPL  62

Query  306  VKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSS  485
            +  NPH  VP+LEV              H     E     R+ +TH+PY +L  ++ +  
Sbjct  63   LTRNPHACVPFLEVPF-----------RHRFPDLEAIPPPRLLATHLPYSILPSSV-ADC  110

Query  486  GCRVVYVVRNPKDTL  530
            GCR+VY+ R+PKD +
Sbjct  111  GCRLVYLCRDPKDVV  125



>gb|KDO70277.1| hypothetical protein CISIN_1g019700mg [Citrus sinensis]
Length=337

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 16/148 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E  W   HL+Q  GFW     +  +      F    SD++L + PK GTTWLK++ F+I+
Sbjct  37   ETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIV  96

Query  282  NR-SSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR   +D+     L+ NNPH+LVP++E+++Y D+Q   D +T          + R+F+TH
Sbjct  97   NRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQ-VPDLTTLT--------SPRLFATH  147

Query  444  IPYQLLGKTL-ESSSGCRVVYVVRNPKD  524
            +P+  L  ++ +SSS C++VY+ RNPKD
Sbjct  148  LPFVSLPASVKDSSSACKLVYLCRNPKD  175



>ref|XP_007022041.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY13566.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=335

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 18/151 (12%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPS---DVILGSFPKTGTTWLKSLI  269
            +EK W    L+Q  GFW+ PF  P+   V+A  N + +   D+ L + PK+GTTWLK+LI
Sbjct  27   QEKDWVGSTLYQYQGFWY-PFFAPKA--VIAFQNHVKAHETDIFLITMPKSGTTWLKALI  83

Query  270  FSIINRSSL----DSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            FSI+NR+        L+  NPH+LVP+++  +Y  +Q             E+  + RIF+
Sbjct  84   FSIVNRNQFPLTQSPLLTANPHELVPFIDFNIYSKNQTPD-------LENENFPSPRIFA  136

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            TH PY  L  ++   S CR+VY+ RNP D  
Sbjct  137  THTPYGTLPSSI-LKSNCRIVYLCRNPLDQF  166



>ref|XP_006484253.1| PREDICTED: cytosolic sulfotransferase 12-like [Citrus sinensis]
Length=337

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 16/148 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E  W   HL+Q  GFW     +  +      F    SD++L + PK GTTWLK++ F+I+
Sbjct  37   ETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIV  96

Query  282  NR-SSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR   +D+     L+ NNPH+LVP++E+++Y D+Q   D +T          + R+F+TH
Sbjct  97   NRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQ-VPDLTTLT--------SPRLFATH  147

Query  444  IPYQLLGKTL-ESSSGCRVVYVVRNPKD  524
            +P+  L  ++ +SSS C++VY+ RNPKD
Sbjct  148  LPFVSLPASVKDSSSACKLVYLCRNPKD  175



>gb|ACR10273.1| sulfotransferase 5c [Brassica rapa subsp. pekinensis]
Length=337

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 88/164 (54%), Gaps = 20/164 (12%)
 Frame = +3

Query  51   HY*SSISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGS  230
            HY  +I+ + + N      W       +  G W++  ++  +    + F   P+D  + S
Sbjct  23   HYQETIATLPHQN-----GWRPKDPFVEYGGHWWLQPLLEGLLHAQSFFKARPNDFFVCS  77

Query  231  FPKTGTTWLKSLIFSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            +PKTGTTWLK+L F+I NRS  D     L+K NPH+ VPY+E+            S  VL
Sbjct  78   YPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEIDF------PFFPSVDVL  131

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              E +     +FSTHIPY LL +++   +GC++VY+ R+PKDT 
Sbjct  132  KDEGNT----LFSTHIPYNLLPESI-LKAGCKMVYIWRDPKDTF  170



>emb|CDY22189.1| BnaC01g39120D [Brassica napus]
Length=334

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK +  K+L+   G W+ P  +  I      F    SD+IL SFPK+GTTWLK+L+F+++
Sbjct  34   EKDFMGKNLYSYQGSWYYPSTLQAILNFQKHFRARDSDIILASFPKSGTTWLKALVFAVV  93

Query  282  NRSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +R+          L+ +NPH+LV ++E+ +Y  +Q             E+  + R+F+TH
Sbjct  94   HRNKYAPNLVSHPLLSDNPHNLVRFIELDLYVKNQR---------PDLEELPSPRLFATH  144

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+Q L  +L  S  C+VVY+ RN KD L
Sbjct  145  MPFQTLHDSLRDSP-CKVVYMCRNIKDVL  172



>ref|XP_002267209.1| PREDICTED: cytosolic sulfotransferase 12 [Vitis vinifera]
Length=333

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 84/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HL Q  GFW     +  +      F    +D++L + PK+GTTWLK++ F+++
Sbjct  33   EKGWVTSHLFQYQGFWHTSRHLKGVVACQQHFQAHDTDILLVTTPKSGTTWLKAMAFALL  92

Query  282  NRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             R          L+ NNPH+LVP+LE+++Y + +    +S             R+FSTH+
Sbjct  93   KRVRFPDTRHHPLLTNNPHELVPFLEIKLYAESKVPDLTSF---------TAPRLFSTHL  143

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P+  L +++ ++SGC++VY+ RNP+DT 
Sbjct  144  PFTSLPESV-NTSGCKLVYLCRNPRDTF  170



>ref|XP_010051291.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=204

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 85/154 (55%), Gaps = 20/154 (13%)
 Frame = +3

Query  93   SEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIF  272
            SEE+  W         GFW  P +   I      F   PSD++L + PK+GTTWLKS++F
Sbjct  14   SEED--WITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKSILF  71

Query  273  SIINRSSLDS--------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
            +++NR+            L+  N HD VP+LE+ +Y   QE+ D +           + R
Sbjct  72   ALLNRAKYSDSDSQRRHPLLTQNSHDRVPFLELNLYLG-QENPDLTAIA--------SPR  122

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +F+TH+PY LL +++  S+ C++VY+ RNPKDT 
Sbjct  123  LFATHMPYSLLPQSVRDSN-CKLVYLCRNPKDTF  155



>ref|XP_010023658.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW59960.1| hypothetical protein EUGRSUZ_H02685 [Eucalyptus grandis]
Length=329

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 84/149 (56%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W    L+Q  GFW  P ++  +      F    +D++L + PK GTTWLK+++F + 
Sbjct  31   EKGWITPSLYQYQGFWVAPKLLNGVLACQDNFRVQETDILLITAPKCGTTWLKAILFCLS  90

Query  282  NRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
             R           L+  +PHDLVP+LE+++Y   +  + +S           + R+F+TH
Sbjct  91   TRGRYSGSMQQHPLLTQSPHDLVPFLELKLYFGQEIPNLTSL---------PSPRLFATH  141

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +PYQ L ++++  SGC++VY+ RNPKDT 
Sbjct  142  LPYQSLPQSVK-DSGCKLVYLCRNPKDTF  169



>ref|XP_002512030.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF50699.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=354

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 82/149 (55%), Gaps = 17/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   +LHQ  GFW     +  +      F    SD+ L + PK+GTTWLK+++F+++
Sbjct  57   EKGWVANYLHQYQGFWHTTRQLKGVIACQNHFQAQESDIFLVTTPKSGTTWLKAIMFALV  116

Query  282  NRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR           L+ NNPH LVP+LE Q Y D Q    +S           + R+FSTH
Sbjct  117  NRKHFSDTKQQHPLLTNNPHVLVPFLEHQ-YIDTQLPDFTSF---------TSPRLFSTH  166

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L K++E   GC++VY+ RNPKDT 
Sbjct  167  LPFASLPKSVE-DWGCKLVYLCRNPKDTF  194



>ref|XP_010416243.1| PREDICTED: cytosolic sulfotransferase 18 [Camelina sativa]
Length=345

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 15/148 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            E+ W   + L +  G+W++  ++         F   P D ++ S+PKTGTTWLK+L F+I
Sbjct  42   EKGWRVKEPLIEYGGYWWLQPLLEGCIHAQEFFQARPGDFLICSYPKTGTTWLKALTFAI  101

Query  279  INRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
             NRS  D     L+K NPH+ VPY+E+    D     D    VL   +D+  T +FSTH+
Sbjct  102  ANRSRFDDSSNPLLKRNPHEFVPYIEI----DFPFFPD--VDVL---KDKGNT-LFSTHV  151

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            PY+LL +++   SGC++VY+ R PKDT 
Sbjct  152  PYELLPESV-VKSGCKMVYIWREPKDTF  178



>emb|CDY19226.1| BnaC05g14270D [Brassica napus]
Length=337

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 20/164 (12%)
 Frame = +3

Query  51   HY*SSISIMENINLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGS  230
            HY  +I+ + + N      W       +  G W++  ++  +      F   P+D  + S
Sbjct  23   HYQETIATLPHQN-----GWRPKDPFVEYGGHWWLQPLLEGLLHAQNFFKARPNDFFVCS  77

Query  231  FPKTGTTWLKSLIFSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVL  398
            +PKTGTTWLK+L F+I NRS  D     L+K NPH+ VPY+E+            S  VL
Sbjct  78   YPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEIDF------PFFPSVDVL  131

Query  399  SSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
               +DQ  T +FSTHIPY LL +++   +GC++VY+ R+PKDT 
Sbjct  132  ---KDQGNT-LFSTHIPYNLLPESI-LKAGCKMVYIWRDPKDTF  170



>emb|CDX96515.1| BnaA07g31260D [Brassica napus]
Length=338

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 87/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  ++ L Q NG W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPNEILTQYNGHWWQECLLEGLLHAKDHFQARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++Q    ++S
Sbjct  91   YAIVNRSRFDDATNPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDGKNQ----LYS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L +++   SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPESI-VKSGCKMVYIWRDPKDTF  170



>ref|XP_009123345.1| PREDICTED: cytosolic sulfotransferase 11-like [Brassica rapa]
Length=351

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK +  K+L+   G W+ P  +  I      F    SD+IL SFPK+GTTWLK+L+F+++
Sbjct  51   EKDFMGKNLYSYQGSWYYPSTLQAILNFQKHFRARDSDIILASFPKSGTTWLKALVFAVV  110

Query  282  NRSSLD------SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            +R+          L+ +NPH+LV ++E+ +Y  +Q             E+  + R+F+TH
Sbjct  111  HRNKYAPNLVSHPLLSDNPHNLVRFIELDLYVKNQR---------PDLEELPSPRLFATH  161

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+Q L  +L  S  C+VVY+ RN KD L
Sbjct  162  MPFQTLHDSLRDSP-CKVVYMCRNIKDVL  189



>emb|CDX73052.1| BnaC06g35000D [Brassica napus]
Length=338

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 87/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  ++ L Q NG W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPNEILTQYNGHWWQECLLEGLLHAKDHFQARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++Q    ++S
Sbjct  91   YAIVNRSRFDDSTNPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDGKNQ----LYS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L +++   SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPESI-VKSGCKMVYIWRDPKDTF  170



>emb|CDP20151.1| unnamed protein product [Coffea canephora]
Length=328

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 13/134 (10%)
 Frame = +3

Query  141  GFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS--SLDS--LV  308
            G WF   ++         F  + SD+IL S PK+GTTWLK+L FSI+NR+  S+D   L+
Sbjct  37   GVWFYADLLQATLTFQKHFKAIDSDIILASMPKSGTTWLKALTFSIVNRNNHSVDDSPLL  96

Query  309  KNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSG  488
             +NPH LVP+LE+ +Y D           +   +     RI +TH+PYQ L  ++   S 
Sbjct  97   FSNPHYLVPFLEIYLYKDGN---------IPDIDSMPCPRILATHLPYQFLPSSILDCSN  147

Query  489  CRVVYVVRNPKDTL  530
            CR++Y+ RNP D  
Sbjct  148  CRIIYLCRNPLDVF  161



>ref|XP_006302516.1| hypothetical protein CARUB_v10020613mg [Capsella rubella]
 gb|EOA35414.1| hypothetical protein CARUB_v10020613mg [Capsella rubella]
Length=337

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (58%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q  G W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFEARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   +D+  T +FS
Sbjct  91   YAIVNRSRFDDATNPLLKRNPHEFVPYVEIDF------AFYPTVDVL---QDKKNT-LFS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L  ++  +SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPDSI-VNSGCKMVYIWRDPKDTF  170



>ref|XP_006348794.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=332

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 82/150 (55%), Gaps = 16/150 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +EK W   +++   GFW  P ++  +     +F    SD+ L + PK+GT WLKSL+F++
Sbjct  30   KEKGWIGSYIYNYQGFWISPRLLQGVIACQKQFQAQDSDIFLVTNPKSGTIWLKSLLFAL  89

Query  279  INR------SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFST  440
            +NR           L+  NPHDLVP+LE+ +Y D Q    SS           T R+ ST
Sbjct  90   VNRMKHPMFEQNHPLLNKNPHDLVPFLELTLYVDGQVPDFSSF---------TTPRLLST  140

Query  441  HIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            H+P+  L K+ + S   ++VY+ RNPKDT 
Sbjct  141  HLPFASLPKSAQDSK-TKLVYLCRNPKDTF  169



>ref|XP_009106068.1| PREDICTED: cytosolic sulfotransferase 18-like [Brassica rapa]
 gb|ACR10267.1| sulfotransferase 5b [Brassica rapa subsp. pekinensis]
Length=346

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 84/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  102  EKWWGDKHLH-QINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            EK W  K  + +  G W+  F++         F   P+   + S+PKTGTTWLK+L F+I
Sbjct  42   EKGWRQKEAYIEYGGSWWTQFVLEGCLHAQEFFKARPNHFFVCSYPKTGTTWLKALTFAI  101

Query  279  INRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHI  446
            +NRS  D     L++  PH+LVPY+E  V      SS     VL+   D+    +FSTHI
Sbjct  102  VNRSRFDHSSSPLLRRTPHELVPYIEFDV------SSFPQVDVLN---DKGNNNLFSTHI  152

Query  447  PYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            P++LL  ++ +S  C++VY+ R+PKDT 
Sbjct  153  PHELLPVSVVTSR-CKLVYIWRDPKDTF  179



>ref|XP_002524376.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
 gb|EEF37987.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
Length=395

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +3

Query  111  WGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS  290
            W    LHQ  GFW+    +  I     +F   P D+IL ++PKTGTTWLK+L F+I  RS
Sbjct  91   WKFMPLHQYQGFWYFTIYLEAILAAQEKFQAQPDDIILCTYPKTGTTWLKALAFAITTRS  150

Query  291  ----SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQL  458
                S   L+ + PHD VP++E+++      S D+   ++            +THIPY  
Sbjct  151  RYSISETPLLTSTPHDCVPFIEIEIGTRETYSRDTENPLV------------ATHIPYNS  198

Query  459  LGKTLESSSGCRVVYVVRNPKDTL  530
            L  ++ ++ GC++VY  R+PKD L
Sbjct  199  LPTSI-TTLGCKMVYFCRDPKDVL  221



>ref|XP_006437857.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
 gb|ESR51097.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
Length=377

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 16/148 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            E  W   HL+Q  GFW     +  +      F    SD++L + PK GTTWLK++ F+I+
Sbjct  77   ETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIV  136

Query  282  NR-SSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR   +D+     L+ NNPH+LVP++E+++Y D+Q   D +T          + R+F+TH
Sbjct  137  NRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQ-VPDLTTLT--------SPRLFATH  187

Query  444  IPYQLLGKTL-ESSSGCRVVYVVRNPKD  524
            +P+  L  ++ +SSS C++VY+ RNPKD
Sbjct  188  LPFVSLPASVKDSSSACKLVYLCRNPKD  215



>ref|XP_002890287.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66546.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 84/151 (56%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L  ++ W       +  G W++  ++  +      F   P+D  + S+PKTGTTWLK+L 
Sbjct  40   LPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQNFFKARPNDFFVCSYPKTGTTWLKALT  99

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            F+I NRS  D     L+K NPH+ VPY+E+            S  VL   +DQ  T +FS
Sbjct  100  FAIANRSKFDDSTNPLLKRNPHEFVPYIEIDF------PFFPSVDVL---KDQGNT-LFS  149

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIPY LL +++   SGC++VY+ R+PKDT 
Sbjct  150  THIPYDLLPESV-VKSGCKIVYIWRDPKDTF  179



>ref|XP_009764805.1| PREDICTED: flavonol 3-sulfotransferase-like [Nicotiana sylvestris]
Length=357

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 91/156 (58%), Gaps = 15/156 (10%)
 Frame = +3

Query  81   NINLSE--EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTW  254
            +I LSE  +E+ W  +H+HQ   FW+   I+  +  +   F P P+DV+L S+PK+GTTW
Sbjct  28   DIILSELPKERGWLTEHVHQYKDFWYSAGILQGLISLQQNFKPKPNDVLLASYPKSGTTW  87

Query  255  LKSLIFSIINRSSLD----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDT  422
            LK+L+F+I NR+  D     L+ +NPH+LV  LE   +  H  +   ++ ++ S      
Sbjct  88   LKALLFAITNRTKYDYKTHPLLSSNPHELVHQLEAYAF-KHPTNPTPNSSLMHS------  140

Query  423  TRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
              +    +P  +LG   +S+S C++VYV R+PKD L
Sbjct  141  -HLAFNSLPESILGGE-DSNSKCKIVYVFRDPKDVL  174



>ref|XP_004490050.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=356

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 86/144 (60%), Gaps = 14/144 (10%)
 Frame = +3

Query  114  GDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-  290
            G++ L+    FW    IIP        F    SDV++ S PK+GTTWLK+L F+I+NR  
Sbjct  43   GNECLYFYQSFWIPKSIIPTTISFQNHFQAKDSDVVVASMPKSGTTWLKALAFAIVNRQK  102

Query  291  -SLDS--LVKNNPHDLVPYLEVQVYGD--HQESSDSSTHVLSSEEDQDTTRIFSTHIPYQ  455
             SL++  L+  N H+LVP+ EV VY D   Q  + + ++++         RIF+TH+PY 
Sbjct  103  FSLENHPLLTLNSHELVPHFEVNVYVDTMFQLPNTNRSNMIEP-------RIFATHVPYP  155

Query  456  LLGKTLESSSGCRVVYVVRNPKDT  527
             L K+++ S+ CR++Y+ RNP DT
Sbjct  156  SLAKSVKDSN-CRIIYICRNPFDT  178



>emb|CDY39902.1| BnaA09g14840D [Brassica napus]
Length=341

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 92/152 (61%), Gaps = 24/152 (16%)
 Frame = +3

Query  102  EKWWGDKH-LHQINGFWFMPFIIPRIHRVLAE---FNPLPSDVILGSFPKTGTTWLKSLI  269
            EK W  K+ L Q  G W M    PR    +     F   PSD++L S+PKTGTTWLK+L 
Sbjct  41   EKGWRPKNPLIQYGGHWLMQ---PRAEGCMYAQEFFQARPSDLLLCSYPKTGTTWLKALT  97

Query  270  FSIINRS----SLDSLVKNNPHDLVPYLEVQ-VYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            F+I NRS    S + L+K NPH+LVPY+E++  +  H         V++++E+     +F
Sbjct  98   FAIRNRSHFNDSTNPLLKRNPHELVPYIEIEFAFFPH-------IDVINNKENT----LF  146

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+ LL +++ S S C++VY+ R+PKDT 
Sbjct  147  ATHLPHGLLPESV-SRSSCKMVYIWRDPKDTF  177



>ref|XP_002877382.1| hypothetical protein ARALYDRAFT_484902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53641.1| hypothetical protein ARALYDRAFT_484902 [Arabidopsis lyrata subsp. 
lyrata]
Length=254

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 15/143 (10%)
 Frame = +3

Query  120  KHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD  299
            +++ +  G W+ P I+  +      F P  +D+I+ SFPK GTTWLK+L F+++ RS   
Sbjct  35   RNVCKYQGCWYTPHILQAVLNFQKNFKPQDTDIIVASFPKCGTTWLKALTFAVVCRSKHP  94

Query  300  S------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLL  461
            S      L+ +NPH LVPYLE+ +Y  +  +    T   SS       R+FSTH+P  +L
Sbjct  95   SHDDHHPLLSDNPHVLVPYLEMNLY--YYSAKPDFTKFSSS------PRLFSTHMPSHML  146

Query  462  GKTLESSSGCRVVYVVRNPKDTL  530
             + L+ S+ C+ VY+ RN KDTL
Sbjct  147  QEGLKDST-CKFVYMSRNVKDTL  168



>ref|XP_006442535.1| hypothetical protein CICLE_v10024230mg [Citrus clementina]
 gb|ESR55775.1| hypothetical protein CICLE_v10024230mg [Citrus clementina]
 gb|KDO38948.1| hypothetical protein CISIN_1g048598mg [Citrus sinensis]
Length=335

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 85/154 (55%), Gaps = 19/154 (12%)
 Frame = +3

Query  90   LSEEEKWWGDK-HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            LS+  K  GD  +  +  GFW     I  +      F    SDVIL ++PK+GTTWLK+L
Sbjct  25   LSQLRKEKGDGFYFCEYQGFWCPEPAINAVISFQKHFQAQESDVILATYPKSGTTWLKAL  84

Query  267  IFSIINRSSLDSLVKNNP------HDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             F+I+NRS  +  ++N+P      H LVP+LE  +Y +HQ  +          E     R
Sbjct  85   TFTIMNRSRFE--LQNSPLHTTTLHQLVPFLEFDLYLNHQSPNF---------ECFSAPR  133

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            IF+TH+P+ LL  ++  +SGCR+VYV RNP D  
Sbjct  134  IFATHVPHALLPGSI-LNSGCRIVYVCRNPLDQF  166



>ref|XP_007045763.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
 gb|EOY01595.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
Length=395

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 88/149 (59%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HLHQ  GFW     +  +     +F    +D++L + PK+GTTWLK+++F+++
Sbjct  97   EKGWVANHLHQYQGFWHTTRQLLAVLTCQNQFQAQDTDILLVTTPKSGTTWLKAIVFALM  156

Query  282  NRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR    +      L+  NPH LVP+LE+++Y D++  +D +T          + R+F TH
Sbjct  157  NRVQYPNPEVKHPLLAENPHVLVPFLELELYIDNR-VADFTTFT--------SPRLFGTH  207

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P   L  ++++S+ C++VY+ RNPKDT 
Sbjct  208  LPLVSLPDSVKNSA-CKLVYLCRNPKDTF  235



>ref|XP_010459484.1| PREDICTED: cytosolic sulfotransferase 17 [Camelina sativa]
Length=345

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (55%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L  E+ W       +  G W++  ++  +      F    SD  + S+PKTGTTWLK+L 
Sbjct  40   LPHEDGWRPKDPFVEYGGHWWLQPLLEGLLHAQKFFKARHSDFFVCSYPKTGTTWLKALT  99

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            F+I+NRS  D     L+K NPH+ VPY+E+            S  VL  + +    ++FS
Sbjct  100  FAIVNRSKFDDSTNPLLKRNPHEFVPYIEIDF------PFFPSVDVLKDQGN----KLFS  149

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIPY LL +++   SGC++VY+ R+PKDT 
Sbjct  150  THIPYDLLPESV-VKSGCKIVYIWRDPKDTF  179



>ref|XP_010418265.1| PREDICTED: cytosolic sulfotransferase 1-like [Camelina sativa]
Length=268

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 13/142 (9%)
 Frame = +3

Query  120  KHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRSSLD  299
            K L +  G W+    +  +      F P  +D+IL SFPK+GTTWLK+L  +++ RS   
Sbjct  35   KKLCKYQGCWYYYNTLQGVLNFHRGFQPQDTDIILASFPKSGTTWLKALTVALLERSKHR  94

Query  300  S-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLG  464
            S     L+ +NPH +VP+LE+ VY    ESS       SS       R+FSTH+P   + 
Sbjct  95   SSDDHPLLSDNPHGIVPFLEIDVY---IESSSPDLSKFSS-----FPRLFSTHMPLHTMQ  146

Query  465  KTLESSSGCRVVYVVRNPKDTL  530
            +TL+ SS C++VY+ R  KDTL
Sbjct  147  ETLKDSSPCKIVYMCRYAKDTL  168



>emb|CDP12288.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 89/160 (56%), Gaps = 22/160 (14%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + EKWWG   L++ +GFW+    +         F    +D++L S PK+GTTWLKSL+
Sbjct  30   LPKVEKWWGRFDLYKYDGFWYRLDWLEGAISAKTNFQAQDNDILLSSPPKSGTTWLKSLM  89

Query  270  FSIIN-------------RSSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEE  410
             SI++             +   D L +N PHDL+P +E++++   + S + +        
Sbjct  90   VSIMDSHAARTFNNINDAKDQYDLLEENFPHDLIPCMEMEIFNPLRASENPTL-------  142

Query  411  DQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             +   R+  TH+PY +L ++++ +SGC++VY+ R+PKD L
Sbjct  143  -KGQPRLHHTHVPYSMLSESVK-NSGCKIVYIARDPKDVL  180



>gb|KFK41855.1| hypothetical protein AALP_AA2G179800 [Arabis alpina]
Length=337

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 15/151 (10%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L + + W  D+ L Q NG W+   ++  +      F   P+D ++ S+PKTGTTWLK+L 
Sbjct  31   LPKSKGWRPDEILTQHNGHWWQECLLEGLLHAKDNFQARPTDFLVCSYPKTGTTWLKALT  90

Query  270  FSIINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            ++I+NRS  D     L+K NPH+ VPY+E+        +   +  VL   ++     +FS
Sbjct  91   YAIVNRSRFDDATNPLLKRNPHEFVPYVEIDF------AFYPTVDVLQDAKNP----LFS  140

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            THIP   L  ++  +SGC++VY+ R+PKDT 
Sbjct  141  THIPNGSLPDSI-VNSGCKMVYIWRDPKDTF  170



>emb|CBI27337.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 84/149 (56%), Gaps = 15/149 (10%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
             EK W   HL Q  GFW     +  +      F    +D++L + PK+GTTWLK++ F++
Sbjct  32   REKGWVTSHLFQYQGFWHTSRHLKGVVACQQHFQAHDTDILLVTTPKSGTTWLKAMAFAL  91

Query  279  INRSSLDS-----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            + R          L+ NNPH+LVP+LE+++Y + +    +S             R+FSTH
Sbjct  92   LKRVRFPDTRHHPLLTNNPHELVPFLEIKLYAESKVPDLTSF---------TAPRLFSTH  142

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L +++ ++SGC++VY+ RNP+DT 
Sbjct  143  LPFTSLPESV-NTSGCKLVYLCRNPRDTF  170


 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 8/91 (9%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            +L  EE W  D  ++Q  GFWF    I  +      F    +D++L + PK+GTTWLK++
Sbjct  306  SLPTEEGWLFD--VYQYQGFWFPSRQIQAVLASQQRFQAQDTDILLVTTPKSGTTWLKAI  363

Query  267  IFSIINRSSLDS------LVKNNPHDLVPYL  341
            +F+ +NR           L+ +NPH+LVP L
Sbjct  364  VFAFVNRVKFPDMQDHHPLLTSNPHELVPLL  394



>gb|ACR10269.1| sulfotransferase 5b [Brassica rapa subsp. pekinensis]
Length=342

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 92/152 (61%), Gaps = 24/152 (16%)
 Frame = +3

Query  102  EKWWGDKH-LHQINGFWFMPFIIPRIHRVLAE---FNPLPSDVILGSFPKTGTTWLKSLI  269
            EK W  K+ L Q  G W M    PR    +     F   PSD++L S+PKTGTTWLK+L 
Sbjct  41   EKGWRPKNPLIQYGGHWLMQ---PRAEGCMYAQEFFQARPSDLLLCSYPKTGTTWLKALT  97

Query  270  FSIINRS----SLDSLVKNNPHDLVPYLEVQ-VYGDHQESSDSSTHVLSSEEDQDTTRIF  434
            F+I NRS    S + L+K NPH+LVPY+E++  +  H         V++++E+     +F
Sbjct  98   FAIRNRSHFNDSTNPLLKRNPHELVPYIEIEFAFFPH-------IDVINNKENT----LF  146

Query  435  STHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +TH+P+ LL +++ S S C++VY+ R+PKDT 
Sbjct  147  ATHLPHGLLPESV-SRSSCKMVYIWRDPKDTF  177



>emb|CDP14958.1| unnamed protein product [Coffea canephora]
Length=325

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 87/149 (58%), Gaps = 16/149 (11%)
 Frame = +3

Query  99   EEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSI  278
            +E+W G  +L++ NGFW +  ++P +      F    +DV+L + PK+GTTWLK+L+F++
Sbjct  33   KERWLGSSYLYKYNGFWLIHKVLPGLIACQNHFQAQDTDVLLITTPKSGTTWLKALMFAL  92

Query  279  INR-----SSLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
             NR     +    L+K NPH LVP++E   +   + + D S  +          R++STH
Sbjct  93   ANRKIYPINQNHPLLKQNPHSLVPFMEF-FFSPEKMNPDFSCPL---------GRLYSTH  142

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             P  LL +++  +SGC++VY+ RN KDT 
Sbjct  143  YPLTLLPESV-LNSGCKIVYLCRNIKDTF  170



>ref|XP_006292772.1| hypothetical protein CARUB_v10019022mg [Capsella rubella]
 gb|EOA25670.1| hypothetical protein CARUB_v10019022mg [Capsella rubella]
Length=326

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 91/169 (54%), Gaps = 25/169 (15%)
 Frame = +3

Query  72   IMENINLSEEEKWW----------GDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVI  221
            +M N++L E+ K              K + +  G W+    +  + R    F P  +DVI
Sbjct  7    VMRNVDLHEDTKTLISSLPSDKDSCGKSICKYQGCWYTHQALQGVLRFQKNFKPQDTDVI  66

Query  222  LGSFPKTGTTWLKSLIFSIINRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDS  383
            + SFPK GTTWLK+L F+++ RS   S      L+ +NPH LVPYLE+ +Y  + E  D 
Sbjct  67   VASFPKCGTTWLKALTFALVRRSEHPSQDHHHPLLSDNPHVLVPYLEMNLYY-YSEKPD-  124

Query  384  STHVLSSEEDQDTTRIFSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             T  LSS       R+FSTH+P   L + L+ S  C++VY+ RN KDTL
Sbjct  125  LTKFLSS------PRLFSTHMPLHPLQEGLKDSP-CKIVYMCRNVKDTL  166



>ref|XP_002529674.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
 gb|EEF32716.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
Length=235

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 80/140 (57%), Gaps = 22/140 (16%)
 Frame = +3

Query  126  LHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSIINRS-----  290
            LH+  GFW+ P I+  I      F   P+D+I+ S PK+GTTWLK+L F+I+ R+     
Sbjct  47   LHKYQGFWYNPDILKCIVSAQEHFVAEPTDIIISSLPKSGTTWLKALCFAILRRTHLRDY  106

Query  291  SLDSLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTHIPYQLLGKT  470
            S++ L+   PHD+VP++E      +Q+  D + H L           + THIPY  L K+
Sbjct  107  SINRLLTELPHDIVPFIEY-----NQDIKDPNNHPL-----------WGTHIPYSSLPKS  150

Query  471  LESSSGCRVVYVVRNPKDTL  530
            + + S C+++Y+ RNPKD  
Sbjct  151  I-AESNCKIIYIFRNPKDVF  169



>ref|XP_006442533.1| hypothetical protein CICLE_v10021050mg [Citrus clementina]
 gb|ESR55773.1| hypothetical protein CICLE_v10021050mg [Citrus clementina]
Length=335

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 86/152 (57%), Gaps = 19/152 (13%)
 Frame = +3

Query  90   LSEEEKWWGDK-HLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
            LS+  K  GD  + ++  GFW     I  +      F    SDVIL ++PK+GTTWLK+L
Sbjct  25   LSQLRKEKGDGFYFYEYQGFWCPEPTINAVISFQKHFQAQESDVILATYPKSGTTWLKAL  84

Query  267  IFSIINRSSLDSLVKNNP------HDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTR  428
             F+I+NRS  +  ++N+P      H LVP+LE  +Y +HQ           + E     R
Sbjct  85   TFTIMNRSRFE--LQNSPLHTTTLHQLVPFLEFDLYLNHQS---------PNLECFSAPR  133

Query  429  IFSTHIPYQLLGKTLESSSGCRVVYVVRNPKD  524
            IF+TH+P+ LL  ++ +SS CR+VYV RNP D
Sbjct  134  IFATHVPHALLPGSILNSS-CRIVYVCRNPLD  164



>gb|KDP41358.1| hypothetical protein JCGZ_15765 [Jatropha curcas]
Length=310

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 84/149 (56%), Gaps = 17/149 (11%)
 Frame = +3

Query  102  EKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFSII  281
            EK W   HLHQ  GFW     +  +      F    +D+ L + PK+GTTWLK+L F+++
Sbjct  15   EKGWVANHLHQYQGFWHPTRQLKGVIACQNHFQAQENDIFLITTPKSGTTWLKALTFALV  74

Query  282  NRSSLDS------LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            NR    +      L+ NNPH LVP+L++  Y D  +S D S+          + R+FSTH
Sbjct  75   NRVRFPNPKENHPLLTNNPHVLVPFLDM-AYID-TDSPDFSSFT--------SPRLFSTH  124

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +P+  L K++E   GC++VY+ RNPKDT 
Sbjct  125  LPFVSLPKSVE-DLGCKIVYLCRNPKDTF  152



>ref|XP_002514611.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
 gb|EEF47717.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
Length=330

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 18/149 (12%)
 Frame = +3

Query  96   EEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLIFS  275
            +E+ W    ++++  GFW+       +      F   P+D+I+ S PKTGTTWLK+L F+
Sbjct  23   KEKGWDTRNYMYKYQGFWYYESFAEGVMSAQEHFKAQPNDIIVASCPKTGTTWLKALTFA  82

Query  276  IINRSSLDS----LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFSTH  443
            I+ R   D     L+K  PH+ VP+LE+ +  D             S +      + +TH
Sbjct  83   IVTRGVFDDSTNPLLKKVPHECVPFLELDLAKD-------------SRDRDSAIPLVATH  129

Query  444  IPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +PY  L KT+   SGC++VYV R+PKD  
Sbjct  130  VPYISLPKTI-LDSGCKIVYVCRDPKDVF  157



>ref|XP_003572076.1| PREDICTED: cytosolic sulfotransferase 5-like [Brachypodium distachyon]
Length=330

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 82/153 (54%), Gaps = 16/153 (10%)
 Frame = +3

Query  87   NLSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSL  266
             L   E W   + L Q   +WF P ++ +I +    F P   D++L +FPK GTTWLK+L
Sbjct  26   TLPAREGWSQGQPLIQYKKYWFRPRMLEQILQAQDAFKPRADDILLATFPKCGTTWLKAL  85

Query  267  IFSIINRSSLD-----SLVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRI  431
             F++INRS         L+  + H LVP++E+     H+ ++D         E   + R+
Sbjct  86   TFTVINRSRYSFSGDHPLLTCHSHRLVPFIEI---AHHRAAADFL-------ETLPSPRL  135

Query  432  FSTHIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
             +TH+P  LL     SSS CR+VY+ R+PKD L
Sbjct  136  IATHMPMSLLPPG-TSSSACRIVYLCRDPKDAL  167



>gb|EYU29210.1| hypothetical protein MIMGU_mgv1a010218mg [Erythranthe guttata]
Length=318

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 83/151 (55%), Gaps = 13/151 (9%)
 Frame = +3

Query  90   LSEEEKWWGDKHLHQINGFWFMPFIIPRIHRVLAEFNPLPSDVILGSFPKTGTTWLKSLI  269
            L E    W  +HL    GFWF    +P I      F    +D+IL + PK+GTTWLK+L 
Sbjct  13   LLERRTGWDGQHLVNYEGFWFPEMFLPSIRSSRNNFVAKNTDIILATVPKSGTTWLKALT  72

Query  270  FSIINRS--SLDS--LVKNNPHDLVPYLEVQVYGDHQESSDSSTHVLSSEEDQDTTRIFS  437
            FS+ NR   ++D   L+K+NPH LVP+++  +  +H +        L   E+    RI S
Sbjct  73   FSVANRGIYAVDQSPLLKSNPHKLVPFIQEYIGDEHDK--------LLPMENVSDPRILS  124

Query  438  THIPYQLLGKTLESSSGCRVVYVVRNPKDTL  530
            +H+P+ +L  ++ + S C+++Y+ RNP D  
Sbjct  125  SHVPFVMLPYSV-AKSECKIIYLCRNPLDQF  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512576545360