BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14846_g2_i1 len=1906 path=[1:0-1292 1294:1293-1295 1297:1296-1905]

Length=1906
                                                                      Score     E

ref|XP_006350168.1|  PREDICTED: probable serine/threonine-protein...    494   2e-162   
ref|XP_009597660.1|  PREDICTED: probable serine/threonine-protein...    491   2e-161   
ref|XP_004232198.1|  PREDICTED: probable serine/threonine-protein...    489   8e-161   
ref|XP_009768103.1|  PREDICTED: probable serine/threonine-protein...    489   1e-160   
ref|XP_009625284.1|  PREDICTED: probable serine/threonine-protein...    488   1e-160   
ref|XP_009597721.1|  PREDICTED: probable serine/threonine-protein...    487   7e-160   
ref|XP_006338417.1|  PREDICTED: probable serine/threonine-protein...    483   1e-158   
ref|XP_009768104.1|  PREDICTED: probable serine/threonine-protein...    480   1e-157   
ref|XP_009768588.1|  PREDICTED: probable serine/threonine-protein...    480   4e-157   
ref|XP_009768582.1|  PREDICTED: probable serine/threonine-protein...    477   4e-156   
emb|CDP02267.1|  unnamed protein product                                475   4e-155   
ref|XP_011098677.1|  PREDICTED: probable serine/threonine-protein...    461   2e-149   
ref|XP_011085705.1|  PREDICTED: probable serine/threonine-protein...    458   2e-148   
ref|XP_007032627.1|  ATP binding protein, putative isoform 1            421   7e-134   
gb|EYU34634.1|  hypothetical protein MIMGU_mgv1a018397mg                412   2e-133   
ref|XP_008230818.1|  PREDICTED: probable serine/threonine-protein...    414   3e-131   
ref|XP_007217007.1|  hypothetical protein PRUPE_ppa002153mg             410   8e-130   
gb|KDP31293.1|  hypothetical protein JCGZ_11669                         409   2e-129   
ref|XP_002514714.1|  ATP binding protein, putative                      407   2e-129   Ricinus communis
ref|XP_007032628.1|  ATP binding protein, putative isoform 2            400   2e-128   
ref|XP_002317972.1|  hypothetical protein POPTR_0012s06960g             405   5e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010030365.1|  PREDICTED: probable serine/threonine-protein...    404   1e-127   
ref|XP_011012137.1|  PREDICTED: probable serine/threonine-protein...    404   2e-127   
ref|XP_011012136.1|  PREDICTED: probable serine/threonine-protein...    403   2e-127   
ref|XP_006482784.1|  PREDICTED: probable serine/threonine-protein...    399   3e-127   
ref|XP_010663340.1|  PREDICTED: probable serine/threonine-protein...    403   3e-127   
gb|KHG12951.1|  hypothetical protein F383_07371                         403   7e-127   
ref|XP_010089563.1|  putative serine/threonine-protein kinase           401   1e-126   
gb|KHN26278.1|  Putative serine/threonine-protein kinase                398   3e-126   
gb|KDO72711.1|  hypothetical protein CISIN_1g041720mg                   400   3e-126   
ref|XP_006431266.1|  hypothetical protein CICLE_v10013417mg             400   4e-126   
gb|EPS68289.1|  hypothetical protein M569_06479                         388   9e-126   
ref|XP_011006282.1|  PREDICTED: probable serine/threonine-protein...    399   9e-126   
ref|XP_007037445.1|  Kinase superfamily protein                         399   1e-125   
ref|XP_004306120.1|  PREDICTED: probable serine/threonine-protein...    399   2e-125   
ref|XP_008348081.1|  PREDICTED: probable serine/threonine-protein...    399   2e-125   
ref|XP_003527095.1|  PREDICTED: probable serine/threonine-protein...    397   3e-125   
ref|XP_008459351.1|  PREDICTED: probable serine/threonine-protein...    397   4e-125   
ref|XP_004141453.1|  PREDICTED: probable serine/threonine-protein...    397   5e-125   
ref|XP_004489426.1|  PREDICTED: probable serine/threonine-protein...    394   7e-125   
ref|XP_004156158.1|  PREDICTED: probable serine/threonine-protein...    397   9e-125   
ref|XP_009360586.1|  PREDICTED: probable serine/threonine-protein...    397   1e-124   
ref|XP_008341611.1|  PREDICTED: probable serine/threonine-protein...    397   1e-124   
ref|XP_004137627.1|  PREDICTED: probable serine/threonine-protein...    391   4e-124   
ref|XP_006374446.1|  hypothetical protein POPTR_0015s07250g             394   8e-124   
gb|KDO55463.1|  hypothetical protein CISIN_1g005119mg                   388   1e-123   
gb|EPS61975.1|  hypothetical protein M569_12817                         379   2e-123   
ref|XP_010065651.1|  PREDICTED: probable serine/threonine-protein...    390   3e-123   
ref|XP_002530023.1|  ATP binding protein, putative                      392   4e-123   Ricinus communis
ref|XP_006585759.1|  PREDICTED: probable serine/threonine-protein...    390   2e-122   
ref|XP_010678451.1|  PREDICTED: probable serine/threonine-protein...    390   3e-122   
ref|XP_006494991.1|  PREDICTED: probable serine/threonine-protein...    390   3e-122   
emb|CDP18308.1|  unnamed protein product                                390   3e-122   
ref|XP_006585758.1|  PREDICTED: probable serine/threonine-protein...    389   4e-122   
ref|XP_009596963.1|  PREDICTED: probable serine/threonine-protein...    390   4e-122   
gb|KDO55461.1|  hypothetical protein CISIN_1g005119mg                   389   5e-122   
ref|XP_007139558.1|  hypothetical protein PHAVU_008G039800g             389   5e-122   
ref|XP_006585757.1|  PREDICTED: probable serine/threonine-protein...    389   5e-122   
gb|KCW63248.1|  hypothetical protein EUGRSUZ_G00872                     389   6e-122   
ref|XP_003530415.1|  PREDICTED: probable serine/threonine-protein...    389   7e-122   
ref|XP_007139559.1|  hypothetical protein PHAVU_008G039800g             388   7e-122   
ref|XP_009793962.1|  PREDICTED: probable serine/threonine-protein...    389   9e-122   
gb|KDO55458.1|  hypothetical protein CISIN_1g005119mg                   389   9e-122   
ref|XP_007139557.1|  hypothetical protein PHAVU_008G039800g             388   1e-121   
ref|XP_008239891.1|  PREDICTED: probable serine/threonine-protein...    389   1e-121   
ref|XP_004491857.1|  PREDICTED: probable serine/threonine-protein...    388   1e-121   
ref|XP_008465829.1|  PREDICTED: probable serine/threonine-protein...    389   2e-121   
gb|KDO55462.1|  hypothetical protein CISIN_1g005119mg                   381   2e-121   
ref|XP_006440664.1|  hypothetical protein CICLE_v10019086mg             388   2e-121   
ref|XP_010258217.1|  PREDICTED: probable serine/threonine-protein...    388   2e-121   
gb|KDO55460.1|  hypothetical protein CISIN_1g005119mg                   389   2e-121   
ref|XP_006593682.1|  PREDICTED: probable serine/threonine-protein...    384   3e-121   
ref|XP_004491856.1|  PREDICTED: probable serine/threonine-protein...    387   4e-121   
gb|KHN45673.1|  Putative serine/threonine-protein kinase                382   6e-121   
ref|XP_003618563.1|  Serine/threonine protein kinase                    384   8e-121   
gb|AES74781.2|  cyclin-dependent kinase                                 384   1e-120   
gb|KHN13194.1|  Putative serine/threonine-protein kinase                383   1e-120   
ref|XP_007138154.1|  hypothetical protein PHAVU_009G184700g             385   1e-120   
ref|XP_006603881.1|  PREDICTED: probable serine/threonine-protein...    382   2e-120   
ref|XP_011035812.1|  PREDICTED: probable serine/threonine-protein...    384   2e-120   
gb|KHN48786.1|  Putative serine/threonine-protein kinase                382   2e-120   
ref|XP_006602932.1|  PREDICTED: probable serine/threonine-protein...    384   3e-120   
ref|XP_003551748.1|  PREDICTED: probable serine/threonine-protein...    384   3e-120   
ref|XP_002324078.2|  hypothetical protein POPTR_0017s12410g             383   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_009795917.1|  PREDICTED: probable serine/threonine-protein...    385   3e-120   
ref|XP_008445783.1|  PREDICTED: probable serine/threonine-protein...    385   4e-120   
ref|XP_011035811.1|  PREDICTED: probable serine/threonine-protein...    384   7e-120   
ref|XP_009617164.1|  PREDICTED: probable serine/threonine-protein...    384   9e-120   
gb|AES77534.2|  cyclin-dependent kinase C                               383   1e-119   
ref|XP_006844845.1|  hypothetical protein AMTR_s00058p00088010          384   1e-119   
ref|XP_010258718.1|  PREDICTED: probable serine/threonine-protein...    380   1e-119   
ref|XP_010553990.1|  PREDICTED: probable serine/threonine-protein...    383   2e-119   
gb|KHN13587.1|  Putative serine/threonine-protein kinase                384   2e-119   
ref|XP_004137420.1|  PREDICTED: probable serine/threonine-protein...    383   2e-119   
ref|XP_004163820.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    388   2e-119   
ref|XP_002278818.1|  PREDICTED: probable serine/threonine-protein...    383   3e-119   Vitis vinifera
ref|XP_003523004.1|  PREDICTED: probable serine/threonine-protein...    382   3e-119   
ref|XP_009406003.1|  PREDICTED: probable serine/threonine-protein...    381   5e-119   
ref|XP_009406002.1|  PREDICTED: probable serine/threonine-protein...    381   5e-119   
ref|XP_009406001.1|  PREDICTED: probable serine/threonine-protein...    381   5e-119   
ref|XP_003621316.1|  Cyclin-dependent protein kinase-like protein       383   9e-119   
ref|XP_010258708.1|  PREDICTED: probable serine/threonine-protein...    380   1e-118   
ref|XP_010318824.1|  PREDICTED: probable serine/threonine-protein...    380   1e-118   
ref|XP_004235975.1|  PREDICTED: probable serine/threonine-protein...    380   1e-118   
gb|KHG22711.1|  hypothetical protein F383_28957                         380   2e-118   
ref|XP_006345172.1|  PREDICTED: probable serine/threonine-protein...    380   3e-118   
ref|XP_009125105.1|  PREDICTED: probable serine/threonine-protein...    379   3e-118   
ref|XP_006345173.1|  PREDICTED: probable serine/threonine-protein...    380   3e-118   
emb|CDY37004.1|  BnaC06g12590D                                          377   6e-118   
ref|XP_009139852.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    377   6e-118   
ref|XP_010106628.1|  putative serine/threonine-protein kinase           382   8e-118   
gb|KEH31968.1|  cyclin-dependent kinase                                 373   1e-117   
gb|KHN48710.1|  Putative serine/threonine-protein kinase                376   2e-117   
gb|AAL56635.1|AF120153_1  cyclin-dependent kinase CDC2C                 376   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198758.2|  cyclin-dependent kinase CDC2C                         376   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52489.1|  hypothetical protein Csa_5G637790                       373   5e-117   
ref|XP_010450811.1|  PREDICTED: probable serine/threonine-protein...    375   6e-117   
ref|XP_010923564.1|  PREDICTED: probable serine/threonine-protein...    377   8e-117   
dbj|BAG97316.1|  unnamed protein product                                371   8e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003524702.1|  PREDICTED: probable serine/threonine-protein...    375   9e-117   
ref|XP_010528375.1|  PREDICTED: probable serine/threonine-protein...    375   1e-116   
ref|XP_004508714.1|  PREDICTED: probable serine/threonine-protein...    375   1e-116   
ref|XP_006283311.1|  hypothetical protein CARUB_v10004349mg             374   1e-116   
ref|XP_009394329.1|  PREDICTED: probable serine/threonine-protein...    375   2e-116   
ref|XP_010670220.1|  PREDICTED: probable serine/threonine-protein...    373   2e-116   
ref|XP_007155279.1|  hypothetical protein PHAVU_003G187700g             374   2e-116   
ref|XP_010441062.1|  PREDICTED: probable serine/threonine-protein...    373   3e-116   
gb|KFK33201.1|  hypothetical protein AALP_AA6G343500                    373   3e-116   
ref|XP_010539977.1|  PREDICTED: probable serine/threonine-protein...    375   3e-116   
ref|XP_011072815.1|  PREDICTED: probable serine/threonine-protein...    374   4e-116   
ref|XP_011072816.1|  PREDICTED: probable serine/threonine-protein...    374   5e-116   
ref|XP_010435890.1|  PREDICTED: probable serine/threonine-protein...    372   7e-116   
gb|KEH31969.1|  cyclin-dependent kinase                                 373   7e-116   
ref|XP_008393191.1|  PREDICTED: probable serine/threonine-protein...    373   1e-115   
gb|AAG52349.1|AC011765_1  putative protein kinase; 3429-1655            365   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787098.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    373   1e-115   
ref|XP_008374583.1|  PREDICTED: probable serine/threonine-protein...    373   1e-115   
ref|XP_008374582.1|  PREDICTED: probable serine/threonine-protein...    373   1e-115   
ref|XP_009411082.1|  PREDICTED: probable serine/threonine-protein...    372   3e-115   
ref|XP_009339128.1|  PREDICTED: probable serine/threonine-protein...    372   3e-115   
ref|XP_009339129.1|  PREDICTED: probable serine/threonine-protein...    372   3e-115   
ref|XP_003550793.1|  PREDICTED: probable serine/threonine-protein...    371   3e-115   
ref|XP_009411081.1|  PREDICTED: probable serine/threonine-protein...    372   3e-115   
ref|NP_001060172.1|  Os07g0596600                                       372   4e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008785933.1|  PREDICTED: probable serine/threonine-protein...    372   4e-115   
ref|XP_009338827.1|  PREDICTED: probable serine/threonine-protein...    371   5e-115   
gb|EAZ40528.1|  hypothetical protein OsJ_24984                          372   5e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010471520.1|  PREDICTED: probable serine/threonine-protein...    371   8e-115   
emb|CDX67429.1|  BnaA07g14690D                                          377   8e-115   
gb|KHN18575.1|  Putative serine/threonine-protein kinase                370   8e-115   
ref|XP_010938783.1|  PREDICTED: probable serine/threonine-protein...    370   9e-115   
ref|XP_004299330.1|  PREDICTED: probable serine/threonine-protein...    370   1e-114   
gb|EAZ04580.1|  hypothetical protein OsI_26730                          371   1e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_006405630.1|  hypothetical protein EUTSA_v10027682mg             369   1e-114   
ref|XP_006390438.1|  hypothetical protein EUTSA_v10018206mg             370   1e-114   
ref|XP_004958203.1|  PREDICTED: probable serine/threonine-protein...    370   1e-114   
ref|XP_010416283.1|  PREDICTED: probable serine/threonine-protein...    370   2e-114   
emb|CBI22263.3|  unnamed protein product                                371   2e-114   
ref|XP_010471522.1|  PREDICTED: probable serine/threonine-protein...    369   2e-114   
ref|XP_004958202.1|  PREDICTED: probable serine/threonine-protein...    370   2e-114   
ref|XP_006300808.1|  hypothetical protein CARUB_v10019891mg             368   4e-114   
ref|XP_010471518.1|  PREDICTED: probable serine/threonine-protein...    369   4e-114   
ref|NP_001154470.1|  putative serine/threonine kinase                   369   5e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177573.2|  putative serine/threonine kinase                      369   6e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73077.1|  BnaC06g35250D                                          367   7e-114   
ref|XP_009106092.1|  PREDICTED: probable serine/threonine-protein...    368   9e-114   
ref|XP_006300809.1|  hypothetical protein CARUB_v10019891mg             367   1e-113   
ref|XP_006657913.1|  PREDICTED: probable serine/threonine-protein...    367   2e-113   
ref|XP_007210886.1|  hypothetical protein PRUPE_ppa002234mg             367   2e-113   
ref|XP_010939059.1|  PREDICTED: probable serine/threonine-protein...    367   3e-113   
ref|XP_010416284.1|  PREDICTED: probable serine/threonine-protein...    366   4e-113   
ref|XP_008651752.1|  PREDICTED: uncharacterized protein LOC100383...    367   4e-113   
ref|XP_006390437.1|  hypothetical protein EUTSA_v10018206mg             360   5e-113   
ref|XP_008781045.1|  PREDICTED: probable serine/threonine-protein...    367   5e-113   
gb|KFK41882.1|  hypothetical protein AALP_AA2G184200                    366   5e-113   
ref|XP_009394765.1|  PREDICTED: probable serine/threonine-protein...    365   6e-113   
dbj|BAJ97684.1|  predicted protein                                      362   7e-113   
ref|XP_010459503.1|  PREDICTED: probable serine/threonine-protein...    366   8e-113   
ref|XP_008667076.1|  PREDICTED: uncharacterized LOC100191951 isof...    365   1e-112   
ref|XP_008667075.1|  PREDICTED: uncharacterized LOC100191951 isof...    366   1e-112   
gb|KFK44020.1|  hypothetical protein AALP_AA1G204600                    365   1e-112   
ref|XP_008667077.1|  PREDICTED: uncharacterized LOC100191951 isof...    365   1e-112   
ref|NP_001130847.1|  uncharacterized LOC100191951                       365   1e-112   Zea mays [maize]
ref|XP_006306905.1|  hypothetical protein CARUB_v10008466mg             365   1e-112   
emb|CDX96534.1|  BnaA07g31450D                                          363   2e-112   
gb|EMT15543.1|  Putative serine/threonine-protein kinase                361   3e-112   
ref|XP_009397746.1|  PREDICTED: probable serine/threonine-protein...    363   3e-112   
ref|XP_010477057.1|  PREDICTED: probable serine/threonine-protein...    364   4e-112   
tpg|DAA41309.1|  TPA: putative protein kinase superfamily protein       365   5e-112   
ref|XP_002463130.1|  hypothetical protein SORBIDRAFT_02g038280          363   5e-112   Sorghum bicolor [broomcorn]
ref|XP_004499517.1|  PREDICTED: probable serine/threonine-protein...    363   6e-112   
gb|KDO44513.1|  hypothetical protein CISIN_1g036122mg                   355   7e-112   
emb|CDY71137.1|  BnaC08g49430D                                          354   1e-111   
gb|KGN64182.1|  hypothetical protein Csa_1G042890                       361   1e-111   
dbj|BAJ87041.1|  predicted protein                                      362   2e-111   
ref|XP_010428415.1|  PREDICTED: probable serine/threonine-protein...    362   2e-111   
ref|XP_010498274.1|  PREDICTED: probable serine/threonine-protein...    362   3e-111   
ref|XP_010428414.1|  PREDICTED: probable serine/threonine-protein...    361   3e-111   
ref|XP_006416579.1|  hypothetical protein EUTSA_v10006926mg             362   4e-111   
ref|XP_006436913.1|  hypothetical protein CICLE_v10031084mg             357   4e-111   
ref|XP_006485128.1|  PREDICTED: probable serine/threonine-protein...    357   5e-111   
ref|XP_003562766.1|  PREDICTED: probable serine/threonine-protein...    361   6e-111   
ref|XP_006416580.1|  hypothetical protein EUTSA_v10006926mg             362   7e-111   
gb|KFK37574.1|  hypothetical protein AALP_AA3G000700                    358   8e-111   
ref|XP_008790095.1|  PREDICTED: probable serine/threonine-protein...    359   3e-110   
ref|XP_008790097.1|  PREDICTED: probable serine/threonine-protein...    359   3e-110   
gb|AAF27112.1|AC011809_21  Putative protein kinase                      358   3e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74282.1|  BnaA03g27650D                                          356   4e-110   
ref|XP_006299569.1|  hypothetical protein CARUB_v10015744mg             356   7e-110   
ref|NP_683519.2|  protein kinase superfamily protein                    356   8e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KDP27188.1|  hypothetical protein JCGZ_19887                         358   8e-110   
ref|NP_001168769.1|  uncharacterized LOC100382566                       353   9e-110   Zea mays [maize]
emb|CDX81891.1|  BnaC08g37100D                                          357   1e-109   
ref|NP_173302.2|  cyclin-dependent kinase-like protein                  358   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389755.1|  PREDICTED: probable serine/threonine-protein...    356   1e-109   
ref|XP_006408460.1|  hypothetical protein EUTSA_v10020289mg             354   4e-109   
emb|CDX96706.1|  BnaA08g22490D                                          357   4e-109   
gb|EYU43019.1|  hypothetical protein MIMGU_mgv1a003556mg                352   5e-109   
ref|XP_009110327.1|  PREDICTED: probable serine/threonine-protein...    355   6e-109   
ref|XP_009399300.1|  PREDICTED: probable serine/threonine-protein...    355   7e-109   
gb|KHN31275.1|  Putative serine/threonine-protein kinase                348   8e-109   
ref|XP_007159987.1|  hypothetical protein PHAVU_002G283400g             350   9e-109   
gb|EPS58921.1|  hypothetical protein M569_15891                         353   1e-108   
ref|XP_002874601.1|  kinase family protein                              348   1e-108   
gb|KHN17474.1|  Putative serine/threonine-protein kinase                346   1e-108   
gb|KHG30226.1|  hypothetical protein F383_12098                         351   1e-108   
ref|XP_011083509.1|  PREDICTED: probable serine/threonine-protein...    351   1e-108   
ref|XP_004984389.1|  PREDICTED: probable serine/threonine-protein...    350   2e-108   
ref|XP_007159986.1|  hypothetical protein PHAVU_002G283400g             346   2e-108   
ref|XP_009804117.1|  PREDICTED: probable serine/threonine-protein...    350   2e-108   
ref|XP_002465275.1|  hypothetical protein SORBIDRAFT_01g035420          345   3e-108   Sorghum bicolor [broomcorn]
ref|XP_003557843.1|  PREDICTED: probable serine/threonine-protein...    350   3e-108   
ref|XP_004501733.1|  PREDICTED: probable serine/threonine-protein...    349   4e-108   
ref|NP_001146380.1|  uncharacterized protein LOC100279958               347   5e-108   Zea mays [maize]
ref|XP_003523166.1|  PREDICTED: probable serine/threonine-protein...    349   5e-108   
dbj|BAJ86619.1|  predicted protein                                      348   6e-108   
ref|XP_007035478.1|  Serine/threonine-protein kinase isoform 2          349   6e-108   
ref|XP_011028376.1|  PREDICTED: probable serine/threonine-protein...    349   6e-108   
ref|XP_011073124.1|  PREDICTED: probable serine/threonine-protein...    349   7e-108   
ref|XP_002455623.1|  hypothetical protein SORBIDRAFT_03g014750          343   7e-108   Sorghum bicolor [broomcorn]
ref|XP_006643878.1|  PREDICTED: probable serine/threonine-protein...    347   1e-107   
ref|XP_011073123.1|  PREDICTED: probable serine/threonine-protein...    348   1e-107   
ref|XP_008794856.1|  PREDICTED: probable serine/threonine-protein...    348   2e-107   
gb|KHN23956.1|  Putative serine/threonine-protein kinase                345   2e-107   
ref|XP_006650079.1|  PREDICTED: probable serine/threonine-protein...    342   2e-107   
ref|XP_006382713.1|  hypothetical protein POPTR_0005s04700g             348   2e-107   
ref|XP_009624462.1|  PREDICTED: probable serine/threonine-protein...    347   3e-107   
ref|XP_010243586.1|  PREDICTED: probable serine/threonine-protein...    347   3e-107   
emb|CDX83825.1|  BnaC08g18200D                                          351   3e-107   
gb|KDP22563.1|  hypothetical protein JCGZ_26394                         347   3e-107   
gb|KDO42442.1|  hypothetical protein CISIN_1g005582mg                   351   3e-107   
ref|XP_003524475.1|  PREDICTED: probable serine/threonine-protein...    347   3e-107   
ref|XP_007207442.1|  hypothetical protein PRUPE_ppa005135mg             344   4e-107   
ref|XP_010921742.1|  PREDICTED: probable serine/threonine-protein...    347   4e-107   
ref|XP_006431519.1|  hypothetical protein CICLE_v10000479mg             350   4e-107   
ref|XP_011071480.1|  PREDICTED: probable serine/threonine-protein...    347   4e-107   
gb|EYU43892.1|  hypothetical protein MIMGU_mgv1a003944mg                346   4e-107   
ref|XP_011013582.1|  PREDICTED: probable serine/threonine-protein...    347   5e-107   
ref|XP_006470963.1|  PREDICTED: probable serine/threonine-protein...    350   5e-107   
ref|XP_011032535.1|  PREDICTED: probable serine/threonine-protein...    347   5e-107   
ref|XP_008390743.1|  PREDICTED: probable serine/threonine-protein...    347   5e-107   
ref|XP_011012673.1|  PREDICTED: probable serine/threonine-protein...    346   5e-107   
ref|XP_011015566.1|  PREDICTED: probable serine/threonine-protein...    346   5e-107   
ref|XP_009352210.1|  PREDICTED: probable serine/threonine-protein...    347   5e-107   
ref|XP_002312751.2|  hypothetical protein POPTR_0008s20890g             346   6e-107   Populus trichocarpa [western balsam poplar]
ref|XP_008438801.1|  PREDICTED: probable serine/threonine-protein...    346   6e-107   
ref|XP_004289615.1|  PREDICTED: probable serine/threonine-protein...    347   6e-107   
ref|XP_011028375.1|  PREDICTED: probable serine/threonine-protein...    350   7e-107   
ref|XP_004968746.1|  PREDICTED: probable serine/threonine-protein...    346   7e-107   
ref|XP_004968747.1|  PREDICTED: probable serine/threonine-protein...    346   7e-107   
ref|XP_004134185.1|  PREDICTED: probable serine/threonine-protein...    346   9e-107   
gb|EYU43895.1|  hypothetical protein MIMGU_mgv1a003878mg                345   9e-107   
gb|EEE54576.1|  hypothetical protein OsJ_01779                          345   9e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670639.1|  PREDICTED: probable serine/threonine-protein...    346   1e-106   
ref|XP_006855464.1|  hypothetical protein AMTR_s00057p00183920          345   1e-106   
ref|XP_010479840.1|  PREDICTED: probable serine/threonine-protein...    349   1e-106   
gb|AES73013.2|  cyclin-dependent kinase C                               345   1e-106   
gb|KHG15743.1|  hypothetical protein F383_22519                         346   1e-106   
ref|XP_010258219.1|  PREDICTED: probable serine/threonine-protein...    347   1e-106   
ref|XP_006658942.1|  PREDICTED: probable serine/threonine-protein...    342   1e-106   
emb|CDO98674.1|  unnamed protein product                                346   1e-106   
gb|KDP40024.1|  hypothetical protein JCGZ_02022                         345   1e-106   
ref|XP_002322289.2|  hypothetical protein POPTR_0015s11450g             346   1e-106   
gb|ABK93496.1|  unknown                                                 346   1e-106   
ref|NP_192739.2|  protein kinase family protein                         342   1e-106   
ref|XP_003526935.1|  PREDICTED: probable serine/threonine-protein...    345   2e-106   
gb|EEE54064.1|  hypothetical protein OsJ_00765                          347   2e-106   
ref|XP_011090850.1|  PREDICTED: probable serine/threonine-protein...    346   2e-106   
gb|EEC70121.1|  hypothetical protein OsI_00791                          347   2e-106   
ref|XP_003602762.1|  hypothetical protein MTR_3g098760                  345   2e-106   
ref|XP_007154226.1|  hypothetical protein PHAVU_003G100900g             344   2e-106   
ref|NP_001043043.1|  Os01g0367700                                       345   2e-106   
dbj|BAD89473.1|  putative CRK1 protein                                  344   2e-106   
gb|EEC70655.1|  hypothetical protein OsI_01940                          344   3e-106   
dbj|BAG89276.1|  unnamed protein product                                344   3e-106   
gb|KHN36823.1|  Putative serine/threonine-protein kinase                345   3e-106   
ref|XP_002461170.1|  hypothetical protein SORBIDRAFT_02g042260          341   3e-106   
ref|XP_002512278.1|  Serine/threonine-protein kinase cdk9, putative     345   3e-106   
ref|XP_010462163.1|  PREDICTED: probable serine/threonine-protein...    348   3e-106   
emb|CDY25738.1|  BnaC03g69370D                                          347   3e-106   
ref|XP_004159827.1|  PREDICTED: probable serine/threonine-protein...    344   4e-106   
ref|XP_002457168.1|  hypothetical protein SORBIDRAFT_03g002610          348   4e-106   
ref|XP_010105022.1|  putative serine/threonine-protein kinase           344   4e-106   
ref|XP_011071482.1|  PREDICTED: probable serine/threonine-protein...    345   5e-106   
ref|XP_007137880.1|  hypothetical protein PHAVU_009G163500g             343   5e-106   
gb|KHN03005.1|  Putative serine/threonine-protein kinase                343   5e-106   
ref|XP_003540463.1|  PREDICTED: probable serine/threonine-protein...    348   5e-106   
gb|ABF95922.1|  Protein kinase domain containing protein, expressed     338   5e-106   
ref|XP_007038087.1|  Kinase superfamily protein                         344   6e-106   
ref|XP_010535099.1|  PREDICTED: probable serine/threonine-protein...    347   7e-106   
gb|KHN28061.1|  Putative serine/threonine-protein kinase                348   8e-106   
ref|XP_010097359.1|  putative serine/threonine-protein kinase           344   8e-106   
ref|NP_175713.1|  putative serine/threonine protein kinase              347   8e-106   
ref|XP_001784887.1|  predicted protein                                  345   8e-106   
gb|AAO42182.1|  putative cell division-related protein                  347   8e-106   
ref|XP_006385063.1|  hypothetical protein POPTR_0004s23550g             347   9e-106   
ref|XP_010551835.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-depen...    355   9e-106   
ref|XP_008440049.1|  PREDICTED: probable serine/threonine-protein...    343   9e-106   
tpg|DAA52935.1|  TPA: putative protein kinase superfamily protein       347   9e-106   
ref|XP_004298098.1|  PREDICTED: probable serine/threonine-protein...    343   1e-105   
ref|XP_010500934.1|  PREDICTED: probable serine/threonine-protein...    347   1e-105   
ref|XP_003532395.1|  PREDICTED: probable serine/threonine-protein...    343   1e-105   
ref|XP_008791083.1|  PREDICTED: probable serine/threonine-protein...    339   1e-105   
ref|XP_011090852.1|  PREDICTED: probable serine/threonine-protein...    343   1e-105   
gb|KFK35750.1|  hypothetical protein AALP_AA4G031500                    347   1e-105   
ref|XP_009383751.1|  PREDICTED: probable serine/threonine-protein...    343   1e-105   
ref|XP_003528653.1|  PREDICTED: probable serine/threonine-protein...    342   1e-105   
ref|XP_010327074.1|  PREDICTED: probable serine/threonine-protein...    342   1e-105   
ref|XP_008655744.1|  PREDICTED: probable serine/threonine-protein...    347   1e-105   
ref|XP_008218161.1|  PREDICTED: probable serine/threonine-protein...    343   1e-105   
ref|XP_003542916.1|  PREDICTED: probable serine/threonine-protein...    342   1e-105   
gb|KDP23602.1|  hypothetical protein JCGZ_23435                         343   2e-105   
ref|XP_008223102.1|  PREDICTED: probable serine/threonine-protein...    343   2e-105   
ref|XP_007151268.1|  hypothetical protein PHAVU_004G0322001g            337   2e-105   
gb|EYU32922.1|  hypothetical protein MIMGU_mgv1a003828mg                342   2e-105   
ref|XP_002284341.1|  PREDICTED: probable serine/threonine-protein...    343   2e-105   
ref|XP_006836804.1|  hypothetical protein AMTR_s00099p00026630          347   2e-105   
ref|NP_001148044.1|  transposon protein                                 342   2e-105   
gb|KFK32036.1|  hypothetical protein AALP_AA6G191700                    345   2e-105   
ref|NP_001050108.1|  Os03g0349200                                       339   2e-105   
ref|XP_007222466.1|  hypothetical protein PRUPE_ppa003511mg             342   2e-105   
ref|XP_009798347.1|  PREDICTED: probable serine/threonine-protein...    343   2e-105   
emb|CDY02525.1|  BnaA08g01320D                                          345   2e-105   
ref|XP_006489159.1|  PREDICTED: probable serine/threonine-protein...    343   2e-105   
emb|CDX86879.1|  BnaA09g22690D                                          343   2e-105   
ref|XP_003594001.1|  hypothetical protein MTR_2g020210                  341   2e-105   
ref|XP_006419669.1|  hypothetical protein CICLE_v10004618mg             342   3e-105   
gb|EEE67776.1|  hypothetical protein OsJ_25501                          341   3e-105   
dbj|BAC20085.1|  putative CRK1 protein(cdc2-related kinase 1)           342   3e-105   
gb|KDO55459.1|  hypothetical protein CISIN_1g005119mg                   344   3e-105   
ref|XP_009602765.1|  PREDICTED: probable serine/threonine-protein...    342   4e-105   
ref|XP_006303920.1|  hypothetical protein CARUB_v10008475mg             345   4e-105   
ref|XP_008672137.1|  PREDICTED: LOC100193551 isoform X2                 341   4e-105   
ref|XP_009113591.1|  PREDICTED: probable serine/threonine-protein...    343   4e-105   
ref|NP_001132134.1|  LOC100193551                                       341   4e-105   
ref|XP_003562490.1|  PREDICTED: probable serine/threonine-protein...    342   4e-105   
ref|XP_006286675.1|  hypothetical protein CARUB_v10002640mg             344   4e-105   
ref|XP_009144802.1|  PREDICTED: probable serine/threonine-protein...    345   4e-105   
dbj|BAC41787.1|  putative cyclin-dependent protein kinase               342   4e-105   
ref|XP_002276606.1|  PREDICTED: probable serine/threonine-protein...    342   5e-105   
ref|XP_003596750.1|  Serine/threonine protein kinase cdk9               345   5e-105   
ref|NP_199899.1|  protein kinase family protein                         342   5e-105   
ref|XP_009762471.1|  PREDICTED: probable serine/threonine-protein...    340   5e-105   
ref|XP_002318759.2|  hypothetical protein POPTR_0012s10570g             343   5e-105   
ref|XP_010230878.1|  PREDICTED: probable serine/threonine-protein...    340   5e-105   
ref|XP_003567686.1|  PREDICTED: probable serine/threonine-protein...    340   6e-105   
dbj|BAJ91828.1|  predicted protein                                      341   6e-105   
ref|XP_007209085.1|  hypothetical protein PRUPE_ppa003653mg             341   6e-105   
ref|NP_001170286.1|  uncharacterized LOC100384249                       341   7e-105   
ref|XP_006392837.1|  hypothetical protein EUTSA_v10011275mg             345   8e-105   
ref|XP_010421919.1|  PREDICTED: probable serine/threonine-protein...    343   8e-105   
emb|CBI26114.3|  unnamed protein product                                340   8e-105   
ref|XP_006402054.1|  hypothetical protein EUTSA_v10013077mg             341   9e-105   
ref|XP_007035477.1|  Serine/threonine-protein kinase isoform 1          347   9e-105   
ref|XP_008388632.1|  PREDICTED: probable serine/threonine-protein...    341   9e-105   
gb|KEH24542.1|  cyclin-dependent kinase                                 338   9e-105   
ref|XP_008388629.1|  PREDICTED: probable serine/threonine-protein...    341   1e-104   
ref|XP_006348252.1|  PREDICTED: probable serine/threonine-protein...    345   1e-104   
gb|KGN64435.1|  hypothetical protein Csa_1G051730                       339   1e-104   
emb|CDX99520.1|  BnaC09g24720D                                          342   1e-104   
ref|XP_003543242.1|  PREDICTED: probable serine/threonine-protein...    345   1e-104   
tpg|DAA45358.1|  TPA: putative protein kinase superfamily protein       341   1e-104   
emb|CDO97634.1|  unnamed protein product                                345   1e-104   
ref|XP_009123850.1|  PREDICTED: probable serine/threonine-protein...    342   1e-104   
ref|XP_010929623.1|  PREDICTED: probable serine/threonine-protein...    339   1e-104   
ref|XP_004145145.1|  PREDICTED: probable serine/threonine-protein...    340   1e-104   
ref|XP_007147866.1|  hypothetical protein PHAVU_006G161400g             339   1e-104   
ref|XP_011002117.1|  PREDICTED: probable serine/threonine-protein...    340   2e-104   
ref|XP_009757170.1|  PREDICTED: probable serine/threonine-protein...    340   2e-104   
ref|XP_007149459.1|  hypothetical protein PHAVU_005G071900g             344   2e-104   
ref|XP_002865826.1|  kinase family protein                              340   2e-104   
ref|XP_006366910.1|  PREDICTED: probable serine/threonine-protein...    340   2e-104   
emb|CDO98917.1|  unnamed protein product                                339   2e-104   
ref|XP_010674933.1|  PREDICTED: probable serine/threonine-protein...    340   2e-104   
ref|XP_010475800.1|  PREDICTED: probable serine/threonine-protein...    343   2e-104   
ref|XP_008364580.1|  PREDICTED: probable serine/threonine-protein...    340   2e-104   
ref|XP_006433109.1|  hypothetical protein CICLE_v10000698mg             340   2e-104   
dbj|BAJ97237.1|  predicted protein                                      340   3e-104   
emb|CAB39625.1|  putative protein kinase                                342   3e-104   
ref|XP_003546100.1|  PREDICTED: probable serine/threonine-protein...    338   3e-104   
emb|CDY34698.1|  BnaA01g33270D                                          341   3e-104   
ref|XP_009364570.1|  PREDICTED: probable serine/threonine-protein...    340   3e-104   
ref|XP_006645895.1|  PREDICTED: probable serine/threonine-protein...    340   3e-104   
ref|XP_010318321.1|  PREDICTED: probable serine/threonine-protein...    339   4e-104   
emb|CDY50511.1|  BnaC06g10110D                                          343   4e-104   
ref|XP_011003825.1|  PREDICTED: probable serine/threonine-protein...    339   4e-104   
emb|CDY55799.1|  BnaCnng29100D                                          341   4e-104   
gb|AIG20411.1|  kinase family protein                                   341   5e-104   
ref|XP_008799326.1|  PREDICTED: probable serine/threonine-protein...    339   5e-104   
ref|XP_009421283.1|  PREDICTED: probable serine/threonine-protein...    343   5e-104   
ref|XP_004244231.1|  PREDICTED: probable serine/threonine-protein...    343   5e-104   
ref|XP_002533553.1|  Cell division protein kinase, putative             341   5e-104   
ref|XP_008799327.1|  PREDICTED: probable serine/threonine-protein...    339   6e-104   
ref|XP_003626368.1|  Cdc2-like protein kinase                           338   6e-104   
ref|XP_007021485.1|  Kinase superfamily protein                         342   6e-104   
ref|XP_009417044.1|  PREDICTED: probable serine/threonine-protein...    336   6e-104   
gb|KDO55464.1|  hypothetical protein CISIN_1g005119mg                   335   6e-104   
ref|XP_004248172.1|  PREDICTED: probable serine/threonine-protein...    342   7e-104   
ref|XP_010093941.1|  putative serine/threonine-protein kinase           339   7e-104   
ref|XP_006844562.1|  hypothetical protein AMTR_s00016p00189320          339   7e-104   
ref|XP_009757169.1|  PREDICTED: probable serine/threonine-protein...    341   7e-104   
ref|XP_010463587.1|  PREDICTED: uncharacterized protein LOC104744263    351   8e-104   
emb|CDY05828.1|  BnaA10g05920D                                          338   8e-104   
gb|EYU45584.1|  hypothetical protein MIMGU_mgv1a003511mg                338   8e-104   
ref|XP_010678314.1|  PREDICTED: probable serine/threonine-protein...    338   9e-104   
gb|KEH43056.1|  cyclin-dependent kinase                                 338   1e-103   
gb|KDP27060.1|  hypothetical protein JCGZ_20995                         342   1e-103   
ref|XP_009342019.1|  PREDICTED: probable serine/threonine-protein...    338   1e-103   
ref|XP_010555575.1|  PREDICTED: probable serine/threonine-protein...    338   1e-103   
ref|XP_009757166.1|  PREDICTED: probable serine/threonine-protein...    341   1e-103   
ref|XP_009757168.1|  PREDICTED: probable serine/threonine-protein...    341   1e-103   
ref|XP_010437707.1|  PREDICTED: probable serine/threonine-protein...    340   1e-103   
ref|XP_008392719.1|  PREDICTED: probable serine/threonine-protein...    337   1e-103   
emb|CDX91965.1|  BnaC03g32670D                                          349   1e-103   
ref|XP_002319597.2|  hypothetical protein POPTR_0013s03250g             338   1e-103   
ref|XP_011100264.1|  PREDICTED: probable serine/threonine-protein...    341   1e-103   
ref|XP_008226629.1|  PREDICTED: probable serine/threonine-protein...    342   1e-103   
ref|XP_004959874.1|  PREDICTED: probable serine/threonine-protein...    337   1e-103   
ref|XP_004503783.1|  PREDICTED: probable serine/threonine-protein...    337   2e-103   
ref|XP_009622009.1|  PREDICTED: probable serine/threonine-protein...    336   2e-103   
ref|XP_003630554.1|  hypothetical protein MTR_8g099770                  337   2e-103   
gb|EAY89996.1|  hypothetical protein OsI_11562                          337   2e-103   
emb|CDX72813.1|  BnaC06g32610D                                          339   2e-103   
gb|KHF99596.1|  hypothetical protein F383_20049                         338   2e-103   
ref|XP_009622007.1|  PREDICTED: probable serine/threonine-protein...    336   2e-103   
ref|XP_009405424.1|  PREDICTED: probable serine/threonine-protein...    337   2e-103   
ref|XP_006451848.1|  hypothetical protein CICLE_v10007617mg             341   2e-103   
ref|XP_009140887.1|  PREDICTED: probable serine/threonine-protein...    337   2e-103   
ref|XP_010694981.1|  PREDICTED: probable serine/threonine-protein...    342   2e-103   
ref|XP_009611564.1|  PREDICTED: probable serine/threonine-protein...    337   2e-103   
gb|EYU22739.1|  hypothetical protein MIMGU_mgv1a002645mg                339   2e-103   
ref|XP_009762470.1|  PREDICTED: probable serine/threonine-protein...    340   2e-103   
ref|XP_003550528.1|  PREDICTED: probable serine/threonine-protein...    336   2e-103   
ref|XP_004487708.1|  PREDICTED: probable serine/threonine-protein...    341   2e-103   
ref|XP_010024564.1|  PREDICTED: probable serine/threonine-protein...    337   2e-103   
ref|XP_010694982.1|  PREDICTED: probable serine/threonine-protein...    342   2e-103   
ref|XP_004486064.1|  PREDICTED: probable serine/threonine-protein...    336   2e-103   
ref|XP_010490179.1|  PREDICTED: probable serine/threonine-protein...    341   2e-103   
ref|XP_006464753.1|  PREDICTED: probable serine/threonine-protein...    341   3e-103   
ref|XP_003609580.1|  hypothetical protein MTR_4g118780                  336   3e-103   
ref|XP_009762469.1|  PREDICTED: probable serine/threonine-protein...    340   3e-103   
emb|CDP08611.1|  unnamed protein product                                337   3e-103   
ref|XP_006347832.1|  PREDICTED: probable serine/threonine-protein...    337   3e-103   
ref|XP_009385619.1|  PREDICTED: probable serine/threonine-protein...    334   3e-103   
ref|XP_006606492.1|  PREDICTED: probable serine/threonine-protein...    336   3e-103   
gb|KDO62492.1|  hypothetical protein CISIN_1g004999mg                   341   4e-103   
ref|XP_004250837.1|  PREDICTED: probable serine/threonine-protein...    338   4e-103   
ref|XP_009127863.1|  PREDICTED: probable serine/threonine-protein...    339   4e-103   
ref|XP_009337536.1|  PREDICTED: probable serine/threonine-protein...    336   4e-103   
emb|CDX71637.1|  BnaC09g26780D                                          337   4e-103   
ref|XP_003556490.1|  PREDICTED: probable serine/threonine-protein...    337   4e-103   
ref|XP_010252405.1|  PREDICTED: probable serine/threonine-protein...    341   4e-103   
ref|XP_010260205.1|  PREDICTED: probable serine/threonine-protein...    340   5e-103   
ref|XP_010260204.1|  PREDICTED: probable serine/threonine-protein...    340   5e-103   
gb|KHN04043.1|  Putative serine/threonine-protein kinase                336   5e-103   
gb|KCW61690.1|  hypothetical protein EUGRSUZ_H04417                     333   5e-103   
ref|XP_006280224.1|  hypothetical protein CARUB_v10026141mg             337   5e-103   
gb|AIQ82912.1|  cyclin-dependent kinase                                 336   6e-103   
emb|CDY67268.1|  BnaCnng54190D                                          338   6e-103   
gb|EYU44145.1|  hypothetical protein MIMGU_mgv1a0032121mg               331   6e-103   
ref|XP_008386179.1|  PREDICTED: probable serine/threonine-protein...    340   7e-103   
ref|XP_008791729.1|  PREDICTED: probable serine/threonine-protein...    340   7e-103   
ref|XP_008791720.1|  PREDICTED: probable serine/threonine-protein...    340   7e-103   
ref|XP_010455394.1|  PREDICTED: probable serine/threonine-protein...    338   7e-103   
ref|XP_002316895.2|  hypothetical protein POPTR_0011s12010g             338   7e-103   
ref|XP_009411878.1|  PREDICTED: probable serine/threonine-protein...    333   7e-103   
ref|XP_010925563.1|  PREDICTED: probable serine/threonine-protein...    340   7e-103   
gb|KHG22910.1|  hypothetical protein F383_06618                         339   7e-103   
ref|XP_006367646.1|  PREDICTED: probable serine/threonine-protein...    339   7e-103   
ref|XP_009784583.1|  PREDICTED: probable serine/threonine-protein...    340   8e-103   
ref|XP_010417186.1|  PREDICTED: uncharacterized protein LOC104702947    351   8e-103   
ref|XP_009792319.1|  PREDICTED: probable serine/threonine-protein...    338   9e-103   
ref|XP_004300004.1|  PREDICTED: probable serine/threonine-protein...    339   9e-103   
ref|XP_009420482.1|  PREDICTED: probable serine/threonine-protein...    340   9e-103   
ref|XP_004135651.1|  PREDICTED: probable serine/threonine-protein...    335   9e-103   
emb|CDP05922.1|  unnamed protein product                                337   9e-103   
ref|XP_010458252.1|  PREDICTED: probable serine/threonine-protein...    339   1e-102   
ref|XP_009385023.1|  PREDICTED: probable serine/threonine-protein...    336   1e-102   
ref|XP_011037349.1|  PREDICTED: probable serine/threonine-protein...    340   1e-102   
ref|XP_009402529.1|  PREDICTED: probable serine/threonine-protein...    336   1e-102   



>ref|XP_006350168.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=678

 Score =   494 bits (1271),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 356/489 (73%), Gaps = 31/489 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC ++KF+DSQIKC+M+QLLSGLEHCH +GIMHRDIK SN+LVNN
Sbjct  200   YLVFEYMEHDLSGLLSCPDVKFTDSQIKCYMQQLLSGLEHCHSRGIMHRDIKASNVLVNN  259

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWSAGCVFAEL
Sbjct  260   EGILKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTSYGLTVDLWSAGCVFAEL  319

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP LKGRTEVEQLHKIFKLCGSPS+DYW++S+LPLA IFKPQ+ YES LR+RCKELP
Sbjct  320   FFGRPFLKGRTEVEQLHKIFKLCGSPSEDYWKKSRLPLATIFKPQHPYESVLRDRCKELP  379

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+P+KRG ASS+L+S YF+TKPYAC PSS+PK+PPN+EIDAKFREEAR
Sbjct  380   KTAVNLIETLLSIDPHKRGAASSALDSVYFNTKPYACTPSSLPKYPPNKEIDAKFREEAR  439

Query  722   rrkagsavrgsgssrNMRRLRK--------GMAPTEEVEANMLgsrrg-----ngsgsrg  862
             R++A S VR SG+SRN R+++K        G+  TEE EAN+   RR      + S  +G
Sbjct  440   RKRASSTVRASGASRNSRKVQKSLQESRNFGIVSTEEAEANIHNGRRNIGGSGHISKGKG  499

Query  863   ATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh-  1039
             ATVAR+S+KSSYDTVSE ASQT TE SQG+SI SVPAQ  SS +  W K  ++ +A    
Sbjct  500   ATVARISMKSSYDTVSE-ASQT-TEESQGESIRSVPAQTASSGT-AWAKMRKQDSAASRP  556

Query  1040  -afaNSRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIYH  1216
                ANS+S  +        L  +       D  D  +        ++       + D  H
Sbjct  557   HPQANSKSQKLIAFDTSSVLHSA-------DTLDLNMPGNNDFSSRINNEARGCNNDAKH  609

Query  1217  -FSKELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTY-RGHKRQDGQAAQSV  1378
               S++ +  EQ   F S D++ S+E S D +GR     FSGPL + R    QD Q  Q  
Sbjct  610   SISRQYTHHEQRDSFGSSDIHQSQEISEDYNGRQRRVVFSGPLIHQRSDPNQDYQTHQDG  669

Query  1379  RRSRFCRDV  1405
             +RSRF +D+
Sbjct  670   QRSRFYKDL  678



>ref|XP_009597660.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana tomentosiformis]
Length=673

 Score =   491 bits (1263),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 292/487 (60%), Positives = 348/487 (71%), Gaps = 38/487 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+DSQIKC+M+QLLSGLEHCH +GIMHRDIK SN+L+NN
Sbjct  205   YLVFEYMEHDLSGLLSCPDIKFTDSQIKCYMRQLLSGLEHCHSRGIMHRDIKASNVLINN  264

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWSAGCVFAEL
Sbjct  265   EGILKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTNYGLTVDLWSAGCVFAEL  324

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSPSD+YW +SKLPLA IFKPQ+ YESTLR+RCKELP
Sbjct  325   FFGRPLLKGRTEVEQLHKIFKLCGSPSDEYWRKSKLPLATIFKPQHPYESTLRDRCKELP  384

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+P++RGTASS+ +SEYF TKPYACDPSS+PK+PPN+EIDAKFREEAR
Sbjct  385   KTAVNLIETLLSIDPHRRGTASSAHDSEYFSTKPYACDPSSLPKYPPNKEIDAKFREEAR  444

Query  722   rrkagsavrgsgssrNMRRLRKG---------MAPTEEVEANMLgsrrgn-----gsgsr  859
             R+K  S V+ SG+SR+ R ++K          M  TEE EAN+   RR N      S  +
Sbjct  445   RKKTSSTVKASGASRDSRNVQKALQKSSNFGIMVSTEEAEANIHNGRRNNGGSGPISKGK  504

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh  1039
             GATVAR+S+K SYDTVSEA+  T    SQG+SI SVPAQM +SS   W KK ++ +A   
Sbjct  505   GATVARISMKPSYDTVSEASQTTGD--SQGESIRSVPAQMTASSGVTWAKKRKQDSAATR  562

Query  1040  --afaNSRSITMNGGVEPPTLQQSKDDPLGL-DEQDGGLAIRPKSMKQVEQPLSFHSPDI  1210
                  NSRS  +        L  +    L + D  D    I  ++          H+ D 
Sbjct  563   PHPQDNSRSQKLIAFDLSNVLHAADTSDLNMQDSYDFSSRINTEARG--------HNNDA  614

Query  1211  YH-FSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLT-YRGHKRQDGQAAQSVRR  1384
              H   ++ + E Q    LS D Y+ +++ V       SGPL   R   + D Q  Q  RR
Sbjct  615   THSIGRQYTHESQE---LSED-YNGKQKRV-----GLSGPLIQQRSDAKHDNQTRQDCRR  665

Query  1385  SRFCRDV  1405
             SRF RD+
Sbjct  666   SRFYRDL  672



>ref|XP_004232198.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=657

 Score =   489 bits (1258),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 293/492 (60%), Positives = 352/492 (72%), Gaps = 49/492 (10%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKFSDSQIKC+M+QLLSGLEHCH +GIMHRDIKVSNILVNN
Sbjct  191   YLVFEYMEHDLSGLLSCPDIKFSDSQIKCYMQQLLSGLEHCHSRGIMHRDIKVSNILVNN  250

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG LKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWS GCVFAEL
Sbjct  251   EGTLKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTSYGVTVDLWSVGCVFAEL  310

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSP +DYW++SKLPLA +FKP+  Y+STLR+RCKELP
Sbjct  311   FFGRPLLKGRTEVEQLHKIFKLCGSPPEDYWKRSKLPLATMFKPKQPYDSTLRDRCKELP  370

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV+LIETL+SI+P+KRGTASS+LNSEYF+TKPYACD SS+PK+PPN+EIDAKFREEAR
Sbjct  371   KSAVNLIETLISIDPHKRGTASSALNSEYFNTKPYACDSSSLPKYPPNKEIDAKFREEAR  430

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgs-----rrgngsgsr  859
             R++A S V+ S +S+N R+ RKG+          PTEEVEAN+ GS          S  R
Sbjct  431   RKRASSTVQTSETSKNSRKSRKGLQEPNNFCKVVPTEEVEANVHGSHRNYGSNAQISKGR  490

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDS-ICSVPAQMISSSSYGWPkkheraaarf  1036
              ATV+R+S+K  YDTVS+AASQ  T+ SQGDS + SVP QM  SS + W KK ++ +A  
Sbjct  491   RATVSRISMKPLYDTVSDAASQM-TDESQGDSTVLSVPVQMPESSGFAWAKKGKQDSAVT  549

Query  1037  haf--aNSRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDI  1210
               +   NSRS  ++   +P  +  S  D L    QD    +R             H    
Sbjct  550   RLYPPPNSRSQKLS-AFDPSAVLHS-GDTLESKMQDNDEFLRRTQ----------HRKHG  597

Query  1211  YHFSKELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTYRGH---KRQDGQAA  1369
             +H        E+P  F   D    +EQS + DG+     FSGPL  +      ++D Q  
Sbjct  598   HH--------ERPDSFDLSD----QEQSAEFDGQQGRVGFSGPLLSQSQTFDSKKDSQTR  645

Query  1370  QSVRRSRFCRDV  1405
             ++ RRSRF  D+
Sbjct  646   KAGRRSRFYGDI  657



>ref|XP_009768103.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
Length=671

 Score =   489 bits (1259),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 355/496 (72%), Gaps = 56/496 (11%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+D QIKC+M+QLLSGLEHCH +GIMHRDIK SN+L+NN
Sbjct  204   YLVFEYMEHDLSGLLSCPDIKFTDLQIKCYMRQLLSGLEHCHSRGIMHRDIKTSNVLINN  263

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWSAGCVFAEL
Sbjct  264   EGILKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTNYGLTVDLWSAGCVFAEL  323

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSPSD+YW +SKLPLA IFKPQ+ YESTLR+RCKELP
Sbjct  324   FFGRPLLKGRTEVEQLHKIFKLCGSPSDEYWRKSKLPLATIFKPQHPYESTLRDRCKELP  383

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIE LLSI+P++RGTASS+++SEYF+TKPYACDPSS+PK+PPN+EIDAKFREEAR
Sbjct  384   KTAVNLIEKLLSIDPHRRGTASSAIDSEYFNTKPYACDPSSLPKYPPNKEIDAKFREEAR  443

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsrrgn-----gsgsr  859
             R+KA S ++ SG+SR+ R+++K +         A TEE E N+   RR N      S  +
Sbjct  444   RKKASSTMKASGASRDSRKVQKDLQKSSNFGIVASTEESEVNIHNGRRNNGDSGHISKGK  503

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh  1039
             GATVAR+S+K SYDTVSE  SQT TE SQG+SI SVPAQM +SS   W KK ++ +A   
Sbjct  504   GATVARISMKPSYDTVSE-VSQT-TEESQGESIRSVPAQMAASSGVTWAKKRKQDSAATR  561

Query  1040  --afaNSRS----------ITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQ  1183
                 ANSRS          +          +Q S D    ++ +D G             
Sbjct  562   PHPQANSRSQKLIAFDLSNVLHAADTSDLNMQGSYDFSSRINTEDRG-------------  608

Query  1184  PLSFHSPDIYH-FSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLT-YRGHKRQD  1357
                 H+ D  H   ++ + E Q    LS D Y+ +++ V      FSGPL   R   ++D
Sbjct  609   ----HNNDATHSIGRQYTHESQE---LSED-YNDKQRRV-----GFSGPLIQQRSDAKRD  655

Query  1358  GQAAQSVRRSRFCRDV  1405
              Q  Q  RRSRF RD+
Sbjct  656   NQTRQDGRRSRFYRDL  671



>ref|XP_009625284.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=668

 Score =   488 bits (1257),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 286/488 (59%), Positives = 354/488 (73%), Gaps = 39/488 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+DSQIKC+M+QLLSGLEHCH +GIMHRDIKVSNILVNN
Sbjct  200   YLVFEYMEHDLSGLLSCPDIKFTDSQIKCYMQQLLSGLEHCHSRGIMHRDIKVSNILVNN  259

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+S+R KQP+TSRVVTLWYRPPELLLG+T YG TVDLWS GCVFAEL
Sbjct  260   EGILKIADFGLANFLSSRHKQPLTSRVVTLWYRPPELLLGSTNYGVTVDLWSVGCVFAEL  319

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCG+P DDYW++SKLPLA +FKP+  Y+STLR+RCKELP
Sbjct  320   FFGRPLLKGRTEVEQLHKIFKLCGTPPDDYWKKSKLPLATMFKPKQPYDSTLRDRCKELP  379

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+PYKRGTASS+LNSEYF+TKPYACDPSS+PK+PPN+EIDAKFREEAR
Sbjct  380   KTAVNLIETLLSIDPYKRGTASSALNSEYFNTKPYACDPSSLPKYPPNKEIDAKFREEAR  439

Query  722   rrkagsavrgsgssrNMRRLRK------GMAPTEEVEANMLgsr-----rgngsgsrgAT  868
             R++A S  + S +SR  R+  +       + P+EEVEAN+ GSR       + S  R AT
Sbjct  440   RKRASSTAQASETSRKSRKALQEPSSFCKVVPSEEVEANVHGSRRNHGGSVHISKGRRAT  499

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDS-ICSVPAQMISSSSYGWPkkheraaarfhaf  1045
             ++R+S+K  YDTVSE +    T+ SQGDS I SVP QM  SS + W K+ ++ +A    +
Sbjct  500   ISRISMKPLYDTVSEVSQM--TDESQGDSTILSVPVQMPESSGFAWAKRGKQDSATTRLY  557

Query  1046  aNSRSITMNGGVEPPTLQQSKDDPLGLDEQDG-GLAIRPKSMKQVEQPLSFHSPDIYHFS  1222
               + S +       P+     +D    + QD   L  R  ++K      S H        
Sbjct  558   PPANSTSQKLSTVDPSGVLHAEDTWDSNMQDNYELLSRAHTVKH-----SIH--------  604

Query  1223  KELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTYRGHK---RQDGQAAQSVR  1381
             ++  + E+   F S D    +E SVD +G+    A+SGPL Y+  K   +QD Q+ ++  
Sbjct  605   RQHGLHERSDSFDSSD----QEPSVDYNGQQGRVAYSGPLLYQSQKFDTKQDSQSRKAGH  660

Query  1382  RSRFCRDV  1405
             RSRF RD+
Sbjct  661   RSRFYRDL  668



>ref|XP_009597721.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana tomentosiformis]
Length=669

 Score =   487 bits (1253),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 289/483 (60%), Positives = 347/483 (72%), Gaps = 34/483 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+DSQIKC+M+QLLSGLEHCH +GIMHRDIK SN+L+NN
Sbjct  205   YLVFEYMEHDLSGLLSCPDIKFTDSQIKCYMRQLLSGLEHCHSRGIMHRDIKASNVLINN  264

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWSAGCVFAEL
Sbjct  265   EGILKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTNYGLTVDLWSAGCVFAEL  324

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSPSD+YW +SKLPLA IFKPQ+ YESTLR+RCKELP
Sbjct  325   FFGRPLLKGRTEVEQLHKIFKLCGSPSDEYWRKSKLPLATIFKPQHPYESTLRDRCKELP  384

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+P++RGTASS+ +SEYF TKPYACDPSS+PK+PPN+EIDAKFREEAR
Sbjct  385   KTAVNLIETLLSIDPHRRGTASSAHDSEYFSTKPYACDPSSLPKYPPNKEIDAKFREEAR  444

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTE-----EVEANMLgsrrgn-----gsgsrgATV  871
             R+K  S V+ SG+SR+ R ++K +  +      E EAN+   RR N      S  +GATV
Sbjct  445   RKKTSSTVKASGASRDSRNVQKALQKSSNFGIMEAEANIHNGRRNNGGSGPISKGKGATV  504

Query  872   ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh--af  1045
             AR+S+K SYDTVSEA+  T    SQG+SI SVPAQM +SS   W KK ++ +A       
Sbjct  505   ARISMKPSYDTVSEASQTTGD--SQGESIRSVPAQMTASSGVTWAKKRKQDSAATRPHPQ  562

Query  1046  aNSRSITMNGGVEPPTLQQSKDDPLGL-DEQDGGLAIRPKSMKQVEQPLSFHSPDIYH-F  1219
              NSRS  +        L  +    L + D  D    I  ++          H+ D  H  
Sbjct  563   DNSRSQKLIAFDLSNVLHAADTSDLNMQDSYDFSSRINTEARG--------HNNDATHSI  614

Query  1220  SKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLT-YRGHKRQDGQAAQSVRRSRFC  1396
              ++ + E Q    LS D Y+ +++ V       SGPL   R   + D Q  Q  RRSRF 
Sbjct  615   GRQYTHESQE---LSED-YNGKQKRV-----GLSGPLIQQRSDAKHDNQTRQDCRRSRFY  665

Query  1397  RDV  1405
             RD+
Sbjct  666   RDL  668



>ref|XP_006338417.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=663

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 293/492 (60%), Positives = 353/492 (72%), Gaps = 43/492 (9%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKFSDSQIKC+M+QLL GLEHCH +GIMHRDIKVSNILVNN
Sbjct  191   YLVFEYMEHDLSGLLSCPDIKFSDSQIKCYMQQLLRGLEHCHSRGIMHRDIKVSNILVNN  250

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG LKI DFGLANF++AR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWS GCVFAEL
Sbjct  251   EGTLKIADFGLANFLNARHKQPLTSRVVTLWYRPPELLLGSTSYGVTVDLWSVGCVFAEL  310

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSP +DYW++SKLPLA +FKP+  Y+STLR+RCKELP
Sbjct  311   FFGRPLLKGRTEVEQLHKIFKLCGSPPEDYWKRSKLPLATMFKPKQPYDSTLRDRCKELP  370

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETL+SI+P+KRGTASS+LNSEYF+TKPYACD SS+PK+PPN+EIDAKFREEAR
Sbjct  371   KTAVNLIETLISIDPHKRGTASSALNSEYFNTKPYACDSSSLPKYPPNKEIDAKFREEAR  430

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgs-----rrgngsgsr  859
             R++A S V+ S +SRN R+ RKG+          P EEVEAN+ GS        + S  R
Sbjct  431   RKRASSTVQTSETSRNSRKARKGLQEPSNFCKVVPAEEVEANVHGSHRNYGSNAHISKGR  490

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDS-ICSVPAQMISSSSYGWPkkheraaarf  1036
              ATV+R+S+K  YDTVS+AASQ  T+ SQGDS + SVP QM  SS + W KK ++ +A  
Sbjct  491   RATVSRISMKPLYDTVSDAASQM-TDESQGDSTVLSVPVQMPESSGFAWAKKGKKGSAAT  549

Query  1037  haf--aNSRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDI  1210
               +   NSRS  ++   +P  +  S  D L  + QD    +R     Q     S H    
Sbjct  550   RLYPPPNSRSQKLS-AFDPSGVLHS-GDTLESNMQDNDEFLRRTHTFQ----HSIHRKHG  603

Query  1211  YHFSKELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTYRGHK---RQDGQAA  1369
             +H       E Q    LS      +E S D DG+     FSGPL  +      ++D QA 
Sbjct  604   HH-------ERQDSFDLS-----DQELSADYDGQQGRVGFSGPLLSQSQTFDPKKDSQAR  651

Query  1370  QSVRRSRFCRDV  1405
             ++ RRSRF  D+
Sbjct  652   KAGRRSRFYGDL  663



>ref|XP_009768104.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana sylvestris]
Length=653

 Score =   480 bits (1236),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 290/487 (60%), Positives = 348/487 (71%), Gaps = 56/487 (11%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+D QIKC+M+QLLSGLEHCH +GIMHRDIK SN+L+NN
Sbjct  204   YLVFEYMEHDLSGLLSCPDIKFTDLQIKCYMRQLLSGLEHCHSRGIMHRDIKTSNVLINN  263

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+SAR KQP+TSRVVTLWYRPPELLLG+T YG TVDLWSAGCVFAEL
Sbjct  264   EGILKIADFGLANFLSARHKQPLTSRVVTLWYRPPELLLGSTNYGLTVDLWSAGCVFAEL  323

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCGSPSD+YW +SKLPLA IFKPQ+ YESTLR+RCKELP
Sbjct  324   FFGRPLLKGRTEVEQLHKIFKLCGSPSDEYWRKSKLPLATIFKPQHPYESTLRDRCKELP  383

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIE LLSI+P++RGTASS+++SEYF+TKPYACDPSS+PK+PPN+EIDAKFREEAR
Sbjct  384   KTAVNLIEKLLSIDPHRRGTASSAIDSEYFNTKPYACDPSSLPKYPPNKEIDAKFREEAR  443

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgn-----gsgsrgATVARMSL  886
             R+KA S ++ SG+SR+ R+         E E N+   RR N      S  +GATVAR+S+
Sbjct  444   RKKASSTMKASGASRDSRK---------ESEVNIHNGRRNNGDSGHISKGKGATVARISM  494

Query  887   KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh--afaNSRS  1060
             K SYDTVSE  SQT TE SQG+SI SVPAQM +SS   W KK ++ +A       ANSRS
Sbjct  495   KPSYDTVSE-VSQT-TEESQGESIRSVPAQMAASSGVTWAKKRKQDSAATRPHPQANSRS  552

Query  1061  ----------ITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDI  1210
                       +          +Q S D    ++ +D G                 H+ D 
Sbjct  553   QKLIAFDLSNVLHAADTSDLNMQGSYDFSSRINTEDRG-----------------HNNDA  595

Query  1211  YH-FSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLT-YRGHKRQDGQAAQSVRR  1384
              H   ++ + E Q    LS D Y+ +++ V      FSGPL   R   ++D Q  Q  RR
Sbjct  596   THSIGRQYTHESQE---LSED-YNDKQRRV-----GFSGPLIQQRSDAKRDNQTRQDGRR  646

Query  1385  SRFCRDV  1405
             SRF RD+
Sbjct  647   SRFYRDL  653



>ref|XP_009768588.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana sylvestris]
Length=668

 Score =   480 bits (1235),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 348/488 (71%), Gaps = 39/488 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+DSQIKC+M+QLLSGLEHCH +GIMHRDIKVSNILVNN
Sbjct  200   YLVFEYMEHDLSGLLSCPDIKFTDSQIKCYMQQLLSGLEHCHSRGIMHRDIKVSNILVNN  259

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+S+R KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  260   EGILKIADFGLANFLSSRHKQPLTSRVVTLWYRPPELLLGSTNYGVSVDLWSVGCVFAEL  319

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCG+P DDYW++SKLPLA +FKP+  YESTLR+RCKELP
Sbjct  320   FFGRPLLKGRTEVEQLHKIFKLCGTPPDDYWKKSKLPLATMFKPKQPYESTLRDRCKELP  379

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+PYKRGTASS+LNSEYF+TKPYACD SS+PK+PPN+EIDAKFREEAR
Sbjct  380   KTAVNLIETLLSIDPYKRGTASSALNSEYFNTKPYACDSSSLPKYPPNKEIDAKFREEAR  439

Query  722   rrkagsavrgsgssrNMRRLRK------GMAPTEEVEANMLgsr-----rgngsgsrgAT  868
             R++A S  + S +SR  R+  +       + P+EEVEAN+ GSR       + S  R AT
Sbjct  440   RKRASSNAQASETSRKSRKALQEPSSFCKVVPSEEVEANVHGSRRNHGGSVHISKGRRAT  499

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDS-ICSVPAQMISSSSYGWPkkheraaarfhaf  1045
             V+R+S+K  YDTVSEA+    T+ SQGDS I SVP QM  SS + W KK +  ++    +
Sbjct  500   VSRISMKPLYDTVSEASQM--TDESQGDSTILSVPVQMPESSGFAWAKKGKLDSSTTRLY  557

Query  1046  aNSRSITMNGGVEPPTLQQSKDDPLGLDEQDG-GLAIRPKSMKQVEQPLSFHSPDIYHFS  1222
               + S +       P+     +D    + QD   L  R  + K      S H    +H  
Sbjct  558   PPANSTSQKLSAVDPSGVLHTEDTWDSNMQDNYELLNRAHTFKH-----SIHRQHGHH--  610

Query  1223  KELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTYRGHK---RQDGQAAQSVR  1381
                   E+   F S D    +E SVD  G+    A SGPL  +  K   +QD Q+ ++  
Sbjct  611   ------ERSDSFDSSD----QEPSVDYTGQQGRVACSGPLLCQSQKFDTKQDSQSRKAGH  660

Query  1382  RSRFCRDV  1405
             RSRF RD+
Sbjct  661   RSRFYRDL  668



>ref|XP_009768582.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
Length=669

 Score =   477 bits (1227),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 286/486 (59%), Positives = 346/486 (71%), Gaps = 39/486 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLSC +IKF+DSQIKC+M+QLLSGLEHCH +GIMHRDIKVSNILVNN
Sbjct  200   YLVFEYMEHDLSGLLSCPDIKFTDSQIKCYMQQLLSGLEHCHSRGIMHRDIKVSNILVNN  259

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+S+R KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  260   EGILKIADFGLANFLSSRHKQPLTSRVVTLWYRPPELLLGSTNYGVSVDLWSVGCVFAEL  319

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             FFGRP+LKGRTEVEQLHKIFKLCG+P DDYW++SKLPLA +FKP+  YESTLR+RCKELP
Sbjct  320   FFGRPLLKGRTEVEQLHKIFKLCGTPPDDYWKKSKLPLATMFKPKQPYESTLRDRCKELP  379

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV+LIETLLSI+PYKRGTASS+LNSEYF+TKPYACD SS+PK+PPN+EIDAKFREEAR
Sbjct  380   KTAVNLIETLLSIDPYKRGTASSALNSEYFNTKPYACDSSSLPKYPPNKEIDAKFREEAR  439

Query  722   rrkagsavrgsgssrNMRRLRK------GMAPTEEVEANMLgsr-----rgngsgsrgAT  868
             R++A S  + S +SR  R+  +       + P+EEVEAN+ GSR       + S  R AT
Sbjct  440   RKRASSNAQASETSRKSRKALQEPSSFCKVVPSEEVEANVHGSRRNHGGSVHISKGRRAT  499

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDS-ICSVPAQMISSSSYGWPkkheraaarfhaf  1045
             V+R+S+K  YDTVSEA+    T+ SQGDS I SVP QM  SS + W KK +  ++    +
Sbjct  500   VSRISMKPLYDTVSEASQM--TDESQGDSTILSVPVQMPESSGFAWAKKGKLDSSTTRLY  557

Query  1046  aNSRSITMNGGVEPPTLQQSKDDPLGLDEQDG-GLAIRPKSMKQVEQPLSFHSPDIYHFS  1222
               + S +       P+     +D    + QD   L  R  + K      S H    +H  
Sbjct  558   PPANSTSQKLSAVDPSGVLHTEDTWDSNMQDNYELLNRAHTFKH-----SIHRQHGHH--  610

Query  1223  KELSVEEQPPPFLSPDLYHSREQSVDSDGR----AFSGPLTYRGHK---RQDGQAAQSVR  1381
                   E+   F S D    +E SVD  G+    A SGPL  +  K   +QD Q+ ++  
Sbjct  611   ------ERSDSFDSSD----QEPSVDYTGQQGRVACSGPLLCQSQKFDTKQDSQSRKAGH  660

Query  1382  RSRFCR  1399
             RSRF R
Sbjct  661   RSRFYR  666



>emb|CDP02267.1| unnamed protein product [Coffea canephora]
Length=694

 Score =   475 bits (1223),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 289/497 (58%), Positives = 342/497 (69%), Gaps = 58/497 (12%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQ-IKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVN  178
             YLVFEYMEHDLSGLLSC  IKF++SQ IKC+M+QL+SG+EHCH +GIMHRDIK SNILVN
Sbjct  221   YLVFEYMEHDLSGLLSCPGIKFTESQQIKCYMRQLVSGVEHCHSRGIMHRDIKASNILVN  280

Query  179   NEGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             NEGILKI DFGLANF+SAR+KQP+TSRVVTLWYRPPELLLG+T YG TVDLWS GCVFAE
Sbjct  281   NEGILKIADFGLANFLSARNKQPLTSRVVTLWYRPPELLLGSTNYGLTVDLWSLGCVFAE  340

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             LF GRP+LKGRTEVEQLHKIFKLCGSP D+YW+QSKLPLA +FKPQ+ YESTLRERCKE 
Sbjct  341   LFIGRPLLKGRTEVEQLHKIFKLCGSPPDEYWKQSKLPLATMFKPQHPYESTLRERCKEF  400

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
             PK+AV+LIETLLS++P KRGTAS++L SEYF+TKPYACDPSSMPK+PPN+EIDAKFREEA
Sbjct  401   PKTAVNLIETLLSMDPQKRGTASAALESEYFNTKPYACDPSSMPKYPPNKEIDAKFREEA  460

Query  719   rrrkagsavrgsgssrNMRRLRKG---------MAPTEEVE-ANMLgsrrgngsgsrgAT  868
             +R+K GS VR SG+SRN RR RK          + PTEEV+       R  + S  +GAT
Sbjct  461   KRKKVGSTVRASGASRNTRRGRKSAQEPNNFFKVVPTEEVDPITQATRRNNSSSKGKGAT  520

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafa  1048
             V+ MSLK S DTVSEA+    TE S  DSI SVP +M +SS++ W K+ ++ A       
Sbjct  521   VSWMSLKPS-DTVSEASQM--TEESHDDSIRSVPIEMPASSNFAWAKRRKQDA-------  570

Query  1049  NSRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIYHFSKE  1228
              SR I  N  +           P   D           S+ QVE        +   FS  
Sbjct  571   -SRKIYGNANMR-------TQKPSAFDHS---------SVLQVEAIFESEEQEYDDFSSR  613

Query  1229  LSVEE--------------QPPPFLSPDLYHSREQSVDSD---GRAFSGPLTYRGH---K  1348
                +E              +   F S D+Y ++E  +D +   GR  SGPLTY+ H    
Sbjct  614   AGADEIAKRAMQKQRMRPHRLDSFESSDMYENQELQMDYNSQQGRVKSGPLTYQPHGIEA  673

Query  1349  RQDGQAAQSVRRSRFCR  1399
             RQD Q    +RRSRF R
Sbjct  674   RQDSQIHHPIRRSRFSR  690



>ref|XP_011098677.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=690

 Score =   461 bits (1185),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 272/499 (55%), Positives = 329/499 (66%), Gaps = 53/499 (11%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVF+YMEHDL+GLLSC +IKF+DSQIKC+M+QLLS +EHCH +GIMHRDIK SNILVNN
Sbjct  213   YLVFDYMEHDLAGLLSCPDIKFTDSQIKCYMQQLLSAVEHCHSRGIMHRDIKSSNILVNN  272

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF   ++KQP+TSRVVTLWYRPPELLLG+T Y E+VDLWS GCVFAEL
Sbjct  273   EGILKIADFGLANFTRPKNKQPLTSRVVTLWYRPPELLLGSTNYAESVDLWSVGCVFAEL  332

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F GRP+LK RTEVEQLHKIFKLCGSP DDYW++SKLPLAA+FKPQ  YESTLRERCKE P
Sbjct  333   FMGRPLLKARTEVEQLHKIFKLCGSPPDDYWKRSKLPLAAMFKPQQPYESTLRERCKEFP  392

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIET LS+EP+KRGTA+S+L SEYF TKPYACDPSS+PK+PPN+EIDAK RE+A+
Sbjct  393   KSAVSLIETFLSVEPHKRGTAASALESEYFTTKPYACDPSSLPKYPPNKEIDAKIREDAK  452

Query  722   rrkagsavrgsgssrNMRRLRKGMA---------PTEEVE----ANMLgsrrgngsgsrg  862
             R+K+ +  R  G  RN RR RK +          P EEV+    A        N    +G
Sbjct  453   RKKSSAITRAEGGPRNPRRARKTLQESTDFCKVIPAEEVDNAQVARRNHGVSTNAYRKKG  512

Query  863   ATVARMSLKSSYDTVSEAA--SQTATEVSQGDSICSVPAQMISSSSYGW------Pkkhe  1018
                 R SLK SYDT S+A+  SQT T+VSQG SI S+PAQ+ +S+S+ W      P    
Sbjct  513   GVETRTSLKPSYDTKSDASQGSQT-TQVSQGTSIHSLPAQVTTSNSFAWAKRRKQPDVFT  571

Query  1019  raaarfhafaNSRSITMNGGVEPPTLQQSKD--DPLGLDEQD-------GGLAIRP--KS  1165
             R  ++    +N +SI +    EP  +    D  +P G    D          A RP  + 
Sbjct  572   RLHSQPTQSSNQKSIAL----EPSNILHVHDTLEPDGQQNHDYSGRISGAETARRPTRRE  627

Query  1166  MKQVEQPLSFHSPDIYHFSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLTYRGH  1345
               Q+ +P SF S DIY            P  L  D  + ++  V      +SG LT +  
Sbjct  628   QAQLRRPESFDSSDIYE-----------PQELPEDYGNKKKCRV-----GYSGTLTSQEI  671

Query  1346  KRQDGQAAQSVRRSRFCRD  1402
               +     + V RSRF  D
Sbjct  672   AARQHDLPRQVHRSRFYID  690



>ref|XP_011085705.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=691

 Score =   458 bits (1178),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 269/501 (54%), Positives = 323/501 (64%), Gaps = 53/501 (11%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GLLSC +IKF+DSQIKC+M+QLLSG+EHCH +GI+HRDIK SNILVNN
Sbjct  209   YLVFEYMEHDLAGLLSCPDIKFTDSQIKCYMRQLLSGVEHCHSRGILHRDIKTSNILVNN  268

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF+  ++KQP+TSRVVTLWYRPPELLLG+T YGE VDLWS GCVFAEL
Sbjct  269   EGILKIADFGLANFLKTKNKQPLTSRVVTLWYRPPELLLGSTSYGEAVDLWSVGCVFAEL  328

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F GRPILKGRTEVEQLHKIFKLCGSP +DYW++SKLPLA +FKPQ+ YESTLRERCKE P
Sbjct  329   FIGRPILKGRTEVEQLHKIFKLCGSPPEDYWKRSKLPLANMFKPQHPYESTLRERCKEFP  388

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIET LSIEPY RGTA+S+L+S+YF TKP+ACDP+S+PK+PPN+EID     E  
Sbjct  389   KSAVSLIETFLSIEPYNRGTAASALDSKYFTTKPFACDPASLPKYPPNKEID-AKYREEA  447

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsr-----rgngsgsr  859
             RRK  SA +  G SRN RR+RK +          P EE E   L SR       N    R
Sbjct  448   RRKRTSAAQTQGGSRNPRRVRKTLQESTDFFKVVPKEEAEGKQLVSRRSHGGSTNAYRRR  507

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDSIC---SVPAQMISSSSYGWPkkheraaa  1030
                 +R SLK SYDTVSEA+    T+ SQG  +    SVP +   S+   W K+  +  A
Sbjct  508   SGLASRTSLKQSYDTVSEASQ--LTQESQGSLVSTTRSVPVEASESNGSAWAKRQMQREA  565

Query  1031  rfhaf--aNSRSITMNGGVEPPTL----QQSKDDPLGLDEQDGGL--------AIRPKSM  1168
                      SR    N  +EPP +    + S  D   +D+  GG+         +R ++ 
Sbjct  566   YTRLHGPHTSRGQKYN-ALEPPNVLHATESSDSDEHEVDDPSGGVQRNQAPKRTVRWEAD  624

Query  1169  KQVEQPLSFHSPDIYHFSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLTYRGHK  1348
             +  E   SFH  D+Y          +P      DLY             FSGPL Y+  +
Sbjct  625   RVHEPDDSFHLSDVY----------EP-----HDLYMDNGNKKKKGRVVFSGPLIYQSQE  669

Query  1349  RQDGQ---AAQSVRRSRFCRD  1402
                GQ     Q + RSRF +D
Sbjct  670   STSGQHDEHRQPLNRSRFAKD  690



>ref|XP_007032627.1| ATP binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY03553.1| ATP binding protein, putative isoform 1 [Theobroma cacao]
Length=700

 Score =   421 bits (1081),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 251/505 (50%), Positives = 324/505 (64%), Gaps = 46/505 (9%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL SC +IKFS++Q+KC+MKQLLSGLEHCH++GIMHRDIK SNILVNN
Sbjct  203   YLVFEYMEHDLAGLSSCPDIKFSEAQVKCYMKQLLSGLEHCHLRGIMHRDIKASNILVNN  262

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+GDFGLAN +++R++Q +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAEL
Sbjct  263   EGVLKLGDFGLANILTSRNRQQLTSRVVTLWYRPPELLMGSTSYDVSVDLWSVGCVFAEL  322

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PILKGRTEVEQLHKIFKLCGSP DDYW++++LP + +FKPQ+ YES LRERCK++P
Sbjct  323   LMGKPILKGRTEVEQLHKIFKLCGSPPDDYWKKTRLPHSTMFKPQHPYESCLRERCKDIP  382

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              SA++L+E LLS+EP+KRGTASSSL SEYFHTKPYACDPSS+PK+ PN+EIDAK R+E R
Sbjct  383   ASAMNLLEALLSVEPHKRGTASSSLMSEYFHTKPYACDPSSLPKYSPNKEIDAKQRDELR  442

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVE-----ANMLgsrrgngsgsr  859
             R+KAGS  R SG S+  RR RK +         AP EE+      A+       N    R
Sbjct  443   RKKAGSRTRESGVSKKTRRSRKALQEPNNFSKTAPKEELRDDTQFASKNHGLTANNLKGR  502

Query  860   gATVARMSLKSS-YDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaa--  1030
                  +  L SS +DT SE +    T VSQGD I + P  +  SSS+ W K+ +  +   
Sbjct  503   EGAAHKGQLNSSFFDTRSETSQ--VTTVSQGD-IFTAPPPVTGSSSFSWAKRKDSTSTLS  559

Query  1031  -------rfhafaNSRSITMNGGVEPPTLQQSKDDPLGL-------DEQDGGLAIRPKSM  1168
                       + A+S S T +      T ++++D P G+        +Q  GL       
Sbjct  560   YNQPSSISQLSDADSSSFTFSNSAFKLTKEETQDVPQGVYDYWREQKQQQNGLNRHGFFY  619

Query  1169  KQVEQPLS-FHSPDIYHFSKELSVEEQPPPFLSPDLYHSREQSVDSDGRAFSGPLTYRGH  1345
                +Q  S F   D++H S      +    F      ++    +D     +SGPL    +
Sbjct  620   VNDQQVQSKFDRSDVFHASDVPQSHDYSMAFHQETAINNDMVKID-----YSGPLVTESY  674

Query  1346  ------KRQDGQAAQSVRRSRFCRD  1402
                   +R +    Q  RRSRF R+
Sbjct  675   NVDELLQRNESHIRQVARRSRFHRE  699



>gb|EYU34634.1| hypothetical protein MIMGU_mgv1a018397mg [Erythranthe guttata]
Length=466

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLLSC +IKF+DSQIKC+M+QLL GLEHCH +GI+HRDIK SNILVNN
Sbjct  225  YLVFEYMEHDLAGLLSCPDIKFTDSQIKCYMRQLLCGLEHCHSRGILHRDIKTSNILVNN  284

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF+  +++QP+TSRVVTLWYRPPELL+G+T YGE VDLWS GCVFAEL
Sbjct  285  EGVLKIADFGLANFMRPKNRQPLTSRVVTLWYRPPELLMGSTNYGEAVDLWSVGCVFAEL  344

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRP+ KGRTEVEQLHKIFKLCGSP++DYW+ ++LPLA +FKPQ  YESTLRERCKELP
Sbjct  345  FIGRPLFKGRTEVEQLHKIFKLCGSPAEDYWQVTRLPLANMFKPQQPYESTLRERCKELP  404

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KSAV+LIET LSIEPY RGTASS+L+S+YF TKPYACDP+S+PK+PPN+EID
Sbjct  405  KSAVNLIETFLSIEPYMRGTASSALDSKYFTTKPYACDPASLPKYPPNKEID  456



>ref|XP_008230818.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=710

 Score =   414 bits (1064),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 266/345 (77%), Gaps = 16/345 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++ S+IKFSD QIKC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  244   YLVFEYMEHDLAGLVASSDIKFSDMQIKCYMRQLLSAVEHCHLRGIMHRDIKASNILVNN  303

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+GDFGLAN +++++KQP+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  304   DGILKLGDFGLANVINSKNKQPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  363

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP ++YW+ SKLP A +FKPQY+YES+LRERCKE P
Sbjct  364   FLGKPILKGRTEVEQLHKIFKLCGSPPEEYWKASKLPHATMFKPQYSYESSLRERCKEFP  423

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV ++E LLS+EPYKRGTASS L +EYF T+PYACDPS +PK+PP +E+D K RE+++
Sbjct  424   TTAVDMLENLLSVEPYKRGTASSVLMAEYFRTRPYACDPSHLPKYPPTKEMDTKSREDSQ  483

Query  722   rrkagsavrgsgssrNMRRLRK---------GMAPTEEVEANMLgsrrgn--gsgsrgAT  868
             R++ G   R +      RR+RK          +AP E+ + +   S R N      +G  
Sbjct  484   RKRPGIRARETSRKP--RRVRKTLQESNNSAKLAPKEDGQDDNTQSARCNPLILREKGGL  541

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             + R SLK S+DTVSE  +      SQGDS  S  A + ++S + W
Sbjct  542   LRRESLKQSFDTVSENCN---LNTSQGDSTFSSGAHISAASGFTW  583



>ref|XP_007217007.1| hypothetical protein PRUPE_ppa002153mg [Prunus persica]
 gb|EMJ18206.1| hypothetical protein PRUPE_ppa002153mg [Prunus persica]
Length=708

 Score =   410 bits (1054),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 265/345 (77%), Gaps = 16/345 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++ S+IKFSD QIKC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  242   YLVFEYMEHDLAGLVASSDIKFSDMQIKCYMRQLLSAVEHCHLRGIMHRDIKASNILVNN  301

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+GDFGLAN V++++KQP+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  302   DGILKLGDFGLANVVNSKNKQPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  361

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+P+LKGRTEVEQLHKIFKLCGSP ++YW+ SKLP A +FKPQY+YES+LR+RCKE P
Sbjct  362   FLGKPLLKGRTEVEQLHKIFKLCGSPPEEYWKASKLPHATMFKPQYSYESSLRDRCKEFP  421

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV ++E LLS+EPYKRGTASS L +EYF T+PYACDPS +PK+PP +E+D K RE+++
Sbjct  422   TTAVDMLENLLSVEPYKRGTASSVLMAEYFRTRPYACDPSHLPKYPPTKEMDTKSREDSQ  481

Query  722   rrkagsavrgsgssrNMRRLRK---------GMAPTEEVEANMLgsrrgn--gsgsrgAT  868
             R++ G   R +      RR+RK          +AP E+ + +   S R N      +G  
Sbjct  482   RKRPGIRARETSRKP--RRVRKTLQESNNSAKLAPKEDGQDDNTQSARCNPLILREKGGL  539

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             + R SLK S+DTVSE         SQGDS  S  A + ++S + W
Sbjct  540   LRRESLKLSFDTVSE---NCKLNTSQGDSTFSSGALISAASGFTW  581



>gb|KDP31293.1| hypothetical protein JCGZ_11669 [Jatropha curcas]
Length=687

 Score =   409 bits (1051),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 296/448 (66%), Gaps = 31/448 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS+SQIKC+MKQLLSGLEHCH+KG+MHRDIK SN+LVNN
Sbjct  190   YLVFEYMEHDITGLLSCPDVRFSESQIKCYMKQLLSGLEHCHLKGVMHRDIKGSNLLVNN  249

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+GDFGLANF ++ ++QP+TSRVVTLWYRPPELLLG++ YG +VDLWS GCVFAEL
Sbjct  250   EGMLKVGDFGLANFCNSGNRQPLTSRVVTLWYRPPELLLGSSDYGASVDLWSVGCVFAEL  309

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              FG+PIL+GRTEVEQLHKIFKLCGSP D+YW +S+LP A +FKPQ  Y+S L+E  K+LP
Sbjct  310   LFGKPILQGRTEVEQLHKIFKLCGSPPDEYWRKSRLPHATLFKPQQPYDSCLQETFKDLP  369

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKRG+A+S+L SEYF  KP+ACDPSS+PK+PP++EIDAK REEA 
Sbjct  370   TTAVNLIETLLSVEPYKRGSATSALKSEYFTAKPHACDPSSLPKYPPSKEIDAKNREEAS  429

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsgsrgATVARMSLKS  892
             R+K     RG  + +  R+L  G+   APTE+  A M          S     + M +  
Sbjct  430   RKKISGRSRGGETRKPTRKL-GGINKPAPTEDAVARM---------QSAQNNTSNMHITK  479

Query  893   SYDTVSEAASQT-----------ATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfh  1039
               D  S   ++                SQGD   S P Q+ +SS + W K+ +  A+   
Sbjct  480   GGDVRSSGEARKPSLEKLEEILHVKNASQGDIPFSGPLQVSTSSGFAWAKRLKDDASVRS  539

Query  1040  afaNSRSITMNGGVEPPTLQQSKD--DPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIY  1213
                      +  G+E  T  Q K+  D    D  D    IR  S       +S H+    
Sbjct  540   HNRTISRGHVTNGLETSTALQEKNHFDSRRQDNGDVRYGIRTNSKGHDSYEISKHA----  595

Query  1214  HFSKELSVEEQPPPFLSPDLYHSREQSV  1297
                K+ S  E+P  F + + YHS+E S+
Sbjct  596   -LQKQWSQFERPDSFDASEGYHSQELSL  622



>ref|XP_002514714.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47820.1| ATP binding protein, putative [Ricinus communis]
Length=661

 Score =   407 bits (1047),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 300/442 (68%), Gaps = 18/442 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS+SQIKC+M+QLL GLEHCH KG+MHRDIK SN+LVNN
Sbjct  163   YLVFEYMEHDITGLLSCPDVRFSESQIKCYMRQLLFGLEHCHSKGVMHRDIKGSNLLVNN  222

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+GDFGLANF     +QP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVFAEL
Sbjct  223   EGMLKVGDFGLANFCHTGHRQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFAEL  282

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++S+LP A +FKPQ  Y+S+LRE  K+LP
Sbjct  283   LLGKPVLQGRTEVEQLHKIFKLCGSPPDEYWKKSRLPHATLFKPQQPYDSSLREIFKDLP  342

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKRGTASS+L SEYF TKPYACDPSS+PK+PP++EIDAK REEAR
Sbjct  343   TTAVNLIETLLSVEPYKRGTASSALASEYFMTKPYACDPSSLPKYPPSKEIDAKNREEAR  402

Query  722   rrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgs-----rgATVAR  877
             R+K     RG+ + +  R+   + K +AP E+  A + GS+    +         A    
Sbjct  403   RKKTSGRSRGAETRKPARKPGGINK-LAPAEDATARIQGSQNSITTNVCLPKGVDAKSGG  461

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSR  1057
              + K+S D + E         SQGD   S P Q+ SSS + W ++ +  A+      ++ 
Sbjct  462   EARKASLDKLEEIFH--VKNASQGDIPFSGPLQVSSSSGFAWARRRKDDASVRSHSRSTS  519

Query  1058  SITMNGGVEPPTLQQSKD--DPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIYHFSKEL  1231
                +N G+E  T  Q K   D    +  D    IR  S       +S  +       K+ 
Sbjct  520   RSLINNGLENSTALQEKSNFDSRRRENGDAIYGIRTNSRGHDSNEISKRA-----LQKQW  574

Query  1232  SVEEQPPPFLSPDLYHSREQSV  1297
             S  E+P  F + + YHS+E S+
Sbjct  575   SQLERPDSFDASEGYHSQELSL  596



>ref|XP_007032628.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY03554.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
Length=499

 Score =   400 bits (1027),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/264 (73%), Positives = 234/264 (89%), Gaps = 0/264 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC +IKFS++Q+KC+MKQLLSGLEHCH++GIMHRDIK SNILVNN
Sbjct  203  YLVFEYMEHDLAGLSSCPDIKFSEAQVKCYMKQLLSGLEHCHLRGIMHRDIKASNILVNN  262

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LK+GDFGLAN +++R++Q +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAEL
Sbjct  263  EGVLKLGDFGLANILTSRNRQQLTSRVVTLWYRPPELLMGSTSYDVSVDLWSVGCVFAEL  322

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTEVEQLHKIFKLCGSP DDYW++++LP + +FKPQ+ YES LRERCK++P
Sbjct  323  LMGKPILKGRTEVEQLHKIFKLCGSPPDDYWKKTRLPHSTMFKPQHPYESCLRERCKDIP  382

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             SA++L+E LLS+EP+KRGTASSSL SEYFHTKPYACDPSS+PK+ PN+EIDAK R+E R
Sbjct  383  ASAMNLLEALLSVEPHKRGTASSSLMSEYFHTKPYACDPSSLPKYSPNKEIDAKQRDELR  442

Query  722  rrkagsavrgsgssrNMRRLRKGM  793
            R+KAGS  R SG S+  RR RK +
Sbjct  443  RKKAGSRTRESGVSKKTRRSRKAL  466



>ref|XP_002317972.1| hypothetical protein POPTR_0012s06960g [Populus trichocarpa]
 gb|EEE96192.1| hypothetical protein POPTR_0012s06960g [Populus trichocarpa]
Length=685

 Score =   405 bits (1040),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 294/439 (67%), Gaps = 15/439 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS+SQIKC+M+QLLSGL+HCH KG+MHRDIK SN+LVNN
Sbjct  190   YLVFEYMEHDITGLLSCPDVRFSESQIKCYMRQLLSGLDHCHSKGVMHRDIKGSNLLVNN  249

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLANF ++  +QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  250   EGILKVGDFGLANFCTSGHRQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  309

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S LRE  K+LP
Sbjct  310   LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSCLRETFKDLP  369

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPY RGTA S+L SEYF TKPYACDPSS+PK+PP++EIDAK  EEA 
Sbjct  370   TTAVNLIETLLSVEPYNRGTAFSALASEYFSTKPYACDPSSLPKYPPSKEIDAKKHEEAG  429

Query  722   rrkagsavrgsgssrNMRR---LRKGMAPTEEVEANM----LgsrrgngsgsrgATVARM  880
             R+K     RG+ + +  R+   + K +AP E++ A +    + +        R       
Sbjct  430   RKKISGRGRGTETRKCTRKPYGISK-LAPAEDLAARIQCGQINTSNMRIPKVRDGKSGGE  488

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
             + K S D + E         SQGD   S P Q+ SSS + W K+    A+      +   
Sbjct  489   ARKPSLDKLEEIFH--IKNASQGDIPFSGPLQVSSSSGFAWAKRRNGDASIRSHSRSISR  546

Query  1061  ITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIYHFSKELSVE  1240
                N G+EP + +++  D    +  D    +R  S       +S      +   K+ S  
Sbjct  547   GHSNNGLEPSSEEKNNSDSKQHNNGDLIYGVRTNSRGHNSYEIS-----KFALQKQWSQF  601

Query  1241  EQPPPFLSPDLYHSREQSV  1297
             E+P  F + + YHS+E S+
Sbjct  602   ERPDSFDASEEYHSQELSL  620



>ref|XP_010030365.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW83670.1| hypothetical protein EUGRSUZ_B00551 [Eucalyptus grandis]
Length=704

 Score =   404 bits (1039),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 245/506 (48%), Positives = 322/506 (64%), Gaps = 50/506 (10%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+MKQLLSGL+HCH +GIMHRDIK SN+LVNN
Sbjct  203   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMKQLLSGLDHCHSRGIMHRDIKGSNLLVNN  262

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF S+ ++QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAE+
Sbjct  263   EGILKVADFGLANFCSSGNRQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEI  322

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP DDYW++S+LP A +FKPQ  Y+S LRE    +P
Sbjct  323   LLGKPVLQGRTEVEQLHKIFKLCGSPPDDYWKKSRLPHATLFKPQNPYDSCLRETFANMP  382

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LIETLLS+EP+KRG ASS+L +EYF  KPYAC+PSS+P +PP++EIDAK REEA+
Sbjct  383   AAAVDLIETLLSVEPHKRGNASSALAAEYFRMKPYACEPSSLPIYPPSKEIDAKVREEAK  442

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEVEANMLgsrrgngsgsrgATVARMSLKS  892
             R+K G   RG  ++R   R   G   +AP E++ A    + R   +GS+   +    + S
Sbjct  443   RKKGGGRGRGPDTARKQARKPHGTSKLAPAEDLAAPAKVANRIEVNGSKLHILKEGKVMS  502

Query  893   SYDT------VSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNS  1054
              +D       + E AS  A   SQGD   S P Q+ SSS + W    +R        +++
Sbjct  503   GWDAPKPSLDLHEDASH-AKNASQGDIPFSGPLQVSSSSGFAW---AKRRKDEAPVRSHT  558

Query  1055  RSITMN---GGVEPPTLQQSKDDPLGLDEQDGGL------------------AIRPKSMK  1171
             RSI+      G+EP    Q++++      ++G L                   + P    
Sbjct  559   RSISRGHIFNGLEPSITLQARNNIESKRHENGSLPYGARTNSRGHYSNDVVKNMIPHQWG  618

Query  1172  QVEQPLSFHSPDIYHFSKELSV----EEQPPPFLSPDLYHSREQSVDSDGRAFSGPLTYR  1339
               E+P SF + D YH S+ELS+    +E+         YH     V+     FSGPL  +
Sbjct  619   HFERPDSFDASDEYH-SQELSLALYQKEEMAAKRGNLGYHDHADKVE-----FSGPLLTQ  672

Query  1340  GHK------RQDGQAAQSVRRSRFCR  1399
              H+      + +    Q+VRRS F R
Sbjct  673   AHRVDELLEKHERHIRQAVRRSWFQR  698



>ref|XP_011012137.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Populus euphratica]
Length=684

 Score =   404 bits (1037),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/440 (52%), Positives = 292/440 (66%), Gaps = 15/440 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS+SQIKC+M+QLLSGL+HCH KG+MHRDIK SN+LVNN
Sbjct  190   YLVFEYMEHDITGLLSCPDVRFSESQIKCYMRQLLSGLDHCHSKGVMHRDIKGSNLLVNN  249

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLANF +   +QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  250   EGILKVGDFGLANFCTLGHRQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  309

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S LRE  K+LP
Sbjct  310   LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSCLRETFKDLP  369

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPY RGTA S+L SEYF TKPYACDPSS+PK+PP++E+DAK REEA 
Sbjct  370   TTAVNLIETLLSVEPYTRGTAFSALASEYFSTKPYACDPSSLPKYPPSKEVDAKNREEAG  429

Query  722   rrkagsavrgsgssrNMRRLRK--GMAPTEEVEANM----LgsrrgngsgsrgATVARMS  883
             R+K G   RG+ + +  R+      +AP E++ A +    + +                +
Sbjct  430   RKKIGGRGRGTETRKCTRKPYGICKLAPAEDLAAKIQCSQINTSNMRIPKVGDGKSGGEA  489

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSI  1063
              K S D + E         SQGD   S P Q+ SSS + W K+    A+      +    
Sbjct  490   RKPSLDKLEETFH--IKNASQGDIPFSGPLQVSSSSGFAWAKRRNADASIRSHSRSISRG  547

Query  1064  TMNGGVEPPTLQQSKDDPLGLDEQDGGL--AIRPKSMKQVEQPLSFHSPDIYHFSKELSV  1237
               N G EP +  Q K++       +G L   +R  S       +S      +   K+ S 
Sbjct  548   HSNNGSEPSSALQEKNNSDSKQHNNGDLIYGVRTNSRGHNSYEIS-----KFALQKQWSQ  602

Query  1238  EEQPPPFLSPDLYHSREQSV  1297
              E+P  F + + YHS+E S+
Sbjct  603   FERPDSFDASEEYHSQELSL  622



>ref|XP_011012136.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Populus euphratica]
Length=687

 Score =   403 bits (1036),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/440 (52%), Positives = 292/440 (66%), Gaps = 15/440 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS+SQIKC+M+QLLSGL+HCH KG+MHRDIK SN+LVNN
Sbjct  190   YLVFEYMEHDITGLLSCPDVRFSESQIKCYMRQLLSGLDHCHSKGVMHRDIKGSNLLVNN  249

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLANF +   +QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  250   EGILKVGDFGLANFCTLGHRQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  309

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S LRE  K+LP
Sbjct  310   LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSCLRETFKDLP  369

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPY RGTA S+L SEYF TKPYACDPSS+PK+PP++E+DAK REEA 
Sbjct  370   TTAVNLIETLLSVEPYTRGTAFSALASEYFSTKPYACDPSSLPKYPPSKEVDAKNREEAG  429

Query  722   rrkagsavrgsgssrNMRRLRK--GMAPTEEVEANM----LgsrrgngsgsrgATVARMS  883
             R+K G   RG+ + +  R+      +AP E++ A +    + +                +
Sbjct  430   RKKIGGRGRGTETRKCTRKPYGICKLAPAEDLAAKIQCSQINTSNMRIPKVGDGKSGGEA  489

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSI  1063
              K S D + E         SQGD   S P Q+ SSS + W K+    A+      +    
Sbjct  490   RKPSLDKLEETFH--IKNASQGDIPFSGPLQVSSSSGFAWAKRRNADASIRSHSRSISRG  547

Query  1064  TMNGGVEPPTLQQSKDDPLGLDEQDGGL--AIRPKSMKQVEQPLSFHSPDIYHFSKELSV  1237
               N G EP +  Q K++       +G L   +R  S       +S      +   K+ S 
Sbjct  548   HSNNGSEPSSALQEKNNSDSKQHNNGDLIYGVRTNSRGHNSYEIS-----KFALQKQWSQ  602

Query  1238  EEQPPPFLSPDLYHSREQSV  1297
              E+P  F + + YHS+E S+
Sbjct  603   FERPDSFDASEEYHSQELSL  622



>ref|XP_006482784.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Citrus sinensis]
Length=572

 Score =   399 bits (1026),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 274/392 (70%), Gaps = 19/392 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL SC +IKFS+ Q+KC+M+QLL G+EHCH++GIMHRDIK SNILVNN
Sbjct  81    YLVFEYMEHDLAGLSSCPDIKFSEPQVKCYMRQLLHGVEHCHLRGIMHRDIKASNILVNN  140

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN +++++KQ +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAEL
Sbjct  141   EGILKLGDFGLANILTSKNKQKLTSRVVTLWYRPPELLMGSTNYNVSVDLWSVGCVFAEL  200

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PILKGRTEVEQLHKIFKLCGSP ++YW++SKLP   +FKPQ  YE  LRERCK+  
Sbjct  201   LIGKPILKGRTEVEQLHKIFKLCGSPPEEYWKKSKLPHGDMFKPQNPYEGCLRERCKDFT  260

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LI+T LSIEPYKRGTASS L  EYF T+PYACDPSS+PK+PP +EIDAK R+EAR
Sbjct  261   PTAVDLIDTCLSIEPYKRGTASSLLMCEYFTTQPYACDPSSLPKYPPKKEIDAKQRDEAR  320

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTE---------EVEANMLgsrrgngsgsrgAT--  868
             RRK  + +R   SS+  RR R+ +   E         E EA+    +  N   +   T  
Sbjct  321   RRKVRARMREPASSKRQRRARQTLQLQEPNSYSSKELEDEAHFADRKNNNNDNNTSRTYK  380

Query  869   -----VARMSLKSSYDTVSEAASQTAT-EVSQGDSICSVPAQMISSSSYGWPkkheraaa  1030
                  V R     ++DT+SE +  T+T   S GD++ +VP Q+ +SS + W K  +   A
Sbjct  381   GRGSAVGREPRNPTFDTISETSRATSTSHASHGDTVFTVPTQISASSGFAWAKNQQDEVA  440

Query  1031  rfhafaNSRSI--TMNGGVEPPTLQQSKDDPL  1120
                +  +  S   T   G E  T   +KDD +
Sbjct  441   ASLSLRSHTSTFDTSGLGFEDNTSNLTKDDTV  472



>ref|XP_010663340.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
 emb|CBI15183.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   403 bits (1035),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 233/433 (54%), Positives = 285/433 (66%), Gaps = 24/433 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGL+SC +IKFS+SQ+KC+ KQLLSGLEHCH +G+MHRDIK +N+LVNN
Sbjct  192   YLVFEYMEHDLSGLMSCPDIKFSESQVKCYTKQLLSGLEHCHSRGVMHRDIKGANLLVNN  251

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKI DFGLANF S+  +QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  252   EGILKIADFGLANFCSSVYRQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  311

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               GRPILKGRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  YES LRE  K+LP
Sbjct  312   LVGRPILKGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYESCLRESFKDLP  371

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               +V LIETLLS+EPYKRGTASS+L SEYF TKPYACDPSS+PK+ PN+EIDAK REE+R
Sbjct  372   TISVDLIETLLSVEPYKRGTASSALASEYFKTKPYACDPSSLPKYSPNKEIDAKNREESR  431

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEA-----NMLgsrrgngsgsrgATVARMSL  886
             R+K G  VRGS            + P E   A     + L     +        +     
Sbjct  432   RKKVGGRVRGSEKPTRKPNGINKLVPAENFTAQTQGPHKLNGNGFHIFKEGDGKLGGEPP  491

Query  887   KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSIT  1066
             K S D ++EA+       SQGD   S P Q+ +SS + W K+ +  A+      +S    
Sbjct  492   KPSIDVLTEASHM--KNASQGDIPFSGPLQVSTSSGFAWAKRRKDDASTRSHSRSSSRGL  549

Query  1067  MNGGVEPPTLQQSKD----------------DPLGLDEQDGGLAIRPKSMKQVEQPLSFH  1198
                 +EP     +++                D  G D  +    +  K   Q E+P SF 
Sbjct  550   GCNALEPNAALHARNNSNRLENSDVSNGGRTDSRGYDSSEIAKRVMLKQWGQFERPDSFD  609

Query  1199  SPDIYHFSKELSV  1237
             + D+YH S+ELS+
Sbjct  610   ASDMYH-SQELSL  621



>gb|KHG12951.1| hypothetical protein F383_07371 [Gossypium arboreum]
Length=712

 Score =   403 bits (1035),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 293/440 (67%), Gaps = 34/440 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS+SQIKC+MKQLLSGL+HCH +GIMHRDIK SN+LVNN
Sbjct  214   YLVFEYMEHDITGLLSCPDIKFSNSQIKCYMKQLLSGLDHCHSRGIMHRDIKGSNLLVNN  273

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF  +  +QP+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  274   EGILKMADFGLANFYGSGRRQPLTSRVVTLWYRPPELLLGSTDYTAAVDLWSVGCVFAEL  333

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++S+LP A +FKPQ  Y+S+L E  K+LP
Sbjct  334   LLGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSRLPHATVFKPQQPYDSSLHEAFKDLP  393

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKRGTASS+L SEYF TKPYACDPSS+P +PP++EIDAK REEAR
Sbjct  394   ATAVNLIETLLSVEPYKRGTASSALASEYFTTKPYACDPSSLPVYPPSKEIDAKHREEAR  453

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEE-----VEANMLgsrrgngsgsrgATVARM  880
             R+K    VRG  + + +R+      +AP E+       +  +   R +    R AT+   
Sbjct  454   RKKISGRVRGPETRKPIRKPHGITKLAPVEDAAAQAQASQKINGNRLHKVKQRNATITEG  513

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
                 S D+V EAA       SQGD   S P Q+ +SS + W    +R        ++SRS
Sbjct  514   LTNPSTDSVEEAAH--TKHASQGDIPFSGPLQVSTSSGFAW---AKRRKDDASKRSHSRS  568

Query  1061  IT---MNGGVEPPTLQQSKD------------------DPLGLDEQDGGLAIRPKSMKQV  1177
             I+   +   +EP     +++                  D  G D  +       K   Q 
Sbjct  569   ISRGHLYNSLEPSAQLHTRNNCDSKRHENGDVIYGGRTDSKGHDLYEAAKHAMQKQWSQF  628

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  629   ERPDSFDASDEYH-SQELSL  647



>ref|XP_010089563.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38034.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=682

 Score =   401 bits (1031),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 262/348 (75%), Gaps = 16/348 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVF+YMEHDL+GL+S  EIKFS++Q+KC+M+QLLS +EHCH++GIMHRDIKVSNILVN+
Sbjct  172   YLVFDYMEHDLAGLVSSPEIKFSEAQVKCYMRQLLSAIEHCHLRGIMHRDIKVSNILVND  231

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN V++++KQ +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  232   EGILKLGDFGLANIVNSKNKQSLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFAEL  291

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F  +P+LKGRTEVEQLHKIFKLCGSPS++YW++SKLP A +FKPQ+ YES+LRERCK++P
Sbjct  292   FLKKPVLKGRTEVEQLHKIFKLCGSPSEEYWKKSKLPHATMFKPQHPYESSLRERCKDVP  351

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ LIET LS+EPY+RGTASS+L S+YF T P ACDPS++PK+PPN+EIDAK RE+  
Sbjct  352   ATALDLIETFLSVEPYQRGTASSALISQYFRTPPLACDPSTLPKYPPNKEIDAKNREDVL  411

Query  722   rrk-------agsavrgsgssrNMRRLRKGMAPTEEVEANM-------Lgsrrgngsgsr  859
             RRK       A    R S  +   + L   +A  EE + N        + +        +
Sbjct  412   RRKPGIRHTGASRKPRKSRKTLQQQNLISKLAQKEEAQENAQIGRRNNVTNNDAQIIKDK  471

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             G  + R S K S+DTVSE     +T+  QGDS  S P  + +SS + W
Sbjct  472   GGHLRRDSFKPSFDTVSETYQMLSTQ--QGDSAFSGPIPVSASSGFAW  517



>gb|KHN26278.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=612

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 243/503 (48%), Positives = 317/503 (63%), Gaps = 50/503 (10%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKF++ QIKC+MKQLL GLEHCH++G+MHRDIK SN+LVNN
Sbjct  117   YLVFEYMEHDITGLLSSPDIKFTEPQIKCYMKQLLVGLEHCHLRGVMHRDIKGSNLLVNN  176

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANFV+   +QP+TSRVVTLWYRPPELLLG+T YG  VDLWS GCVFAEL
Sbjct  177   EGVLKVADFGLANFVNPGHRQPLTSRVVTLWYRPPELLLGSTDYGPAVDLWSVGCVFAEL  236

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++S+LP A +FKPQ  Y+S LR+  K+LP
Sbjct  237   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSRLPHATLFKPQQPYDSCLRQSFKDLP  296

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              ++VHL++TLLSIEPYKRGTA+S+L+SEYF TKPYACDPSS+P +PP++EIDAK REE+R
Sbjct  297   VTSVHLLQTLLSIEPYKRGTATSALSSEYFKTKPYACDPSSLPVYPPSKEIDAKHREESR  356

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSSY  898
             ++ +G          + + L    +AP E++ +    S++ N    R     R  +    
Sbjct  357   KKISGRVRGTETRKPSRKPLGFNKLAPAEDLASQTQTSQKVNVRSFRVLEEERTKIGDKA  416

Query  899   DTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-SRSIT  1066
                S    + A+ V   SQGD   S P Q+ +SS + W K  +   +        SR  T
Sbjct  417   QKPSSGKPEDASHVKNASQGDIPISGPLQVSTSSGFAWAKSRKDDTSFRSHCRTISRGHT  476

Query  1067  MNGGVEPPTL----------QQSKDDPLGLDEQDGG--LAIRPKSMK----QVEQPLSFH  1198
              N  +EP TL          Q++K+   G     G   L I   SM+    + ++P SF 
Sbjct  477   FN-PLEPCTLNSRNNLDTRNQENKEFSGGCTNSRGHDLLEISKLSMQNQWSKFDRPDSFD  535

Query  1199  SPDIYHFSKELSVEEQPPPFLSPDLYHSREQSV----------DSDGRAFSGPLTYRGH-  1345
             + D YH S+ELS+           LYH RE S             +   FSGPL  + H 
Sbjct  536   ASDEYH-SQELSIA----------LYH-REDSASKRSNLSFQDQGEKVEFSGPLLSQMHT  583

Query  1346  -----KRQDGQAAQSVRRSRFCR  1399
                  +R +    ++VRRS F R
Sbjct  584   VDELLERHERHIRRTVRRSWFQR  606



>gb|KDO72711.1| hypothetical protein CISIN_1g041720mg, partial [Citrus sinensis]
Length=690

 Score =   400 bits (1028),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 274/392 (70%), Gaps = 19/392 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL SC +IKFS+ Q+KC+M+QLL G+EHCH++GIMHRDIK SNILVNN
Sbjct  201   YLVFEYMEHDLAGLSSCHDIKFSEPQVKCYMRQLLHGVEHCHLRGIMHRDIKASNILVNN  260

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN +++++KQ +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAEL
Sbjct  261   EGILKLGDFGLANILTSKNKQKLTSRVVTLWYRPPELLMGSTNYNVSVDLWSVGCVFAEL  320

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PILKGRTEVEQLHKIFKLCGSP ++YW++SKLP   +FKPQ  YE  LRERCK+  
Sbjct  321   LIGKPILKGRTEVEQLHKIFKLCGSPPEEYWKKSKLPHGDMFKPQNPYEGCLRERCKDFT  380

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LI+T LSIEPYKRGTASS L  EYF T+PYACDPSS+PK+PP +EIDAK R+EAR
Sbjct  381   PTAVDLIDTCLSIEPYKRGTASSLLMCEYFTTQPYACDPSSLPKYPPKKEIDAKQRDEAR  440

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTE---------EVEANMLgsrrgngsgsrgAT--  868
             RRK  + +R   SS+  RR R+ +   E         E EA+    +  N   +   T  
Sbjct  441   RRKVRARMREPASSKRQRRARQTLQLQEPNSYSSKELEDEAHFADRKNNNNDNNTSRTYK  500

Query  869   -----VARMSLKSSYDTVSEAASQTAT-EVSQGDSICSVPAQMISSSSYGWPkkheraaa  1030
                  V R     ++DT+SE +  T+T   S GD++ +VP Q+ +SS + W K  +   A
Sbjct  501   GRGSAVGREPRNPTFDTISETSRATSTSHASHGDTVFTVPTQISASSGFAWAKNQQDEVA  560

Query  1031  rfhafaNSRSI--TMNGGVEPPTLQQSKDDPL  1120
                +  +  S   T   G E  T   +KDD +
Sbjct  561   ASLSLRSHTSTFDTSGLGFEDNTSNLTKDDTV  592



>ref|XP_006431266.1| hypothetical protein CICLE_v10013417mg, partial [Citrus clementina]
 gb|ESR44506.1| hypothetical protein CICLE_v10013417mg, partial [Citrus clementina]
Length=690

 Score =   400 bits (1028),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 274/392 (70%), Gaps = 19/392 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL SC +IKFS+ Q+KC+M+QLL G+EHCH++GIMHRDIK SNILVNN
Sbjct  201   YLVFEYMEHDLAGLSSCHDIKFSEPQVKCYMRQLLHGVEHCHLRGIMHRDIKASNILVNN  260

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN +++++KQ +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAEL
Sbjct  261   EGILKLGDFGLANILTSKNKQKLTSRVVTLWYRPPELLMGSTNYNVSVDLWSVGCVFAEL  320

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PILKGRTEVEQLHKIFKLCGSP ++YW++SKLP   +FKPQ  YE  LRERCK+  
Sbjct  321   LIGKPILKGRTEVEQLHKIFKLCGSPPEEYWKKSKLPHGDMFKPQNPYEGCLRERCKDFT  380

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LI+T LSIEPYKRGTASS L  EYF T+PYACDPSS+PK+PP +EIDAK R+EAR
Sbjct  381   PTAVDLIDTCLSIEPYKRGTASSLLMCEYFTTQPYACDPSSLPKYPPKKEIDAKQRDEAR  440

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTE---------EVEANMLgsrrgngsgsrgAT--  868
             RRK  + +R   SS+  RR R+ +   E         E EA+    +  N   +   T  
Sbjct  441   RRKVRARMREPASSKRQRRARQTLQLQEPNSYSSKELEDEAHFADRKNNNNDNNTSRTYK  500

Query  869   -----VARMSLKSSYDTVSEAASQTAT-EVSQGDSICSVPAQMISSSSYGWPkkheraaa  1030
                  V R     ++DT+SE +  T+T   S GD++ +VP Q+ +SS + W K  +   A
Sbjct  501   GRGSAVGREPRNPTFDTISETSRATSTSHASHGDTVFTVPTQISASSGFAWAKNQQDEVA  560

Query  1031  rfhafaNSRSI--TMNGGVEPPTLQQSKDDPL  1120
                +  +  S   T   G E  T   +KDD +
Sbjct  561   ASLSLRSHTSTFDTSGLGFEDNTSNLTKDDTV  592



>gb|EPS68289.1| hypothetical protein M569_06479, partial [Genlisea aurea]
Length=354

 Score =   388 bits (996),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 210/235 (89%), Gaps = 3/235 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLLS  +++F+DSQIKC+M QLLSGL+HCH KGI+HRDIK SNIL+NN
Sbjct  115  YLVFEYMEHDLAGLLSSPDVRFTDSQIKCYMLQLLSGLKHCHSKGILHRDIKTSNILLNN  174

Query  182  EGILKIGDFGLANF--VSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFA  355
            +GILKI DFGLANF  +  R +QP+TSRVVTLWYRPPELLLG+T YG+ VDLWS GCVFA
Sbjct  175  DGILKIADFGLANFTRMKNRQQQPLTSRVVTLWYRPPELLLGSTSYGKGVDLWSVGCVFA  234

Query  356  ELFFGRPILKGRTEV-EQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCK  532
            ELFFG+P+LKGRTEV EQLHKIFKLCGSPSD+YW +SKLPL+ +F+PQ +YESTLR RC 
Sbjct  235  ELFFGKPLLKGRTEVVEQLHKIFKLCGSPSDEYWARSKLPLSNMFRPQQSYESTLRNRCS  294

Query  533  ELPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +LPK+A+ L+ET  SIEP++RGTASS+LNS YF+TKPYACDPSS PK+PPN+E+D
Sbjct  295  QLPKTALSLLETFFSIEPHRRGTASSALNSMYFNTKPYACDPSSFPKYPPNKEMD  349



>ref|XP_011006282.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=685

 Score =   399 bits (1025),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 295/438 (67%), Gaps = 32/438 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS++QIKC+MKQL+SGL+HCH KG+MHRDIK SN+LVNN
Sbjct  189   YLVFEYMEHDITGLLSCPDVRFSEAQIKCYMKQLISGLDHCHSKGVMHRDIKGSNLLVNN  248

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLANF +    QP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  249   EGILKVGDFGLANFCTLGHGQPLTSRVVTLWYRPPELLLGSTDYGPSVDLWSVGCVFAEL  308

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S LRE  K+LP
Sbjct  309   LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSCLRETLKDLP  368

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LI+TLLS+EPYKRGTASS+L SEYF TKPY CDPS++PK+PP++EIDAK REEAR
Sbjct  369   TTAVNLIKTLLSVEPYKRGTASSALASEYFSTKPYPCDPSNLPKYPPSKEIDAKNREEAR  428

Query  722   rrkagsavrgsgssrNMRRL--------RKGMAPTEEVEANMLgsrrgngsgsrgATVAR  877
             R+K G   RG+ + +  R+L            A  +  + N+   R   G   + +  AR
Sbjct  429   RKKIGGRGRGTETRKCTRKLCGISKLAAEDLAAQKQCAQINISNMRVPKGGDGKSSGEAR  488

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSR  1057
                K S D + E         SQGD   S P ++ SSS + W K+ +  A+      ++ 
Sbjct  489   ---KPSLDKLEEIFH--IKNASQGDIPFSGPLKVSSSSGFAWAKRRKDDASIRSHNRSTS  543

Query  1058  SITMNGGVEPPTL--QQSKDDPLGLDEQDGGLAIRP----------------KSMKQVEQ  1183
                 N G+EP +   Q++  D  G D  D    IR                 K  +Q E+
Sbjct  544   RGHSNNGLEPSSALQQKTNSDTKGHDNWDLTHGIRTNSRGHDSYEISKLALRKQWRQFER  603

Query  1184  PLSFHSPDIYHFSKELSV  1237
             P SF + + YH S+ELS+
Sbjct  604   PDSFDASEEYH-SQELSL  620



>ref|XP_007037445.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY21946.1| Kinase superfamily protein [Theobroma cacao]
Length=716

 Score =   399 bits (1026),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 291/438 (66%), Gaps = 28/438 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS+SQIKC++KQLLSGL+HCH +GIMHRDIK SN+LVNN
Sbjct  216   YLVFEYMEHDITGLLSCPDIKFSESQIKCYVKQLLSGLDHCHSRGIMHRDIKGSNLLVNN  275

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++  +QP+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  276   EGILKMADFGLANFCASGHRQPLTSRVVTLWYRPPELLLGSTDYTAAVDLWSVGCVFAEL  335

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++S+LP A +FKPQ  Y+S LRE  K+LP
Sbjct  336   LLGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSRLPHATLFKPQQPYDSCLRETFKDLP  395

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKRGTASS+L SEYF TKPYACDPSS+P +PP++EIDAK REEA+
Sbjct  396   ATAVNLIETLLSVEPYKRGTASSALASEYFTTKPYACDPSSLPVYPPSKEIDAKHREEAK  455

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEA------NMLgsrrgngsgsrgATVAR  877
             R+K    VRGS + + +R+      +AP E+  A        +     + S  R AT++ 
Sbjct  456   RKKISGRVRGSETRKPIRKPHGISKLAPVEDAAAAQTRGSQKINGNHVHNSKQRNATISD  515

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSR  1057
                  S D + EAA       SQGD   S P Q+ +SS + W K+ +  A+      +  
Sbjct  516   GVPNPSTDGLEEAAH--VKHASQGDIPYSGPLQVSTSSGFAWAKRQKDDASIRSHSRSIS  573

Query  1058  SITMNGGVEPPTLQQSKD------------------DPLGLDEQDGGLAIRPKSMKQVEQ  1183
                +   +EP     +++                  D  G D  +       K   Q E+
Sbjct  574   RGHIYNSLEPSAQLNARNNFDSKRHENGDVIYGGRTDSRGHDSYEAAKRAMQKQWSQFER  633

Query  1184  PLSFHSPDIYHFSKELSV  1237
             P SF + D  + S+ELS+
Sbjct  634   PDSFDASDGGYHSQELSL  651



>ref|XP_004306120.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Fragaria vesca subsp. vesca]
Length=698

 Score =   399 bits (1024),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++ ++IKFSD QIKC+M+QL S +EHCH++GIMHRDIK SNILVNN
Sbjct  231  YLVFEYMEHDLAGLVAANDIKFSDVQIKCYMRQLFSAVEHCHMRGIMHRDIKASNILVNN  290

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLAN V+++SKQP+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  291  DGILKLADFGLANVVNSKSKQPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  350

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PILKGRTEVEQLHKI KLCGSP ++YW+ SKLP A +FKPQY+YES+LRERCKE P
Sbjct  351  YLGKPILKGRTEVEQLHKILKLCGSPPEEYWKNSKLPHATMFKPQYSYESSLRERCKEFP  410

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++V L++TLLS+EPYKRGTASS+L SEYF TKPYACDPS +PK+PP +E+D
Sbjct  411  TTSVGLLQTLLSVEPYKRGTASSALLSEYFRTKPYACDPSKLPKYPPTKEMD  462



>ref|XP_008348081.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=710

 Score =   399 bits (1025),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 260/350 (74%), Gaps = 23/350 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  EIKFSD QIKC+ +QLLS +EHCH++GIMHRDIK SNILVN+
Sbjct  242   YLVFEYMEHDLAGLVASPEIKFSDMQIKCYXRQLLSAVEHCHLRGIMHRDIKASNILVND  301

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+GDFGLAN V+++SKQP+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  302   DGILKLGDFGLANVVNSKSKQPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  361

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP ++YW+ SKLP A +FKPQ+ YES+LRERCKE P
Sbjct  362   FLGKPILKGRTEVEQLHKIFKLCGSPPEEYWKTSKLPHATMFKPQHTYESSLRERCKEFP  421

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV ++E LLS+EPYKRGT SS+L SEYF TKPYACDPS +PK+PP +E+DAK REE++
Sbjct  422   TTAVDMLENLLSVEPYKRGTVSSALMSEYFKTKPYACDPSHLPKYPPTKEMDAKIREESQ  481

Query  722   rrkagsavrgsgssrNMRRLRKG---------MAPTEEVE------ANMLgsrrgngsgs  856
             R+K G   R +      RR+RK          +AP E+ +      A  +         +
Sbjct  482   RKKPGIRARETRKP---RRVRKALLESNSSAKLAPKEDGQDDHTQSARRMNGGNPLILRA  538

Query  857   rgATVARMS-LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +G  + R S LK  +DTVSE     A   S GDS  S   Q  ++S + W
Sbjct  539   KGGLLRRESNLKPQFDTVSENCELNA---SLGDSTLS-SVQTSAASGFAW  584



>ref|XP_003527095.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Glycine max]
Length=677

 Score =   397 bits (1021),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 243/503 (48%), Positives = 316/503 (63%), Gaps = 50/503 (10%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKF++ QIKC+MKQLL GLEHCH++G+MHRDIK SN+LVNN
Sbjct  182   YLVFEYMEHDITGLLSSPDIKFTEPQIKCYMKQLLVGLEHCHLRGVMHRDIKGSNLLVNN  241

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANFV+   +QP+TSRVVTLWYRPPELLLG+T YG  VDLWS GCVFAEL
Sbjct  242   EGVLKVADFGLANFVNPGHRQPLTSRVVTLWYRPPELLLGSTDYGPAVDLWSVGCVFAEL  301

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++S+LP A +FKPQ  Y+S LR+  K+LP
Sbjct  302   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSRLPHATLFKPQQPYDSCLRQSFKDLP  361

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              ++VHL++TLLSIEPYKRGTA+S+L+SEYF TKPYACDPSS+P +PP++EIDAK REE+R
Sbjct  362   VTSVHLLQTLLSIEPYKRGTATSALSSEYFKTKPYACDPSSLPVYPPSKEIDAKHREESR  421

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSSY  898
             ++ +G          + + L    +AP E++ +    S + N    R     R  +    
Sbjct  422   KKISGRVRGTETRKPSRKPLGFNKLAPAEDLASQTQTSHKVNARSFRVLEEERTKIGDKA  481

Query  899   DTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-SRSIT  1066
                S    + A+ V   SQGD   S P Q+ +SS + W K  +   +        SR  T
Sbjct  482   QKPSSGKPEDASHVKNASQGDIPLSGPLQVSTSSGFAWAKSRKDDTSFRSHCRTISRGHT  541

Query  1067  MNGGVEPPTL----------QQSKDDPLGLDEQDGG--LAIRPKSMK----QVEQPLSFH  1198
              N  +EP TL          Q++K+   G     G   L I   SM+    + ++P SF 
Sbjct  542   FN-PLEPCTLNSRNNLDTRNQENKEFSGGCTNSRGHDLLEISKLSMQNQWSKFDRPDSFD  600

Query  1199  SPDIYHFSKELSVEEQPPPFLSPDLYHSREQSV----------DSDGRAFSGPLTYRGH-  1345
             + D YH S+ELS+           LYH RE S             +   FSGPL  + H 
Sbjct  601   ASDEYH-SQELSIA----------LYH-REDSASKRSNLSFQDQGEKVEFSGPLLSQMHT  648

Query  1346  -----KRQDGQAAQSVRRSRFCR  1399
                  +R +    ++VRRS F R
Sbjct  649   VDELLERHERHIRRTVRRSWFQR  671



>ref|XP_008459351.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
Length=691

 Score =   397 bits (1021),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 266/347 (77%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+S   +KFS++QIKC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  204   YLVFEYMEHDLAGLVSSPNVKFSEAQIKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  263

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN +++R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  264   EGVLKLADFGLANVINSRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  323

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP +++W+++KLP AA+FKPQ++YES+L E+CKE  
Sbjct  324   HLGKPLLKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHAAMFKPQHSYESSLNEKCKEFA  383

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              SAV L+E+ L+IEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+AR
Sbjct  384   PSAVSLLESFLAIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDAR  443

Query  722   rrkagsavrgsgssrNMRRLRKGM-------APTEE-VEANMLgsrrgngsgsrgA----  865
             R++A +  + +G ++  RR+R+          P +E  E N+  SRR   + +  +    
Sbjct  444   RKRANAKAKETGVTQRPRRVRRNFQELNSHKVPIKEGAEENIQPSRRNGSNTANLSKEQG  503

Query  866   -TVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                 R   K  +DT SE+ + TA    +GDS  + P  + +SS + W
Sbjct  504   DVFQRDPQKQLFDTTSESQAATAPN-QRGDSAFTAPIPVSASSGFSW  549



>ref|XP_004141453.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
Length=691

 Score =   397 bits (1021),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 265/347 (76%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYM+HDL+GL+S   IKFS++QIKC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  204   YLVFEYMDHDLAGLVSSPNIKFSEAQIKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  263

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLAN +++R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  264   EGILKLADFGLANVINSRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  323

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP +++W+++KLP AA+FKPQ+AYES+L E+CKE  
Sbjct  324   HLGKPLLKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHAAMFKPQHAYESSLSEKCKEFA  383

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ L+E+ L+IEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+AR
Sbjct  384   PTALSLLESFLAIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDAR  443

Query  722   rrkagsavrgsgssrNMRRLRKGMAP--------TEEVEANMLgsrrgngsgsrgA----  865
             R++A + V+ SG ++  RR+R+             EE E N+  SRR   S +       
Sbjct  444   RKRANARVKESGVTQRPRRVRRNFQELNSHKVPIKEEAEENIQPSRRNGSSTANLCKEQG  503

Query  866   -TVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                 R   K  +DT SE+ + TA    +GDS  + P  + +SS + W
Sbjct  504   DVFQRDPQKQLFDTTSESQAATAPN-QRGDSAFTAPIPVSASSGFAW  549



>ref|XP_004489426.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=601

 Score =   394 bits (1012),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/341 (58%), Positives = 249/341 (73%), Gaps = 10/341 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+S  +I F+D+QIKC+M+QLLSGLEHCHV+GIMHRDIKVSNIL+NN
Sbjct  186   YLVFEYMEHDLAGLVSRPDIVFTDAQIKCYMRQLLSGLEHCHVRGIMHRDIKVSNILLNN  245

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKIGDFGLAN +S  +K  +TSRVVTLWYRPPELL+GAT YG +VDLWS GCVFAEL
Sbjct  246   EGVLKIGDFGLANTISTNNKHHLTSRVVTLWYRPPELLMGATNYGVSVDLWSVGCVFAEL  305

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+P+LKGRTEVEQLHKIFKLCGSP D++W+++KLP A +FKPQ  YES+LRERC + P
Sbjct  306   FLGKPVLKGRTEVEQLHKIFKLCGSPPDEFWKKNKLPHATMFKPQTNYESSLRERCVDFP  365

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDak-freea  718
             +SAV+L+ETLLSI+P KRGTASS+L SEYF TKPYAC+PSS+PK+ P++E+DAK   + +
Sbjct  366   ESAVNLLETLLSIDPTKRGTASSALLSEYFTTKPYACNPSSLPKYTPSKEMDAKGHEDTS  425

Query  719   rrrkagsavrgsgssrNMRRLRKGM------APTEEVEANMLgsrrgngsgsrgATVARM  880
              ++        + S R  RR+ KG         T +        +     G  G  + + 
Sbjct  426   SKKTGDKTRDAATSRRQQRRVYKGFEQNNLGKTTAKENTRKDDGKTHVTKGKGGGAMHKD  485

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
               K S DT+SE +       S G    SVP Q+  S+ Y W
Sbjct  486   HTKPSMDTMSETSQMVNVADSNG---YSVPVQVQGSNDYSW  523



>ref|XP_004156158.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
Length=691

 Score =   397 bits (1019),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 265/347 (76%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYM+HDL+GL+S   IKFS++QIKC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  204   YLVFEYMDHDLAGLVSSPNIKFSEAQIKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  263

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN +++R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  264   EGVLKLADFGLANVINSRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  323

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP +++W+++KLP AA+FKPQ+AYES+L E+CKE  
Sbjct  324   HLGKPLLKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHAAMFKPQHAYESSLSEKCKEFA  383

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ L+E+ L+IEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+AR
Sbjct  384   PTALSLLESFLAIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDAR  443

Query  722   rrkagsavrgsgssrNMRRLRKGMAP--------TEEVEANMLgsrrgngsgsrgA----  865
             R++A + V+ SG ++  RR+R+             EE E N+  SRR   S +       
Sbjct  444   RKRANARVKESGVTQRPRRVRRNFQELNSHKVPIKEEAEENIQPSRRNGSSTANLCKEQG  503

Query  866   -TVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                 R   K  +DT SE+ + TA    +GDS  + P  + +SS + W
Sbjct  504   DVFQRDPQKQLFDTTSESQAATAPN-QRGDSAFTAPIPVSASSGFAW  549



>ref|XP_009360586.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=713

 Score =   397 bits (1020),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 262/350 (75%), Gaps = 22/350 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++ SEIKF+D QIKC+M+QL S +EHCH++GIMHRDIK SNILVNN
Sbjct  244   YLVFEYMEHDLAGLVASSEIKFTDMQIKCYMRQLFSAVEHCHLRGIMHRDIKASNILVNN  303

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN ++++SK+P+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  304   EGILKLGDFGLANVINSKSKRPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  363

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+ +LKGRTEVEQLHKIFKLCGSP ++YW+ SKLP A +FKPQY YES+L+ERCKE P
Sbjct  364   FLGKTLLKGRTEVEQLHKIFKLCGSPPEEYWKTSKLPHATMFKPQYNYESSLKERCKEFP  423

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ ++E LLS+EPYKRGTASS+L SEYF TKPYACDPS +PK+PP +E+DAK REE++
Sbjct  424   TTALDMLENLLSVEPYKRGTASSALMSEYFKTKPYACDPSHLPKYPPTKEMDAKNREESQ  483

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVE------ANMLgsrrgngsgs  856
             R++ G   R +      RR+RK +         AP E+ +      A  +         +
Sbjct  484   RKRPGIRERETTRKP--RRVRKALHESNGSAKVAPKEDGQDDHTQSARRINGGNPFIPKA  541

Query  857   rgATVARMS-LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +G  + R S LK  +DTVSE     A   SQG S  S   Q+ ++S + W
Sbjct  542   KGGLLRRESNLKPQFDTVSENCELNA---SQGYSTLS-SVQISAASGFAW  587



>ref|XP_008341611.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=713

 Score =   397 bits (1019),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 261/350 (75%), Gaps = 22/350 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++ SEIKF+D QIKC+M+QL S +EHCH++GIMHRDIK SNILVNN
Sbjct  244   YLVFEYMEHDLAGLVASSEIKFTDMQIKCYMRQLFSAVEHCHLRGIMHRDIKASNILVNN  303

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+GDFGLAN ++++SK+P+TSRVVTLWYRPPELL+GAT+YG +VDLWS GCVFAEL
Sbjct  304   EGILKLGDFGLANVINSKSKRPLTSRVVTLWYRPPELLMGATEYGVSVDLWSVGCVFAEL  363

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+ +LKGRTEVEQLHKIFKLCGSP ++YW+ SKLP A +FKPQY YES+L+ERCKE P
Sbjct  364   FLGKTLLKGRTEVEQLHKIFKLCGSPPEEYWKTSKLPHATMFKPQYNYESSLKERCKEFP  423

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ ++E LLS+EPYKRGTASS+L SEYF TKPYACDPS +PK+PP +E+DAK REE++
Sbjct  424   TTALDMLENLLSVEPYKRGTASSALMSEYFKTKPYACDPSHLPKYPPTKEMDAKNREESQ  483

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVE------ANMLgsrrgngsgs  856
             R++ G   R +      RR+RK +         AP E+ +      A  +         +
Sbjct  484   RKRPGIRARETTRKP--RRVRKALHESNGSAKVAPKEDGQDDHTQSARRINGGNPFIPKA  541

Query  857   rgATVARMS-LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +G  + R S LK  +DTVSE     A   SQG S  S   Q  ++S + W
Sbjct  542   KGGLLRRESNLKPQFDTVSENCELNA---SQGYSTLS-SVQTSAASGFAW  587



>ref|XP_004137627.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
Length=565

 Score =   391 bits (1004),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 259/364 (71%), Gaps = 30/364 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+SC ++ FS++Q+KC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  51    YLVFEYMEHDLAGLVSCPDVMFSEAQVKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  110

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLAN ++ R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  111   EGILKLADFGLANVINTRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  170

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP +++W+++KLP AA+F+PQ+AYES+L E+CKE  
Sbjct  171   HLGKPLLKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHAAMFRPQHAYESSLDEKCKEFA  230

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               AV L+E+ L+IEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+AR
Sbjct  231   PVAVRLLESFLAIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDAR  290

Query  722   rrkagsavrgsgssrNM--RRLRKG--------MAPTEEVEANMLgsrrgngsgsrgATV  871
             R+   +  R   +      RR+R+         +A  EE+ A  + +     S   G+  
Sbjct  291   RKNRVNNARAKETGATQRPRRVRRNFQEFNSHKVAIKEELSAEDVQNINNQPSRRNGSNN  350

Query  872   ARMSLKSS-------------------YDTVSEAASQTATEVSQ-GDSICSVPAQMISSS  991
                +   S                   YDT SE +   AT  +Q GDS  + P  + +SS
Sbjct  351   NNTTNNLSKDQQGDVFQRDPQKKQQQLYDTTSETSQAAATAPNQGGDSAFTAPMLVSASS  410

Query  992   SYGW  1003
              + W
Sbjct  411   GFAW  414



>ref|XP_006374446.1| hypothetical protein POPTR_0015s07250g [Populus trichocarpa]
 gb|ERP52243.1| hypothetical protein POPTR_0015s07250g [Populus trichocarpa]
Length=687

 Score =   394 bits (1012),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 291/437 (67%), Gaps = 28/437 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +++FS++QIKC+MKQL+SGL+HCH KG+MHRDIK SN+LVNN
Sbjct  189   YLVFEYMEHDITGLLSCPDVRFSEAQIKCYMKQLISGLDHCHSKGVMHRDIKGSNLLVNN  248

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+GDFGLANF +   +QP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVFAEL
Sbjct  249   DGILKVGDFGLANFCTYGHRQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFAEL  308

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S LRE  K+LP
Sbjct  309   LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSCLRETLKDLP  368

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LI+TLLS+EPYKRGTASS+L SEYF TKPY CDPS++PK+PP++EIDAK REEAR
Sbjct  369   TTAVNLIKTLLSVEPYKRGTASSALASEYFSTKPYPCDPSNLPKYPPSKEIDAKNREEAR  428

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgngsgsrgATVARM-------  880
             R+K G   RG+ + +  R+L        EV  +   +     +      +          
Sbjct  429   RKKIGGRGRGTETRKCTRKLCGISKLAAEVSLSYEHTCTHTRAHRCLWKLIHTDSDKFLS  488

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
             + K S D + E         SQGD   S P ++ SSS + W K+ +  A+      ++  
Sbjct  489   ARKPSLDKLEEIFH--IKNASQGDIPFSGPLKVSSSSGFAWAKRRKDDASIRSHSRSTSR  546

Query  1061  ITMNGGVEPPTLQQSKD--DPLGLDEQDGGLAIRP----------------KSMKQVEQP  1186
                N  +EP +  Q K   D  G D  D    IR                 K  +Q E+P
Sbjct  547   GHSNNRLEPSSALQQKTNYDTRGHDNGDLTHGIRTNSRGHDSYEISKLALRKQWRQFERP  606

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + + YH S+ELS+
Sbjct  607   DSFDASEEYH-SQELSL  622



>gb|KDO55463.1| hypothetical protein CISIN_1g005119mg [Citrus sinensis]
Length=529

 Score =   388 bits (997),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  32    YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  91

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  92    EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  151

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  152   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  211

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  212   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  271

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  272   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  330

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  331   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  388

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  389   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAVKIAMLNQWSQLERP  448

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  449   DSFDASDGYH-SQELSL  464



>gb|EPS61975.1| hypothetical protein M569_12817, partial [Genlisea aurea]
Length=305

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 204/232 (88%), Gaps = 3/232 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVF+YM+HDL+GLLS  ++KF +SQIKC+M+QLLSGLEHCH +G+MHRDIK SNIL+NN
Sbjct  71   YLVFDYMDHDLAGLLSSPDVKFFESQIKCYMRQLLSGLEHCHSRGVMHRDIKTSNILLNN  130

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G LKI DFGLANFV      P+TSRVVTLWYRPPELLLG+T+YGE VDLWS GCV AEL
Sbjct  131  QGCLKIADFGLANFVGP---CPLTSRVVTLWYRPPELLLGSTEYGEAVDLWSVGCVCAEL  187

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPILKGR EVEQLHKIFKLCGSP ++YW +S+LPLA +FKP   YESTLRERC+ELP
Sbjct  188  FIGRPILKGRNEVEQLHKIFKLCGSPPEEYWRKSRLPLATMFKPHQPYESTLRERCRELP  247

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS V+L+ETLLS+EPYKRGTA+S+L+S+YF T PYACDP S+PK+PPN+E+D
Sbjct  248  KSVVNLLETLLSVEPYKRGTATSALHSQYFETPPYACDPLSLPKYPPNKEMD  299



>ref|XP_010065651.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
Length=611

 Score =   390 bits (1002),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 255/346 (74%), Gaps = 15/346 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL GL+S  ++KFSD+Q+KC+MKQLLSG+EHCH  G++HRD+K SNILVNN
Sbjct  190   YLVFEYMEHDLYGLISSPQVKFSDAQVKCYMKQLLSGIEHCHQHGVIHRDVKSSNILVNN  249

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGIL+IGDFGLAN ++ + +Q +TS VVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  250   EGILRIGDFGLANILNPKDRQQLTSHVVTLWYRPPELLMGSTSYGVTVDLWSVGCVFAEL  309

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              F +PIL+GRTEVEQLHKIFKLCGSP D YW+  K+P A +F+P++AYE TLRERCK + 
Sbjct  310   MFRKPILRGRTEVEQLHKIFKLCGSPPDGYWKMCKVPQATMFRPRHAYECTLRERCKGIA  369

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              SA+ L+ET LSIEP+KRGTASS+L SEYF T PYACDPSS+PK+PPN+EIDAK REEAR
Sbjct  370   TSAMKLMETFLSIEPHKRGTASSALISEYFRTVPYACDPSSLPKYPPNKEIDAKHREEAR  429

Query  722   rrkagsavrgsgssrNMRRLRKG---------MAPTEEVEANMLgsrrgngsgsrgATV-  871
             R+KA S VR     +   R+ +          +AP EE++      RR     S+   + 
Sbjct  430   RKKARSRVREPEVGKRPTRIHRASQEQGFSSKIAPKEELQGQAQFVRRNLVRSSQRGEID  489

Query  872   --ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                R  LKSS D    +A   A + SQG SI S P Q+ +S+ + W
Sbjct  490   VPCREPLKSSCDA---SAISEAADTSQGPSILSGPTQISASNGFAW  532



>ref|XP_002530023.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF32385.1| ATP binding protein, putative [Ricinus communis]
Length=696

 Score =   392 bits (1008),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 259/348 (74%), Gaps = 20/348 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL S  ++KFS+SQ+KC+MKQLL G+EHCH++G++HRDIKVSNILVNN
Sbjct  220   YLVFEYMEHDLAGLSSSPDVKFSESQVKCYMKQLLHGIEHCHLRGVLHRDIKVSNILVNN  279

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKIGDFGLAN ++ ++K  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  280   EGILKIGDFGLANVLNPKNKHQLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFAEL  339

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP D+YW+Q KLP   +FKPQ+ YES+LRERCK+ P
Sbjct  340   LVGKPLLKGRTEVEQLHKIFKLCGSPPDEYWKQCKLPNVTMFKPQHIYESSLRERCKDFP  399

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LIET LSI+P KRGTASS+L S+YF+T PYACDPSS+PK+PPN+E+DAK+R+E R
Sbjct  400   TAAVDLIETFLSIDPEKRGTASSALLSQYFNTTPYACDPSSLPKYPPNKEMDAKYRDETR  459

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANM-----Lgsrrgngsgsr  859
             RR +G   R +G+ R  R++ + +         A  EE++        L           
Sbjct  460   RRMSGVRARDAGAPRRSRKVNRTLQECNILNKYASKEEMKDKTQVVCKLNDGNTQMLNRG  519

Query  860   gATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                V+R  + SS DT S+      ++ ++GD I   PA +I+SS + W
Sbjct  520   RGGVSR-EVSSSIDTTSD-----TSQATKGDCIFMGPAPVIASSGFAW  561



>ref|XP_006585759.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X4 [Glycine max]
Length=677

 Score =   390 bits (1002),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 257/345 (74%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  183   YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  242

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  SKQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  243   EGVLKIADFGLANTLSPNSKQPLTSRVVTLWYRPPELLLGSTSYGVSVDLWSVGCVFAEL  302

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  YE++L+ERC+  P
Sbjct  303   FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPKANYETSLQERCRGFP  362

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+L+ETLLSI+P KR TASS+L SEYF TKPYAC+PS +PK+PP++E+DAK REE R
Sbjct  363   ATAVNLLETLLSIDPSKRRTASSALMSEYFSTKPYACNPSHLPKYPPSKEMDAKNREEVR  422

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEAN--MLgsrrgngsgsrgAT  868
             R+K G  VR + +S+  R++ K           A  E V  N      R     G     
Sbjct  423   RKKNGGKVREAVTSKRQRQVHKVSHDHINFNQPALKENVSQNPGTNDGRAYVTKGKVAGA  482

Query  869   VARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             + +   K SYD  SEAA         G S+ S PA +  SS + W
Sbjct  483   MHKEQPKPSYDAKSEAAQ--VVNGCNGYSVYSGPAPISGSSGFTW  525



>ref|XP_010678451.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Beta vulgaris subsp. vulgaris]
Length=685

 Score =   390 bits (1002),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 218/449 (49%), Positives = 292/449 (65%), Gaps = 23/449 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+SC +IKFS+SQIKC+M+QLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  182   YLVFEYMEHDLAGLVSCPDIKFSESQIKCYMQQLLSGLEHCHSRGVMHRDIKGSNLLVNN  241

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF S +++QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE+
Sbjct  242   EGILKVADFGLANFCSTKNRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEV  301

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  YES+L   CK+LP
Sbjct  302   LLGKPLLQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQRYESSLLVTCKDLP  361

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV LI +LLS+EPYKRG+AS++L SEYF T+PYACDPS++P +PPN+EIDAK R+EAR
Sbjct  362   GNAVDLIGSLLSVEPYKRGSASAALCSEYFSTRPYACDPSTLPHYPPNKEIDAKGRDEAR  421

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEVEANMLgsrrgngsgsrgATV-------  871
             R+K    VRG  + R   +   G   +AP E +   +           +   +       
Sbjct  422   RKKVSGRVRGIDAGRKTTKKSNGIRKLAPAENLPLPLPLPLPSQVQDPQRVKINGSIALF  481

Query  872   -------ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaa  1030
                     R   K S +   EA+       SQGD   S P Q+ +SS + W K       
Sbjct  482   QPEEDVKGREPPKPSIERREEASHM--KNASQGDVPYSGPLQVSASSGFAWAKNRRDDVF  539

Query  1031  rfhafaNSRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDI  1210
                   +S  ++ N G+E       + +P    ++ G +++  ++  +      ++    
Sbjct  540   VRSHRRSSSKLSFN-GLENYMSSNDRSNPELKKQEIGDISLGARAFSRGH---DYYEALK  595

Query  1211  YHFSKELSVEEQPPPFLSPDLYHSREQSV  1297
             +   ++ S  ++P  F + D YHS+E S+
Sbjct  596   HTVRRQWSQFDRPESFDTSDEYHSQELSL  624



>ref|XP_006494991.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
Length=704

 Score =   390 bits (1003),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267   EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  387   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  446

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  447   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  505

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  506   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  563

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  564   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAAKIAMLNQWSQLERP  623

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  624   DSFDASDGYH-SQELSL  639



>emb|CDP18308.1| unnamed protein product [Coffea canephora]
Length=711

 Score =   390 bits (1003),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 230/433 (53%), Positives = 296/433 (68%), Gaps = 23/433 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++Q+KC++KQLLSGLEHCH +G+MHRDIK +N+LVNN
Sbjct  216   YLVFEYMEHDIAGLLSSPDIKFSEAQVKCYLKQLLSGLEHCHSRGVMHRDIKGANLLVNN  275

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +G+LKI DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  276   DGVLKIADFGLANFCNFGQKQPLTSRVVTLWYRPPELLLGSTDYGSSVDLWSVGCVFAEL  335

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES+L E  K+LP
Sbjct  336   LVGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESSLWETLKDLP  395

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             K+AV LIETLLS+EPYKRGTAS++L +EYF TKPYACDPSS+PK+PP++EIDAK REEAR
Sbjct  396   KAAVILIETLLSVEPYKRGTASAALAAEYFKTKPYACDPSSLPKYPPSKEIDAKHREEAR  455

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEV----EANMLgsrrgngsgsrgATVARM  880
             R+K G   RG  +++ + R + G   +AP E +    +     S     +   G  V  +
Sbjct  456   RKKPGGRARGPEATKRLTRKQNGFSKLAPEENLPVQPQGGHKISGYNASNCKEGDIVIGL  515

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
                   + + E AS      SQGD   S P Q+  SS + W K+    + R  + ++SRS
Sbjct  516   EPPKPSNELKEEASHV-KHASQGDVPFSGPLQVSGSSGFAWAKRRIDDSVRSRSRSSSRS  574

Query  1061  ITM--NGGVEPPTLQQSKDDP------------LGLDEQDGGLAIRPKSMKQVEQPLSFH  1198
             +    +G V+     +SK +              G D  +    +  K   Q+E P SF 
Sbjct  575   LIFEPSGAVQLRNNLESKRNENSEALNGHGTNFKGHDSYERLNHVMVKDWSQLEHPDSFD  634

Query  1199  SPDIYHFSKELSV  1237
             + D YH S+ELS+
Sbjct  635   ASDGYH-SQELSL  646



>ref|XP_006585758.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X3 [Glycine max]
Length=678

 Score =   389 bits (1000),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 259/348 (74%), Gaps = 16/348 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  183   YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  242

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  SKQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  243   EGVLKIADFGLANTLSPNSKQPLTSRVVTLWYRPPELLLGSTSYGVSVDLWSVGCVFAEL  302

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  YE++L+ERC+  P
Sbjct  303   FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPKANYETSLQERCRGFP  362

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+L+ETLLSI+P KR TASS+L SEYF TKPYAC+PS +PK+PP++E+DAK REE R
Sbjct  363   ATAVNLLETLLSIDPSKRRTASSALMSEYFSTKPYACNPSHLPKYPPSKEMDAKNREEVR  422

Query  722   rrkagsavrgsgssrNMRRLRKG-------MAPTEEVEANMLgsrrgngsgsrgATVARM  880
             R+K G  VR + +S+  R++ K          P  + E   +    G   G    T  ++
Sbjct  423   RKKNGGKVREAVTSKRQRQVHKVSHDHINFNQPALKEEMQNVSQNPGTNDGRAYVTKGKV  482

Query  881   SL-------KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +        K SYD  SEAA         G S+ S PA +  SS + W
Sbjct  483   AGAMHKEQPKPSYDAKSEAAQ--VVNGCNGYSVYSGPAPISGSSGFTW  528



>ref|XP_009596963.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=690

 Score =   390 bits (1001),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 221/438 (50%), Positives = 290/438 (66%), Gaps = 28/438 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD+SGLLSC E+KF++SQ+KC MKQLLSGL+HCH +GIMHRDIK +N+LVNN
Sbjct  191   YLVFEYMEHDISGLLSCPEVKFNESQVKCLMKQLLSGLDHCHSRGIMHRDIKGANLLVNN  250

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF    +KQP+TSRVVTLWYRPPELLLGAT Y  +VDLWS GCVFAE+
Sbjct  251   EGILKVADFGLANFSDLGTKQPLTSRVVTLWYRPPELLLGATDYAASVDLWSVGCVFAEI  310

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHK+FKLCGSP DDYW++SKLP A IFKPQ+ YES L    K+LP
Sbjct  311   LTGKPILQGRTEVEQLHKVFKLCGSPPDDYWKRSKLPHATIFKPQHPYESCLWNTFKDLP  370

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIETLLS+EP+KRG ASS+L SEYF TKP+ACDPSS+PK+PP++EIDAK  E+A+
Sbjct  371   KSAVSLIETLLSVEPHKRGAASSALASEYFKTKPHACDPSSLPKYPPSKEIDAKHLEDAK  430

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEV----EANMLgsrrgngsgsrgATVARM  880
             R+K     R    +R + R + G   +AP E +    +   +       +     T+  +
Sbjct  431   RKKPSGRARAPDPTRKLTRKQNGLRKLAPEENLPIQNKGAHISDCNNVTTQEERDTITSL  490

Query  881   SL-KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN--  1051
             +  K S D + +         SQGD     P Q+  SS + W K+    ++         
Sbjct  491   ARPKPSVDMMVKTFH--VKNASQGDVPFPGPLQISGSSGFAWAKRRFDDSSVRSRRRTSS  548

Query  1052  -------SRSITMNGGVEPPT------LQQSKDDPLGLD-EQDGGLAIRPKSMKQVEQPL  1189
                    S ++ +   ++P        +  ++ + +G D ++    AIR +   Q+E+P 
Sbjct  549   RSLIFEPSVALHVKNNMDPKVQGNCELINANQTNSVGHDTDESTKHAIRQR-WSQLERPD  607

Query  1190  SFHSPDIYHFSKELSVEE  1243
             SF + D YH S+ELS+ +
Sbjct  608   SFDASDGYH-SQELSLTQ  624



>gb|KDO55461.1| hypothetical protein CISIN_1g005119mg [Citrus sinensis]
Length=657

 Score =   389 bits (998),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267   EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  387   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  446

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  447   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  505

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  506   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  563

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  564   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAVKIAMLNQWSQLERP  623

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  624   DSFDASDGYH-SQELSL  639



>ref|XP_007139558.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
 gb|ESW11552.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
Length=667

 Score =   389 bits (998),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 263/349 (75%), Gaps = 22/349 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+D+QIKC+M+QLLSG+EHCH++GIMHRDIKVSNILV+N
Sbjct  180   YLVFEYMEHDLAGLVASPDIKFTDAQIKCYMRQLLSGIEHCHLRGIMHRDIKVSNILVSN  239

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  +K+P+TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  240   EGVLKIADFGLANTLSPNNKRPLTSRVVTLWYRPPELLMGSTTYGVSVDLWSVGCVFAEL  299

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F GRPILKGRTEVEQLHKIFKLCGSP  +YW+++KLPLA +FKPQ  YE++L+ERCK  P
Sbjct  300   FLGRPILKGRTEVEQLHKIFKLCGSPPQEYWKKNKLPLATMFKPQTNYETSLQERCKGFP  359

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               AV L+ETLLSI+P KRGTASS+L SEYF TKPYACDP  +PK+PP++E+DA+ RE+A 
Sbjct  360   APAVKLLETLLSIDPSKRGTASSALTSEYFRTKPYACDPLLLPKYPPSKEMDARDREDAS  419

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgngsgsrg----ATVARMSL-  886
             R+KA   VR + +S+  RR+ K     + +  NM   +  N   +      A VA++++ 
Sbjct  420   RKKAAGKVREAVTSKRHRRVHK--VSHDHINFNMPALKENNSQNAGTDDGGAHVAKVNIG  477

Query  887   -------KSSYDTVSEAASQTATEVSQG---DSICSVPAQMISSSSYGW  1003
                    K S D  SEAA     +V  G   +S+ S PA + +SS + W
Sbjct  478   ALHIEQPKPSCDGKSEAA-----QVGDGCNENSVYSGPAPVSASSGFTW  521



>ref|XP_006585757.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X2 [Glycine max]
 gb|KHM98817.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=680

 Score =   389 bits (999),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 259/348 (74%), Gaps = 16/348 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  183   YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  242

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  SKQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  243   EGVLKIADFGLANTLSPNSKQPLTSRVVTLWYRPPELLLGSTSYGVSVDLWSVGCVFAEL  302

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  YE++L+ERC+  P
Sbjct  303   FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPKANYETSLQERCRGFP  362

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+L+ETLLSI+P KR TASS+L SEYF TKPYAC+PS +PK+PP++E+DAK REE R
Sbjct  363   ATAVNLLETLLSIDPSKRRTASSALMSEYFSTKPYACNPSHLPKYPPSKEMDAKNREEVR  422

Query  722   rrkagsavrgsgssrNMRRLRKG-------MAPTEEVEANMLgsrrgngsgsrgATVARM  880
             R+K G  VR + +S+  R++ K          P  + E   +    G   G    T  ++
Sbjct  423   RKKNGGKVREAVTSKRQRQVHKVSHDHINFNQPALKEEMQNVSQNPGTNDGRAYVTKGKV  482

Query  881   SL-------KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +        K SYD  SEAA         G S+ S PA +  SS + W
Sbjct  483   AGAMHKEQPKPSYDAKSEAAQ--VVNGCNGYSVYSGPAPISGSSGFTW  528



>gb|KCW63248.1| hypothetical protein EUGRSUZ_G00872 [Eucalyptus grandis]
Length=698

 Score =   389 bits (1000),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 255/346 (74%), Gaps = 15/346 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL GL+S  ++KFSD+Q+KC+MKQLLSG+EHCH  G++HRD+K SNILVNN
Sbjct  277   YLVFEYMEHDLYGLISSPQVKFSDAQVKCYMKQLLSGIEHCHQHGVIHRDVKSSNILVNN  336

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGIL+IGDFGLAN ++ + +Q +TS VVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  337   EGILRIGDFGLANILNPKDRQQLTSHVVTLWYRPPELLMGSTSYGVTVDLWSVGCVFAEL  396

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              F +PIL+GRTEVEQLHKIFKLCGSP D YW+  K+P A +F+P++AYE TLRERCK + 
Sbjct  397   MFRKPILRGRTEVEQLHKIFKLCGSPPDGYWKMCKVPQATMFRPRHAYECTLRERCKGIA  456

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              SA+ L+ET LSIEP+KRGTASS+L SEYF T PYACDPSS+PK+PPN+EIDAK REEAR
Sbjct  457   TSAMKLMETFLSIEPHKRGTASSALISEYFRTVPYACDPSSLPKYPPNKEIDAKHREEAR  516

Query  722   rrkagsavrgsgssrNMRRLRKG---------MAPTEEVEANMLgsrrgngsgsrgATV-  871
             R+KA S VR     +   R+ +          +AP EE++      RR     S+   + 
Sbjct  517   RKKARSRVREPEVGKRPTRIHRASQEQGFSSKIAPKEELQGQAQFVRRNLVRSSQRGEID  576

Query  872   --ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                R  LKSS D    +A   A + SQG SI S P Q+ +S+ + W
Sbjct  577   VPCREPLKSSCDA---SAISEAADTSQGPSILSGPTQISASNGFAW  619



>ref|XP_003530415.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X1 [Glycine max]
Length=675

 Score =   389 bits (998),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 259/348 (74%), Gaps = 16/348 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  183   YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  242

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  SKQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  243   EGVLKIADFGLANTLSPNSKQPLTSRVVTLWYRPPELLLGSTSYGVSVDLWSVGCVFAEL  302

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  YE++L+ERC+  P
Sbjct  303   FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPKANYETSLQERCRGFP  362

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+L+ETLLSI+P KR TASS+L SEYF TKPYAC+PS +PK+PP++E+DAK REE R
Sbjct  363   ATAVNLLETLLSIDPSKRRTASSALMSEYFSTKPYACNPSHLPKYPPSKEMDAKNREEVR  422

Query  722   rrkagsavrgsgssrNMRRLRKG-------MAPTEEVEANMLgsrrgngsgsrgATVARM  880
             R+K G  VR + +S+  R++ K          P  + E   +    G   G    T  ++
Sbjct  423   RKKNGGKVREAVTSKRQRQVHKVSHDHINFNQPALKEEMQNVSQNPGTNDGRAYVTKGKV  482

Query  881   SL-------KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +        K SYD  SEAA         G S+ S PA +  SS + W
Sbjct  483   AGAMHKEQPKPSYDAKSEAAQ--VVNGCNGYSVYSGPAPISGSSGFTW  528



>ref|XP_007139559.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
 gb|ESW11553.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
Length=648

 Score =   388 bits (996),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 266/354 (75%), Gaps = 29/354 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+D+QIKC+M+QLLSG+EHCH++GIMHRDIKVSNILV+N
Sbjct  180   YLVFEYMEHDLAGLVASPDIKFTDAQIKCYMRQLLSGIEHCHLRGIMHRDIKVSNILVSN  239

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  +K+P+TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  240   EGVLKIADFGLANTLSPNNKRPLTSRVVTLWYRPPELLMGSTTYGVSVDLWSVGCVFAEL  299

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F GRPILKGRTEVEQLHKIFKLCGSP  +YW+++KLPLA +FKPQ  YE++L+ERCK  P
Sbjct  300   FLGRPILKGRTEVEQLHKIFKLCGSPPQEYWKKNKLPLATMFKPQTNYETSLQERCKGFP  359

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               AV L+ETLLSI+P KRGTASS+L SEYF TKPYACDP  +PK+PP++E+DA+ RE+A 
Sbjct  360   APAVKLLETLLSIDPSKRGTASSALTSEYFRTKPYACDPLLLPKYPPSKEMDARDREDAS  419

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsrrgngsgsrgATVA  874
             R+KA   VR + +S+  RR+ K           A  EE++ N     +  G+   GA VA
Sbjct  420   RKKAAGKVREAVTSKRHRRVHKVSHDHINFNMPALKEEMQNN----SQNAGTDDGGAHVA  475

Query  875   RMSL--------KSSYDTVSEAASQTATEVSQG---DSICSVPAQMISSSSYGW  1003
             ++++        K S D  SEAA     +V  G   +S+ S PA + +SS + W
Sbjct  476   KVNIGALHIEQPKPSCDGKSEAA-----QVGDGCNENSVYSGPAPVSASSGFTW  524



>ref|XP_009793962.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=685

 Score =   389 bits (998),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 290/441 (66%), Gaps = 34/441 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD+SGLLSC E++F++SQ+KC MKQLLSGL+HCH +GIMHRDIK +N+LVNN
Sbjct  186   YLVFEYMEHDISGLLSCPEVEFNESQVKCLMKQLLSGLDHCHSRGIMHRDIKGANLLVNN  245

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF    +KQP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE+
Sbjct  246   EGILKVADFGLANFSDLGTKQPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAEI  305

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHK+FKLCGSP DDYW++SKLP A IFKPQ+ YES L    K+LP
Sbjct  306   LTGKPILQGRTEVEQLHKVFKLCGSPPDDYWKRSKLPHATIFKPQHPYESCLWNTFKDLP  365

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIETLLS+EP+KRG ASS+L S+YF TKP+ACDPSS+PK+PP++EIDA + E+A+
Sbjct  366   KSAVSLIETLLSVEPHKRGNASSALASQYFKTKPHACDPSSLPKYPPSKEIDATYHEDAK  425

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEV----EANMLgsrrgngsgsrgATVARM  880
             R+K    VR    +R + R + G   +AP E +    +   +       +     T+  +
Sbjct  426   RKKPCGIVRVPDPTRKLTRKQNGLRKLAPEENLPIQNKGTHISDSNNVTAQEERDTITSL  485

Query  881   SL-KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSR  1057
                K S D + +         SQGD   S P Q+  SS + W K+    ++       S 
Sbjct  486   ERPKPSVDMMVKTFH--VKNASQGDVPFSGPLQISGSSGFAWAKRRFDDSSVRSRRRTSS  543

Query  1058  SITMNGGVEPPTLQQSKDD--PLGLD-------------EQD----GGLAIRPKSMKQVE  1180
                +    EP      K++  P G D             +QD       AIR +S  Q+E
Sbjct  544   RSLI---FEPSIALHVKNNMEPKGQDNYELIDAKQTNYMDQDTYESTKHAIR-QSWSQLE  599

Query  1181  QPLSFHSPDIYHFSKELSVEE  1243
             +P SF + D YH S+ELS+ +
Sbjct  600   RPDSFDASDGYH-SQELSLTQ  619



>gb|KDO55458.1| hypothetical protein CISIN_1g005119mg [Citrus sinensis]
Length=704

 Score =   389 bits (999),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267   EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  387   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  446

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  447   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  505

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  506   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  563

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  564   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAVKIAMLNQWSQLERP  623

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  624   DSFDASDGYH-SQELSL  639



>ref|XP_007139557.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
 gb|ESW11551.1| hypothetical protein PHAVU_008G039800g [Phaseolus vulgaris]
Length=670

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 266/354 (75%), Gaps = 29/354 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL++  +IKF+D+QIKC+M+QLLSG+EHCH++GIMHRDIKVSNILV+N
Sbjct  180   YLVFEYMEHDLAGLVASPDIKFTDAQIKCYMRQLLSGIEHCHLRGIMHRDIKVSNILVSN  239

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKI DFGLAN +S  +K+P+TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  240   EGVLKIADFGLANTLSPNNKRPLTSRVVTLWYRPPELLMGSTTYGVSVDLWSVGCVFAEL  299

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F GRPILKGRTEVEQLHKIFKLCGSP  +YW+++KLPLA +FKPQ  YE++L+ERCK  P
Sbjct  300   FLGRPILKGRTEVEQLHKIFKLCGSPPQEYWKKNKLPLATMFKPQTNYETSLQERCKGFP  359

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               AV L+ETLLSI+P KRGTASS+L SEYF TKPYACDP  +PK+PP++E+DA+ RE+A 
Sbjct  360   APAVKLLETLLSIDPSKRGTASSALTSEYFRTKPYACDPLLLPKYPPSKEMDARDREDAS  419

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsrrgngsgsrgATVA  874
             R+KA   VR + +S+  RR+ K           A  EE++ N     +  G+   GA VA
Sbjct  420   RKKAAGKVREAVTSKRHRRVHKVSHDHINFNMPALKEEMQNN----SQNAGTDDGGAHVA  475

Query  875   RMSL--------KSSYDTVSEAASQTATEVSQG---DSICSVPAQMISSSSYGW  1003
             ++++        K S D  SEAA     +V  G   +S+ S PA + +SS + W
Sbjct  476   KVNIGALHIEQPKPSCDGKSEAA-----QVGDGCNENSVYSGPAPVSASSGFTW  524



>ref|XP_008239891.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=698

 Score =   389 bits (998),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 296/440 (67%), Gaps = 34/440 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC++KQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  199   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYLKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  258

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+ DFGLANF ++  +QP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  259   DGILKVADFGLANFCNSGQRQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  318

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LR+  K+LP
Sbjct  319   LIGKPVLQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRQTFKDLP  378

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A++L+ETLLS+EP+KRGTASS+L SEYF  KPYACDPSS+P +PP++EIDAK REEAR
Sbjct  379   TTALNLLETLLSVEPHKRGTASSALASEYFKMKPYACDPSSLPIYPPSKEIDAKNREEAR  438

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEAN-----MLgsrrgngsgsrgATVARM  880
             R+K G  VRGS + +  R+      +AP E++         +    GN      A   R 
Sbjct  439   RKKIGGRVRGSETRKQTRKSLGCSKLAPAEDLAVQSQVTYKINGNNGNILKEENAITGRE  498

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K S   V E  S      SQGD   S P ++ +SS + W    +R        +++RS
Sbjct  499   LPKPSAGKVEE--SSHVKNASQGDIPFSGPLEVSTSSGFAW---AKRRKDDASIRSHTRS  553

Query  1061  ITMN---GGVEPPTLQQSKDDPLGLDEQDGGLAIRPKS---------------MKQ---V  1177
             I+       +EPP    ++++      ++G L  R ++               MKQ   +
Sbjct  554   ISRGHIFNAIEPPIAVHTRNNFDSRRHENGELKYRVRTDSRGHDSYEIAKLAMMKQWGKL  613

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E P SF + D YH S+ELS+
Sbjct  614   EHPDSFDASDGYH-SQELSL  632



>ref|XP_004491857.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X2 [Cicer arietinum]
Length=683

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 250/348 (72%), Gaps = 15/348 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+S  +IKF+DSQIKC+M+QLLSGLE CH++GIMHRDIKVSNILVNN
Sbjct  191   YLVFEYMEHDLAGLVSNPDIKFTDSQIKCYMRQLLSGLEQCHLRGIMHRDIKVSNILVNN  250

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LKIGDFGLAN VS  SK P+TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  251   EGVLKIGDFGLANTVSPNSKHPLTSRVVTLWYRPPELLMGSTTYGVSVDLWSVGCVFAEL  310

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             F G+PILKGRTEVEQLHK FKLCGSP ++YW+++KLPLA +FKPQ +YES+L ERCK+ P
Sbjct  311   FMGKPILKGRTEVEQLHKTFKLCGSPPEEYWKKTKLPLATMFKPQTSYESSLWERCKDFP  370

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+L+ETLLSI+P KRGTASS+L SEYF+T PYAC PS +PK+ P++E+DAK RE   
Sbjct  371   PTAVNLLETLLSIDPSKRGTASSALMSEYFNTAPYACSPSLLPKYQPSKEMDAKNREAMN  430

Query  722   rrk--agsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsrrgngsgsrgAT  868
             R+K       R + +S   RR+ K +         A  E +  N         +      
Sbjct  431   RKKIGGKVRERDAVTSGRQRRVHKVLQDPKSVNKPALKENISQNACRDNGDGKAYHTKGK  490

Query  869   VARM---SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             V  +     K  YDT +EAA Q       G S  S PA +  SS + W
Sbjct  491   VGAIHKEQHKKLYDTKAEAA-QMVNGGYNGYSAYSGPAPVTGSSGFTW  537



>ref|XP_008465829.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
Length=725

 Score =   389 bits (999),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+SC ++KF ++Q+KC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  209  YLVFEYMEHDLAGLVSCPDVKFGEAQVKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  268

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLAN +++R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  269  EGILKLADFGLANVINSRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  328

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+P+LKGRTEVEQLHKIF+LCGSP +++W+++KLP AA+F+PQ+ YES+L E+CKE  
Sbjct  329  HLGKPLLKGRTEVEQLHKIFRLCGSPPEEFWKKTKLPHAAMFRPQHPYESSLDEKCKEFA  388

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV L+E+ LSIEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+D
Sbjct  389  PAAVRLLESFLSIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMD  440



>gb|KDO55462.1| hypothetical protein CISIN_1g005119mg [Citrus sinensis]
Length=478

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207  YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267  EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327  LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EID
Sbjct  387  TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEID  438



>ref|XP_006440664.1| hypothetical protein CICLE_v10019086mg [Citrus clementina]
 gb|ESR53904.1| hypothetical protein CICLE_v10019086mg [Citrus clementina]
Length=704

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267   EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  387   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  446

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  447   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  505

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  506   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  563

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  564   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAVKIAMLNQWSQLERP  623

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  624   DSFDASDGYH-SQELSL  639



>ref|XP_010258217.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nelumbo nucifera]
Length=697

 Score =   388 bits (996),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC +IKFS+ Q+KC+M+QLLSGLEHCH +GIMHRDIK SN+LVNN
Sbjct  194  YLVFEYMEHDLAGLSSCPDIKFSEPQVKCYMRQLLSGLEHCHSRGIMHRDIKGSNLLVNN  253

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF +   +Q +TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVFAEL
Sbjct  254  EGILKVADFGLANFYNPGHRQLLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFAEL  313

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+G+TEVEQLHKIFKLCGSP D+YW +SKLP A IF+P++ YES LRE CK+ P
Sbjct  314  LLGKPILQGKTEVEQLHKIFKLCGSPPDEYWNKSKLPHATIFRPKHPYESCLRETCKDFP  373

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+LIE LLS+EPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+EID
Sbjct  374  ATAVNLIEMLLSVEPYKRGTASSALASEYFTTKPYACDPSTLPKYPPNKEID  425



>gb|KDO55460.1| hypothetical protein CISIN_1g005119mg [Citrus sinensis]
Length=713

 Score =   389 bits (998),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 288/437 (66%), Gaps = 29/437 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS++QIKC+M QLL GLEHCH +G++HRDIK SN+LVNN
Sbjct  207   YLVFEYMEHDITGLLSCPDIKFSEAQIKCYMNQLLHGLEHCHSRGVLHRDIKGSNLLVNN  266

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL
Sbjct  267   EGVLKLADFGLANFSNTGHRQPLTSRVVTLWYRPPELLLGATDYGPSVDLWSVGCVFAEL  326

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  327   LIGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  386

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +AV+LIETLLS+EPYKR TAS++L SEYF TKPYACD SS+P +PP++EIDAK RE+AR
Sbjct  387   TTAVNLIETLLSVEPYKRATASAALASEYFSTKPYACDLSSLPIYPPSKEIDAKHREDAR  446

Query  722   rrkagsavrgsgssrNMRRLRKGM---APTEEVEANMLgsrrgngsg----srgATVARM  880
             R+K G  VRG+ + +  R+   GM   AP E+V      +++ NG             R 
Sbjct  447   RKKVGGRVRGAETRKTTRK-SHGMSKLAPVEDVAVRTQFAKKINGHSLHILKDDELSGRE  505

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K   D   EA+       S GD   S P Q+ +SS + W K+ +  A+      ++  
Sbjct  506   VQKPLVDNREEASH--VKNASHGDIPFSGPLQVSTSSGFAWAKRRKDDASIRSHTRSTSR  563

Query  1061  ITMNGGVEPPT------------------LQQSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
               +   +EP                    +  S+ D  G D  +           Q+E+P
Sbjct  564   GQVINALEPSAALHTRNNYDSRKHENGDIINGSRTDSRGHDSLEAVKIAMLNQWSQLERP  623

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF + D YH S+ELS+
Sbjct  624   DSFDASDGYH-SQELSL  639



>ref|XP_006593682.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=587

 Score =   384 bits (986),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S  +I FS+SQIKC+M+QLLSGLEHCH++GIMHRDIK+SNIL+NN
Sbjct  179  YLVFEYMEHDLAGLVSRPDIVFSESQIKCYMRQLLSGLEHCHMRGIMHRDIKLSNILLNN  238

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKIGDFGLAN +S  SK  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  239  EGVLKIGDFGLANTISTNSKHHLTSRVVTLWYRPPELLMGSTNYGVSVDLWSVGCVFAEL  298

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLP A +FKPQ  YES+LRERC + P
Sbjct  299  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHATMFKPQTNYESSLRERCADFP  358

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV+L+ETLLSI+P  RGTASS+L SEYF TKPYAC+ SS+PK+PP++E+D
Sbjct  359  ASAVNLLETLLSIDPGNRGTASSALMSEYFSTKPYACNASSLPKYPPSKEMD  410



>ref|XP_004491856.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X1 [Cicer arietinum]
Length=686

 Score =   387 bits (994),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S  +IKF+DSQIKC+M+QLLSGLE CH++GIMHRDIKVSNILVNN
Sbjct  191  YLVFEYMEHDLAGLVSNPDIKFTDSQIKCYMRQLLSGLEQCHLRGIMHRDIKVSNILVNN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKIGDFGLAN VS  SK P+TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  251  EGVLKIGDFGLANTVSPNSKHPLTSRVVTLWYRPPELLMGSTTYGVSVDLWSVGCVFAEL  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHK FKLCGSP ++YW+++KLPLA +FKPQ +YES+L ERCK+ P
Sbjct  311  FMGKPILKGRTEVEQLHKTFKLCGSPPEEYWKKTKLPLATMFKPQTSYESSLWERCKDFP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+L+ETLLSI+P KRGTASS+L SEYF+T PYAC PS +PK+ P++E+D
Sbjct  371  PTAVNLLETLLSIDPSKRGTASSALMSEYFNTAPYACSPSLLPKYQPSKEMD  422



>gb|KHN45673.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=532

 Score =   382 bits (980),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 220/452 (49%), Positives = 294/452 (65%), Gaps = 32/452 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKF++ QIKC+MKQLL+GLEHCH++G+MHRDIK SN+LVNN
Sbjct  32    YLVFEYMEHDITGLLSSPDIKFTEPQIKCYMKQLLAGLEHCHLRGVMHRDIKGSNLLVNN  91

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN+V++  +QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  92    EGVLKVADFGLANYVNSGHRQPLTSRVVTLWYRPPELLLGSTDYDPSVDLWSVGCVFAEL  151

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKP+  Y+S LR+  K+LP
Sbjct  152   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPEQPYDSCLRQSFKDLP  211

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              ++VHL++TLLS+EPYKRGTA+S+L+SEYF TKPYACDPSS+P +PP++EIDAK R+E+R
Sbjct  212   ATSVHLLQTLLSVEPYKRGTATSALSSEYFKTKPYACDPSSLPVYPPSKEIDAKHRDESR  271

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSSY  898
             ++ +G     +   ++ + L    +AP E + +    S++ NG         ++ +    
Sbjct  272   KKISGRVRGTATRKQSRKPLGFNKLAPAEGLASQTQTSQKVNGRYFHILEEEKIKIGDKA  331

Query  899   DTVSEAASQTA---TEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSITM  1069
                S    + A      SQGD   S P Q+ +SS + W K  +   +            +
Sbjct  332   QKSSSGKPEDAFHMKNASQGDIPLSGPLQVSTSSGFAWAKSRKDDTSFRSHCRTISRGHI  391

Query  1070  NGGVEPPTL---------QQSKDDPLGLDEQDGG---LAIRPKSMK----QVEQPLSFHS  1201
                +EP TL          Q   +  G      G   L I   SM+    + ++P SF +
Sbjct  392   FNALEPSTLNTRNNLDTTNQENKEFCGRYPNSRGHDLLEISKLSMQNQWSKFDRPDSFDA  451

Query  1202  PDIYHFSKELSVEEQPPPFLSPDLYHSREQSV  1297
              D YH S+ELS            LYH RE SV
Sbjct  452   SDEYH-SQELSTA----------LYH-REDSV  471



>ref|XP_003618563.1| Serine/threonine protein kinase [Medicago truncatula]
Length=608

 Score =   384 bits (986),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S S+I F+D+QIKC+M+QLLSGLEHCHV+GIMHRDIKVSNIL+NN
Sbjct  185  YLVFEYMEHDLAGLVSRSDIVFTDAQIKCYMRQLLSGLEHCHVRGIMHRDIKVSNILLNN  244

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN +S  +K P+TSRVVTLWYRPPELL+GAT YG +VDLWS GCVFAEL
Sbjct  245  EGVLKIADFGLANSISPNNKHPLTSRVVTLWYRPPELLMGATNYGVSVDLWSVGCVFAEL  304

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLP A +FKPQ  YES+LRERC + P
Sbjct  305  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHATMFKPQTNYESSLRERCIDFP  364

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +S + L+ETLLSI+P KRGTASS+L SEYF+T P+AC+PS++PK+ P++E+D
Sbjct  365  ESTIGLLETLLSIDPSKRGTASSALISEYFNTMPFACNPSNLPKYTPSKEMD  416



>gb|AES74781.2| cyclin-dependent kinase [Medicago truncatula]
Length=612

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S S+I F+D+QIKC+M+QLLSGLEHCHV+GIMHRDIKVSNIL+NN
Sbjct  185  YLVFEYMEHDLAGLVSRSDIVFTDAQIKCYMRQLLSGLEHCHVRGIMHRDIKVSNILLNN  244

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN +S  +K P+TSRVVTLWYRPPELL+GAT YG +VDLWS GCVFAEL
Sbjct  245  EGVLKIADFGLANSISPNNKHPLTSRVVTLWYRPPELLMGATNYGVSVDLWSVGCVFAEL  304

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLP A +FKPQ  YES+LRERC + P
Sbjct  305  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHATMFKPQTNYESSLRERCIDFP  364

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +S + L+ETLLSI+P KRGTASS+L SEYF+T P+AC+PS++PK+ P++E+D
Sbjct  365  ESTIGLLETLLSIDPSKRGTASSALISEYFNTMPFACNPSNLPKYTPSKEMD  416



>gb|KHN13194.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=608

 Score =   383 bits (984),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S  +I FS+SQIKC+M+QLLSGLEHCH++GIMHRDIK+SNIL+NN
Sbjct  179  YLVFEYMEHDLAGLVSRPDIVFSESQIKCYMRQLLSGLEHCHMRGIMHRDIKLSNILLNN  238

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKIGDFGLAN +S  SK  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  239  EGVLKIGDFGLANTISTNSKHHLTSRVVTLWYRPPELLMGSTNYGVSVDLWSVGCVFAEL  298

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLP A +FKPQ  YES+LRERC + P
Sbjct  299  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKTKLPHATMFKPQTNYESSLRERCADFP  358

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV+L+ETLLSI+P  RGTASS+L SEYF TKPYAC+ SS+PK+PP++E+D
Sbjct  359  ASAVNLLETLLSIDPGNRGTASSALMSEYFSTKPYACNASSLPKYPPSKEMD  410



>ref|XP_007138154.1| hypothetical protein PHAVU_009G184700g [Phaseolus vulgaris]
 ref|XP_007138155.1| hypothetical protein PHAVU_009G184700g [Phaseolus vulgaris]
 gb|ESW10148.1| hypothetical protein PHAVU_009G184700g [Phaseolus vulgaris]
 gb|ESW10149.1| hypothetical protein PHAVU_009G184700g [Phaseolus vulgaris]
Length=681

 Score =   385 bits (990),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 218/433 (50%), Positives = 295/433 (68%), Gaps = 22/433 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKF++ QIKC++KQLL+GLEHCH++G+MHRDIK SN+LVNN
Sbjct  185   YLVFEYMEHDITGLLSSPDIKFTEPQIKCYLKQLLAGLEHCHLRGVMHRDIKGSNLLVNN  244

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +G+LK+ DFGLAN+V+   +QP+TSRVVTLWYRPPELLLG+T YG  VDLWS GCVFAEL
Sbjct  245   KGVLKVADFGLANYVNPGHRQPLTSRVVTLWYRPPELLLGSTDYGPAVDLWSVGCVFAEL  304

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++++LP A +FKPQ  Y+S LR+  K+LP
Sbjct  305   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKTRLPHATLFKPQQPYDSCLRQSFKDLP  364

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              ++VHL++TLLS+EPYKRGTA+S+L+SEYF TKPYACDPSS+P +PP++EIDAK REE+R
Sbjct  365   ATSVHLLQTLLSVEPYKRGTATSALSSEYFKTKPYACDPSSLPIYPPSKEIDAKHREESR  424

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSSY  898
             ++ +G          + + L    +AP E++ +    S++ NG   R     ++ +    
Sbjct  425   KKVSGRVRGTETRKPSRKPLGFSKLAPAEDLASQTQTSQKVNGRSFRNHEEEKIKIGDKA  484

Query  899   DTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-SRSIT  1066
                S   ++ A+ +   SQGD   S P Q+ SSS + W K  +  A+        SR   
Sbjct  485   QKSSSGKAEDASHMKNASQGDIPLSGPLQVSSSSGFAWAKSRKDDASFRSHCRTISRGHI  544

Query  1067  MNGGVEPPTL----------QQSKDDPLGLDEQDGG--LAIRPKSMK----QVEQPLSFH  1198
              N   +P TL          Q++K+   G     G   L I   SM+    + ++P SF 
Sbjct  545   FNPSEQPSTLNSRNNLDTANQENKEFCGGCVNSRGQQLLEISTLSMQNQWSKFDRPDSFD  604

Query  1199  SPDIYHFSKELSV  1237
             + D YH S+ELS+
Sbjct  605   ASDEYH-SQELSM  616



>ref|XP_006603881.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=583

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S  +I FS+SQIKC+M+QLLSGLEHCH++GIMHRDIKVSNIL+NN
Sbjct  178  YLVFEYMEHDLAGLVSRPDIVFSESQIKCYMRQLLSGLEHCHMRGIMHRDIKVSNILLNN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKIGDFGLAN ++   K  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  238  EGVLKIGDFGLANTINTNGKHHLTSRVVTLWYRPPELLMGSTNYGVSVDLWSVGCVFAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +D+W++++LP A +FKPQ  YES+LRERC + P
Sbjct  298  FLGKPILKGRTEVEQLHKIFKLCGSPPEDFWKKTRLPHATMFKPQTNYESSLRERCADFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV+L+ETLLSI+   RGTASS+L SEYF TKPYAC+ SS+PK+PP++E+D
Sbjct  358  ASAVNLLETLLSIDSGNRGTASSALMSEYFSTKPYACNASSLPKYPPSKEMD  409



>ref|XP_011035812.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Populus euphratica]
Length=659

 Score =   384 bits (987),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 260/342 (76%), Gaps = 11/342 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLS  +IKF++SQ+KC+MKQLL G+EH H  GIMHRDIK SNIL+NN
Sbjct  230   YLVFEYMEHDLSGLLSSPDIKFTESQVKCYMKQLLCGIEHFHSLGIMHRDIKASNILLNN  289

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKIGDFGLAN +++R++  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVF E+
Sbjct  290   EGILKIGDFGLANVLNSRNQNQLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFGEI  349

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              FG+P+LKGRTEVEQLHKIFKLCGSPSDD+W++SKL  A +FKPQ+ YES+L+ERCK++ 
Sbjct  350   LFGKPLLKGRTEVEQLHKIFKLCGSPSDDFWKRSKLSNATMFKPQHPYESSLQERCKDIS  409

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ L+ETLLSIEP KRGTAS++L S+YF T PYAC+PSS+P++PPN+E+DAK+REEAR
Sbjct  410   AAALDLMETLLSIEPEKRGTASTALLSQYFRTMPYACEPSSLPQYPPNKEMDAKYREEAR  469

Query  722   rrkagsavrgsgssrNMRRLRK--------GMAPTEEVEANMLgsrrgngsgsrgATVAR  877
             R+KAGS +R  G  R  RR+ +          AP EEV+ N         + +      R
Sbjct  470   RKKAGSRMRDPGLPRKPRRVHRTFQEQNFNKFAPKEEVKDN--SEFVRMANDNNAYVKGR  527

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                    +  S+  S+TA +V++G    + PAQ+ +SS + W
Sbjct  528   RGASREQNLFSDTISETA-QVTKGHYSFTGPAQVTASSGFAW  568



>gb|KHN48786.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=582

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL+S  +I FS+SQIKC+M+QLLSGLEHCH++GIMHRDIKVSNIL+NN
Sbjct  178  YLVFEYMEHDLAGLVSRPDIVFSESQIKCYMRQLLSGLEHCHMRGIMHRDIKVSNILLNN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKIGDFGLAN ++   K  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  238  EGVLKIGDFGLANTINTNGKHHLTSRVVTLWYRPPELLMGSTNYGVSVDLWSVGCVFAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +D+W++++LP A +FKPQ  YES+LRERC + P
Sbjct  298  FLGKPILKGRTEVEQLHKIFKLCGSPPEDFWKKTRLPHATMFKPQTNYESSLRERCADFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV+L+ETLLSI+   RGTASS+L SEYF TKPYAC+ SS+PK+PP++E+D
Sbjct  358  ASAVNLLETLLSIDSGNRGTASSALMSEYFSTKPYACNASSLPKYPPSKEMD  409



>ref|XP_006602932.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X2 [Glycine max]
Length=670

 Score =   384 bits (987),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  184  YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  243

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN +   SKQP+TSRVVTLWYRPPE LLG+T YG +VDLWS GCVFAEL
Sbjct  244  EGVLKIADFGLANTLVPNSKQPLTSRVVTLWYRPPENLLGSTNYGVSVDLWSVGCVFAEL  303

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  Y+++L+ERC+  P
Sbjct  304  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPRTNYKTSLKERCRGFP  363

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+L+ETLLSI+P KRGTASS+L SEYF TKPYAC+PS +PK+PP++E+D
Sbjct  364  ATAVNLLETLLSIDPSKRGTASSALMSEYFSTKPYACNPSLLPKYPPSKEMD  415



>ref|XP_003551748.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X1 [Glycine max]
Length=673

 Score =   384 bits (987),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  184  YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  243

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN +   SKQP+TSRVVTLWYRPPE LLG+T YG +VDLWS GCVFAEL
Sbjct  244  EGVLKIADFGLANTLVPNSKQPLTSRVVTLWYRPPENLLGSTNYGVSVDLWSVGCVFAEL  303

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  Y+++L+ERC+  P
Sbjct  304  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPRTNYKTSLKERCRGFP  363

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+L+ETLLSI+P KRGTASS+L SEYF TKPYAC+PS +PK+PP++E+D
Sbjct  364  ATAVNLLETLLSIDPSKRGTASSALMSEYFSTKPYACNPSLLPKYPPSKEMD  415



>ref|XP_002324078.2| hypothetical protein POPTR_0017s12410g [Populus trichocarpa]
 gb|EEF04211.2| hypothetical protein POPTR_0017s12410g [Populus trichocarpa]
Length=640

 Score =   383 bits (984),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 244/338 (72%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLS  +IKF++SQ+KC+MKQLL G+EH H  GIMHRDIK SNIL+NN
Sbjct  228   YLVFEYMEHDLSGLLSSPDIKFTESQVKCYMKQLLCGIEHVHSLGIMHRDIKASNILLNN  287

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKIGDFGLAN +++R++  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVF E+
Sbjct  288   EGILKIGDFGLANVLNSRNQNQLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFGEI  347

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              FG+P+LKGRTEVEQLHKIFKLCGSPSDD+W++SKL  A +FKPQ+ YES+L+ERCK++P
Sbjct  348   LFGKPLLKGRTEVEQLHKIFKLCGSPSDDFWKRSKLSNATMFKPQHPYESSLQERCKDIP  407

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A++L+ETLLSIEP KRGTAS++L S+YF T PYAC+PSS+P++PPN+E+D        
Sbjct  408   AAALNLMETLLSIEPEKRGTASAALLSQYFRTTPYACEPSSLPQYPPNKEMD--------  459

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEAN----MLgsrrgngsgsrgATVARMSLK  889
               K     R   +   MR       P  EV+ N     L +     +  R       +L 
Sbjct  460   -AKYREEARRKKAGSRMRDPGLPRKPRREVKDNSEFVRLANDNNAYAKGRKGASREQNLF  518

Query  890   SSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             S  DT+SE A  T     +G    + PAQ+ +SS + W
Sbjct  519   S--DTISETAQAT-----KGHYSFTGPAQVTASSGFAW  549



>ref|XP_009795917.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=691

 Score =   385 bits (988),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 249/342 (73%), Gaps = 10/342 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD+SGLLS  E++FS+SQ+KC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  197   YLVFEYMEHDISGLLSRPEVEFSESQVKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  256

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  257   DGILKVADFGLANFCNPGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  316

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  317   LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  376

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIETLLS+EP+KRGTASS+L SEYF TKP+ACDPSS+PK+PP++EIDAK  EEA+
Sbjct  377   KSAVSLIETLLSVEPHKRGTASSALVSEYFKTKPHACDPSSLPKYPPSKEIDAKHCEEAK  436

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEV-----EANMLgsrrgngsgsrgATVAR  877
             R+K     RG  ++R   R       +AP E +       N                +  
Sbjct  437   RKKPSGRARGPETTRKSTRKHNATNKLAPEENLPVQNQGVNKTNGSSLGAQREADVIIGL  496

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             +  K S D++ EA+       SQGD   S P Q+  SS + W
Sbjct  497   VRPKPSVDSMGEASH--IKNASQGDVPFSGPLQVSGSSGFAW  536



>ref|XP_008445783.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
 ref|XP_008445835.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
Length=697

 Score =   385 bits (988),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 243/347 (70%), Gaps = 22/347 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYM+HD++GLLSC +I FS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  203   YLVFEYMDHDITGLLSCPDITFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  262

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF ++  +QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  263   EGVLKVADFGLANFCNSGHRQPLTSRVVTLWYRPPELLLGSTDYNASVDLWSVGCVFAEL  322

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ+ Y + LR+  K+ P
Sbjct  323   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQHPYNNCLRQTFKDHP  382

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              + V+L+ETLLS+EPYKRG ASS+L SEYF TKPYACDPSSMP +PPN+EID    ++  
Sbjct  383   STTVNLLETLLSVEPYKRGVASSALTSEYFSTKPYACDPSSMPIYPPNKEID---AKQRE  439

Query  722   rrkagsavrgsgssrNMRRLRK-----GMAPTEEV--------EANMLgsrrgngsgsrg  862
               +       +    N R  RK      +AP E++        + ++           +G
Sbjct  440   ETRRKKGSGRARGLDNRRLTRKHLGISKLAPAEDLSVSARDLHKISINAQNLKEEKVIKG  499

Query  863   ATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
               V +MS+    +T+           SQGD   S P Q+ +SS + W
Sbjct  500   VEVEKMSMDKLEETIH------VKNASQGDLPFSGPLQVSTSSGFAW  540



>ref|XP_011035811.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Populus euphratica]
Length=705

 Score =   384 bits (987),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 260/342 (76%), Gaps = 11/342 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDLSGLLS  +IKF++SQ+KC+MKQLL G+EH H  GIMHRDIK SNIL+NN
Sbjct  230   YLVFEYMEHDLSGLLSSPDIKFTESQVKCYMKQLLCGIEHFHSLGIMHRDIKASNILLNN  289

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKIGDFGLAN +++R++  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVF E+
Sbjct  290   EGILKIGDFGLANVLNSRNQNQLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFGEI  349

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              FG+P+LKGRTEVEQLHKIFKLCGSPSDD+W++SKL  A +FKPQ+ YES+L+ERCK++ 
Sbjct  350   LFGKPLLKGRTEVEQLHKIFKLCGSPSDDFWKRSKLSNATMFKPQHPYESSLQERCKDIS  409

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A+ L+ETLLSIEP KRGTAS++L S+YF T PYAC+PSS+P++PPN+E+DAK+REEAR
Sbjct  410   AAALDLMETLLSIEPEKRGTASTALLSQYFRTMPYACEPSSLPQYPPNKEMDAKYREEAR  469

Query  722   rrkagsavrgsgssrNMRRLRK--------GMAPTEEVEANMLgsrrgngsgsrgATVAR  877
             R+KAGS +R  G  R  RR+ +          AP EEV+ N         + +      R
Sbjct  470   RKKAGSRMRDPGLPRKPRRVHRTFQEQNFNKFAPKEEVKDN--SEFVRMANDNNAYVKGR  527

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                    +  S+  S+TA +V++G    + PAQ+ +SS + W
Sbjct  528   RGASREQNLFSDTISETA-QVTKGHYSFTGPAQVTASSGFAW  568



>ref|XP_009617164.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=691

 Score =   384 bits (985),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 249/342 (73%), Gaps = 10/342 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD+SGLLS  E++FS+SQ+KC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  197   YLVFEYMEHDISGLLSRPEVEFSESQVKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  256

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  257   DGILKVADFGLANFCNLGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  316

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  317   LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  376

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             KSAV LIETLLS+EP+KRGTASS+L SEYF TKP+ACDPSS+PK+PP++EIDAK  EEA+
Sbjct  377   KSAVSLIETLLSVEPHKRGTASSALVSEYFKTKPHACDPSSLPKYPPSKEIDAKHCEEAK  436

Query  722   rrkagsavrgsgssrNMRRLRKG---MAPTEEV-----EANMLgsrrgngsgsrgATVAR  877
             R+K     RG  ++R   R       +AP E++       N                +  
Sbjct  437   RKKPSGRARGPETTRKSTRKHNATNKLAPEEKLPVQNQGVNKTNGSSLCAQREGDVIIGL  496

Query  878   MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                K S D++ EA+       SQGD   S P Q+  SS + W
Sbjct  497   TRPKPSVDSMGEASH--IKNASQGDVPFSGPLQVSGSSGFAW  536



>gb|AES77534.2| cyclin-dependent kinase C [Medicago truncatula]
Length=690

 Score =   383 bits (984),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 209/233 (90%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLLS  ++KF+DSQIKC+M+QLLSGLEH H++GIMHRDIKVSNILVNN
Sbjct  195  YLVFEYMEHDLAGLLSNPDVKFTDSQIKCYMRQLLSGLEHFHLRGIMHRDIKVSNILVNN  254

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKIGDFGLAN VS  SK P+TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  255  EGILKIGDFGLANTVSPNSKHPLTSRVVTLWYRPPELLMGSTNYGVTVDLWSVGCVFAEL  314

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKE-L  538
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKPQ +YES+L +RC+  L
Sbjct  315  FMGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPQISYESSLEDRCQGFL  374

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            P +AV L++TLLS++P KRGTASS+L SEYF+T PYAC+PS +PK+ P++E+D
Sbjct  375  PATAVSLLQTLLSVDPSKRGTASSALMSEYFNTAPYACNPSLLPKYIPSKEMD  427



>ref|XP_006844845.1| hypothetical protein AMTR_s00058p00088010 [Amborella trichopoda]
 gb|ERN06520.1| hypothetical protein AMTR_s00058p00088010 [Amborella trichopoda]
Length=697

 Score =   384 bits (985),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDL+GL SC +I FS+SQ+KC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  196  YLVFEYMDHDLAGLSSCPDIIFSESQVKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLANFV+   KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  256  EGILKIADFGLANFVNPSHKQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A IFKPQ+ YES+L E  K +P
Sbjct  316  LLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATIFKPQHPYESSLAETLKGIP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A  LI  LLSIE YKRG+AS +L+SEYF TKPYACDPSS+PK+PPN+EID
Sbjct  376  STASDLIGNLLSIETYKRGSASVALSSEYFTTKPYACDPSSLPKYPPNKEID  427



>ref|XP_010258718.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Nelumbo nucifera]
Length=591

 Score =   380 bits (976),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC  IK S++Q+KC+M QLLSGLEHCH   +MHRDIK SNILVNN
Sbjct  169  YLVFEYMEHDLAGLASCPNIKLSEAQVKCYMHQLLSGLEHCHSCNVMHRDIKGSNILVNN  228

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLAN+ S   KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  229  EGILKIADFGLANYFSPGHKQPLTSRVVTLWYRPPELLLGSTDYRASVDLWSVGCVFAEL  288

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP D+YW+ SK+P   +FKPQ+ Y S LRE CKELP
Sbjct  289  FLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKNSKVPHRTMFKPQHPYGSCLRETCKELP  348

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV LIET LS+EP+KRGTASS+L SEYF TKPYACDPS++PK+PPN+E+D
Sbjct  349  ATAVDLIETFLSLEPHKRGTASSALVSEYFTTKPYACDPSTLPKYPPNKEMD  400



>ref|XP_010553990.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010553992.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=692

 Score =   383 bits (983),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGL S  +IKF++SQIKC+MKQLL GLEHCH++G++HRDIK SNILVNN
Sbjct  197  YLVFEYMEHDLSGLSSSPDIKFTESQIKCYMKQLLLGLEHCHLRGVIHRDIKASNILVNN  256

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+GDFGLAN ++ R+K  +TSRVVTLWYR PELL+G+  Y  +VDLWS GCVFAE+
Sbjct  257  QGILKVGDFGLANIITPRNKNQLTSRVVTLWYRAPELLMGSMSYRVSVDLWSVGCVFAEI  316

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP DD+W++ KLP A +FKPQ+ YESTLR+RC E  
Sbjct  317  LMGKPILKGRTEIEQLHKIYKLCGSPPDDFWKKCKLPQATVFKPQHTYESTLRDRCSEFT  376

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+L+ET LSIEP KRGTASS+LNSEYF TKPYACDPSS+PK+PPN+EID
Sbjct  377  VNAVNLLETFLSIEPGKRGTASSALNSEYFLTKPYACDPSSLPKYPPNKEID  428



>gb|KHN13587.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=721

 Score =   384 bits (986),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++  +IKF+DSQIKC+M+QLLSG+EHCH+KGIMHRDIKVSNILVNN
Sbjct  271  YLVFEYMEHDLAGLVASPDIKFTDSQIKCYMRQLLSGIEHCHLKGIMHRDIKVSNILVNN  330

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN +   SKQP+TSRVVTLWYRPPE LLG+T YG +VDLWS GCVFAEL
Sbjct  331  EGVLKIADFGLANTLVPNSKQPLTSRVVTLWYRPPENLLGSTNYGVSVDLWSVGCVFAEL  390

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKP+  Y+++L+ERC+  P
Sbjct  391  FLGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPRTNYKTSLKERCRGFP  450

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV+L+ETLLSI+P KRGTASS+L SEYF TKPYAC+PS +PK+PP++E+D
Sbjct  451  ATAVNLLETLLSIDPSKRGTASSALMSEYFSTKPYACNPSLLPKYPPSKEMD  502



>ref|XP_004137420.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
 ref|XP_004157463.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
 gb|KGN64024.1| hypothetical protein Csa_1G038910 [Cucumis sativus]
Length=697

 Score =   383 bits (984),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 241/343 (70%), Gaps = 14/343 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYM+HD++GLLSC +I FS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  203   YLVFEYMDHDITGLLSCPDITFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  262

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  263   EGVLKVADFGLANFCNTGHRQPLTSRVVTLWYRPPELLLGSTDYNASVDLWSVGCVFAEL  322

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ+ Y + LR+  K+ P
Sbjct  323   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQHPYNNCLRQTFKDHP  382

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              + V+L+ETLLS+EPYKRG ASS+L SEYF TKPYACDPSSMP +PPN+EID    ++  
Sbjct  383   STTVNLLETLLSVEPYKRGVASSALISEYFSTKPYACDPSSMPIYPPNKEID---AKQRE  439

Query  722   rrkagsavrgsgssrNMRRLRK-----GMAPTEE--VEANMLgsrrgngsgsrgATVAR-  877
               +       S    N R  RK      +AP E+  V A  L     N    +   V + 
Sbjct  440   ETRRKKGSGRSRGLDNRRLTRKHLGISKLAPAEDLSVSARDLHKISINAQNLKEEKVIKG  499

Query  878   -MSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
               + K S D + E         SQGD   S P Q+ +SS + W
Sbjct  500   VEAEKMSMDKLEETIH--VKNSSQGDIPFSGPLQVSTSSGFAW  540



>ref|XP_004163820.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228141 
[Cucumis sativus]
Length=875

 Score =   388 bits (996),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 258/364 (71%), Gaps = 30/364 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+SC ++ FS++Q+KC+M+QLLS +EHCH++GIMHRDIK SNILVNN
Sbjct  361   YLVFEYMEHDLAGLVSCPDVMFSEAQVKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNN  420

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLAN ++ R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  421   EGILKLADFGLANVINTRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAEL  480

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP +++W++ KLP AA+F+PQ+AYES+L E+CKE  
Sbjct  481   HLGKPLLKGRTEVEQLHKIFKLCGSPPEEFWKKXKLPHAAMFRPQHAYESSLDEKCKEFA  540

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
               AV L+E+ L+IEPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+AR
Sbjct  541   PVAVRLLESFLAIEPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDAR  600

Query  722   rrkagsavrgsgssrNM--RRLRKG--------MAPTEEVEANMLgsrrgngsgsrgATV  871
             R+   +  R   +      RR+R+         +A  EE+ A  + +     S   G+  
Sbjct  601   RKNRVNNARAKETGATQRPRRVRRNFQEFNSHKVAIKEELSAEDVQNINNQPSRRNGSNN  660

Query  872   ARMSLKSS-------------------YDTVSEAASQTATEVSQ-GDSICSVPAQMISSS  991
                +   S                   YDT SE +   AT  +Q GDS  + P  + +SS
Sbjct  661   NNTTNNLSKDQQGDVFQRDPQKKQQQLYDTTSETSQAAATAPNQGGDSAFTAPMLVSASS  720

Query  992   SYGW  1003
              + W
Sbjct  721   GFAW  724



>ref|XP_002278818.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=712

 Score =   383 bits (984),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 259/347 (75%), Gaps = 15/347 (4%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+SC +IKFS +Q+KC+M+QLLS +EHCH+ G+MHRDIK SNILVNN
Sbjct  221   YLVFEYMEHDLAGLVSCPDIKFSVAQVKCYMQQLLSAIEHCHLLGVMHRDIKASNILVNN  280

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN +  + KQ +TSRVVTLWYRPPEL+LG+T YG +VDLWS GCVFAEL
Sbjct  281   EGVLKLADFGLANILRPKHKQILTSRVVTLWYRPPELILGSTSYGVSVDLWSVGCVFAEL  340

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+ KGRTEVEQLHKIFKLCGSP D+YW++SK P A +FKP ++YESTLRER +E P
Sbjct  341   LIGKPLFKGRTEVEQLHKIFKLCGSPPDEYWKKSKFPHATMFKPHHSYESTLRERFREYP  400

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A++LIETLLS+EP KRGTASS+L SEYF+TKPYAC+PSS+PK+PPN+EIDAK REEAR
Sbjct  401   TTALNLIETLLSVEPPKRGTASSALISEYFNTKPYACEPSSLPKYPPNKEIDAKCREEAR  460

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSL----  886
             R+  G  VRGSG+ R  RR R     P    +  +  S       + G++ A +S     
Sbjct  461   RKTGGVGVRGSGALRKPRRSRTSSQEPNSTSKFAVTESNTQYSRRNSGSSSAHISKGKGR  520

Query  887   --------KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                     K S++T S+ +    + VS+GD +  VP Q+ +  S+ W
Sbjct  521   GFDYGDSEKPSFETSSQISQ--VSNVSRGDFLFQVPKQITAPCSFAW  565



>ref|XP_003523004.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
Length=674

 Score =   382 bits (980),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 220/452 (49%), Positives = 293/452 (65%), Gaps = 32/452 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKF++ QIKC+MKQLL+GLEHCH++G+MHRDIK SN+LVNN
Sbjct  179   YLVFEYMEHDITGLLSSPDIKFTEPQIKCYMKQLLAGLEHCHLRGVMHRDIKGSNLLVNN  238

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN+V++  +QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  239   EGVLKVADFGLANYVNSGHRQPLTSRVVTLWYRPPELLLGSTDYDPSVDLWSVGCVFAEL  298

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKP+  Y+S LR+  K+LP
Sbjct  299   LVGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPEQPYDSCLRQSFKDLP  358

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              ++VHL++TLLS+EPYKRGTA+S+L+SEYF TKPYACDPSS+P +PP++EIDAK R+E+R
Sbjct  359   TTSVHLLQTLLSVEPYKRGTATSALSSEYFKTKPYACDPSSLPVYPPSKEIDAKHRDESR  418

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSSY  898
             ++ +G     +    + + L    +AP E + +    S++ NG         ++ +    
Sbjct  419   KKISGRVRGTATRKPSRKPLGFNKLAPAEGLASQTQTSQKVNGRSFHILEEEKIKIGDKA  478

Query  899   DTVSEAASQTA---TEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSITM  1069
                S    + A      SQGD   S P Q+ +SS + W K  +   +            +
Sbjct  479   QKSSSGKPEDAFHMKNASQGDIPLSGPLQVSTSSGFAWAKSRKDDTSFRSHCRTISRGHI  538

Query  1070  NGGVEPPTL---------QQSKDDPLGLDEQDGG---LAIRPKSMK----QVEQPLSFHS  1201
                +EP TL          Q   +  G      G   L I   SM+    + ++P SF +
Sbjct  539   FNALEPSTLNTRNNLDTTNQENKEFCGRYPNSRGHDLLEISKLSMQNQWSKFDRPDSFDA  598

Query  1202  PDIYHFSKELSVEEQPPPFLSPDLYHSREQSV  1297
              D YH S+ELS            LYH RE SV
Sbjct  599   SDEYH-SQELSTA----------LYH-REDSV  618



>ref|XP_009406003.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=676

 Score =   381 bits (979),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C +I+FS++Q+KC+M+QLLSGLEHCH++G++HRDIK +N+LVNN
Sbjct  191  YLVFEYMEHDLAGLSACPDIEFSEAQVKCYMQQLLSGLEHCHLRGVIHRDIKGANLLVNN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLANF S + KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  251  DGVLKMADFGLANFCSTKHKQPLTSRVVTLWYRPPELLLGSTNYEVSVDLWSVGCVFAEM  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A IFKP + YES L++  K LP
Sbjct  311  FLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATIFKPHHPYESCLQDMFKNLP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A++L+ET LS+EPYKRGTASS+L SEYF TKPYAC+PSS+PK+PPN+EID
Sbjct  371  ATAINLLETFLSVEPYKRGTASSALASEYFRTKPYACEPSSLPKYPPNKEID  422



>ref|XP_009406002.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=677

 Score =   381 bits (979),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C +I+FS++Q+KC+M+QLLSGLEHCH++G++HRDIK +N+LVNN
Sbjct  191  YLVFEYMEHDLAGLSACPDIEFSEAQVKCYMQQLLSGLEHCHLRGVIHRDIKGANLLVNN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLANF S + KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  251  DGVLKMADFGLANFCSTKHKQPLTSRVVTLWYRPPELLLGSTNYEVSVDLWSVGCVFAEM  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A IFKP + YES L++  K LP
Sbjct  311  FLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATIFKPHHPYESCLQDMFKNLP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A++L+ET LS+EPYKRGTASS+L SEYF TKPYAC+PSS+PK+PPN+EID
Sbjct  371  ATAINLLETFLSVEPYKRGTASSALASEYFRTKPYACEPSSLPKYPPNKEID  422



>ref|XP_009406001.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=679

 Score =   381 bits (979),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C +I+FS++Q+KC+M+QLLSGLEHCH++G++HRDIK +N+LVNN
Sbjct  191  YLVFEYMEHDLAGLSACPDIEFSEAQVKCYMQQLLSGLEHCHLRGVIHRDIKGANLLVNN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLANF S + KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  251  DGVLKMADFGLANFCSTKHKQPLTSRVVTLWYRPPELLLGSTNYEVSVDLWSVGCVFAEM  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP A IFKP + YES L++  K LP
Sbjct  311  FLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATIFKPHHPYESCLQDMFKNLP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A++L+ET LS+EPYKRGTASS+L SEYF TKPYAC+PSS+PK+PPN+EID
Sbjct  371  ATAINLLETFLSVEPYKRGTASSALASEYFRTKPYACEPSSLPKYPPNKEID  422



>ref|XP_003621316.1| Cyclin-dependent protein kinase-like protein [Medicago truncatula]
Length=751

 Score =   383 bits (983),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 209/233 (90%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLLS  ++KF+DSQIKC+M+QLLSGLEH H++GIMHRDIKVSNILVNN
Sbjct  195  YLVFEYMEHDLAGLLSNPDVKFTDSQIKCYMRQLLSGLEHFHLRGIMHRDIKVSNILVNN  254

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKIGDFGLAN VS  SK P+TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL
Sbjct  255  EGILKIGDFGLANTVSPNSKHPLTSRVVTLWYRPPELLMGSTNYGVTVDLWSVGCVFAEL  314

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKE-L  538
            F G+PILKGRTEVEQLHKIFKLCGSP +++W+++KLPLA +FKPQ +YES+L +RC+  L
Sbjct  315  FMGKPILKGRTEVEQLHKIFKLCGSPPEEFWKKNKLPLATMFKPQISYESSLEDRCQGFL  374

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            P +AV L++TLLS++P KRGTASS+L SEYF+T PYAC+PS +PK+ P++E+D
Sbjct  375  PATAVSLLQTLLSVDPSKRGTASSALMSEYFNTAPYACNPSLLPKYIPSKEMD  427



>ref|XP_010258708.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nelumbo nucifera]
Length=669

 Score =   380 bits (976),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC  IK S++Q+KC+M QLLSGLEHCH   +MHRDIK SNILVNN
Sbjct  169  YLVFEYMEHDLAGLASCPNIKLSEAQVKCYMHQLLSGLEHCHSCNVMHRDIKGSNILVNN  228

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLAN+ S   KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  229  EGILKIADFGLANYFSPGHKQPLTSRVVTLWYRPPELLLGSTDYRASVDLWSVGCVFAEL  288

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP D+YW+ SK+P   +FKPQ+ Y S LRE CKELP
Sbjct  289  FLGKPILQGRTEVEQLHKIFKLCGSPPDEYWKNSKVPHRTMFKPQHPYGSCLRETCKELP  348

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +AV LIET LS+EP+KRGTASS+L SEYF TKPYACDPS++PK+PPN+E+D
Sbjct  349  ATAVDLIETFLSLEPHKRGTASSALVSEYFTTKPYACDPSTLPKYPPNKEMD  400



>ref|XP_010318824.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Solanum lycopersicum]
Length=690

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD+SGLLSC E++FS+SQIKC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDISGLLSCPEVEFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  256  DGILKVADFGLANFCNLGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  316  LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS+V LIETLLS+EP KRGTASS+L SEYF TKP+ACDP S+PK+PP++EID
Sbjct  376  KSSVSLIETLLSVEPPKRGTASSALASEYFKTKPHACDPLSLPKYPPSKEID  427



>ref|XP_004235975.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Solanum lycopersicum]
Length=691

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD+SGLLSC E++FS+SQIKC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDISGLLSCPEVEFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  256  DGILKVADFGLANFCNLGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  316  LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS+V LIETLLS+EP KRGTASS+L SEYF TKP+ACDP S+PK+PP++EID
Sbjct  376  KSSVSLIETLLSVEPPKRGTASSALASEYFKTKPHACDPLSLPKYPPSKEID  427



>gb|KHG22711.1| hypothetical protein F383_28957 [Gossypium arboreum]
Length=689

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 251/351 (72%), Gaps = 25/351 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL SC +I F+++Q+KC+MKQLL GLEHCH++G+MHRDIK SNILVNN
Sbjct  200   YLVFEYMEHDLAGLSSCPDINFTEAQVKCYMKQLLMGLEHCHLRGVMHRDIKASNILVNN  259

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+GDFGLAN +++++K  +TSRVVTLWYRPPELL+G+T Y  +VDLWS GCVFAE+
Sbjct  260   QGILKLGDFGLANILTSKNKNQLTSRVVTLWYRPPELLMGSTSYEVSVDLWSVGCVFAEV  319

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PILKGRTEVEQLHKIFKLCGSP D+YW++ KLP + +FKPQ+ YES L++RCK++P
Sbjct  320   LMGKPILKGRTEVEQLHKIFKLCGSPPDEYWKKLKLPHSTMFKPQHPYESCLQQRCKDIP  379

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +A++L+E LLS+EP+KRGTASSSL S+YFHTKP+ CDPSS+PK+ PN+EID   + +  
Sbjct  380   STALNLLEILLSVEPHKRGTASSSLMSKYFHTKPFPCDPSSLPKYSPNKEID-AKQRDDL  438

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgngsgsrgATVARMSL-----  886
             RRK    VR  G +R  RR RK +      EAN              A     +      
Sbjct  439   RRKKLGGVRDPGVTRKTRRPRKTLQ-----EANNFNKTITKEDLRDNARFGGKNQGITAN  493

Query  887   ------------KSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
                         + ++DT+SE +  T   +SQGD + + P  +  S+S+ W
Sbjct  494   NPKPKDGIVHLNQPAFDTMSETSQLTT--MSQGDIVTAPPPVITGSNSFSW  542



>ref|XP_006345172.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Solanum tuberosum]
Length=694

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD+SGLLSC E++FS+SQIKC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  199  YLVFEYMEHDISGLLSCPEVEFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  258

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  259  DGILKVADFGLANFCNLGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  318

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  319  LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  378

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS+V LIETLLS+EP KRGTASS+L SEYF T+P+ACDP S+PK+PP++EID
Sbjct  379  KSSVSLIETLLSVEPPKRGTASSALASEYFKTRPHACDPLSLPKYPPSKEID  430



>ref|XP_009125105.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
Length=654

 Score =   379 bits (972),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++SQIKC+M+QLL GLEHCH++G++HRDIK SNILVNN
Sbjct  189  YLVFEYMEHDLAGLSSNPDIRFTESQIKCYMQQLLWGLEHCHMRGVIHRDIKASNILVNN  248

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+A++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  249  KGVLKLGDFGLANVVTAKNKHQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  308

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W++++LP A  F+PQ+ YE+TLRERCKEL 
Sbjct  309  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKKTRLPHATSFRPQHTYEATLRERCKELS  368

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V L+ETLLS+E YKRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  369  TTGVLLLETLLSMEAYKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  420



>ref|XP_006345173.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Solanum tuberosum]
Length=693

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD+SGLLSC E++FS+SQIKC+MKQLLSG+EHCH +G+MHRDIK +N+LVNN
Sbjct  199  YLVFEYMEHDISGLLSCPEVEFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGANLLVNN  258

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T+YG +VDLWS GCVF EL
Sbjct  259  DGILKVADFGLANFCNLGRKQPLTSRVVTLWYRPPELLLGSTEYGASVDLWSVGCVFGEL  318

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ+ YES L +  K+L 
Sbjct  319  LTGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQHPYESCLWDTFKDLT  378

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS+V LIETLLS+EP KRGTASS+L SEYF T+P+ACDP S+PK+PP++EID
Sbjct  379  KSSVSLIETLLSVEPPKRGTASSALASEYFKTRPHACDPLSLPKYPPSKEID  430



>emb|CDY37004.1| BnaC06g12590D [Brassica napus]
Length=650

 Score =   377 bits (969),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++SQIKC+M+QLL GLEHCH++G++HRDIK SNILVNN
Sbjct  189  YLVFEYMEHDLAGLSSNPDIRFTESQIKCYMQQLLLGLEHCHMRGVIHRDIKASNILVNN  248

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+A++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  249  KGVLKLGDFGLANVVTAKNKHQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  308

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP+D +W++++LP A  F+PQ+ YE+TLRERCK+L 
Sbjct  309  LMGKPILKGRTEIEQLHKIYKLCGSPADSFWKKTRLPHATSFRPQHTYEATLRERCKDLS  368

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V L+ETLLS+E YKRGTASS+LNSEYF T+PY+CDPSS+PK+PPN+E+D
Sbjct  369  TTGVLLLETLLSMEAYKRGTASSALNSEYFLTRPYSCDPSSLPKYPPNKEMD  420



>ref|XP_009139852.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g54610 [Brassica rapa]
Length=642

 Score =   377 bits (969),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 205/233 (88%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGL S  +I+F++SQIKC+M+QLL GLEHCH++G++HRDIK SNILVNN
Sbjct  183  YLVFEYMEHDLSGLSSNPDIRFTESQIKCYMQQLLWGLEHCHMQGVIHRDIKASNILVNN  242

Query  182  EGILKIGDF-GLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
            +G+LK+GDF GLAN V+A++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE
Sbjct  243  KGVLKVGDFIGLANVVTAKNKHQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAE  302

Query  359  LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
            +  G+PILKGRTE+EQLHKI+KLCGSP D +W ++ LP A  F+PQ+ YE+TLRERC+EL
Sbjct  303  ILMGKPILKGRTEIEQLHKIYKLCGSPPDSFWRKTWLPHATSFRPQHTYEATLRERCREL  362

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            P S V L+ETLLS+EPYKRGTASS+LNSEYF T PYACDPSS+PK+PPN+E+D
Sbjct  363  PTSGVSLLETLLSMEPYKRGTASSALNSEYFLTTPYACDPSSLPKYPPNKEMD  415



>ref|XP_010106628.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC11007.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=812

 Score =   382 bits (981),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 226/445 (51%), Positives = 292/445 (66%), Gaps = 24/445 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLSC +IKFS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LV N
Sbjct  209   YLVFEYMEHDITGLLSCPDIKFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVGN  268

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
              GILK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLG+T YG  VDLWS GCVFAEL
Sbjct  269   NGILKVADFGLANFCNFGHRQPLTSRVVTLWYRPPELLLGSTDYGAAVDLWSVGCVFAEL  328

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S L+E  K+ P
Sbjct  329   LMGKPILQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSCLQETFKDCP  388

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              + V L+ETLLS+EPYKRGTAS +L SEYF TKPYACDPSS+P +PP++EIDAK REEA+
Sbjct  389   TTNVTLLETLLSVEPYKRGTASLALASEYFSTKPYACDPSSLPVYPPSKEIDAKNREEAK  448

Query  722   rrkagsavrgsgssrNMRR--LRKGMAPTEEVEANMLgsrrgng-----sgsrgATVARM  880
             R+K+   VRG  + +  R+  +   +AP E++ A    SR+ NG             +  
Sbjct  449   RKKSSGRVRGPETRKPTRKPVVISKLAPAEDLAAQTHDSRKSNGCHIHILKDENGISSGE  508

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K S D   EA        SQGD   S P Q+ +SS + W K+ +          +   
Sbjct  509   VAKPSTDKEEEALH--IKNESQGDIPFSGPLQVSTSSGFAWAKRRKDDVPTRSHTRSISR  566

Query  1061  ITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQPLSFHSPDIYHFSKELSVE  1240
               +   VEP     +K++      ++G +  R ++  +          D Y  +K L+++
Sbjct  567   GNIFNPVEPSVALHAKNNFDLKRHENGDVMHRGRTESR--------GHDSYEIAK-LAIQ  617

Query  1241  ------EQPPPFLSPDLYHSREQSV  1297
                   E+P  F + D+YHS+E S+
Sbjct  618   NQWGKFERPDSFDASDVYHSQELSL  642



>gb|KEH31968.1| cyclin-dependent kinase [Medicago truncatula]
Length=529

 Score =   373 bits (957),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  EI F++SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  32   YLVFEYMEHDVTGLLSKPEISFTESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++  KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  92   EGILKVADFGLANFTNSGKKQPLTSRVVTLWYRPPELLLGSTDYGPSVDLWSVGCVFAEL  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTEVEQLHKIFKLCGSP D+YW++++LP A +FKPQ  Y+S LRE  K+  
Sbjct  152  LVGKPILKGRTEVEQLHKIFKLCGSPPDEYWKKTRLPHATLFKPQQPYDSCLRETFKDFS  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++V+L++ LLSIEP KRGTASS+L+ EYF TKPYACDPSS+P +PP++EID
Sbjct  212  ATSVNLLQNLLSIEPNKRGTASSALSLEYFKTKPYACDPSSLPVYPPSKEID  263



>gb|KHN48710.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=634

 Score =   376 bits (965),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLL+  EIKFS+SQIKC+MKQLLSG+EHCH +G+MHRDIK SN+LVNN
Sbjct  137  YLVFEYMEHDITGLLARPEIKFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGSNLLVNN  196

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  197  EGILKVADFGLANFSNSGNKQPLTSRVVTLWYRPPELLLGSTAYGASVDLWSVGCVFAEL  256

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP ++YW++++LP A +FKPQ  Y+S LRE  K+  
Sbjct  257  LIGKPILQGRTEVEQLHKIFKLCGSPPEEYWKKTRLPHATLFKPQQPYDSCLRETFKDFH  316

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S+V+L++TLLS+EP KRGTASS+L+ EYF TKPYACDPSS+P +PP++EID
Sbjct  317  ASSVNLLQTLLSVEPSKRGTASSALSLEYFKTKPYACDPSSLPIYPPSKEID  368



>gb|AAL56635.1|AF120153_1 cyclin-dependent kinase CDC2C [Arabidopsis thaliana]
Length=644

 Score =   376 bits (965),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++ QIKC+MKQLL GLEHCH++G++HRDIK SNILVNN
Sbjct  180  YLVFEYMEHDLAGLSSNPDIRFTEPQIKCYMKQLLWGLEHCHMRGVIHRDIKASNILVNN  239

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+  +K  +TSRVVTLWYR PELL+G+T YG +VDLWS GCVFAE+
Sbjct  240  KGVLKLGDFGLANVVTPSNKNQLTSRVVTLWYRAPELLMGSTSYGVSVDLWSVGCVFAEI  299

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERCK+L 
Sbjct  300  LMGKPILKGRTEIEQLHKIYKLCGSPQDSFWKRTKLPHATSFKPQHTYEATLRERCKDLS  359

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V+L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  360  ATGVYLLETLLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  411



>ref|NP_198758.2| cyclin-dependent kinase CDC2C [Arabidopsis thaliana]
 gb|ACI49782.1| At5g39420 [Arabidopsis thaliana]
 gb|AED94431.1| cyclin-dependent kinase CDC2C [Arabidopsis thaliana]
Length=644

 Score =   376 bits (965),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++ QIKC+MKQLL GLEHCH++G++HRDIK SNILVNN
Sbjct  180  YLVFEYMEHDLAGLSSNPDIRFTEPQIKCYMKQLLWGLEHCHMRGVIHRDIKASNILVNN  239

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+  +K  +TSRVVTLWYR PELL+G+T YG +VDLWS GCVFAE+
Sbjct  240  KGVLKLGDFGLANVVTPSNKNQLTSRVVTLWYRAPELLMGSTSYGVSVDLWSVGCVFAEI  299

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERCK+L 
Sbjct  300  LMGKPILKGRTEIEQLHKIYKLCGSPQDSFWKRTKLPHATSFKPQHTYEATLRERCKDLS  359

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V+L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  360  ATGVYLLETLLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  411



>gb|KGN52489.1| hypothetical protein Csa_5G637790 [Cucumis sativus]
Length=584

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 204/393 (52%), Positives = 265/393 (67%), Gaps = 60/393 (15%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQ----------------------------------  79
             YLVFEYM+HDL+GL+S   IKFS++Q                                  
Sbjct  51    YLVFEYMDHDLAGLVSSPNIKFSEAQVGISSTDLTCTINSVGKVLIKKQSHFLFHWVCGF  110

Query  80    ------------IKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNEGILKIGDFGLANF  223
                         IKC+M+QLLS +EHCH++GIMHRDIK SNILVNNEG+LK+ DFGLAN 
Sbjct  111   YICKKLLCSLFQIKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNNEGVLKLADFGLANV  170

Query  224   VSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAELFFGRPILKGRTEVE  403
             +++R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL  G+P+LKGRTEVE
Sbjct  171   INSRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAELHLGKPLLKGRTEVE  230

Query  404   QLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELPKSAVHLIETLLSIE  583
             QLHKIFKLCGSP +++W+++KLP AA+FKPQ+AYES+L E+CKE   +A+ L+E+ L+IE
Sbjct  231   QLHKIFKLCGSPPEEFWKKTKLPHAAMFKPQHAYESSLSEKCKEFAPTALSLLESFLAIE  290

Query  584   PYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreearrrkagsavrgsgss  763
             PYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+ARR++A + V+ SG +
Sbjct  291   PYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDARRKRANARVKESGVT  350

Query  764   rNMRRLRKGMAP--------TEEVEANMLgsrrgngsgsrgA-----TVARMSLKSSYDT  904
             +  RR+R+             EE E N+  SRR   S +           R   K  +DT
Sbjct  351   QRPRRVRRNFQELNSHKVPIKEEAEENIQPSRRNGSSTANLCKEQGDVFQRDPQKQLFDT  410

Query  905   VSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
              SE+ + TA    +GDS  + P  + +SS + W
Sbjct  411   TSESQAATAPN-QRGDSAFTAPIPVSASSGFAW  442



>ref|XP_010450811.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=639

 Score =   375 bits (962),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I F++SQIKC+M+Q+L GLEHCH++G++HRDIK SNILVNN
Sbjct  177  YLVFEYMEHDLAGLSSNPDIIFTESQIKCYMQQILWGLEHCHMRGVIHRDIKASNILVNN  236

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN ++  +K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  237  KGVLKLGDFGLANVITPTNKNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  296

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERC+EL 
Sbjct  297  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKRTKLPHATSFKPQHTYEATLRERCQELS  356

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KS V L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  357  KSGVFLLETLLSMEPEKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  408



>ref|XP_010923564.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=712

 Score =   377 bits (967),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVF+YMEHDL+GL SC  I FS+SQIKC+MKQLLSGLEHCH  GIMHRDIK +N+L+NN
Sbjct  186  YLVFDYMEHDLAGLSSCPNINFSESQIKCYMKQLLSGLEHCHAHGIMHRDIKCANLLINN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLANF  +  KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  246  EGILKIADFGLANFCESGRKQPLTSRVVTLWYRPPELLLGSTDYEVSVDLWSVGCVFAEV  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQ+HKIFKLCGSP D+YW++SKLP A +FKPQ  YE  LRE    LP
Sbjct  306  CLGKPILQGRTEVEQIHKIFKLCGSPPDEYWKRSKLPHATLFKPQQPYEGHLRETLTCLP  365

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            K A  L+ET LS+EPYKRGTASS+L SEYF +KPYACDPSS+PK+PPN+EID
Sbjct  366  KCAFRLLETFLSVEPYKRGTASSALASEYFKSKPYACDPSSLPKYPPNKEID  417



>dbj|BAG97316.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00792.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score =   371 bits (952),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  32   YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWSAGCVFAE+
Sbjct  92   EGVLKIADFGLANYFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSAGCVFAEM  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y+STL++  KE+P
Sbjct  152  FRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYQSTLQDVFKEMP  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTAS++L SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  212  ANALRLLETLLSVEPYKRGTASAALTSEFFKTKPYACDPSSLPKYAPNKEMD  263



>ref|XP_003524702.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=670

 Score =   375 bits (963),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLL+  EIKFS+SQIKC+MKQLLSG+EHCH +G+MHRDIK SN+LVNN
Sbjct  173  YLVFEYMEHDITGLLARPEIKFSESQIKCYMKQLLSGIEHCHSRGVMHRDIKGSNLLVNN  232

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  233  EGILKVADFGLANFSNSGNKQPLTSRVVTLWYRPPELLLGSTAYGASVDLWSVGCVFAEL  292

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP ++YW++++LP A +FKPQ  Y+S LRE  K+  
Sbjct  293  LIGKPILQGRTEVEQLHKIFKLCGSPPEEYWKKTRLPHATLFKPQQPYDSCLRETFKDFH  352

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S+V+L++TLLS+EP KRGTASS+L+ EYF TKPYACDPSS+P +PP++EID
Sbjct  353  ASSVNLLQTLLSVEPSKRGTASSALSLEYFKTKPYACDPSSLPIYPPSKEID  404



>ref|XP_010528375.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=680

 Score =   375 bits (963),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S   IKF++ QIKC+MKQLL GLEHCH++GI+HRDIK SNILVNN
Sbjct  195  YLVFEYMEHDLAGLSSSPLIKFTEPQIKCYMKQLLLGLEHCHLRGIIHRDIKASNILVNN  254

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+GDFGLAN ++ R+K  +TSRVVTLWYR PELL+G+T YG +VDLWS GCVFAE+
Sbjct  255  EGILKLGDFGLANIITPRNKNQLTSRVVTLWYRAPELLMGSTSYGVSVDLWSVGCVFAEI  314

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D++W++ KLP A +FKPQ  YESTLR+RC++  
Sbjct  315  LMGKPILKGRTEIEQLHKIYKLCGSPPDEFWKKCKLPHATMFKPQRTYESTLRDRCRDFT  374

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A++L ET LS+EP KRGTASS+LNSEYF TKPYACDPSS+PK+PPN+E+D
Sbjct  375  VNALNLFETFLSMEPGKRGTASSALNSEYFLTKPYACDPSSLPKYPPNKEMD  426



>ref|XP_004508714.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=677

 Score =   375 bits (962),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  +I FS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  179  YLVFEYMEHDVTGLLSRPDIIFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  238

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF +  +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  239  EGILKVADFGLANFSNFSNKQPLTSRVVTLWYRPPELLLGSTDYGASVDLWSVGCVFAEL  298

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTEVEQLHKIFKLCGSP ++YW+++KLP A +FKPQ  Y+S LRE  K+ P
Sbjct  299  LVGKPILKGRTEVEQLHKIFKLCGSPPEEYWKKTKLPHATLFKPQQPYDSCLRETFKDFP  358

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++V+L++TLLS+EP KRGTASS+L+ EYF TKPYACDPSS+P +PP++EID
Sbjct  359  ATSVNLLQTLLSVEPNKRGTASSALSLEYFKTKPYACDPSSLPVYPPSKEID  410



>ref|XP_006283311.1| hypothetical protein CARUB_v10004349mg [Capsella rubella]
 gb|EOA16209.1| hypothetical protein CARUB_v10004349mg [Capsella rubella]
Length=639

 Score =   374 bits (959),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I F++SQIKC+MKQLL GLEHCH++G++HRDIK SNILVNN
Sbjct  177  YLVFEYMEHDLAGLSSNPDIIFTESQIKCYMKQLLWGLEHCHMRGVIHRDIKASNILVNN  236

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN ++  +K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  237  KGVLKLGDFGLANVMTPTNKNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEV  296

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERCKEL 
Sbjct  297  LMGKPILKGRTEIEQLHKIYKLCGSPPDRFWKKTKLPHATSFKPQHTYEATLRERCKELS  356

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S V L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  357  TSGVFLLETLLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  408



>ref|XP_009394329.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=694

 Score =   375 bits (963),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S   IKFS+SQ+KC+M+QLLSGLEHCH +GI+HRDIK +N+LVNN
Sbjct  195  YLVFEYMEHDLAGLSSSPNIKFSESQVKCYMQQLLSGLEHCHSRGIIHRDIKGANLLVNN  254

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG++KI DFGLANF S    QP+TSRVVTLWYRPPELLLG+T YG TVDLWS GCVFAE+
Sbjct  255  EGVVKIADFGLANFFSPGHSQPLTSRVVTLWYRPPELLLGSTNYGTTVDLWSIGCVFAEM  314

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP D+YW +SKLP A IF+P + YES+L E  K LP
Sbjct  315  FVGRPILQGRTEVEQLHKIFKLCGSPPDEYWNKSKLPHATIFRPYHLYESSLLETFKSLP  374

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ L+ET LSIEP+KRGTA+S+L  EYF TKPYAC+PSS+PK+PP +EID
Sbjct  375  ESAISLLETFLSIEPFKRGTATSALEVEYFKTKPYACEPSSLPKYPPTKEID  426



>ref|XP_010670220.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Beta vulgaris subsp. vulgaris]
Length=617

 Score =   373 bits (957),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 221/265 (83%), Gaps = 1/265 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGLLSC E+ F+++QIKCFM+Q+  GL++CH KG++HRDIK SNIL+NN
Sbjct  222  YLVFEYMEHDLSGLLSCPEVTFTEAQIKCFMQQIFYGLDYCHGKGVLHRDIKTSNILLNN  281

Query  182  EGILKIGDFGLANFVSARSKQ-PMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
            EG+LK+ DFGLANF+S R+KQ P+TSRVVTLWYRPPELLLG+T YG  VD+WSAGCVFAE
Sbjct  282  EGVLKLADFGLANFMSTRTKQQPLTSRVVTLWYRPPELLLGSTNYGPYVDMWSAGCVFAE  341

Query  359  LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
            L  G+PILKG+TEVEQLHKIFKL GSP D+YW +SKLP +++FKPQ  YES+LRER K  
Sbjct  342  LLIGKPILKGKTEVEQLHKIFKLSGSPPDEYWNKSKLPHSSMFKPQAPYESSLRERFKTF  401

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
            P+  V L+E LLS++P  RGTA+S+LNS+ F+T PYACDPSS+P +PPN+EIDAK REE+
Sbjct  402  PEHIVTLLENLLSVDPKNRGTAASALNSQLFNTMPYACDPSSLPTYPPNKEIDAKSREES  461

Query  719  rrrkagsavrgsgssrNMRRLRKGM  793
            RRRK       + SSR  RR RKG+
Sbjct  462  RRRKTNRIQDSTSSSRMHRRGRKGL  486



>ref|XP_007155279.1| hypothetical protein PHAVU_003G187700g [Phaseolus vulgaris]
 gb|ESW27273.1| hypothetical protein PHAVU_003G187700g [Phaseolus vulgaris]
Length=665

 Score =   374 bits (960),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  EIKFS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  170  YLVFEYMEHDITGLLSRPEIKFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  229

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  230  EGILKVADFGLANFSNSGNKQPLTSRVVTLWYRPPELLLGSTDYGPSVDLWSVGCVFAEL  289

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP ++YW++++LP A +FKPQ  Y+S LRE  K+  
Sbjct  290  LIGKPILQGRTEVEQLHKIFKLCGSPPEEYWKKTRLPHATLFKPQQPYDSCLRETFKDFH  349

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S+V+L++TLLS+EP KRGTASS+L  EYF TKPYACDPSS+P +PP++EID
Sbjct  350  VSSVNLLQTLLSVEPSKRGTASSALTLEYFKTKPYACDPSSLPLYPPSKEID  401



>ref|XP_010441062.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=641

 Score =   373 bits (957),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I F++SQIKC+M+Q+L GLEHCH++G++HRDIK SNILVNN
Sbjct  177  YLVFEYMEHDLAGLSSNPDIIFTESQIKCYMQQILWGLEHCHMRGVIHRDIKASNILVNN  236

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN ++  +K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  237  KGVLKLGDFGLANVITPTNKNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  296

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERC+ELP
Sbjct  297  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKRTKLPHATSFKPQHTYEATLRERCQELP  356

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S V L+ET LS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  357  TSGVFLLETFLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  408



>gb|KFK33201.1| hypothetical protein AALP_AA6G343500 [Arabis alpina]
Length=649

 Score =   373 bits (957),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++SQIKC+M+QLL GLEHCH++G+MHRDIK SNILVNN
Sbjct  186  YLVFEYMEHDLAGLSSNPDIRFTESQIKCYMQQLLWGLEHCHMRGVMHRDIKASNILVNN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+ ++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  246  KGVLKLGDFGLANVVTPKNKNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++K+  A  F+PQ+ YE+TLRERCK+L 
Sbjct  306  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKRTKITHATSFRPQHTYEATLRERCKDLS  365

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  366  TTGVFLLETLLSMEPEKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  417



>ref|XP_010539977.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=709

 Score =   375 bits (962),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLLSC +IKFS  QIKC+MKQL+SGL+HCH +G+MHRDIK SN+LVNN
Sbjct  202  YLVFEYMEHDLTGLLSCPDIKFSTPQIKCYMKQLMSGLDHCHSRGVMHRDIKGSNLLVNN  261

Query  182  EGILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFA  355
            EGILK+ DFGLANF   S   +QP+TSRVVTLWYRPPELLLGAT YG  VDLWS GCVFA
Sbjct  262  EGILKVADFGLANFCNSSGNKQQPLTSRVVTLWYRPPELLLGATDYGAFVDLWSVGCVFA  321

Query  356  ELFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKE  535
            EL  GRPIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+
Sbjct  322  ELLLGRPILQGRTEVEQLHKIFKLCGSPPSDYWKKSKLPHAMLFKPQQHYDGCLRETLKD  381

Query  536  LPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            L +S V+LIETLLSIEP+KRGTASS+L SEYF T+PYACDP S+P +PP++EID
Sbjct  382  LSESEVNLIETLLSIEPHKRGTASSALVSEYFVTEPYACDPLSLPVYPPSKEID  435



>ref|XP_011072815.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Sesamum indicum]
Length=692

 Score =   374 bits (960),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 250/339 (74%), Gaps = 6/339 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  EI F+++Q+KC+MKQLLSGLEHCH +G+MHRDIK +N+LV+N
Sbjct  198   YLVFEYMEHDVAGLLSSPEITFTEAQVKCYMKQLLSGLEHCHSRGVMHRDIKGANLLVDN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGA  YG +VDLWS GC+ AEL
Sbjct  258   EGVLKVADFGLANFSTYGHRQPLTSRVVTLWYRPPELLLGANDYGASVDLWSVGCLLAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ+ Y+S+L +  + LP
Sbjct  318   LTGKPILQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHATLFKPQHPYKSSLWQTFEHLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             +SAV LIETLLS+EPYKRGTA+S+L SEYF  KPYACDPSS+PK+PP++EID K  EEA 
Sbjct  378   ESAVTLIETLLSVEPYKRGTATSALTSEYFKMKPYACDPSSLPKYPPSKEIDIKHHEEAS  437

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSS  895
             R++ G   RG  + +  R+      +AP E +   M G R+ N  G       R+ L   
Sbjct  438   RKRTGGRSRGPETRKPARKQNGINKLAPEENLPHQMQGERKMNRHGVTNHRGDRV-LGQE  496

Query  896   YDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
                 S  +++ A+ V   SQGD   S P Q+  SS + W
Sbjct  497   PPKPSTGSTKEASHVKNASQGDDTYSGPLQVSGSSGFAW  535



>ref|XP_011072816.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Sesamum indicum]
Length=688

 Score =   374 bits (959),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 250/339 (74%), Gaps = 6/339 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  EI F+++Q+KC+MKQLLSGLEHCH +G+MHRDIK +N+LV+N
Sbjct  198   YLVFEYMEHDVAGLLSSPEITFTEAQVKCYMKQLLSGLEHCHSRGVMHRDIKGANLLVDN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLANF +   +QP+TSRVVTLWYRPPELLLGA  YG +VDLWS GC+ AEL
Sbjct  258   EGVLKVADFGLANFSTYGHRQPLTSRVVTLWYRPPELLLGANDYGASVDLWSVGCLLAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ+ Y+S+L +  + LP
Sbjct  318   LTGKPILQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHATLFKPQHPYKSSLWQTFEHLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
             +SAV LIETLLS+EPYKRGTA+S+L SEYF  KPYACDPSS+PK+PP++EID K  EEA 
Sbjct  378   ESAVTLIETLLSVEPYKRGTATSALTSEYFKMKPYACDPSSLPKYPPSKEIDIKHHEEAS  437

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLKSS  895
             R++ G   RG  + +  R+      +AP E +   M G R+ N  G       R+ L   
Sbjct  438   RKRTGGRSRGPETRKPARKQNGINKLAPEENLPHQMQGERKMNRHGVTNHRGDRV-LGQE  496

Query  896   YDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
                 S  +++ A+ V   SQGD   S P Q+  SS + W
Sbjct  497   PPKPSTGSTKEASHVKNASQGDDTYSGPLQVSGSSGFAW  535



>ref|XP_010435890.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=640

 Score =   372 bits (955),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I F++SQIKC+M+Q+L GLEHCH++G++HRDIK SNILVNN
Sbjct  177  YLVFEYMEHDLAGLSSNPDIIFTESQIKCYMQQILWGLEHCHMRGVIHRDIKASNILVNN  236

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN ++  +K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  237  KGVLKLGDFGLANVITPTNKNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  296

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W+++KLP A  FKPQ+ YE+TLRERC+EL 
Sbjct  297  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKRTKLPHATSFKPQHTYEATLRERCQELS  356

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S V L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  357  TSGVFLLETLLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  408



>gb|KEH31969.1| cyclin-dependent kinase [Medicago truncatula]
Length=677

 Score =   373 bits (958),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  EI F++SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  180  YLVFEYMEHDVTGLLSKPEISFTESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  239

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++  KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  240  EGILKVADFGLANFTNSGKKQPLTSRVVTLWYRPPELLLGSTDYGPSVDLWSVGCVFAEL  299

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTEVEQLHKIFKLCGSP D+YW++++LP A +FKPQ  Y+S LRE  K+  
Sbjct  300  LVGKPILKGRTEVEQLHKIFKLCGSPPDEYWKKTRLPHATLFKPQQPYDSCLRETFKDFS  359

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++V+L++ LLSIEP KRGTASS+L+ EYF TKPYACDPSS+P +PP++EID
Sbjct  360  ATSVNLLQNLLSIEPNKRGTASSALSLEYFKTKPYACDPSSLPVYPPSKEID  411



>ref|XP_008393191.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=696

 Score =   373 bits (958),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +G+MHRD+K SN+LV+N
Sbjct  198  YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGVMHRDVKGSNLLVSN  257

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T YG  +DLWS GC FAEL
Sbjct  258  EGILKVADFGLANFCNTGHKQPLTSRVVTLWYRPPELLLGSTDYGAFIDLWSVGCAFAEL  317

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+P+L+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S+LR+  K+LP
Sbjct  318  LMGKPVLQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHATLFKPQQPYDSSLRDTFKDLP  377

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + ++L+ETLLS+EP+KRGTASS+L SEYF  KP+ACDPSS+P +PP++EID
Sbjct  378  AATLNLLETLLSVEPHKRGTASSALASEYFKMKPHACDPSSLPMYPPSKEID  429



>gb|AAG52349.1|AC011765_1 putative protein kinase; 3429-1655 [Arabidopsis thaliana]
Length=445

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +2

Query  5    LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
            LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197  LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185  GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
            GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  257  GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  316

Query  359  LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
            L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  317  LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQTYDSCLRETLKDL  376

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID
Sbjct  377  SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEID  429



>ref|XP_008787098.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g54610 [Phoenix dactylifera]
Length=693

 Score =   373 bits (957),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDLSGL S  E+K S+ QIKC+M QLLSGLEHCH +G++HRDIK +N+LV+N
Sbjct  191  YLVFEYMDHDLSGLCSSPEVKLSEPQIKCYMHQLLSGLEHCHSRGVIHRDIKCANLLVSN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF     KQP+TSRVVTLWYRPPELLLG+T Y  TVDLWS GCVFAEL
Sbjct  251  EGILKMADFGLANFCRPGHKQPLTSRVVTLWYRPPELLLGSTDYEVTVDLWSVGCVFAEL  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+G+TEVEQLHKIFKLCGSPSD+YW++SKLP A IFKP + YES L+E CK LP
Sbjct  311  FLGKPILQGKTEVEQLHKIFKLCGSPSDEYWKKSKLPHATIFKPHHPYESCLQEACKGLP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S VHL+E  LS+EPY+RGTAS++L SEYF T PYAC+PSS+PK+PP +EID
Sbjct  371  ASVVHLLEVFLSVEPYRRGTASTALASEYFTTMPYACEPSSLPKYPPTKEID  422



>ref|XP_008374583.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Malus domestica]
Length=696

 Score =   373 bits (957),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 207/439 (47%), Positives = 274/439 (62%), Gaps = 33/439 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  198   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  258   EGILKVADFGLANFCNSGNKQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  318   LMGKPVLQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +  +L+ETLLS+EP+KR TASS+L SEYF  KP+ACDPSS+P +PP++EID    +   
Sbjct  378   AATFNLLETLLSVEPHKRATASSALASEYFKMKPHACDPSSLPVYPPSKEID---AKNRE  434

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgngsgsr----------gATV  871
               K          S   +  RK +  ++  +A  L  +                   + +
Sbjct  435   EAKRKKIGGRVRGSETRKPTRKSLGFSKLAQAENLAVQSRGSYKINGTNGHILKEDDSVL  494

Query  872   ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN  1051
              R   K S   V +  S      SQGD   S P ++ +SS + W ++ +  A R H  + 
Sbjct  495   GRELPKPSAGKVED--SSHVKNASQGDIPFSGPLEVSTSSGFAWARRRKDEARRSHTRSF  552

Query  1052  SRSITMNGGVEPPTLQ-----------------QSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             SR    N      T+                  + ++D  G D  +       K   ++E
Sbjct  553   SRGHIFNSIESSITVHTRSNFDSKRHENAELMYKGRNDSRGHDSYEIAKLAMLKQWGKLE  612

Query  1181  QPLSFHSPDIYHFSKELSV  1237
              P SF + D YH S+ELS+
Sbjct  613   NPDSFDACDGYH-SQELSL  630



>ref|XP_008374582.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Malus domestica]
Length=697

 Score =   373 bits (957),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 207/439 (47%), Positives = 274/439 (62%), Gaps = 33/439 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  198   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  258   EGILKVADFGLANFCNSGNKQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S+LRE  K+LP
Sbjct  318   LMGKPVLQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSSLRETFKDLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +  +L+ETLLS+EP+KR TASS+L SEYF  KP+ACDPSS+P +PP++EID    +   
Sbjct  378   AATFNLLETLLSVEPHKRATASSALASEYFKMKPHACDPSSLPVYPPSKEID---AKNRE  434

Query  722   rrkagsavrgsgssrNMRRLRKGMAPTEEVEANMLgsrrgng----------sgsrgATV  871
               K          S   +  RK +  ++  +A  L  +                   + +
Sbjct  435   EAKRKKIGGRVRGSETRKPTRKSLGFSKLAQAENLAVQSRGSYKINGTNGHILKEDDSVL  494

Query  872   ARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN  1051
              R   K S   V +  S      SQGD   S P ++ +SS + W ++ +  A R H  + 
Sbjct  495   GRELPKPSAGKVED--SSHVKNASQGDIPFSGPLEVSTSSGFAWARRRKDEARRSHTRSF  552

Query  1052  SRSITMNGGVEPPTLQ-----------------QSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             SR    N      T+                  + ++D  G D  +       K   ++E
Sbjct  553   SRGHIFNSIESSITVHTRSNFDSKRHENAELMYKGRNDSRGHDSYEIAKLAMLKQWGKLE  612

Query  1181  QPLSFHSPDIYHFSKELSV  1237
              P SF + D YH S+ELS+
Sbjct  613   NPDSFDACDGYH-SQELSL  630



>ref|XP_009411082.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=688

 Score =   372 bits (954),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGL S  +IKFS+SQIKC+M+Q+LSGLEHCH++GI+HRDIK +NILVNN
Sbjct  193  YLVFEYMEHDLSGLSSSPDIKFSESQIKCYMQQMLSGLEHCHLRGIIHRDIKGANILVNN  252

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF S   KQ +T RVVTLWYRPPELLLG+T Y ETVDLWS GCVFAE+
Sbjct  253  EGVLKIADFGLANFFSHGHKQRLTGRVVTLWYRPPELLLGSTDYEETVDLWSVGCVFAEM  312

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP D+YW +S L  A IF+P + YE+ L+E  K LP
Sbjct  313  FIGRPILQGRTEVEQLHKIFKLCGSPPDEYWNKSTLAHATIFRPHHPYENILQETFKSLP  372

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ L+ET LSIEPYKRGTA+SSL +EYF TKPYAC+PSS+ K+PP +EID
Sbjct  373  GSAISLLETFLSIEPYKRGTATSSLEAEYFRTKPYACEPSSLSKYPPTKEID  424



>ref|XP_009339128.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Pyrus x bretschneideri]
Length=697

 Score =   372 bits (955),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 219/436 (50%), Positives = 287/436 (66%), Gaps = 27/436 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  198   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  258   EGILKVADFGLANFCNSGNKQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S+LR   K+LP
Sbjct  318   LMGKPVLQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSSLRVTFKDLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +  +L+ETLLS+EP+KR TASS+L SEYF  KP+ACDPSS+P +PP++EIDAK REEA+
Sbjct  378   AATFNLLETLLSVEPHKRATASSALASEYFKMKPHACDPSSLPIYPPSKEIDAKNREEAK  437

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEAN-----MLgsrrgngsgsrgATVARM  880
             R+K G  VRGS + +  R+      +AP E +         +    G+      + + R 
Sbjct  438   RKKIGGRVRGSETRKPTRKSLGFTKLAPAENLAVQSRGSYKINGTNGHILKEDDSVLGRE  497

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K S   V +  S      SQGD   S P ++ +SS + W K+ +  A R H  + SR 
Sbjct  498   LPKPSAGKVED--SSHVKNASQGDIPFSGPLEVSTSSGFAWAKRRKDEARRSHTRSFSRG  555

Query  1061  ITMNGGVEPPTLQ-----------------QSKDDPLGLDEQDGGLAIRPKSMKQVEQPL  1189
                N      T+                  + ++D  G D  +       K   ++E P 
Sbjct  556   HIFNTIESSITVHTRSNFDSKRHENAELMYKGRNDSRGHDSYEIAKLAMLKQWGKLENPD  615

Query  1190  SFHSPDIYHFSKELSV  1237
             SF + D YH S+ELS+
Sbjct  616   SFDACDGYH-SQELSL  630



>ref|XP_009339129.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Pyrus x bretschneideri]
Length=696

 Score =   372 bits (955),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 219/436 (50%), Positives = 287/436 (66%), Gaps = 27/436 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  198   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  257

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  258   EGILKVADFGLANFCNSGNKQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  317

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP D+YW++SKLP A +FKPQ  Y+S+LR   K+LP
Sbjct  318   LMGKPVLQGRTEVEQLHKIFKLCGSPPDEYWKKSKLPHATLFKPQQPYDSSLRVTFKDLP  377

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +  +L+ETLLS+EP+KR TASS+L SEYF  KP+ACDPSS+P +PP++EIDAK REEA+
Sbjct  378   AATFNLLETLLSVEPHKRATASSALASEYFKMKPHACDPSSLPIYPPSKEIDAKNREEAK  437

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEAN-----MLgsrrgngsgsrgATVARM  880
             R+K G  VRGS + +  R+      +AP E +         +    G+      + + R 
Sbjct  438   RKKIGGRVRGSETRKPTRKSLGFTKLAPAENLAVQSRGSYKINGTNGHILKEDDSVLGRE  497

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K S   V +  S      SQGD   S P ++ +SS + W K+ +  A R H  + SR 
Sbjct  498   LPKPSAGKVED--SSHVKNASQGDIPFSGPLEVSTSSGFAWAKRRKDEARRSHTRSFSRG  555

Query  1061  ITMNGGVEPPTLQ-----------------QSKDDPLGLDEQDGGLAIRPKSMKQVEQPL  1189
                N      T+                  + ++D  G D  +       K   ++E P 
Sbjct  556   HIFNTIESSITVHTRSNFDSKRHENAELMYKGRNDSRGHDSYEIAKLAMLKQWGKLENPD  615

Query  1190  SFHSPDIYHFSKELSV  1237
             SF + D YH S+ELS+
Sbjct  616   SFDACDGYH-SQELSL  630



>ref|XP_003550793.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 ref|XP_006600703.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=671

 Score =   371 bits (953),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLL+  EIKFS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  174  YLVFEYMEHDITGLLARPEIKFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  233

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  234  EGILKVADFGLANFSNSGNKQPLTSRVVTLWYRPPELLLGSTAYGPSVDLWSVGCVFAEL  293

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP ++YW++++LP A +FKPQ  Y+S+LRE  K+  
Sbjct  294  LIGKPILQGRTEVEQLHKIFKLCGSPPEEYWKKTRLPHATLFKPQQPYDSSLRETFKDFH  353

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S V+L++TLLS+EP KRGTASS+L+ EYF  KPYAC+PSS+P +PP++EID
Sbjct  354  ASTVNLLQTLLSVEPSKRGTASSALSLEYFKIKPYACEPSSLPIYPPSKEID  405



>ref|XP_009411081.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=693

 Score =   372 bits (954),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGL S  +IKFS+SQIKC+M+Q+LSGLEHCH++GI+HRDIK +NILVNN
Sbjct  193  YLVFEYMEHDLSGLSSSPDIKFSESQIKCYMQQMLSGLEHCHLRGIIHRDIKGANILVNN  252

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF S   KQ +T RVVTLWYRPPELLLG+T Y ETVDLWS GCVFAE+
Sbjct  253  EGVLKIADFGLANFFSHGHKQRLTGRVVTLWYRPPELLLGSTDYEETVDLWSVGCVFAEM  312

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP D+YW +S L  A IF+P + YE+ L+E  K LP
Sbjct  313  FIGRPILQGRTEVEQLHKIFKLCGSPPDEYWNKSTLAHATIFRPHHPYENILQETFKSLP  372

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ L+ET LSIEPYKRGTA+SSL +EYF TKPYAC+PSS+ K+PP +EID
Sbjct  373  GSAISLLETFLSIEPYKRGTATSSLEAEYFRTKPYACEPSSLSKYPPTKEID  424



>ref|NP_001060172.1| Os07g0596600 [Oryza sativa Japonica Group]
 dbj|BAC79804.1| putative cyclin-dependent kinase CDC2C [Oryza sativa Japonica 
Group]
 dbj|BAF22086.1| Os07g0596600 [Oryza sativa Japonica Group]
Length=707

 Score =   372 bits (955),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  204  YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  263

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWSAGCVFAE+
Sbjct  264  EGVLKIADFGLANYFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSAGCVFAEM  323

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y+STL++  KE+P
Sbjct  324  FRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYQSTLQDVFKEMP  383

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTAS++L SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  384  ANALRLLETLLSVEPYKRGTASAALTSEFFKTKPYACDPSSLPKYAPNKEMD  435



>ref|XP_008785933.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Phoenix dactylifera]
Length=711

 Score =   372 bits (955),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVF+YMEHDL+GL +C  I FS+SQIKC+MKQLLSGLEHCH +GIMHRDIK +N+L+NN
Sbjct  186  YLVFDYMEHDLAGLSACPNINFSESQIKCYMKQLLSGLEHCHARGIMHRDIKCANLLINN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLANF  +  +QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  246  EGILKIADFGLANFCDSGKEQPLTSRVVTLWYRPPELLLGSTDYEASVDLWSVGCVFAEV  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQ+HKIFKLCGSP D+YW++SKL  A +FKPQ  YES LR     LP
Sbjct  306  CLGKPILQGRTEVEQIHKIFKLCGSPPDEYWKKSKLLHATLFKPQQPYESRLRGTLTFLP  365

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            KSA  L+ET LSIEPYKRGTAS++L SEYF +KPYACDPSS+PK+PPN+EID
Sbjct  366  KSAFSLLETFLSIEPYKRGTASTALASEYFKSKPYACDPSSLPKYPPNKEID  417



>ref|XP_009338827.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=700

 Score =   371 bits (953),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGLEHCH +GIMHRD+K SN+LV+N
Sbjct  202  YLVFEYMEHDITGLLSNPDIKFSEAQIKCYMKQLLSGLEHCHSRGIMHRDVKGSNLLVSN  261

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF +   KQP+TSRVVTLWYRPPELLLG+T YG  +DLWS GC FAEL
Sbjct  262  EGILKVADFGLANFCNTGHKQPLTSRVVTLWYRPPELLLGSTDYGAFIDLWSVGCAFAEL  321

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+P+L+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S+LR+  K+ P
Sbjct  322  LMGKPVLQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHATLFKPQQPYDSSLRDTFKDFP  381

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + ++L+ETLLS+EP+KRGTASS+L SEYF  KP+ACDPSS+P +PP++EID
Sbjct  382  AATLNLLETLLSVEPHKRGTASSALASEYFKMKPHACDPSSLPIYPPSKEID  433



>gb|EAZ40528.1| hypothetical protein OsJ_24984 [Oryza sativa Japonica Group]
Length=709

 Score =   372 bits (954),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  188  YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  247

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWSAGCVFAE+
Sbjct  248  EGVLKIADFGLANYFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSAGCVFAEM  307

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y+STL++  KE+P
Sbjct  308  FRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYQSTLQDVFKEMP  367

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTAS++L SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  368  ANALRLLETLLSVEPYKRGTASAALTSEFFKTKPYACDPSSLPKYAPNKEMD  419



>ref|XP_010471520.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Camelina sativa]
Length=694

 Score =   371 bits (952),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 218/439 (50%), Positives = 282/439 (64%), Gaps = 30/439 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS   IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPNIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID+K R+EA
Sbjct  375   SETEISLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K     R    +R   R       +AP E+V  E      R  +   +   + AR+ 
Sbjct  435   TRKKISGNGRRGIDARKPSRKAHSFNKLAPVEDVRHETETFQKRISHLVHNSIGSDARLC  494

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-S  1054
               L++  D   + AS      SQGD   S P Q+  S+++ W K  +          + S
Sbjct  495   EKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNTFAWAKLEKDDVCVRVHNRSLS  553

Query  1055  RSITMNGGVEPPTL------------------QQSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             R    N  V  P +                  ++ K D  G +  +       K  +Q+E
Sbjct  554   RGHIPNLSVHSPAINGKSNVECKINKNENEDKREDKTDSRGQESYEMVKRSMLKQWRQLE  613

Query  1181  QPLSFHSPDIYHFSKELSV  1237
             +P SF + D YH S+ELS+
Sbjct  614   RPDSFGASDEYH-SQELSL  631



>emb|CDX67429.1| BnaA07g14690D [Brassica napus]
Length=928

 Score =   377 bits (968),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++SQIKC+M+QLL GLEHCH++G++HRDIK SNILVNN
Sbjct  466  YLVFEYMEHDLAGLSSNPDIRFTESQIKCYMQQLLLGLEHCHMRGVIHRDIKASNILVNN  525

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+A++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  526  KGVLKLGDFGLANVVTAKNKHQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  585

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W++++LP A  F+PQ+ YE+TLRERCKEL 
Sbjct  586  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKKTRLPHATSFRPQHTYEATLRERCKELS  645

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V L+ETLLS+E YKRGTAS++LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  646  TTGVLLLETLLSMEAYKRGTASAALNSEYFLTRPYACDPSSLPKYPPNKEMD  697


 Score =   332 bits (851),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F++SQIKC+M+QLL GLEHCH++G++HRDIK SNILVNN
Sbjct  189  YLVFEYMEHDLAGLSSNPDIRFTESQIKCYMQQLLWGLEHCHMRGVIHRDIKASNILVNN  248

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+A++K  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  249  KGVLKLGDFGLANVVTAKNKHQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  308

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KLCGSP D +W++++LP A  F+PQ+ YE+TLRERCKEL 
Sbjct  309  LMGKPILKGRTEIEQLHKIYKLCGSPPDSFWKKTRLPHATSFRPQHTYEATLRERCKELS  368

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSE  625
             + V L+ETLLS+E YKRGTASS+LNSE
Sbjct  369  TTGVLLLETLLSMEAYKRGTASSALNSE  396



>gb|KHN18575.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=687

 Score =   370 bits (951),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD++GLL+  EIKFS+SQIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  174  YLVFEYMEHDITGLLARPEIKFSESQIKCYMKQLLSGLEHCHSRGVMHRDIKGSNLLVNN  233

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF ++ +KQP+TSRVVTLWYRPPELLLG+T YG +VDLWS GCVFAEL
Sbjct  234  EGILKVADFGLANFSNSGNKQPLTSRVVTLWYRPPELLLGSTAYGPSVDLWSVGCVFAEL  293

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP ++YW++++LP A +FKPQ  Y+S+LRE  K+  
Sbjct  294  LIGKPILQGRTEVEQLHKIFKLCGSPPEEYWKKTRLPHATLFKPQQPYDSSLRETFKDFH  353

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S V+L++TLLS+EP KRGTASS+L+ EYF  KPYAC+PSS+P +PP++EID
Sbjct  354  ASTVNLLQTLLSVEPSKRGTASSALSLEYFKIKPYACEPSSLPIYPPSKEID  405



>ref|XP_010938783.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Elaeis guineensis]
Length=690

 Score =   370 bits (951),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVF+YMEHDL+GLLS  +IKFS+ QIKC+M+QLLSGLEHCH  GIMHRDIK +N+L+NN
Sbjct  180  YLVFDYMEHDLAGLLSSPDIKFSEPQIKCYMRQLLSGLEHCHSHGIMHRDIKCANLLINN  239

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILKI DFGLANF S+  KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  240  DGILKIADFGLANFFSSGQKQPLTSRVVTLWYRPPELLLGSTDYEASVDLWSVGCVFAEV  299

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PI +GRTEVEQ+HKIFKLCGSP D++W+ SKLP A +FKP   Y S LRER K LP
Sbjct  300  FLGKPIFQGRTEVEQIHKIFKLCGSPPDEFWKMSKLPHATVFKPHQPYGSCLRERLKCLP  359

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++   L+E  LS+EPYKRGTAS++L SEYF +KPYACDPSS+PK+PPN+EID
Sbjct  360  ENVSSLLEIFLSVEPYKRGTASTALASEYFKSKPYACDPSSLPKYPPNKEID  411



>ref|XP_004299330.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Fragaria vesca subsp. vesca]
Length=668

 Score =   370 bits (949),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 249/340 (73%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  170   YLVFEYMEHDVTGLLSNPDIKFSEAQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLVNN  229

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILK+ DFGLANF ++ ++QP+TSRVVTLWYRPPELLLG+T YG  +DLWS GC FAEL
Sbjct  230   EGILKMADFGLANFCNSGNRQPLTSRVVTLWYRPPELLLGSTSYGAYIDLWSVGCAFAEL  289

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+ +L+GRTEVEQLHKIFKLCG+P ++YW++SKLP A +FKPQ AY+STL+E  K+LP
Sbjct  290   LVGKNVLQGRTEVEQLHKIFKLCGTPPEEYWKKSKLPHATLFKPQQAYDSTLQETFKDLP  349

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              +  +L+ETLLS+EP KRGTASS+L SEYF TKPYAC PSS+P +PP++EIDAK REEA+
Sbjct  350   AATFNLLETLLSVEPNKRGTASSALASEYFKTKPYACHPSSLPIYPPSKEIDAKNREEAK  409

Query  722   rrkagsavrgsgssrNMRRLR-KGMAPTEEVEANM-----LgsrrgngsgsrgATVARMS  883
             R+K G  +RG       + L    +AP E++   +     +    G+ +      ++R  
Sbjct  410   RKKIGGRLRGETRKSTRKSLGISKLAPVEDIATQIQGSYKINGTNGHITKQENGIISREL  469

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
              K       EA        SQGD   S P ++ +SS + W
Sbjct  470   PKPPASKAEEALH--VKNASQGDVPFSGPLEVSTSSGFAW  507



>gb|EAZ04580.1| hypothetical protein OsI_26730 [Oryza sativa Indica Group]
Length=725

 Score =   371 bits (953),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  204  YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  263

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWSAGCVFAE+
Sbjct  264  EGVLKIADFGLANYFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSAGCVFAEM  323

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y+STL++  KE+P
Sbjct  324  FRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYQSTLQDVFKEMP  383

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTAS++L SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  384  ANALRLLETLLSVEPYKRGTASAALTSEFFKTKPYACDPSSLPKYAPNKEMD  435



>ref|XP_006405630.1| hypothetical protein EUTSA_v10027682mg [Eutrema salsugineum]
 gb|ESQ47083.1| hypothetical protein EUTSA_v10027682mg [Eutrema salsugineum]
Length=649

 Score =   369 bits (947),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F+++Q+KC+M+QLL GLEHCH++G+MHRDIK SNILVNN
Sbjct  186  YLVFEYMEHDLAGLSSNPDIRFTEAQVKCYMQQLLWGLEHCHMRGVMHRDIKASNILVNN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+GDFGLAN V+A+++  +TSRVVTLWYR PELL+G+T YG ++DLWS GCVFAE+
Sbjct  246  KGVLKLGDFGLANMVTAKNRNQLTSRVVTLWYRAPELLMGSTSYGVSIDLWSVGCVFAEI  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PILKGRTE+EQLHKI+KL GSP D +W+++K+  A  F+PQ+ YE+TLRERC EL 
Sbjct  306  LMGKPILKGRTEIEQLHKIYKLSGSPPDSFWKRNKITHATSFRPQHTYEATLRERCNELS  365

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             + V L+ETLLS+EP KRGTASS+LNSEYF T+PYACDPSS+PK+PPN+E+D
Sbjct  366  TTGVFLLETLLSMEPEKRGTASSALNSEYFLTRPYACDPSSLPKYPPNKEMD  417



>ref|XP_006390438.1| hypothetical protein EUTSA_v10018206mg [Eutrema salsugineum]
 gb|ESQ27724.1| hypothetical protein EUTSA_v10018206mg [Eutrema salsugineum]
Length=700

 Score =   370 bits (951),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 285/443 (64%), Gaps = 37/443 (8%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  200   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  259

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  260   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  319

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  320   LLLGKPILRGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  379

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSIEP+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K REEA
Sbjct  380   SETEINLIETLLSIEPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHREEA  439

Query  719   rrrkagsavrgsgssrNMRRLR---KGMAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K     R    +R   R       +AP E+V  +      R GN   +   + AR+ 
Sbjct  440   TRKKISGNGRRGIEARKPTRKALTFNKLAPAEDVRHQTGTFQKRIGNLVHNSIESDARVC  499

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSR  1057
               L++  +   + AS      SQGD   S P Q+  SSS+ W    +R         ++R
Sbjct  500   GKLQNPSNHKKDEASHVKN-ASQGDVPFSGPLQVSLSSSFAW---AKREKDDVCVRVHNR  555

Query  1058  SIT-----------------------MNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSM  1168
             S++                       +N  +     + +K D  G D  +       K  
Sbjct  556   SLSRGHIPNLSGHSPAFNGKSDAESKINENMNDDKRENNKTDSRGQDSYEMVKRSMLKQW  615

Query  1169  KQVEQPLSFHSPDIYHFSKELSV  1237
             +Q+E+P SF + D YH S+ELS+
Sbjct  616   RQLERPDSFGASDEYH-SQELSL  637



>ref|XP_004958203.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Setaria italica]
Length=709

 Score =   370 bits (951),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+D+Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  199  YLVFEYMEHDLAGLCSSPDIKFTDAQLKCYMNQLLSGLEHCHSRRVVHRDIKGANLLVNN  258

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAE+
Sbjct  259  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFAEM  318

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KE+P
Sbjct  319  FRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYPSTLRDVFKEVP  378

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTA+ +L+SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  379  GNALSLLETLLSVEPYKRGTAAGALSSEFFRTKPYACDPSSLPKYAPNKEMD  430



>ref|XP_010416283.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Camelina sativa]
Length=694

 Score =   370 bits (949),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 283/439 (64%), Gaps = 30/439 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID+K R+EA
Sbjct  375   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K   +       R   R       +AP E+   +      R G+   +   + AR+ 
Sbjct  435   TRKKISGSGIRGIDERKPSRKAHSFNKLAPVEDARHQTETFQKRIGHLVHNSIGSDARLC  494

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-S  1054
               L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + S
Sbjct  495   EKLQTPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSLS  553

Query  1055  RSITMNGGVEPPTL------------------QQSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             R    N  V  P                    ++ K D  G +  +       K  +Q+E
Sbjct  554   RGHIPNLSVHSPAFNGKSNVECKINKNENEDKREDKTDSRGQESYEMVKRSMLKQWRQLE  613

Query  1181  QPLSFHSPDIYHFSKELSV  1237
             +P SF + D YH S+ELS+
Sbjct  614   RPDSFSASDEYH-SQELSL  631



>emb|CBI22263.3| unnamed protein product [Vitis vinifera]
Length=739

 Score =   371 bits (952),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 204/367 (56%), Positives = 259/367 (71%), Gaps = 35/367 (10%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL+SC +IKFS +Q+KC+M+QLLS +EHCH+ G+MHRDIK SNILVNN
Sbjct  228   YLVFEYMEHDLAGLVSCPDIKFSVAQVKCYMQQLLSAIEHCHLLGVMHRDIKASNILVNN  287

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EG+LK+ DFGLAN +  + KQ +TSRVVTLWYRPPEL+LG+T YG +VDLWS GCVFAEL
Sbjct  288   EGVLKLADFGLANILRPKHKQILTSRVVTLWYRPPELILGSTSYGVSVDLWSVGCVFAEL  347

Query  362   FFGRPILKGRTE--------------------VEQLHKIFKLCGSPSDDYWEQSKLPLAA  481
               G+P+ KGRTE                    VEQLHKIFKLCGSP D+YW++SK P A 
Sbjct  348   LIGKPLFKGRTEPLLNIRQRHLLDESAIWEERVEQLHKIFKLCGSPPDEYWKKSKFPHAT  407

Query  482   IFKPQYAYESTLRERCKELPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPS  661
             +FKP ++YESTLRER +E P +A++LIETLLS+EP KRGTASS+L SEYF+TKPYAC+PS
Sbjct  408   MFKPHHSYESTLRERFREYPTTALNLIETLLSVEPPKRGTASSALISEYFNTKPYACEPS  467

Query  662   SMPKFPPNREIDakfreearrrkagsavrgsgssrNMRRLR-KGMAPTEEVEANMLgsrr  838
             S+PK+PPN+EIDAK REEARR+  G  VRGSG+ R  RR R     P    +  +  S  
Sbjct  468   SLPKYPPNKEIDAKCREEARRKTGGVGVRGSGALRKPRRSRTSSQEPNSTSKFAVTESNT  527

Query  839   gngsgsrgATVARMSL------------KSSYDTVSEAASQTATEVSQGDSICSVPAQMI  982
                  + G++ A +S             K S++T S+ +    + VS+GD +  VP Q+ 
Sbjct  528   QYSRRNSGSSSAHISKGKGRGFDYGDSEKPSFETSSQISQ--VSNVSRGDFLFQVPKQIT  585

Query  983   SSSSYGW  1003
             +  S+ W
Sbjct  586   APCSFAW  592



>ref|XP_010471522.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Camelina sativa]
Length=655

 Score =   369 bits (946),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 281/440 (64%), Gaps = 31/440 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS   IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPNIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID+K R+EA
Sbjct  375   SETEISLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV---EANMLgsrrgngsgsrgATVARM  880
              R+K     R    +R   R       +AP EE    E      R  +   +   + AR+
Sbjct  435   TRKKISGNGRRGIDARKPSRKAHSFNKLAPVEEDVRHETETFQKRISHLVHNSIGSDARL  494

Query  881   --SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                L++  D   + AS      SQGD   S P Q+  S+++ W K  +          + 
Sbjct  495   CEKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNTFAWAKLEKDDVCVRVHNRSL  553

Query  1052  SRSITMNGGVEPPTL------------------QQSKDDPLGLDEQDGGLAIRPKSMKQV  1177
             SR    N  V  P +                  ++ K D  G +  +       K  +Q+
Sbjct  554   SRGHIPNLSVHSPAINGKSNVECKINKNENEDKREDKTDSRGQESYEMVKRSMLKQWRQL  613

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  614   ERPDSFGASDEYH-SQELSL  632



>ref|XP_004958202.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Setaria italica]
Length=728

 Score =   370 bits (951),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+D+Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  199  YLVFEYMEHDLAGLCSSPDIKFTDAQLKCYMNQLLSGLEHCHSRRVVHRDIKGANLLVNN  258

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAE+
Sbjct  259  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFAEM  318

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KE+P
Sbjct  319  FRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYPSTLRDVFKEVP  378

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTA+ +L+SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  379  GNALSLLETLLSVEPYKRGTAAGALSSEFFRTKPYACDPSSLPKYAPNKEMD  430



>ref|XP_006300808.1| hypothetical protein CARUB_v10019891mg [Capsella rubella]
 gb|EOA33706.1| hypothetical protein CARUB_v10019891mg [Capsella rubella]
Length=656

 Score =   368 bits (944),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 281/436 (64%), Gaps = 28/436 (6%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  198   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  257

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  258   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  317

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  318   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  377

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K R+EA
Sbjct  378   SETEIDLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHRDEA  437

Query  719   rrrkagsavrgsgss----rNMRRLRKGMAPTEEV--EANMLgsrrgngsgsrgATVARM  880
              R+K     R    +    RN     K +AP E+   +      R G+   +   + AR+
Sbjct  438   TRKKISGNGRRGVDARKPSRNAHSFNK-LAPVEDAQNQTETFHKRIGHLVHNSIGSDARL  496

Query  881   --SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + 
Sbjct  497   CGKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSL  555

Query  1052  SRSITMNGGVEPPTL--------------QQSKDDPLGLDEQDGGLAIRPKSMKQVEQPL  1189
             SR    N     P                 + K D  G +  +       +  +Q+E+P 
Sbjct  556   SRGHIRNLSGHSPAFNGKGNVGSKINKNENEDKTDSQGHESYEMVKRSMLQQWRQLERPD  615

Query  1190  SFHSPDIYHFSKELSV  1237
             SF + D YH S+ELS+
Sbjct  616   SFGASDEYH-SQELSL  630



>ref|XP_010471518.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Camelina sativa]
 ref|XP_010471519.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Camelina sativa]
Length=695

 Score =   369 bits (947),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 281/440 (64%), Gaps = 31/440 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS   IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPNIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID+K R+EA
Sbjct  375   SETEISLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV---EANMLgsrrgngsgsrgATVARM  880
              R+K     R    +R   R       +AP EE    E      R  +   +   + AR+
Sbjct  435   TRKKISGNGRRGIDARKPSRKAHSFNKLAPVEEDVRHETETFQKRISHLVHNSIGSDARL  494

Query  881   --SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                L++  D   + AS      SQGD   S P Q+  S+++ W K  +          + 
Sbjct  495   CEKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNTFAWAKLEKDDVCVRVHNRSL  553

Query  1052  SRSITMNGGVEPPTL------------------QQSKDDPLGLDEQDGGLAIRPKSMKQV  1177
             SR    N  V  P +                  ++ K D  G +  +       K  +Q+
Sbjct  554   SRGHIPNLSVHSPAINGKSNVECKINKNENEDKREDKTDSRGQESYEMVKRSMLKQWRQL  613

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  614   ERPDSFGASDEYH-SQELSL  632



>ref|NP_001154470.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEE35579.1| putative serine/threonine kinase [Arabidopsis thaliana]
Length=690

 Score =   369 bits (946),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 218/433 (50%), Positives = 281/433 (65%), Gaps = 24/433 (6%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  257   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  316

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  317   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQTYDSCLRETLKDL  376

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K R+EA
Sbjct  377   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHRDEA  436

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEVEANMLgsrrgngsgsrgATVARM--S  883
              R+K     R     R   R       +AP    +      R G+   S   + AR+   
Sbjct  437   ARKKISGNGRRGIDPRKPSRKAHSFNRLAPDVRHQTETFQKRIGHLVHSSIESDARLCGK  496

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafa-----  1048
             L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +               
Sbjct  497   LQNPLDHKKDEASHV-KHASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSLSRG  555

Query  1049  -----NSRSITMNG--GVEPPTLQQSKDDPLGLDEQDGGLAIRP---KSMKQVEQPLSFH  1198
                  +  S   NG   VE    +  K+D      ++    ++    K  +Q+E+P SF 
Sbjct  556   YIPSLSGHSPAFNGKSDVESKINKDEKEDKTDSRGEESYEMVKRSMLKQWRQLERPDSFG  615

Query  1199  SPDIYHFSKELSV  1237
             + D YH S+ELS+
Sbjct  616   ASDEYH-SQELSL  627



>ref|NP_177573.2| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEE35578.1| putative serine/threonine kinase [Arabidopsis thaliana]
Length=699

 Score =   369 bits (946),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 219/436 (50%), Positives = 284/436 (65%), Gaps = 30/436 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  257   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  316

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  317   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQTYDSCLRETLKDL  376

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K R+EA
Sbjct  377   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHRDEA  436

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEVEANMLgsrrgngsgsrgATVARM--S  883
              R+K     R     R   R       +AP    +      R G+   S   + AR+   
Sbjct  437   ARKKISGNGRRGIDPRKPSRKAHSFNRLAPDVRHQTETFQKRIGHLVHSSIESDARLCGK  496

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSI  1063
             L++  D   + AS      SQGD   S P Q+  S+S+ W    +R         ++RS+
Sbjct  497   LQNPLDHKKDEASHV-KHASQGDVPFSGPLQVSKSNSFAW---AKREKDDVCVRVHNRSL  552

Query  1064  T-------------MNG--GVEPPTLQQSKDDPLGLDEQDGGLAIRP---KSMKQVEQPL  1189
             +              NG   VE    +  K+D      ++    ++    K  +Q+E+P 
Sbjct  553   SRGYIPSLSGHSPAFNGKSDVESKINKDEKEDKTDSRGEESYEMVKRSMLKQWRQLERPD  612

Query  1190  SFHSPDIYHFSKELSV  1237
             SF + D YH S+ELS+
Sbjct  613   SFGASDEYH-SQELSL  627



>emb|CDX73077.1| BnaC06g35250D [Brassica napus]
Length=639

 Score =   367 bits (941),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 281/440 (64%), Gaps = 37/440 (8%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLL+  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197   LVFEYMEHDLTGLLASPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG  VDLWS GCVFAE
Sbjct  257   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGSAVDLWSVGCVFAE  316

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y S LRE  K+L
Sbjct  317   LLLGKPILRGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQNYNSCLRETLKDL  376

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              +  + LIETLLSI+P KRGTAS++L SEYF T+P+ACDPSS+P +PP++EID K R EA
Sbjct  377   SEIEISLIETLLSIDPLKRGTASTALVSEYFTTEPFACDPSSLPMYPPSKEIDTKHRTEA  436

Query  719   rrrkagsavrgsgssrNMRRLR---KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    +R   R       +AP EE   +++     + +   G       L+
Sbjct  437   TRKKISGNGRRGVEARKPSRKTLSFNKLAPAEERIGHLVPISIESDAKFCG------KLQ  490

Query  890   SSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSITM  1069
             +  D   + AS     VSQGD   S P Q+  SSS+ W    +R         ++RS++ 
Sbjct  491   TQLDHKKDKASHVKN-VSQGDVPFSGPLQVSKSSSFAW---AKREKDEACVRVHNRSLSR  546

Query  1070  -------------NGGVEPPTLQQSKDDPLGLDEQDGG-----LAIRP---KSMKQVEQP  1186
                          NG    P   +SK+D    D+ D        A++    K  +Q+E+ 
Sbjct  547   GHIPNACGPSPAYNGNGVEPKRNESKNDDKREDKTDSRGQESYEAVKRSMLKQWRQLERL  606

Query  1187  LSFHSPDIYHFSKELSVEEQ  1246
              SF + D YH S+ELS+ ++
Sbjct  607   DSFGASDEYH-SQELSLGQR  625



>ref|XP_009106092.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
Length=684

 Score =   368 bits (944),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 284/440 (65%), Gaps = 37/440 (8%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLL+  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197   LVFEYMEHDLTGLLASPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG TVDLWS GCVFAE
Sbjct  257   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGSTVDLWSVGCVFAE  316

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  317   LLLGKPILRGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  376

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              +  + LIETLLSI+P KRGTAS++L SEYF T+P+ACDPSS+P +PP++EID K R EA
Sbjct  377   SEIEISLIETLLSIDPLKRGTASTALVSEYFTTEPFACDPSSLPMYPPSKEIDTKHRTEA  436

Query  719   rrrkagsavrgsgssrNMRRLR---KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    +R   R       +AP EE   +++     + +   G       ++
Sbjct  437   TRKKISGNGRRGVEARKPSRKTLSFNKLAPAEERIGHLVPISIESDAKFCG------KVQ  490

Query  890   SSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSITM  1069
             +  D   + AS      SQGD   S P Q+  SSS+ W    +R         ++RS++ 
Sbjct  491   TQLDHKKDEASHVKN-ASQGDVPFSGPLQVSKSSSFAW---AKRDKDEACVKVHNRSLSR  546

Query  1070  -------------NGGVEPPTLQQSKDDPLGLDE-----QDGGLAIRP---KSMKQVEQP  1186
                          NG    P + +SK+D    D+     Q+   A++    K  +Q+E+ 
Sbjct  547   GHIPNACGPSPAYNGNGVEPKINESKNDDKREDKTDSRGQESYEAVKRSMLKQWRQLERL  606

Query  1187  LSFHSPDIYHFSKELSVEEQ  1246
              SF + D YH S+ELS+ ++
Sbjct  607   DSFGASDEYH-SQELSLGQR  625



>ref|XP_006300809.1| hypothetical protein CARUB_v10019891mg [Capsella rubella]
 gb|EOA33707.1| hypothetical protein CARUB_v10019891mg [Capsella rubella]
Length=693

 Score =   367 bits (943),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 281/436 (64%), Gaps = 28/436 (6%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  198   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  257

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  258   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  317

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  318   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  377

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K R+EA
Sbjct  378   SETEIDLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHRDEA  437

Query  719   rrrkagsavrgsgss----rNMRRLRKGMAPTEEV--EANMLgsrrgngsgsrgATVARM  880
              R+K     R    +    RN     K +AP E+   +      R G+   +   + AR+
Sbjct  438   TRKKISGNGRRGVDARKPSRNAHSFNK-LAPVEDAQNQTETFHKRIGHLVHNSIGSDARL  496

Query  881   --SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + 
Sbjct  497   CGKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSL  555

Query  1052  SRSITMNGGVEPPTL--------------QQSKDDPLGLDEQDGGLAIRPKSMKQVEQPL  1189
             SR    N     P                 + K D  G +  +       +  +Q+E+P 
Sbjct  556   SRGHIRNLSGHSPAFNGKGNVGSKINKNENEDKTDSQGHESYEMVKRSMLQQWRQLERPD  615

Query  1190  SFHSPDIYHFSKELSV  1237
             SF + D YH S+ELS+
Sbjct  616   SFGASDEYH-SQELSL  630



>ref|XP_006657913.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=699

 Score =   367 bits (943),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  256  EGVLKIADFGLANYFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFAEL  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y STL++  KE+P
Sbjct  316  FRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYPSTLQDVFKEIP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             +A+ L+ETLLS+EPYKRGTAS +L SE+F TKPYACDPSS+PK+ PN+E+D
Sbjct  376  ANALSLLETLLSVEPYKRGTASGALTSEFFKTKPYACDPSSLPKYAPNKEMD  427



>ref|XP_007210886.1| hypothetical protein PRUPE_ppa002234mg [Prunus persica]
 gb|EMJ12085.1| hypothetical protein PRUPE_ppa002234mg [Prunus persica]
Length=698

 Score =   367 bits (942),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 223/440 (51%), Positives = 296/440 (67%), Gaps = 34/440 (8%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHD++GLLS  +IKFS++QIKC++KQLLSGLEHCH +G+MHRDIK SN+LV+N
Sbjct  199   YLVFEYMEHDITGLLSNPDIKFSEAQIKCYLKQLLSGLEHCHSRGVMHRDIKGSNLLVSN  258

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             +GILK+ DFGLANF ++  +QP+TSRVVTLWYRPPELLLG+T YG ++DLWS GC FAEL
Sbjct  259   DGILKVADFGLANFCNSGQRQPLTSRVVTLWYRPPELLLGSTDYGASIDLWSVGCAFAEL  318

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+L+GRTEVEQLHKIFKLCGSP DDYW++SKLP A +FKPQ  Y+S+LR+  K+LP
Sbjct  319   LIGKPVLQGRTEVEQLHKIFKLCGSPPDDYWKKSKLPHATLFKPQQPYDSSLRQTFKDLP  378

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              + ++L+ETLLS+EP+KRGTASS+L SEYF  KPYACDPSS+P +PP++EIDAK REEA+
Sbjct  379   TTTLNLLETLLSVEPHKRGTASSALASEYFKMKPYACDPSSLPIYPPSKEIDAKNREEAK  438

Query  722   rrkagsavrgsgssrNMRRLR--KGMAPTEEVEAN-----MLgsrrgngsgsrgATVARM  880
             R+K G  VRGS + +  R+      +AP E++         + +  GN      A   R 
Sbjct  439   RKKIGGRVRGSETRKQTRKSLGCSKLAPAEDLAVQSQVSYKINANNGNILKEENAITGRE  498

Query  881   SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
               K S   V E  S      SQGD   S P ++ +SS + W    +R        +++RS
Sbjct  499   LPKPSAGKVEE--SSHVKNASQGDIPFSGPLEVSTSSGFAW---AKRRKDDASIRSHTRS  553

Query  1061  ITMN---GGVEPPTLQQSKDDPLGLDEQDGGLAIRPKS---------------MKQ---V  1177
             I+       +EPP    ++++      ++G L  R ++               MKQ   +
Sbjct  554   ISRGHIFNAIEPPIAVHTRNNFDSRRHENGELKYRVRTDSRGHDSYEIAKLAMMKQWGKL  613

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E P SF + D YH S+ELS+
Sbjct  614   EHPDSFDASDGYH-SQELSL  632



>ref|XP_010939059.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=698

 Score =   367 bits (941),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDL+GL S  EI  S+ QIKC+M QLLSGLEHCH +G++HRDIK +N+LVNN
Sbjct  189  YLVFEYMDHDLAGLCSSPEITLSEPQIKCYMHQLLSGLEHCHSRGVIHRDIKGANLLVNN  248

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF     KQP+TSRVVTLWYRPPELLLG+T Y  TVDLWS GCVFAEL
Sbjct  249  EGVLKIADFGLANFFRPGHKQPLTSRVVTLWYRPPELLLGSTDYEATVDLWSVGCVFAEL  308

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F  +PIL+GRTEVEQLHKIFKL GSP D+YW++SKLP A IFKP + YES LRE  K+LP
Sbjct  309  FLRKPILQGRTEVEQLHKIFKLSGSPPDEYWKKSKLPHATIFKPHHPYESCLREAFKDLP  368

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV L+E  LS+EPYKRGTAS +L SEYF T PYACDPSS+PK+PPN+EID
Sbjct  369  ASAVCLLEVFLSVEPYKRGTASVALASEYFTTTPYACDPSSLPKYPPNKEID  420



>ref|XP_010416284.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Camelina sativa]
 ref|XP_010416285.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Camelina sativa]
Length=694

 Score =   366 bits (940),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 281/439 (64%), Gaps = 30/439 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID+K R+EA
Sbjct  375   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K   +       R   R       +AP E+   +      R G+   +   + AR+ 
Sbjct  435   TRKKISGSGIRGIDERKPSRKAHSFNKLAPVEDARHQTETFQKRIGHLVHNSIGSDARLC  494

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-S  1054
               L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + S
Sbjct  495   EKLQTPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSLS  553

Query  1055  RSITMNGGVEPPTLQ------------------QSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             R    N  V  P                     + K D  G +  +       K  +Q+E
Sbjct  554   RGHIPNLSVHSPAFNGKSNVESKINKNENEAKCEDKTDSRGQESYEMVKRSMLKQWRQLE  613

Query  1181  QPLSFHSPDIYHFSKELSV  1237
             +P SF +   YH S+ELS+
Sbjct  614   RPDSFGASGEYH-SQELSL  631



>ref|XP_008651752.1| PREDICTED: uncharacterized protein LOC100383830 isoform X1 [Zea 
mays]
 tpg|DAA63450.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=715

 Score =   367 bits (942),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 201/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I+F+++Q+KC+M QLLSGLEHCH + ++HRD+K +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIRFTEAQLKCYMNQLLSGLEHCHSRRVVHRDMKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAE+
Sbjct  256  EGVLKIADFGLANFFDPNKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSLGCVFAEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A +FKP + Y STLR+  KE+P
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATVFKPHHPYPSTLRDVFKEVP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTASS+L+SE+F TKPYAC+PSS+PK+ PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASSALSSEFFRTKPYACEPSSLPKYAPNKEMD  427



>ref|XP_006390437.1| hypothetical protein EUTSA_v10018206mg [Eutrema salsugineum]
 gb|ESQ27723.1| hypothetical protein EUTSA_v10018206mg [Eutrema salsugineum]
Length=496

 Score =   360 bits (923),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 217/438 (50%), Positives = 280/438 (64%), Gaps = 37/438 (8%)
 Frame = +2

Query  20    MEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNEGILKI  199
             MEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NEGILK+
Sbjct  1     MEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNEGILKV  60

Query  200   GDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAELFFGR  373
              DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAEL  G+
Sbjct  61    ADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAELLLGK  120

Query  374   PILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELPKSAV  553
             PIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S LRE  K+L ++ +
Sbjct  121   PILRGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQNYDSCLRETLKDLSETEI  180

Query  554   HLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreearrrka  733
             +LIETLLSIEP+KRGTASS+L S+YF TKP+ACDPSS+P +PP++EID K REEA R+K 
Sbjct  181   NLIETLLSIEPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHREEATRKKI  240

Query  734   gsavrgsgssrNMRRLR---KGMAPTEEV--EANMLgsrrgngsgsrgATVARM--SLKS  892
                 R    +R   R       +AP E+V  +      R GN   +   + AR+   L++
Sbjct  241   SGNGRRGIEARKPTRKALTFNKLAPAEDVRHQTGTFQKRIGNLVHNSIESDARVCGKLQN  300

Query  893   SYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSIT--  1066
               +   + AS      SQGD   S P Q+  SSS+ W    +R         ++RS++  
Sbjct  301   PSNHKKDEASHVKN-ASQGDVPFSGPLQVSLSSSFAW---AKREKDDVCVRVHNRSLSRG  356

Query  1067  ---------------------MNGGVEPPTLQQSKDDPLGLDEQDGGLAIRPKSMKQVEQ  1183
                                  +N  +     + +K D  G D  +       K  +Q+E+
Sbjct  357   HIPNLSGHSPAFNGKSDAESKINENMNDDKRENNKTDSRGQDSYEMVKRSMLKQWRQLER  416

Query  1184  PLSFHSPDIYHFSKELSV  1237
             P SF + D YH S+ELS+
Sbjct  417   PDSFGASDEYH-SQELSL  433



>ref|XP_008781045.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Phoenix dactylifera]
Length=707

 Score =   367 bits (941),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVF+YMEHDL+GLLS  +I FS+ QIKC+M+QLLSGLEHCH +GIMHRDIK +N+L+NN
Sbjct  179  YLVFDYMEHDLAGLLSAPDINFSEPQIKCYMRQLLSGLEHCHSRGIMHRDIKCANLLINN  238

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLANF SA   QP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAE+
Sbjct  239  EGILKIADFGLANFFSAGQIQPLTSRVVTLWYRPPELLLGSTDYEASVDLWSVGCVFAEV  298

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F  +PI +GRTEVEQ+HKIFKLCGSP +++W++SKLP A +FKPQ  Y S LRE  K LP
Sbjct  299  FLRKPIFQGRTEVEQIHKIFKLCGSPPEEFWKKSKLPHATLFKPQQPYGSCLRETLKRLP  358

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A +L+ET LS+EPY+RGTAS++L SEYF +KPYAC PSS PK+PPN+EID
Sbjct  359  ENAFNLLETFLSVEPYRRGTASTALASEYFKSKPYACAPSSSPKYPPNKEID  410



>gb|KFK41882.1| hypothetical protein AALP_AA2G184200 [Arabis alpina]
Length=702

 Score =   366 bits (940),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 285/440 (65%), Gaps = 32/440 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  200   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  259

Query  185   GILKIGDFGLANFVSA--RSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF S+    K+P+TSRVVTLWYRPPELLLGAT YG  VDLWS GCVFAE
Sbjct  260   GILKVADFGLANFSSSSGNKKKPLTSRVVTLWYRPPELLLGATDYGAAVDLWSVGCVFAE  319

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  320   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  379

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ + LIETLLSIEP+KRGT SS+L S+YF TKP+ACDPSS+P +PP++EID K R+EA
Sbjct  380   SETEISLIETLLSIEPHKRGTPSSALASQYFTTKPFACDPSSLPVYPPSKEIDTKHRDEA  439

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K     R    SR   R       +AP E+V  +      R G+   +   + A++ 
Sbjct  440   TRKKVSGNGRRGIESRKPTRKTHSFNKLAPAEDVRHQTETFQKRIGHLVHNSIESDAKLC  499

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafa---  1048
               L++  +   + AS      SQGD   S P Q+  S+S+ W K+ +             
Sbjct  500   GKLQNPLNHKKDEASHVKN-ASQGDVPFSGPLQVSMSNSFAWAKREKDDVCVRVHNRSLS  558

Query  1049  ---------NSRSITMNGGVEPPTLQQSKDDPLGLDEQDG----GLAIRPKSM----KQV  1177
                      +S +   N  VE   ++   +D    D+ D        +  +SM    +Q+
Sbjct  559   RGHIPNLSGHSPAFNGNSDVESKIIKNENEDKRE-DKADSRGQESFEMVKRSMLKQWRQL  617

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  618   ERPDSFGASDEYH-SQELSL  636



>ref|XP_009394765.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=659

 Score =   365 bits (936),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC +I FS+SQ+KC+M+QLLSGLEHCH+  I+HRDIK +N+LVNN
Sbjct  186  YLVFEYMEHDLAGLSSCPDINFSESQVKCYMRQLLSGLEHCHLHNIIHRDIKGANLLVNN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LK+ DFGLANF S   KQP+TSRVVTLWYRPPELLLG+T Y  TVDLWS GCVFAE+
Sbjct  246  EGVLKMADFGLANFYSPGHKQPLTSRVVTLWYRPPELLLGSTDYEATVDLWSVGCVFAEM  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIF+LCGSP D+YW++SKLP A IFKP   Y+S+ +E  K LP
Sbjct  306  FVGRPILQGRTEVEQLHKIFRLCGSPPDEYWKKSKLPHATIFKPHNRYKSSFQESFKNLP  365

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S   L+E  LSIEPYKRGT SS+L SEYF TKPYAC+ S +PK+PP +EID
Sbjct  366  PSTFSLLEKFLSIEPYKRGTTSSALASEYFRTKPYACESSDLPKYPPTKEID  417



>dbj|BAJ97684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   362 bits (928),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  192  YLVFEYMEHDLAGLCSSPDIKFTEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  251

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  252  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDSAVDLWSVGCVFAEL  311

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP+DDYW++S+LP A IFKP   Y STLR+  KE+P
Sbjct  312  FRGRPILQGRTEVEQLHKIFKLCGSPADDYWKKSRLPHATIFKPHCPYLSTLRDVFKEVP  371

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            + A  L+ETLLS+EPYKRGTAS +L SE+F TKPYAC+P S+P++ PN+E+D
Sbjct  372  QHAFSLLETLLSVEPYKRGTASCALTSEFFKTKPYACEPISLPQYAPNKEMD  423



>ref|XP_010459503.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=703

 Score =   366 bits (939),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 279/440 (63%), Gaps = 30/440 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  201   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLEHCHARGVMHRDIKGSNLLVNN  260

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  261   EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  320

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  321   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDSCLRETLKDL  380

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + ++LIETLLSIEP+KRG+AS++L S+YF +KP+ACDPSS+P + P++EIDAK REE 
Sbjct  381   SDADINLIETLLSIEPHKRGSASTALVSQYFTSKPFACDPSSLPVYSPSKEIDAKHREET  440

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEV-----EANMLgsrrgngsgsrgATVA  874
              R+K     R    SR   R       +AP E+V     + +       + S    AT+ 
Sbjct  441   TRKKICGNGRRGTESRKPTRKPPACAKLAPVEDVRHHSQKFHKRNGHSVHNSIDSDATIC  500

Query  875   RMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                 K S +   + AS     + QGD   S P Q+  SS + W K+ +          + 
Sbjct  501   EKPQKPSSNHEKDEASHVKNAL-QGDVPFSGPLQVSVSSGFAWAKRRKDDICVRSHNRSL  559

Query  1052  SRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRP------------------KSMKQV  1177
             SR    N     P   +S D    ++E++                         K  +Q+
Sbjct  560   SRGHITNLLGPSPAFSESTDVDSKINEKENEEKHHARTDSQDREAYEMLKLSMLKKWRQL  619

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  620   ERPDSFDTSDEYH-SQELSL  638



>ref|XP_008667076.1| PREDICTED: uncharacterized LOC100191951 isoform X2 [Zea mays]
 tpg|DAA41311.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=705

 Score =   365 bits (938),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRHVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVF E+
Sbjct  256  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFPEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KELP
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYTSTLRDVFKELP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+P + PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPNYAPNKEMD  427



>ref|XP_008667075.1| PREDICTED: uncharacterized LOC100191951 isoform X1 [Zea mays]
 tpg|DAA41307.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=707

 Score =   366 bits (939),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRHVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVF E+
Sbjct  256  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFPEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KELP
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYTSTLRDVFKELP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+P + PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPNYAPNKEMD  427



>gb|KFK44020.1| hypothetical protein AALP_AA1G204600 [Arabis alpina]
Length=703

 Score =   365 bits (938),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 198/341 (58%), Positives = 243/341 (71%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  202   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  261

Query  182   EGILKIGDFGLANFV-SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF  S+ +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  262   EGILKVADFGLANFCNSSANKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  321

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K L
Sbjct  322   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLRETLKSL  381

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + ++LIETLLSIEPYKRGTAS++L S+YF TKP+ACDPSS+P + P++EIDAK REE 
Sbjct  382   SDADINLIETLLSIEPYKRGTASTALISQYFTTKPFACDPSSLPVYTPSKEIDAKHREET  441

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    SR   R       +AP E+V       ++ NG     +  +  +L 
Sbjct  442   TRKKISGNGRRGTESRKPTRKPPAFAKLAPAEDVRHLSRSFQKRNGHSVHNSIDSDATLC  501

Query  890   SSYDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
                   S+     A+ V   SQGD   S P Q+  SS + W
Sbjct  502   GKLQKPSDHGKDEASHVKNASQGDVPFSGPLQVSVSSGFAW  542



>ref|XP_008667077.1| PREDICTED: uncharacterized LOC100191951 isoform X3 [Zea mays]
 tpg|DAA41308.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=703

 Score =   365 bits (938),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRHVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVF E+
Sbjct  256  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFPEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KELP
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYTSTLRDVFKELP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+P + PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPNYAPNKEMD  427



>ref|NP_001130847.1| uncharacterized LOC100191951 [Zea mays]
 gb|ACF79215.1| unknown [Zea mays]
 tpg|DAA41310.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=709

 Score =   365 bits (938),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRHVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVF E+
Sbjct  256  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFPEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KELP
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYTSTLRDVFKELP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+P + PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPNYAPNKEMD  427



>ref|XP_006306905.1| hypothetical protein CARUB_v10008466mg [Capsella rubella]
 gb|EOA39803.1| hypothetical protein CARUB_v10008466mg [Capsella rubella]
Length=699

 Score =   365 bits (937),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 215/438 (49%), Positives = 280/438 (64%), Gaps = 27/438 (6%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  198   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  257

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  258   EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  317

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+L
Sbjct  318   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLREALKDL  377

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + ++LIETLLSIEP+KRG+AS++L S+YF +KP+ACDPSS+P + P++EIDAK REE 
Sbjct  378   SDADINLIETLLSIEPHKRGSASTALVSQYFTSKPFACDPSSLPVYSPSKEIDAKHREET  437

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    +R   R       +AP E+V  +     + NG     +  +  +L 
Sbjct  438   IRKKISGNGRRGTEARKPTRKPPAYAKLAPVEDVRHHSQKMPKRNGHSVHSSIDSDATLC  497

Query  890   SSYDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRS  1060
                   S      A+ V   SQGD   S P Q+  SS + W K+ +          +   
Sbjct  498   EKLQKPSNHEKDEASHVKNASQGDVPFSGPLQVSVSSGFAWAKRRKDDICVRSHNRSFSR  557

Query  1061  ITMNGGVEP-PTLQQSKDDPLGLD-----EQDGGLAIRP-------------KSMKQVEQ  1183
               +N  + P P   ++ D    ++     E+DG                   K  +Q+E+
Sbjct  558   GHINNLLGPSPACSENTDVDSKINEKENEEKDGARTDSQDREAYEMLKLSMLKKWRQLER  617

Query  1184  PLSFHSPDIYHFSKELSV  1237
             P SF + D YH S+ELS+
Sbjct  618   PDSFDASDEYH-SQELSL  634



>emb|CDX96534.1| BnaA07g31450D [Brassica napus]
Length=639

 Score =   363 bits (931),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 216/440 (49%), Positives = 282/440 (64%), Gaps = 37/440 (8%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLL+  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  197   LVFEYMEHDLTGLLASPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  256

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG  VDLWS GCVFAE
Sbjct  257   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGSAVDLWSVGCVFAE  316

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S LRE  ++L
Sbjct  317   LLLGKPILRGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQNYDSCLRETLEDL  376

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              +  + LIETLLSI+P KRGTAS++L SEYF T+P+ACDPSS+P +PP++EID K R EA
Sbjct  377   SEIEISLIETLLSIDPLKRGTASTALVSEYFTTEPFACDPSSLPMYPPSKEIDTKHRTEA  436

Query  719   rrrkagsavrgsgssrNMRRLR---KGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    +R   R       +AP EE   +++     + +   G       ++
Sbjct  437   TRKKISGNGRRGVEARKPSRKTLSFNKLAPAEERIGHLVPISIESDAKFCG------KVQ  490

Query  890   SSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaNSRSITM  1069
             +  D   + AS      SQGD   S P Q+  SSS+ W    +R         ++RS++ 
Sbjct  491   TQLDHKKDEASHVKN-ASQGDVPFSGPLQVSKSSSFAW---AKRDKDEACVKVHNRSLSR  546

Query  1070  -------------NGGVEPPTLQQSKDDPLGLDE-----QDGGLAIRP---KSMKQVEQP  1186
                          NG    P   +SK+D    D+     Q+   A++    K  +Q+E+ 
Sbjct  547   GHIPNACGPSPAYNGNGVEPKRNESKNDDKREDKTDSRGQESYEAVKRSLLKQWRQLERL  606

Query  1187  LSFHSPDIYHFSKELSVEEQ  1246
              SF + D YH S+ELS+ ++
Sbjct  607   DSFGASDEYH-SQELSLGQR  625



>gb|EMT15543.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=594

 Score =   361 bits (927),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  78   YLVFEYMEHDLAGLCSSPDIKFTEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  137

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  138  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDSAVDLWSVGCVFAEL  197

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP+DDYW++S+LP A IFKP   Y STLR+  KE+P
Sbjct  198  FRGRPILQGRTEVEQLHKIFKLCGSPADDYWKKSRLPHATIFKPHCPYLSTLRDVFKEVP  257

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            + A  L+ETLLS+EPYKRGTAS +L SE+F TKPYAC+P S+P++ PN+E+D
Sbjct  258  EHAFSLLETLLSVEPYKRGTASCALTSEFFKTKPYACEPISLPQYAPNKEMD  309



>ref|XP_009397746.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=682

 Score =   363 bits (933),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL SC +IKFS+ QIKC+M QLLSGL+ CH +GI+HRDIK +N+LVNN
Sbjct  184  YLVFEYMEHDLAGLSSCPDIKFSEPQIKCYMHQLLSGLDQCHSRGIIHRDIKCANLLVNN  243

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLAN ++   KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  244  EGILKMADFGLANILNPEEKQPLTSRVVTLWYRPPELLLGSTDYDASVDLWSVGCVFAEL  303

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL GRTEVEQ+HKIFKLCGSP + YW+QS++P A +FKPQ+ YE+ L+E    LP
Sbjct  304  FLGRPILPGRTEVEQIHKIFKLCGSPPEVYWKQSRMPHATVFKPQHPYENCLQETFDTLP  363

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA  L+ET LSIEP KRGTAS++L S+YF TKPYACDPSS PK+ PN+EID
Sbjct  364  ESAFELLETFLSIEPKKRGTASAALASKYFRTKPYACDPSSFPKYQPNKEID  415



>ref|XP_010477057.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=712

 Score =   364 bits (935),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 279/440 (63%), Gaps = 30/440 (7%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  209   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLEHCHARGVMHRDIKGSNLLVNN  268

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  269   EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCVFAE  328

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+S L+E  K+L
Sbjct  329   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDSCLQETLKDL  388

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + ++LIETLLSIEP+KRG+AS++L S+YF +KP+ACDPSS+P + P++EIDAK REE 
Sbjct  389   SDADINLIETLLSIEPHKRGSASTALVSQYFTSKPFACDPSSLPVYSPSKEIDAKHREET  448

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEVEAN-----MLgsrrgngsgsrgATVA  874
              R+K     R    SR   R       +AP E+V  +            + S    AT+ 
Sbjct  449   TRKKICGNGRRGTESRKPTRKPPACAKLAPVEDVRHHSQKFQKRNGHSVHNSIDSDATIC  508

Query  875   RMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-  1051
                 K S +   + AS      SQGD   S P Q+  SS + W K+ +          + 
Sbjct  509   EKPQKPSSNHEKDEASHVKN-ASQGDVPFSGPLQVSVSSGFAWAKRRKDDICVRSHNRSL  567

Query  1052  SRSITMNGGVEPPTLQQSKDDPLGLDEQDG----GLAIRP--------------KSMKQV  1177
             SR    N     P   ++ D    ++E++     G                   K  +Q+
Sbjct  568   SRGHITNLLGPSPAFSENTDVDSKINEKENEEKHGAKTDSQDREAYEMLKLSMLKKWRQL  627

Query  1178  EQPLSFHSPDIYHFSKELSV  1237
             E+P SF + D YH S+ELS+
Sbjct  628   ERPDSFDTSDEYH-SQELSL  646



>tpg|DAA41309.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=759

 Score =   365 bits (937),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRHVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVF E+
Sbjct  256  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFPEM  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STLR+  KELP
Sbjct  316  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYTSTLRDVFKELP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+P + PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPNYAPNKEMD  427



>ref|XP_002463130.1| hypothetical protein SORBIDRAFT_02g038280 [Sorghum bicolor]
 gb|EER99651.1| hypothetical protein SORBIDRAFT_02g038280 [Sorghum bicolor]
Length=708

 Score =   363 bits (933),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  197  YLVFEYMEHDLAGLCSSPDIKFTEAQLKCYMNQLLSGLEHCHSRRVVHRDIKGANLLVNN  256

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAE+
Sbjct  257  EGVLKIADFGLANFFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDAAVDLWSVGCVFAEM  316

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PIL+GRTEVEQLHKIFKLCGSP+DDYW++SKLP A IFKP + Y STL E  K +P
Sbjct  317  YRGKPILQGRTEVEQLHKIFKLCGSPADDYWKKSKLPHATIFKPHHPYPSTLGEVFKVVP  376

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L+SE+F TKPYAC+PSS+PK+ PN+E+D
Sbjct  377  ENALSLLETLLSVEPYKRGTASGALSSEFFRTKPYACEPSSLPKYAPNKEMD  428



>ref|XP_004499517.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=673

 Score =   363 bits (931),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 200/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHD+SGLL   ++KFS+SQIKC+MKQLLSG+EH H +G+MHRDIK  N+LVNN
Sbjct  178  YLVFEYMEHDISGLLGNPDVKFSESQIKCYMKQLLSGVEHFHSRGVMHRDIKGPNLLVNN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLANF  +  + P+TSRVVTLWYRPPELLLG+T Y  +VDLWS GC+FAEL
Sbjct  238  EGILKVADFGLANFARSGHEHPLTSRVVTLWYRPPELLLGSTDYDSSVDLWSVGCIFAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
                PIL+GRTEVEQLHKIFKLCGSP D+YW+++KLP A +FKPQ  Y+S L+E  K+ P
Sbjct  298  LVRNPILQGRTEVEQLHKIFKLCGSPPDEYWKKTKLPSATLFKPQLPYDSCLQEYFKDFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             ++V+L++TLLS+EPYKRGTA+S+L+SEYF T+PYACDPSS+PK+PP++EID
Sbjct  358  PTSVNLLQTLLSVEPYKRGTATSALSSEYFKTQPYACDPSSLPKYPPSKEID  409



>gb|KDO44513.1| hypothetical protein CISIN_1g036122mg, partial [Citrus sinensis]
Length=457

 Score =   355 bits (912),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C  +KFS+ Q+KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  175  YLVFEYMEHDLAGLAACQGVKFSEPQVKCYMKQLLSGLEHCHNNGVLHRDIKGSNLLIDN  234

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILKI DFGLA F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  235  DGILKIADFGLATFYDPGLKQPMTSRVVTLWYRPPELLLGATYYGVGVDLWSAGCILAEL  294

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A +FKPQ  Y+  + E  K+ P
Sbjct  295  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPNATLFKPQQPYKRCIAETFKDFP  354

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLLSI+P  RGTA+++LNSE+F+T+PYAC+PSS+PK+PP++E+D
Sbjct  355  SSSLPLIETLLSIDPDNRGTATAALNSEFFNTEPYACEPSSLPKYPPSKEMD  406



>emb|CDY71137.1| BnaC08g49430D [Brassica napus]
Length=436

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            +LVFEYMEHDL+GLLS  +I F+   IKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  181  HLVFEYMEHDLTGLLSRPDINFTTPLIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  240

Query  182  EGILKIGDFGLANFVSA-RSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
            EG+LK+ DFGLANF +A R+KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  241  EGVLKVADFGLANFCNASRNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  300

Query  359  LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
            L   +P+L+GRTEVEQLHKIFKLCGSP +DYW ++KLP A +FKPQ  Y+  LRE  K+L
Sbjct  301  LLLKKPVLQGRTEVEQLHKIFKLCGSPPEDYWRKTKLPHAMLFKPQQHYDGCLRETFKDL  360

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
              + V LIETLLSIEP KRG AS++L S+YF TKPYACDPS++P + P++EID
Sbjct  361  SDADVSLIETLLSIEPNKRGIASTALVSQYFTTKPYACDPSTLPVYSPSKEID  413



>gb|KGN64182.1| hypothetical protein Csa_1G042890 [Cucumis sativus]
Length=662

 Score =   361 bits (927),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 246/351 (70%), Gaps = 30/351 (9%)
 Frame = +2

Query  41    LLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNEGILKIGDFGLAN  220
             L+SC ++ FS++Q+KC+M+QLLS +EHCH++GIMHRDIK SNILVNNEGILK+ DFGLAN
Sbjct  161   LVSCPDVMFSEAQVKCYMRQLLSAIEHCHLRGIMHRDIKASNILVNNEGILKLADFGLAN  220

Query  221   FVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAELFFGRPILKGRTEV  400
              ++ R+KQ +TSRVVTLWYRPPELL+G+T YG TVDLWS GCVFAEL  G+P+LKGRTEV
Sbjct  221   VINTRNKQALTSRVVTLWYRPPELLMGSTDYGLTVDLWSIGCVFAELHLGKPLLKGRTEV  280

Query  401   EQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELPKSAVHLIETLLSI  580
             EQLHKIFKLCGSP +++W+++KLP AA+F+PQ+AYES+L E+CKE    AV L+E+ L+I
Sbjct  281   EQLHKIFKLCGSPPEEFWKKTKLPHAAMFRPQHAYESSLDEKCKEFAPVAVRLLESFLAI  340

Query  581   EPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreearrrkagsavrgsgs  760
             EPYKRGTASS+L SEYF TKPYACDPS++PK+PPN+E+DAK RE+ARR+   +  R   +
Sbjct  341   EPYKRGTASSALMSEYFKTKPYACDPSTLPKYPPNKEMDAKNREDARRKNRVNNARAKET  400

Query  761   srNM--RRLRKG--------MAPTEEVEANMLgsrrgngsgsrgATVARMSLKSS-----  895
                   RR+R+         +A  EE+ A  + +     S   G+     +   S     
Sbjct  401   GATQRPRRVRRNFQEFNSHKVAIKEELSAEDVQNINNQPSRRNGSNNNNTTNNLSKDQQG  460

Query  896   --------------YDTVSEAASQTATEVSQ-GDSICSVPAQMISSSSYGW  1003
                           YDT SE +   AT  +Q GDS  + P  + +SS + W
Sbjct  461   DVFQRDPQKKQQQLYDTTSETSQAAATAPNQGGDSAFTAPMLVSASSGFAW  511



>dbj|BAJ87041.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=692

 Score =   362 bits (929),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKF+++Q+KC+M QLLSGLEHCH + I+HRDIK +N+LVNN
Sbjct  192  YLVFEYMEHDLAGLCSSPDIKFTEAQVKCYMNQLLSGLEHCHSRRIVHRDIKGANLLVNN  251

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAEL
Sbjct  252  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDSAVDLWSVGCVFAEL  311

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F GRPIL+GRTEVEQLHKIFKLCGSP+DDYW++S+LP A IFKP   Y STLR+  KE+P
Sbjct  312  FRGRPILQGRTEVEQLHKIFKLCGSPADDYWKKSRLPHATIFKPHCPYLSTLRDVFKEVP  371

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            + A  L+ETLLS+EPYKRGTAS +L SE+F TKPYAC+P S+P++ PN+E+D
Sbjct  372  QHAFSLLETLLSVEPYKRGTASCALTSEFFKTKPYACEPISLPQYAPNKEMD  423



>ref|XP_010428415.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Camelina sativa]
Length=692

 Score =   362 bits (928),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 214/437 (49%), Positives = 278/437 (64%), Gaps = 28/437 (6%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+AC PSS+P +PP++EID+K R+EA
Sbjct  375   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACYPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEVEANMLgsrrgngsgsrgATVARM--S  883
              R+K     R    +R   R       +AP    +      R G+   +   +  R+   
Sbjct  435   TRKKISGNGRRGTDARKPSRKAHSFNKLAPDARHQTETFQKRIGHLVHNSIGSDVRLCEK  494

Query  884   LKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-SRS  1060
             L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + SR 
Sbjct  495   LQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSLSRG  553

Query  1061  ITMNGGVEPPTLQ------------------QSKDDPLGLDEQDGGLAIRPKSMKQVEQP  1186
                N  V  P                     + K D  G +  +       K  +Q+E+P
Sbjct  554   HIPNLSVHSPAFNGKSNVESKINKNENEAKCEDKTDSRGQESYEMVKRSMLKQWRQLERP  613

Query  1187  LSFHSPDIYHFSKELSV  1237
              SF +   YH S+ELS+
Sbjct  614   DSFGASGEYH-SQELSL  629



>ref|XP_010498274.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Camelina sativa]
 ref|XP_010498275.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Camelina sativa]
Length=703

 Score =   362 bits (928),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 210/449 (47%), Positives = 269/449 (60%), Gaps = 48/449 (11%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGLEHCH +G+MHRDIK SN+LVNN
Sbjct  201   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLEHCHARGVMHRDIKGSNLLVNN  260

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT YG +VDLWS GCVFAE
Sbjct  261   EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATGYGASVDLWSVGCVFAE  320

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW+ SKLP A +FKPQ  Y+  LRE  K+L
Sbjct  321   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKNSKLPHAMLFKPQQHYDGCLRETLKDL  380

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
                 ++LIETLLSIEP+KRG+AS++L S+YF +KP+ACDPSS+P + P++EID       
Sbjct  381   SDVDINLIETLLSIEPHKRGSASTALVSQYFTSKPFACDPSSLPVYSPSKEID-------  433

Query  719   rrrkagsavrgsgssrNMRRLRKG------------MAPTEEVEAN-----MLgsrrgng  847
                K            N RR  +             +AP E+V  +            + 
Sbjct  434   --AKHREETTRKKICGNGRRGTESRKPTQKPPACAKLAPVEDVRHHSQKFQKRNGHSVHN  491

Query  848   sgsrgATVARMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraa  1027
             S    AT+     K S +   + AS      SQGD   S P Q+  SS + W K+ +   
Sbjct  492   SIDSDATICEKPQKPSSNHEKDEASHVKN-ASQGDLPFSGPLQVSVSSGFAWAKRRKDDI  550

Query  1028  arfhafaN-SRSITMNGGVEPPTLQQSKDDPLGLDEQDGGLAIRP---------------  1159
                    + SR    N     P   ++ D    ++E++     +                
Sbjct  551   CVRSHNRSLSRCYITNLLGPSPAFSENTDVDSKINEKENEEKHQARTDSQDREAYEMLKL  610

Query  1160  ---KSMKQVEQPLSFHSPDIYHFSKELSV  1237
                K  +Q+E+P SF + D YH S+ELS+
Sbjct  611   SMLKKWRQLERPDSFDTSDEYH-SQELSL  638



>ref|XP_010428414.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Camelina sativa]
Length=694

 Score =   361 bits (927),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 215/439 (49%), Positives = 280/439 (64%), Gaps = 30/439 (7%)
 Frame = +2

Query  5     LVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNNE  184
             LVFEYMEHDL+GLLS  +IKF+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+L++NE
Sbjct  195   LVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGSNLLLSNE  254

Query  185   GILKIGDFGLANFV--SARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             GILK+ DFGLANF   S   K+P+TSRVVTLWYRPPELLLGAT YG +VD+WS GCVFAE
Sbjct  255   GILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDMWSVGCVFAE  314

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+PIL+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+S LRE  K+L
Sbjct  315   LLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQNYDSCLRETLKDL  374

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
              ++ ++LIETLLSI+P+KRGTASS+L S+YF TKP+AC PSS+P +PP++EID+K R+EA
Sbjct  375   SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACYPSSLPIYPPSKEIDSKHRDEA  434

Query  719   rrrkagsavrgsgssrNMRRLRKG---MAPTEEV--EANMLgsrrgngsgsrgATVARM-  880
              R+K     R    +R   R       +AP E+   +      R G+   +   +  R+ 
Sbjct  435   TRKKISGNGRRGTDARKPSRKAHSFNKLAPVEDARHQTETFQKRIGHLVHNSIGSDVRLC  494

Query  881   -SLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGWPkkheraaarfhafaN-S  1054
               L++  D   + AS      SQGD   S P Q+  S+S+ W K+ +          + S
Sbjct  495   EKLQNPLDHKKDEASHMKN-ASQGDVPFSGPLQVSKSNSFAWAKREKDDVCVRVHNRSLS  553

Query  1055  RSITMNGGVEPPTLQ------------------QSKDDPLGLDEQDGGLAIRPKSMKQVE  1180
             R    N  V  P                     + K D  G +  +       K  +Q+E
Sbjct  554   RGHIPNLSVHSPAFNGKSNVESKINKNENEAKCEDKTDSRGQESYEMVKRSMLKQWRQLE  613

Query  1181  QPLSFHSPDIYHFSKELSV  1237
             +P SF +   YH S+ELS+
Sbjct  614   RPDSFGASGEYH-SQELSL  631



>ref|XP_006416579.1| hypothetical protein EUTSA_v10006926mg [Eutrema salsugineum]
 gb|ESQ34932.1| hypothetical protein EUTSA_v10006926mg [Eutrema salsugineum]
Length=704

 Score =   362 bits (928),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 243/341 (71%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  203   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  262

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +   +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  263   EGILKVADFGLANFCNVSGNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  322

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+L
Sbjct  323   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLRETLKDL  382

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + + LIETLL +EP+KRGTAS++L S+YF TKP+ACDPSS+P + P++EIDAK RE+A
Sbjct  383   SDADITLIETLLCVEPHKRGTASTALVSQYFTTKPFACDPSSLPVYSPSKEIDAKHREDA  442

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    SR   R       +AP E+V  +    ++ NG     +  +  +L 
Sbjct  443   TRKKISGNGRRGTESRKPTRKPPAFANLAPAEDVRQHSRTFQKRNGHSVHSSIDSDATLY  502

Query  890   SSYDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
                   S+   +  + V   SQGD   S P Q+  SS + W
Sbjct  503   EKMKKPSDHEKEEGSHVKNASQGDVPFSGPLQVSVSSGFAW  543



>ref|XP_006436913.1| hypothetical protein CICLE_v10031084mg [Citrus clementina]
 gb|ESR50153.1| hypothetical protein CICLE_v10031084mg [Citrus clementina]
Length=573

 Score =   357 bits (917),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C  +KFS+ Q+KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  175  YLVFEYMEHDLAGLAACQGVKFSEPQVKCYMKQLLSGLEHCHNNGVLHRDIKGSNLLIDN  234

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILKI DFGLA F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  235  DGILKIADFGLATFYDPGLKQPMTSRVVTLWYRPPELLLGATYYGVGVDLWSAGCILAEL  294

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A +FKPQ  Y+  + E  K+ P
Sbjct  295  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPNATLFKPQQPYKRCIAETFKDFP  354

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLLSI+P  RGTA+++LNSE+F+T+PYAC+PSS+PK+PP++E+D
Sbjct  355  SSSLPLIETLLSIDPDNRGTATAALNSEFFNTEPYACEPSSLPKYPPSKEMD  406



>ref|XP_006485128.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Citrus sinensis]
Length=573

 Score =   357 bits (916),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +C  +KFS+ Q+KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  175  YLVFEYMEHDLAGLAACQGVKFSEPQVKCYMKQLLSGLEHCHNNGVLHRDIKGSNLLIDN  234

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILKI DFGLA F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  235  DGILKIADFGLATFYDPGLKQPMTSRVVTLWYRPPELLLGATYYGVGVDLWSAGCILAEL  294

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A +FKPQ  Y+  + E  K+ P
Sbjct  295  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPNATLFKPQQPYKRCIAETFKDFP  354

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLLSI+P  RGTA+++LNSE+F+T+PYAC+PSS+PK+PP++E+D
Sbjct  355  SSSLPLIETLLSIDPDNRGTATAALNSEFFNTEPYACEPSSLPKYPPSKEMD  406



>ref|XP_003562766.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brachypodium distachyon]
Length=701

 Score =   361 bits (926),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +IKFS++Q+KC+M QLLSGLEHCH + ++HRDIK +N+LVNN
Sbjct  196  YLVFEYMEHDLAGLSSSPDIKFSEAQVKCYMNQLLSGLEHCHSRRVVHRDIKGANLLVNN  255

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLAN+       P+TSRVVTLWYRPPELLLG+T Y   VDLWS GCVFAE+
Sbjct  256  EGVLKIADFGLANYFDPSKNHPLTSRVVTLWYRPPELLLGSTHYDSAVDLWSVGCVFAEI  315

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP+D+YW++SKLP A IFKP   Y STLR+  KE+P
Sbjct  316  LRGKPILQGRTEVEQLHKIFKLCGSPADEYWKKSKLPHATIFKPHCPYLSTLRDVFKEVP  375

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            ++A+ L+ETLLS+EPYKRGTAS +L SE+F T+PYAC+PSS+P++ PN+E+D
Sbjct  376  ENALSLLETLLSVEPYKRGTASCALTSEFFKTRPYACEPSSLPQYAPNKEMD  427



>ref|XP_006416580.1| hypothetical protein EUTSA_v10006926mg [Eutrema salsugineum]
 gb|ESQ34933.1| hypothetical protein EUTSA_v10006926mg [Eutrema salsugineum]
Length=729

 Score =   362 bits (928),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 244/341 (72%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  203   HLVFEYMEHDLTGLLSSPDINFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  262

Query  182   EGILKIGDFGLANFVS-ARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF + + +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  263   EGILKVADFGLANFCNVSGNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  322

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L  G+P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+L
Sbjct  323   LLLGKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLRETLKDL  382

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + + LIETLL +EP+KRGTAS++L S+YF TKP+ACDPSS+P + P++EIDAK RE+A
Sbjct  383   SDADITLIETLLCVEPHKRGTASTALVSQYFTTKPFACDPSSLPVYSPSKEIDAKHREDA  442

Query  719   rrrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgsrgATVARMSLK  889
              R+K     R    SR   R       +AP E+V  +    ++ NG     +  +  +L 
Sbjct  443   TRKKISGNGRRGTESRKPTRKPPAFANLAPAEDVRQHSRTFQKRNGHSVHSSIDSDATLY  502

Query  890   SSYDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
                   S+   +  + V   SQGD   S P Q+  SS + W
Sbjct  503   EKMKKPSDHEKEEGSHVKNASQGDVPFSGPLQVSVSSGFAW  543



>gb|KFK37574.1| hypothetical protein AALP_AA3G000700 [Arabis alpina]
Length=637

 Score =   358 bits (920),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            Y VF+YMEHDL GL S  +IKF+++QIKC+MKQLL G+EHCH++GIMHRDIK +NILVNN
Sbjct  191  YFVFDYMEHDLEGLCSSPDIKFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIKAANILVNN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +GILK+ DFGLAN V+ R+K  +TSRVVTLWYR PELL+G+T Y  +VDLWS GCVFAE+
Sbjct  251  KGILKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEI  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKL-PLAAIFKPQYAYESTLRERCKEL  538
              GRP+LKGRTE+EQLHKI+KL GSP +++WE++KL P   +F+PQ+ YE  LRER +E 
Sbjct  311  LTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFEEF  370

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            PK+A++L+E LLSI+P KRGTASS+L SEYF+TKPYACDPS++PK+PPN+E+D
Sbjct  371  PKTAINLLENLLSIDPEKRGTASSALMSEYFNTKPYACDPSTLPKYPPNKEMD  423



>ref|XP_008790095.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Phoenix dactylifera]
Length=697

 Score =   359 bits (921),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDL+GL S  EIK S+ QIKC+M QLLSGLEHCH++G++HRDIK +N+LVNN
Sbjct  190  YLVFEYMDHDLAGLCSSPEIKLSEPQIKCYMHQLLSGLEHCHLRGVIHRDIKGANLLVNN  249

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF     KQP+TSRVVTLWYRPPELLLG+T Y  TVDLWS GCVFAEL
Sbjct  250  EGVLKIADFGLANFCRPGHKQPLTSRVVTLWYRPPELLLGSTDYEATVDLWSVGCVFAEL  309

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F  +PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP   IFKP + YES L E  K+LP
Sbjct  310  FLRKPILQGRTEVEQLHKIFKLCGSPEDEYWKKSKLPHPTIFKPHHPYESCLPEAFKDLP  369

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV L++  LS+EP +RGTAS++L S YF T PYACDPSS+P +PPN+EID
Sbjct  370  ASAVGLLDVFLSVEPCRRGTASTALASVYFRTMPYACDPSSLPTYPPNKEID  421



>ref|XP_008790097.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Phoenix dactylifera]
Length=694

 Score =   359 bits (921),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDL+GL S  EIK S+ QIKC+M QLLSGLEHCH++G++HRDIK +N+LVNN
Sbjct  190  YLVFEYMDHDLAGLCSSPEIKLSEPQIKCYMHQLLSGLEHCHLRGVIHRDIKGANLLVNN  249

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLANF     KQP+TSRVVTLWYRPPELLLG+T Y  TVDLWS GCVFAEL
Sbjct  250  EGVLKIADFGLANFCRPGHKQPLTSRVVTLWYRPPELLLGSTDYEATVDLWSVGCVFAEL  309

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F  +PIL+GRTEVEQLHKIFKLCGSP D+YW++SKLP   IFKP + YES L E  K+LP
Sbjct  310  FLRKPILQGRTEVEQLHKIFKLCGSPEDEYWKKSKLPHPTIFKPHHPYESCLPEAFKDLP  369

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SAV L++  LS+EP +RGTAS++L S YF T PYACDPSS+P +PPN+EID
Sbjct  370  ASAVGLLDVFLSVEPCRRGTASTALASVYFRTMPYACDPSSLPTYPPNKEID  421



>gb|AAF27112.1|AC011809_21 Putative protein kinase [Arabidopsis thaliana]
Length=662

 Score =   358 bits (918),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 202/235 (86%), Gaps = 3/235 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  206  HLVFEYMEHDLTGLLSSPDIDFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  265

Query  182  EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
            EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  266  EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  325

Query  359  LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRE--RCK  532
            L  G+P+L+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+  LRE  + K
Sbjct  326  LLIGKPVLQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQHYDGCLRETLKLK  385

Query  533  ELPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             L  + ++LIETLLSI+P+KRGTAS++L S+YF +KP+ACDPSS+P + P++EID
Sbjct  386  GLSDADINLIETLLSIQPHKRGTASTALVSQYFTSKPFACDPSSLPVYSPSKEID  440



>emb|CDX74282.1| BnaA03g27650D [Brassica napus]
Length=623

 Score =   356 bits (914),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 199/233 (85%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            Y VF+YMEHDL GL +  +IKF+++QIKC+M+QL+ G+EHCH++GIMHRDIK +NILVNN
Sbjct  190  YFVFDYMEHDLEGLCTSPDIKFTEAQIKCYMQQLIWGVEHCHLRGIMHRDIKAANILVNN  249

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLAN V+ R+K  +TSRVVTLWYR PELL+G+T Y  +VDLWS GCVFAE+
Sbjct  250  KGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSLSVDLWSVGCVFAEI  309

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKL-PLAAIFKPQYAYESTLRERCKEL  538
              GRP+LKGRTE+EQLHKI+KLCGSP+++ WE++KL P   +FK Q+ YE  LRER +E 
Sbjct  310  LTGRPLLKGRTEIEQLHKIYKLCGSPNEELWEKNKLHPQTKMFKTQHQYEGCLRERFEEF  369

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            PK+A+ L+E LLSI+P KRGTASS+L SEYF+TKPYACDPS++PK+PPN+EID
Sbjct  370  PKTAIDLLENLLSIDPEKRGTASSALMSEYFNTKPYACDPSTLPKYPPNKEID  422



>ref|XP_006299569.1| hypothetical protein CARUB_v10015744mg [Capsella rubella]
 gb|EOA32467.1| hypothetical protein CARUB_v10015744mg [Capsella rubella]
Length=633

 Score =   356 bits (913),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            Y VF+YMEHDL GL S  +I F+++QIKC+MKQLL G+EHCH++GIMHRDIK +NILVNN
Sbjct  193  YFVFDYMEHDLEGLCSSPDINFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIKAANILVNN  252

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLAN V+ R+K  +TSRVVTLWYR PELL+G+T Y  +VDLWS GCVFAE+
Sbjct  253  KGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEI  312

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKL-PLAAIFKPQYAYESTLRERCKEL  538
              GRP+LKGRTE+EQLHKI+KLCGSP +++W+++KL P   +F+PQ+ YE +LRER  E 
Sbjct  313  LTGRPLLKGRTEIEQLHKIYKLCGSPDEEFWQKNKLHPQTKMFRPQHQYEGSLRERFDEF  372

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            P++A++L+E LL+I+P KRGTASS+L SEYF+TKPYACDPS++PK+PPN+E+D
Sbjct  373  PETAINLLENLLAIDPEKRGTASSALMSEYFNTKPYACDPSTLPKYPPNKEMD  425



>ref|NP_683519.2| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|ACG49252.1| At3g01085 [Arabidopsis thaliana]
 gb|AEE73606.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=629

 Score =   356 bits (913),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 199/233 (85%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            Y VF+YMEHDL GL S  +IKF+++QIKC+MKQLL G+EHCH++GIMHRDIK +NILVNN
Sbjct  190  YFVFDYMEHDLEGLCSSPDIKFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIKAANILVNN  249

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLAN V+ R+K  +TSRVVTLWYR PELL+G+T Y  +VDLWS GCVFAE+
Sbjct  250  KGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEI  309

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKL-PLAAIFKPQYAYESTLRERCKEL  538
              GRP+LKGRTE+EQLHKI+KL GSP +++WE++KL P   +F+PQ+ YE  LRER  E 
Sbjct  310  LTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEF  369

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            PK+A++L+E LLSI+P KRGTASS+L SEYF+T+PYACDPS++PK+PPN+E+D
Sbjct  370  PKTAINLLENLLSIDPEKRGTASSALMSEYFNTQPYACDPSTLPKYPPNKEMD  422



>gb|KDP27188.1| hypothetical protein JCGZ_19887 [Jatropha curcas]
Length=697

 Score =   358 bits (918),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 257/343 (75%), Gaps = 16/343 (5%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             YLVFEYMEHDL+GL +  +IKFS+SQ+KC+MKQLL G+EHCH++GIMHRDIKVSNIL+NN
Sbjct  218   YLVFEYMEHDLAGLSTSPDIKFSESQVKCYMKQLLQGIEHCHLRGIMHRDIKVSNILINN  277

Query  182   EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             EGILKIGDFGLAN +++++K  +TSRVVTLWYRPPELL+G+T YG +VDLWS GCVFAEL
Sbjct  278   EGILKIGDFGLANVLNSKNKNQLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFAEL  337

Query  362   FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
               G+P+LKGRTEVEQLHKIFKLCGSP + YW+QSKL  + +FKPQ+ YES+LR+RCK+LP
Sbjct  338   LLGKPLLKGRTEVEQLHKIFKLCGSPPEQYWKQSKLLNSTMFKPQHVYESSLRDRCKDLP  397

Query  542   KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreear  721
              + V LIE+ LSIEP KRGTASS+L S YF T P+ACDPSS+PK+ PN+E+DAK+REEAR
Sbjct  398   TTTVDLIESFLSIEPEKRGTASSALLSPYFSTMPHACDPSSLPKYAPNKEMDAKYREEAR  457

Query  722   rrkagsavrgsgssrNMRRLRKGM---------APTEEVEANMLgsrrgngsgsrgATVA  874
             R+K GS +R  G+ R  R+  K +         A  EE++ N     R + + +      
Sbjct  458   RKKVGSKMRDPGAPRKSRKNNKALQERKNFAKFATKEEIKENT-QFVRKSNNSNEQMNKG  516

Query  875   RMSLKSSYDTVSEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             R  L  S+D  SE   +T     + D   + PA +I+SS + W
Sbjct  517   RGEL-ISFDNTSEVLQET-----KEDYEFTGPAPVIASSGFAW  553



>ref|NP_001168769.1| uncharacterized LOC100382566 [Zea mays]
 gb|ACN30646.1| unknown [Zea mays]
 gb|AFW88400.1| putative protein kinase superfamily protein [Zea mays]
Length=548

 Score =   353 bits (906),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  EIKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  174  YLVFEYMEHDLAGLAASPEIKFTEPQVKCYMHQLLSGLEHCHDRGVLHRDIKGSNLLLDN  233

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  234  NGMLKIADFGLASFFDPDRKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  293

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y   +RE  K+ P
Sbjct  294  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYRKRIRETFKDFP  353

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TASS+L S++F T+P+AC+PSS+PK+PP++EID
Sbjct  354  QSALQLIETLLAIDPADRLTASSALRSDFFTTEPFACEPSSLPKYPPSKEID  405



>emb|CDX81891.1| BnaC08g37100D [Brassica napus]
Length=698

 Score =   357 bits (917),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 239/341 (70%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+   IKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  181   HLVFEYMEHDLTGLLSRPDINFTTPLIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  240

Query  182   EGILKIGDFGLANFVSA-RSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EG+LK+ DFGLANF +A R+KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  241   EGVLKVADFGLANFCNASRNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  300

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKEL  538
             L   +P+L+GRTEVEQLHKIFKLCGSP +DYW ++KLP A +FKPQ  Y+  LRE  K+L
Sbjct  301   LLLKKPVLQGRTEVEQLHKIFKLCGSPPEDYWRKTKLPHAMLFKPQQHYDGCLRETFKDL  360

Query  539   PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfreea  718
               + V LIETLLSIEP KRG AS++L S+YF TKPYACDPS++P + P++EIDAK REE 
Sbjct  361   SDADVSLIETLLSIEPNKRGIASTALVSQYFTTKPYACDPSTLPVYSPSKEIDAKHREET  420

Query  719   rrrkagsavrgsgssrNMRRLRK-----GMAPTEEVEANMLgsrrgngsgsrgATVARMS  883
              R +      G   + + +  RK      +AP E+        ++ NG     +  +  S
Sbjct  421   TRSEKKICGNGRRGTESRKPTRKPPAFAKLAPAEDARRPSQTFQKRNGHSVHNSIDSDAS  480

Query  884   LKSSYDTV-SEAASQTATEVSQGDSICSVPAQMISSSSYGW  1003
             L        SE   + A+ V  GD   S P Q+  SS + W
Sbjct  481   LYGKLQKKPSEHEKEEASHVKNGDVPFSGPLQVSVSSGFAW  521



>ref|NP_173302.2| cyclin-dependent kinase-like protein [Arabidopsis thaliana]
 gb|AEE29744.1| cyclin-dependent kinase-like protein [Arabidopsis thaliana]
Length=709

 Score =   358 bits (918),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 245/343 (71%), Gaps = 9/343 (3%)
 Frame = +2

Query  2     YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
             +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  206   HLVFEYMEHDLTGLLSSPDIDFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  265

Query  182   EGILKIGDFGLANFVSAR-SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAE  358
             EGILK+ DFGLANF +A  +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFAE
Sbjct  266   EGILKVADFGLANFCNASGNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFAE  325

Query  359   LFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRE--RCK  532
             L  G+P+L+GRTEVEQLHKIFKLCGSP +DYW++SKLP A +FKPQ  Y+  LRE  + K
Sbjct  326   LLIGKPVLQGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFKPQQHYDGCLRETLKLK  385

Query  533   ELPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREIDakfre  712
              L  + ++LIETLLSI+P+KRGTAS++L S+YF +KP+ACDPSS+P + P++EIDAK RE
Sbjct  386   GLSDADINLIETLLSIQPHKRGTASTALVSQYFTSKPFACDPSSLPVYSPSKEIDAKHRE  445

Query  713   earrrkagsavrgsgssrNMRR---LRKGMAPTEEVEANMLgsrrgngsgsrgATVARMS  883
             +  R+K     R    SR   R       +AP E+V  +    ++ NG     +  +  +
Sbjct  446   DTTRKKISGNGRRGTESRKPTRKPPAFAKLAPAEDVRHHSQKFQKRNGHSVHNSIDSDST  505

Query  884   LKSSYDTVSEAASQTATEV---SQGDSICSVPAQMISSSSYGW  1003
             L       S      A+ V   SQGD   S P Q+  SS + W
Sbjct  506   LFEKMQKPSNHEKDEASHVKNASQGDVPFSGPLQVSVSSGFAW  548



>ref|XP_009389755.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=643

 Score =   356 bits (913),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S  +I FS+ QIKC+MKQLLSG+E CH +GI+HRDIK +N+LVNN
Sbjct  185  YLVFEYMEHDLAGLSSSPDINFSEQQIKCYMKQLLSGIEQCHSRGIIHRDIKCANLLVNN  244

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILK+ DFGLAN ++   KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  245  EGILKVADFGLANILNPGEKQPLTSRVVTLWYRPPELLLGSTDYDASVDLWSVGCVFAEL  304

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G PIL+GRTEVEQ+HKIFKLCGSP +DYW++SK P A +FKPQ+ YES L+     LP
Sbjct  305  FLGMPILQGRTEVEQMHKIFKLCGSPPEDYWKKSKTPHATVFKPQHPYESCLQTTYNFLP  364

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ L+ T LSIEP KRGTAS++L SEYF  KPYA DPSS+PK+ PN+EID
Sbjct  365  ESALKLLGTFLSIEPDKRGTASTALTSEYFRAKPYASDPSSLPKYQPNKEID  416



>ref|XP_006408460.1| hypothetical protein EUTSA_v10020289mg [Eutrema salsugineum]
 gb|ESQ49913.1| hypothetical protein EUTSA_v10020289mg [Eutrema salsugineum]
Length=633

 Score =   354 bits (908),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 199/233 (85%), Gaps = 1/233 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            Y VF+YMEHDL GL S  +I F+++QIKC+MKQLL G+EHCH++GIMHRDIK +NILVNN
Sbjct  192  YFVFDYMEHDLEGLCSSPDINFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIKAANILVNN  251

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LK+ DFGLAN V+ R+K  +TSRVVTLWYR PELL+G+T Y  +VDLWS GCVFAE+
Sbjct  252  KGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEI  311

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKL-PLAAIFKPQYAYESTLRERCKEL  538
              GRP+LKGRTE+EQLHKI+KL GSP +++WE++KL P   +F+PQ+ YE  LRER +E 
Sbjct  312  LTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFEEF  371

Query  539  PKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            PK+A++L+E LLSI+P KRGTASS+L SEYF+TKPYAC+PS++PK+PPN+E+D
Sbjct  372  PKTAINLLENLLSIDPEKRGTASSALMSEYFNTKPYACEPSTLPKYPPNKEMD  424



>emb|CDX96706.1| BnaA08g22490D [Brassica napus]
Length=741

 Score =   357 bits (916),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  203  HLVFEYMEHDLTGLLSSPDISFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  262

Query  182  EGILKIGDFGLANFVSAR--SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFA  355
            EG+LK+ DFGLANF +A   +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFA
Sbjct  263  EGVLKVADFGLANFCNASGSNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFA  322

Query  356  ELFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKE  535
            EL   +P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+
Sbjct  323  ELLLKKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLRETLKD  382

Query  536  LPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            L ++ V LIETLLS+EP+KRGTAS++L S+YF ++P+ACDPSS+P + P++EID
Sbjct  383  LSEADVTLIETLLSVEPHKRGTASAALVSQYFTSEPFACDPSSLPVYSPSKEID  436



>gb|EYU43019.1| hypothetical protein MIMGU_mgv1a003556mg [Erythranthe guttata]
Length=578

 Score =   352 bits (903),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +    KF++ Q+KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  171  YLVFEYMEHDLAGLAAVQPAKFTEPQVKCYMKQLLSGLEHCHNNGVLHRDIKCSNLLIDN  230

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+L+I DFGLA+F   + K+PMTSRV+TLWYRPPELLLG+T Y   VDLWSAGC+ AEL
Sbjct  231  EGVLRIADFGLASFFDPQRKRPMTSRVITLWYRPPELLLGSTYYSVGVDLWSAGCILAEL  290

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PIL+GRTEVEQLHK+FKLCGSPS++YW++S+LP A ++KPQ  Y+S L E  K+ P
Sbjct  291  FAGKPILRGRTEVEQLHKVFKLCGSPSEEYWKKSRLPNATLYKPQQPYKSCLSETFKDFP  350

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ LI+TLLSI+P  RGTA+S+LNSE F T+PYAC+PSS+PKFPP++E+D
Sbjct  351  PSALSLIQTLLSIDPDARGTATSALNSELFSTEPYACEPSSLPKFPPSKEMD  402



>ref|XP_009110327.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
Length=701

 Score =   355 bits (912),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            +LVFEYMEHDL+GLLS  +I F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  203  HLVFEYMEHDLTGLLSSPDISFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  262

Query  182  EGILKIGDFGLANFVSAR--SKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFA  355
            EG+LK+ DFGLANF +A   +KQP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVFA
Sbjct  263  EGVLKVADFGLANFCNASGSNKQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVFA  322

Query  356  ELFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKE  535
            EL   +P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  LRE  K+
Sbjct  323  ELLLKKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLRETLKD  382

Query  536  LPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            L ++ + LI+TLLS+EP+KRGTAS++L S+YF ++P+ACDPSS+P + P++EID
Sbjct  383  LSEADITLIDTLLSVEPHKRGTASAALVSQYFTSEPFACDPSSLPVYSPSKEID  436



>ref|XP_009399300.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=687

 Score =   355 bits (911),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 194/232 (84%), Gaps = 1/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLV EYMEHDL+GL SC +IK S+ Q+KC+M QLLSGL+ CH  G++HRDIK +N+LVNN
Sbjct  186  YLVLEYMEHDLAGLSSCPDIKLSEPQVKCYMHQLLSGLQQCHSHGVIHRDIKCANLLVNN  245

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLAN +  + KQP+TSRVVTLWYRPPELLLG+T Y  +VDLWS GCVFAEL
Sbjct  246  EGILKIADFGLANILDPKDKQPLTSRVVTLWYRPPELLLGSTDYEPSVDLWSVGCVFAEL  305

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            FFG PIL+GRTEVEQLHKIFKLCGSP +++W +S LP  +IFKP + YE+ +RE  + LP
Sbjct  306  FFGEPILQGRTEVEQLHKIFKLCGSPPEEFWNKSSLPRESIFKP-HPYENCIRETFRFLP  364

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA  L++TLLSIEP KRGTAS++L SEYF TKPYACDPSS+PK+ PN+EID
Sbjct  365  DSAFKLLQTLLSIEPNKRGTASTALTSEYFRTKPYACDPSSLPKYQPNKEID  416



>gb|KHN31275.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=471

 Score =   348 bits (893),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ Q+KCFMKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  81   YLVFEYMEHDLAGLAAGQGVKFTEPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  140

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + KQ MTSRVVTLWYRPPELLLGAT YG  +DLWSAGC+ AEL
Sbjct  141  EGILKIADFGLATFYDPKIKQAMTSRVVTLWYRPPELLLGATVYGVGIDLWSAGCILAEL  200

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW + +LP A IFKPQ  Y+  + E  K+ P
Sbjct  201  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWRKYRLPNATIFKPQQPYKRCILETYKDFP  260

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGTAS++LNSE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  261  PSSLPLIETLLAIDPEDRGTASATLNSEFFTTEPYACEPSSLPKYPPSKELD  312



>ref|XP_007159987.1| hypothetical protein PHAVU_002G283400g [Phaseolus vulgaris]
 gb|ESW31981.1| hypothetical protein PHAVU_002G283400g [Phaseolus vulgaris]
Length=542

 Score =   350 bits (898),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 192/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +    KFS+ QIKC+MKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  155  YLVFEYMEHDLAGLAAGVGFKFSEPQIKCYMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  214

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + K PMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  215  EGILKIADFGLATFYDPKQKHPMTSRVVTLWYRPPELLLGATSYGVGVDLWSAGCILAEL  274

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++ +LP A +FKPQ  Y+  + E  K+LP
Sbjct  275  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKYRLPNATLFKPQQPYKRNILETFKDLP  334

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGT SS+LNSE+F T+PY C+PSS+PK+PP +E+D
Sbjct  335  SSSLPLIETLLAIDPNDRGTTSSALNSEFFTTEPYTCEPSSLPKYPPTKELD  386



>gb|EPS58921.1| hypothetical protein M569_15891 [Genlisea aurea]
Length=634

 Score =   353 bits (906),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HD+SGLLS  +I F+  Q+KC+ KQLLSGLEHCH +G+MHRDIK +N+LV+N
Sbjct  168  YLVFEYMDHDISGLLSSPDITFTQPQVKCYAKQLLSGLEHCHSRGVMHRDIKGANLLVDN  227

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLANF S    + +TSRVVTLWYRPPELLLG+T YG  VDLWSAGC+ AEL
Sbjct  228  AGVLKIADFGLANFSSLSHNRHLTSRVVTLWYRPPELLLGSTDYGVGVDLWSAGCLLAEL  287

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPIL+GRTEVEQLHKIFKLCGSP +DYW +SKLP A +F+P++ YESTL E  K+ P
Sbjct  288  LTGRPILQGRTEVEQLHKIFKLCGSPPEDYWNKSKLPHATLFRPKHPYESTLLETFKDQP  347

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            + AV LI+TLL+++P+KRGTA+S+L+S+YF  KP+ACDPSS+P++PP++EID
Sbjct  348  EEAVDLIQTLLAVDPHKRGTAASALSSQYFKRKPFACDPSSLPQYPPSKEID  399



>ref|XP_002874601.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50860.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDLSGL     +KF++SQIKC+MKQLLSGLEHCH +GI+HRDIK SN+LVNN
Sbjct  51   YLVFEYMEHDLSGLALRPGVKFTESQIKCYMKQLLSGLEHCHSRGILHRDIKGSNLLVNN  110

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            +G+LKIGDFGLANF      QP+TSRVVTLWYR PELLLGAT+YG  +DLWS GC+  EL
Sbjct  111  DGVLKIGDFGLANFYHPEQDQPLTSRVVTLWYRAPELLLGATEYGPGIDLWSVGCILTEL  170

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PI+ GRTEVEQ+HKIFKLCGSPSDDYW+++KLPLA  FKPQ  Y+  L E  K LP
Sbjct  171  FLGKPIMPGRTEVEQMHKIFKLCGSPSDDYWKKTKLPLATSFKPQQPYKRVLLETFKNLP  230

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ L++ LL +EP KRGTASS+L+S++F  +P  CD SS+PK+PP++E+D
Sbjct  231  SSALALVDKLLCLEPEKRGTASSTLSSKFFTMEPLPCDVSSLPKYPPSKELD  282



>gb|KHN17474.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=422

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 192/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KFS+ Q+KC+MKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  32   YLVFEYMEHDLAGLSAAVGVKFSEPQVKCYMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + K PMTSRVVTLWYRPPELLLG+T YG  VDLWSAGC+ AEL
Sbjct  92   EGILKIADFGLATFFDPKKKHPMTSRVVTLWYRPPELLLGSTSYGVGVDLWSAGCILAEL  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+P + GRTEVEQLHKIFKLCGSPSD+YW++ +LP A ++KPQ  Y+  + E  K+ P
Sbjct  152  LAGKPTMPGRTEVEQLHKIFKLCGSPSDEYWKKYRLPNATLYKPQQPYKRNILETFKDFP  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGT S++LNSE+F T+PYAC+PS++PK+PP +E+D
Sbjct  212  SSSLPLIETLLAIDPDDRGTTSAALNSEFFTTEPYACEPSNLPKYPPTKELD  263



>gb|KHG30226.1| hypothetical protein F383_12098 [Gossypium arboreum]
Length=589

 Score =   351 bits (901),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YL+FEYMEHDL+GL +C  IKF++ Q+KC+MKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  194  YLIFEYMEHDLAGLAACHGIKFTEPQVKCYMKQLLSGLEHCHNQGVLHRDIKGSNLLIDN  253

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F     K+P+TSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  254  EGILKIADFGLATFYDPEQKKPLTSRVVTLWYRPPELLLGATYYGAGVDLWSAGCILAEL  313

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS+ YW++SKLP A +FKPQ  Y+  + +  K+ P
Sbjct  314  ISGKPIMPGRTEVEQLHKIFKLCGSPSEQYWKKSKLPNATLFKPQQPYKRCIADTFKDFP  373

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLLSI+P +R TA+++LNSE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  374  PSSLPLIETLLSIDPEERSTATAALNSEFFTTEPYACEPSSLPKYPPSKEMD  425



>ref|XP_011083509.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
 ref|XP_011083518.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
 ref|XP_011083526.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=581

 Score =   351 bits (900),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ Q+KC+MKQLLSGLEHCH  G++HRDIK SN+L+++
Sbjct  183  YLVFEYMEHDLAGLAAVQSVKFTEPQVKCYMKQLLSGLEHCHNNGVLHRDIKCSNLLIDS  242

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGIL+I DFGLA+F     K+PMTSRV+TLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  243  EGILRIADFGLASFFDPERKRPMTSRVITLWYRPPELLLGATYYGVGVDLWSAGCILAEL  302

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP+++YW++S+LP A ++KPQ  Y+  + E  K+ P
Sbjct  303  LAGKPILRGRTEVEQLHKIFKLCGSPTEEYWKKSRLPNATLYKPQQPYKCCIAETFKDFP  362

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ LIETLL+I+P  RGTA+++LNSE+F T+PYAC+PSS+PKFPP++E+D
Sbjct  363  PSALALIETLLAIDPDARGTATAALNSEFFTTEPYACEPSSLPKFPPSKEMD  414



>ref|XP_004984389.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Setaria italica]
Length=551

 Score =   350 bits (897),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  +IKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  178  YLVFEYMEHDLAGLAASPDIKFTEPQVKCYMHQLLSGLEHCHDRGVLHRDIKGSNLLLDN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  238  NGMLKIADFGLASFFDPDRKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y+  +RE  K+ P
Sbjct  298  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYKRRIRETFKDFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TA+++L S++F T+P+AC+PSS+PK+PP++EID
Sbjct  358  QSALQLIETLLAIDPADRLTATAALRSDFFTTEPFACEPSSLPKYPPSKEID  409



>ref|XP_007159986.1| hypothetical protein PHAVU_002G283400g [Phaseolus vulgaris]
 gb|ESW31980.1| hypothetical protein PHAVU_002G283400g [Phaseolus vulgaris]
Length=435

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 192/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +    KFS+ QIKC+MKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  155  YLVFEYMEHDLAGLAAGVGFKFSEPQIKCYMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  214

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + K PMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  215  EGILKIADFGLATFYDPKQKHPMTSRVVTLWYRPPELLLGATSYGVGVDLWSAGCILAEL  274

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++ +LP A +FKPQ  Y+  + E  K+LP
Sbjct  275  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKYRLPNATLFKPQQPYKRNILETFKDLP  334

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGT SS+LNSE+F T+PY C+PSS+PK+PP +E+D
Sbjct  335  SSSLPLIETLLAIDPNDRGTTSSALNSEFFTTEPYTCEPSSLPKYPPTKELD  386



>ref|XP_009804117.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=566

 Score =   350 bits (898),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  ++KF++ Q+KC+MKQLLSGLEHCH  G++HRD+K SN+L++N
Sbjct  166  YLVFEYMEHDLAGLAAVQKVKFTEPQVKCYMKQLLSGLEHCHNNGVLHRDVKGSNLLIDN  225

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F     KQPMTSRVVTLWYRPPELLLGAT+YG  VDLWSAGC+ AEL
Sbjct  226  EGILKIADFGLAAFYDPEQKQPMTSRVVTLWYRPPELLLGATRYGVGVDLWSAGCILAEL  285

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPSD+YW++ KLP A +FKPQ  Y+  + +  K+ P
Sbjct  286  LAGKPIMPGRTEVEQLHKIFKLCGSPSDEYWKKFKLPNATLFKPQQPYKRCIADTFKDFP  345

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S+  L+ETLL+I+P +RGTA+++LNSE+F T+PY C+PSS+PK+PP++E+D
Sbjct  346  SSSHPLVETLLAIDPDERGTATAALNSEFFTTEPYPCEPSSLPKYPPSKEMD  397



>ref|XP_002465275.1| hypothetical protein SORBIDRAFT_01g035420 [Sorghum bicolor]
 gb|EER92273.1| hypothetical protein SORBIDRAFT_01g035420 [Sorghum bicolor]
Length=429

 Score =   345 bits (886),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  EIKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  176  YLVFEYMEHDLAGLAASPEIKFTEPQVKCYMHQLLSGLEHCHDRGVLHRDIKGSNLLLDN  235

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT Y   VDLWSAGC+ AEL
Sbjct  236  NGMLKIADFGLASFFDPDRKQPMTSRVVTLWYRPPELLLGATDYEVGVDLWSAGCILAEL  295

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y+  +RE  K+ P
Sbjct  296  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYKRRIRETFKDFP  355

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TA+S+L S++F T+P AC+PSS+PK+PP++EID
Sbjct  356  QSALQLIETLLAIDPADRLTATSALRSDFFTTEPLACEPSSLPKYPPSKEID  407



>ref|XP_003557843.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brachypodium distachyon]
Length=563

 Score =   350 bits (897),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++  +IKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  189  YLVFEYMEHDLAGLVASPDIKFTEPQVKCYMNQLLSGLEHCHDRGVLHRDIKGSNLLLDN  248

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  249  NGMLKIADFGLASFFDPSRKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  308

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y+  + +  K+ P
Sbjct  309  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYKRRITDTFKDFP  368

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TASS+L S++F T+PYAC+PSS+PK+PP++E+D
Sbjct  369  QSALRLIETLLAIDPADRLTASSALQSDFFTTEPYACEPSSLPKYPPSKEMD  420



>ref|XP_004501733.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X1 [Cicer arietinum]
 ref|XP_004501734.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
isoform X2 [Cicer arietinum]
Length=559

 Score =   349 bits (896),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++SQ+KCFMKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  169  YLVFEYMEHDLAGLSAGQGVKFTESQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  228

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F     KQ MTSRVVTLWYRPPELLLGAT YG  +DLWSAGC+ AEL
Sbjct  229  EGILKIADFGLATFFDPTQKQSMTSRVVTLWYRPPELLLGATVYGVGIDLWSAGCILAEL  288

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSP+D+YW + +LP A IFKPQ  Y+  + E  K+ P
Sbjct  289  LAGKPIMPGRTEVEQLHKIFKLCGSPADEYWRKYRLPNATIFKPQQPYKRCISETFKDFP  348

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLLSI+P  RGTA ++LNSE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  349  PSSLPLIETLLSIDPDGRGTALAALNSEFFATEPYACEPSSLPKYPPSKELD  400



>ref|NP_001146380.1| uncharacterized protein LOC100279958 [Zea mays]
 gb|ACL53832.1| unknown [Zea mays]
Length=488

 Score =   347 bits (889),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S   +KF++SQ+KC+M+QLL GLEHCH + I+HRDIK SN+L++N
Sbjct  6    YLVFEYMEHDLAGLASFPGVKFTESQVKCYMQQLLRGLEHCHSRHILHRDIKGSNLLIDN  65

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             GILKI DFGLA+F     + P+TSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  66   RGILKIADFGLASFFDPEQRHPLTSRVVTLWYRPPELLLGATNYGVAVDLWSAGCILAEL  125

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PI+ GRTEVEQLHKIFKLCGSPS+DYW +SKLP A IFKPQ+ Y   + E  KE P
Sbjct  126  YAGKPIMPGRTEVEQLHKIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVPETFKEFP  185

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
              A+ L++ LLS++P  RGTASS+L SE+F TKPYAC+PSS+P++PP++E D
Sbjct  186  VPALALVDVLLSVDPADRGTASSALQSEFFTTKPYACNPSSLPRYPPSKEFD  237



>ref|XP_003523166.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Glycine max]
Length=559

 Score =   349 bits (895),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ Q+KCFMKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  169  YLVFEYMEHDLAGLAAGQGVKFTEPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  228

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + KQ MTSRVVTLWYRPPELLLGAT YG  +DLWSAGC+ AEL
Sbjct  229  EGILKIADFGLATFYDPKIKQAMTSRVVTLWYRPPELLLGATVYGVGIDLWSAGCILAEL  288

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW + +LP A IFKPQ  Y+  + E  K+ P
Sbjct  289  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWRKYRLPNATIFKPQQPYKRCILETYKDFP  348

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGTAS++LNSE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  349  PSSLPLIETLLAIDPEDRGTASATLNSEFFTTEPYACEPSSLPKYPPSKELD  400



>dbj|BAJ86619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=552

 Score =   348 bits (894),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL++  +IKF++ Q+KC+M QLLSG EHCH +G++HRDIK SN+L++N
Sbjct  178  YLVFEYMEHDLAGLVASPDIKFTEPQVKCYMNQLLSGPEHCHDRGVLHRDIKGSNLLLDN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  238  NGMLKIADFGLASFFDPSRKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y+  +++  K+ P
Sbjct  298  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYKRRIKDTFKDFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TASS+L S++F T+PYAC+PSS+PK+PP++E+D
Sbjct  358  QSALRLIETLLAIDPADRLTASSALRSDFFTTEPYACEPSSLPKYPPSKEMD  409



>ref|XP_007035478.1| Serine/threonine-protein kinase isoform 2 [Theobroma cacao]
 gb|EOY06404.1| Serine/threonine-protein kinase isoform 2 [Theobroma cacao]
Length=577

 Score =   349 bits (896),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   IKF++SQ+KC+M QLLSGLEHCH + ++HRDIK SN+L+++
Sbjct  197  YLVFEYMEHDLAGLAASPAIKFTESQVKCYMHQLLSGLEHCHNRHLLHRDIKGSNLLIDD  256

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  257  GGVLKIADFGLASFFDPNYKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  316

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A IFKPQ +Y+  + E  K+ P
Sbjct  317  LAGRPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPHATIFKPQQSYKRCIEETFKDFP  376

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P +R TA+++LNSE+F TKPYACDPSS+PK+PP++E+D
Sbjct  377  PSSLPLIETLLAIDPVERLTATAALNSEFFMTKPYACDPSSLPKYPPSKEMD  428



>ref|XP_011028376.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Populus euphratica]
Length=572

 Score =   349 bits (895),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 192/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GLL+   IKF+++QIKC+M+QLL GLEHCH +G++HRDIK SN+L++ 
Sbjct  74   YLVFEYMEHDLAGLLASPAIKFTEAQIKCYMQQLLHGLEHCHNRGVLHRDIKGSNLLIDT  133

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G LKI DFGLA F S+  KQP+TSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  134  NGNLKIADFGLATFFSSPQKQPLTSRVVTLWYRPPELLLGATDYGVAVDLWSAGCILAEL  193

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            F G+PI+ GRTEVEQLHKIFKLCGSPSD+YW++SKLP A IFKPQ+ Y+  + E  K+ P
Sbjct  194  FAGKPIMPGRTEVEQLHKIFKLCGSPSDEYWKRSKLPHATIFKPQHPYKRCVAETYKDFP  253

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ L++ LL++EP  RGTA S+L+SE+F TKP  CDPSS+PK+PP +E D
Sbjct  254  SSALSLLDVLLAVEPEPRGTAFSALDSEFFKTKPLPCDPSSLPKYPPTKEFD  305



>ref|XP_011073124.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Sesamum indicum]
Length=578

 Score =   349 bits (896),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ ++KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  178  YLVFEYMEHDLAGLTAMQSVKFTEPEVKCYMKQLLSGLEHCHNNGVLHRDIKCSNLLIDN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLA+F     K+PMTSRVVTLWYRPPELLLG T YG  VDLWSAGC+ AEL
Sbjct  238  EGVLKIADFGLASFFDPEHKKPMTSRVVTLWYRPPELLLGDTYYGVGVDLWSAGCILAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP+++YW++S+LP A ++KPQ  Y+  + E  KE P
Sbjct  298  LAGKPILRGRTEVEQLHKIFKLCGSPTEEYWKKSRLPNATLYKPQQPYKRCIMESFKEFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +S++ LI+TLLSI+P  RG+A+++LNSE+F T+PYAC+PSS+PKFPP++E+D
Sbjct  358  QSSLGLIDTLLSIDPDARGSATAALNSEFFTTEPYACEPSSLPKFPPSKEMD  409



>ref|XP_002455623.1| hypothetical protein SORBIDRAFT_03g014750 [Sorghum bicolor]
 gb|EES00743.1| hypothetical protein SORBIDRAFT_03g014750 [Sorghum bicolor]
Length=415

 Score =   343 bits (881),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  ++KF+  QIKC+M+QLLSGLEHCH   ++HRDIK SN+L++N
Sbjct  32   YLVFEYMEHDLAGLAASPDVKFTLPQIKCYMQQLLSGLEHCHDNNVLHRDIKGSNLLLDN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             GILKI DFGLA F   R K+PMTSRVVTLWYRPPELLLGAT Y   VDLWSAGC+ AEL
Sbjct  92   NGILKIADFGLATFFDPRHKRPMTSRVVTLWYRPPELLLGATDYSVGVDLWSAGCILAEL  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
             +G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A IFKPQ  Y+  ++E  K+ P
Sbjct  152  LYGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCIKETFKDFP  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             SA+ L+ETLL+I+P +R TA+++L+S++F T+PYACDPSS+P +PP++E+D
Sbjct  212  TSALPLVETLLAIDPAERQTATAALHSDFFSTEPYACDPSSLPTYPPSKEMD  263



>ref|XP_006643878.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=519

 Score =   347 bits (889),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL S   +KF++SQ+KC+M+QLL GLEHCH + I+HRDIK SN+L++N
Sbjct  32   YLVFEYMEHDLAGLASFPGVKFTESQVKCYMQQLLCGLEHCHSRHILHRDIKGSNLLIDN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             GILKI DFGLA+F     + P+TSRVVTLWYRPPELLLGAT YG +VDLWS GC+ AEL
Sbjct  92   RGILKIADFGLASFFDPEQRHPLTSRVVTLWYRPPELLLGATNYGVSVDLWSTGCILAEL  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
            + G+PI+ GRTEVEQLHKIFKLCGSPS+DYW +SKLP A IFKPQ+ Y   + E  K+ P
Sbjct  152  YAGKPIMPGRTEVEQLHKIFKLCGSPSEDYWRKSKLPHATIFKPQHPYPRRVSETFKDFP  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
              AV L++ LLSI+P  RGTASS+L SE+F TKPYAC+PSS+P++PP++E D
Sbjct  212  LPAVALVDVLLSIDPADRGTASSALQSEFFATKPYACNPSSLPRYPPSKEFD  263



>ref|XP_011073123.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Sesamum indicum]
Length=582

 Score =   348 bits (894),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ ++KC+MKQLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  178  YLVFEYMEHDLAGLTAMQSVKFTEPEVKCYMKQLLSGLEHCHNNGVLHRDIKCSNLLIDN  237

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLA+F     K+PMTSRVVTLWYRPPELLLG T YG  VDLWSAGC+ AEL
Sbjct  238  EGVLKIADFGLASFFDPEHKKPMTSRVVTLWYRPPELLLGDTYYGVGVDLWSAGCILAEL  297

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL+GRTEVEQLHKIFKLCGSP+++YW++S+LP A ++KPQ  Y+  + E  KE P
Sbjct  298  LAGKPILRGRTEVEQLHKIFKLCGSPTEEYWKKSRLPNATLYKPQQPYKRCIMESFKEFP  357

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +S++ LI+TLLSI+P  RG+A+++LNSE+F T+PYAC+PSS+PKFPP++E+D
Sbjct  358  QSSLGLIDTLLSIDPDARGSATAALNSEFFTTEPYACEPSSLPKFPPSKEMD  409



>ref|XP_008794856.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Phoenix dactylifera]
Length=583

 Score =   348 bits (893),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  EIKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  212  YLVFEYMEHDLAGLAASPEIKFTEPQVKCYMHQLLSGLEHCHNRGVLHRDIKGSNLLLDN  271

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             GILKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  272  SGILKIADFGLASFFDPNHKQPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAEL  331

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A IFKPQ  Y+  + E  K+ P
Sbjct  332  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRRIAETFKDFP  391

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
              ++ LIETLL+++P +R TAS++L SE+F TKPYAC+PSS+PK+PP++EID
Sbjct  392  PLSLPLIETLLALDPAERLTASAALRSEFFTTKPYACEPSSLPKYPPSKEID  443



>gb|KHN23956.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=478

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF++ Q+KCFMKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  90   YLVFEYMEHDLAGLAAGQGVKFTEPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDN  149

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F   + KQ MTSRVVTLWYRPPELLLGAT YG  +DLWSAGC+ AEL
Sbjct  150  EGILKIADFGLATFYDPKIKQAMTSRVVTLWYRPPELLLGATVYGVGIDLWSAGCILAEL  209

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW + +LP A IFKPQ  Y+  + E  K+ P
Sbjct  210  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWRKYRLPNATIFKPQQPYKRCILETYKDFP  269

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  R TAS++LNSE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  270  PSSLPLIETLLAIDPDDRCTASAALNSEFFTTEPYACEPSSLPKYPPSKELD  321



>ref|XP_006650079.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Oryza brachyantha]
Length=402

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  +IKF++ Q+KC+M+QLLSGLEHCH  G++HRDIK SN+L++N
Sbjct  32   YLVFEYMEHDLAGLAASPDIKFTEPQVKCYMRQLLSGLEHCHNNGVLHRDIKGSNLLLDN  91

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+       QPMTSRVVTLWYRPPELLLG+T YG  VDLWSAGC+ AEL
Sbjct  92   NGMLKIADFGLASLFDPNKNQPMTSRVVTLWYRPPELLLGSTDYGVGVDLWSAGCILAEL  151

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              GRPI+ GRTEVEQLHKIFKLCGSP+++YW++SKLP A IFKPQ  Y+  + E  K+ P
Sbjct  152  LAGRPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFKPQQPYKRRISETYKDFP  211

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +SA+ LIETLL+I+P  R TA+S+L S++F T+PYAC+PSS+P++PP++E+D
Sbjct  212  QSALRLIETLLAIDPADRLTATSALRSDFFTTEPYACEPSSLPEYPPSKEMD  263



>ref|XP_006382713.1| hypothetical protein POPTR_0005s04700g [Populus trichocarpa]
 gb|ERP60510.1| hypothetical protein POPTR_0005s04700g [Populus trichocarpa]
Length=581

 Score =   348 bits (892),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 198/232 (85%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +   +KF+++Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  191  YLVFEYMEHDLAGLAASPAVKFTEAQVKCYMHQLLSGLEHCHKRGVLHRDIKGSNLLIDN  250

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGIL+I DFGLA+F    +K PMTSRVVTLWYRPPELLLGAT YG ++DLWSAGC+ AEL
Sbjct  251  EGILRIADFGLASFFDPNNKHPMTSRVVTLWYRPPELLLGATDYGVSIDLWSAGCILAEL  310

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKI+KLCGSPSD+YW++S+LP A +FKP+  Y+  +RE  K+ P
Sbjct  311  LAGKPIMPGRTEVEQLHKIYKLCGSPSDEYWKKSRLPNATLFKPREPYKRCIRETFKDFP  370

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P +R TA+++L SE+F T+PYAC+PSS+PK+PP++E+D
Sbjct  371  PSSLPLIETLLAIDPVERQTATAALKSEFFTTEPYACEPSSLPKYPPSKEMD  422



>ref|XP_009624462.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=566

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  ++KF++ Q+KC+MKQLLSGLEHCH  G++HRD+K SN+L++N
Sbjct  165  YLVFEYMEHDLAGLAAVQKVKFTEPQVKCYMKQLLSGLEHCHNNGVLHRDVKGSNLLIDN  224

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EGILKI DFGLA F     KQPMTSRVVTLWYRPPELLLGAT+YG  VDLWSAGC+ AEL
Sbjct  225  EGILKIADFGLAAFYDPEHKQPMTSRVVTLWYRPPELLLGATRYGVGVDLWSAGCILAEL  284

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPSD+YW++ KLP A +FKPQ  Y+  + +  K+ P
Sbjct  285  LAGKPIMPGRTEVEQLHKIFKLCGSPSDEYWKKFKLPNATLFKPQQPYKRCIADTFKDFP  344

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S+  LIE LL+I+P +RGTA+++LNSE+F T+PY C+PSS+PK+PP++E+D
Sbjct  345  PSSHPLIEKLLAIDPDERGTATAALNSEFFATEPYPCEPSSLPKYPPSKEMD  396



>ref|XP_010243586.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
Length=568

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYMEHDL+GL +  +IKF++ Q+KC+M QLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  194  YLVFEYMEHDLAGLAASPDIKFTEPQVKCYMHQLLSGLEHCHNRGVLHRDIKGSNLLLDN  253

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
             G+LKI DFGLA+F     KQPMTSRVVTLWYRPPELLLGAT YG  VD+WSAGC+ AEL
Sbjct  254  GGVLKIADFGLASFFDPNHKQPMTSRVVTLWYRPPELLLGATDYGVGVDIWSAGCILAEL  313

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PIL GRTEVEQLHKIFKLCGSPS+DYW+++KLP A IFKPQ  Y+  + E  K+ P
Sbjct  314  LAGKPILPGRTEVEQLHKIFKLCGSPSEDYWKKAKLPHATIFKPQQTYKRCIAETFKDFP  373

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P +R TA+ +L SE+F TKPYAC+PSS+P++PP++E+D
Sbjct  374  PSSLPLIETLLAIDPAERKTATDALRSEFFTTKPYACEPSSLPQYPPSKEMD  425



>emb|CDX83825.1| BnaC08g18200D [Brassica napus]
Length=702

 Score =   351 bits (901),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            +LVFEYMEHDL+GLLS  ++ F+  QIKC+MKQLLSGL+HCH +G+MHRDIK SN+LVNN
Sbjct  203  HLVFEYMEHDLTGLLSSPDVSFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGSNLLVNN  262

Query  182  EGILKIGDFGLANFVSA---RSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVF  352
            EG+LK+ DFGLANF +A     +QP+TSRVVTLWYRPPELLLGAT+YG +VDLWS GCVF
Sbjct  263  EGVLKVADFGLANFCNASGNNKQQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCVF  322

Query  353  AELFFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCK  532
            AEL   +P+L+GRTEVEQLHKIFKLCGSP  DYW++SKLP A +FKPQ  Y+  L E  K
Sbjct  323  AELLLKKPVLQGRTEVEQLHKIFKLCGSPPADYWKKSKLPHAMLFKPQQHYDGCLGETLK  382

Query  533  ELPKSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
            +L ++ + LIETLLS+EP+KRGTAS++L S+YF ++P+ACDPSS+P + P++EID
Sbjct  383  DLSEADITLIETLLSVEPHKRGTASTALVSQYFTSEPFACDPSSLPVYSPSKEID  437



>gb|KDP22563.1| hypothetical protein JCGZ_26394 [Jatropha curcas]
Length=578

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  2    YLVFEYMEHDLSGLLSCSEIKFSDSQIKCFMKQLLSGLEHCHVKGIMHRDIKVSNILVNN  181
            YLVFEYM+HDL+GL +   +KF+++QIKC+MKQLLSGLEHCH +G++HRDIK SN+L++N
Sbjct  180  YLVFEYMDHDLAGLAARQGVKFTEAQIKCYMKQLLSGLEHCHNRGVLHRDIKGSNLLIDN  239

Query  182  EGILKIGDFGLANFVSARSKQPMTSRVVTLWYRPPELLLGATKYGETVDLWSAGCVFAEL  361
            EG+LKI DFGLA F     K PMTSRVVTLWYRPPELLLGAT YG  VDLWSAGC+ AEL
Sbjct  240  EGVLKIADFGLATFFDPEHKVPMTSRVVTLWYRPPELLLGATHYGVGVDLWSAGCILAEL  299

Query  362  FFGRPILKGRTEVEQLHKIFKLCGSPSDDYWEQSKLPLAAIFKPQYAYESTLRERCKELP  541
              G+PI+ GRTEVEQLHKIFKLCGSPS++YW++SKLP A +FKPQ  Y+  + E  K+ P
Sbjct  300  LAGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPNATLFKPQQPYKRCIAETFKDFP  359

Query  542  KSAVHLIETLLSIEPYKRGTASSSLNSEYFHTKPYACDPSSMPKFPPNREID  697
             S++ LIETLL+I+P  RGTA+++LNS +F T+PYAC+PSS+PK+PP++E+D
Sbjct  360  PSSMPLIETLLAIDPDNRGTATTALNSAFFTTEPYACEPSSLPKYPPSKELD  411



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5611601724636