BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14842_g2_i1 len=178 path=[754:0-177]

Length=178
                                                                      Score     E

gb|KHN32457.1|  Eukaryotic translation initiation factor 3 subunit I    120   7e-32   
gb|KHN14569.1|  Eukaryotic translation initiation factor 3 subunit I    118   4e-31   
gb|KDO58633.1|  hypothetical protein CISIN_1g020461mg                   119   5e-31   
ref|XP_006591952.1|  PREDICTED: eukaryotic translation initiation...    119   7e-31   
ref|XP_003534423.1|  PREDICTED: eukaryotic translation initiation...    119   7e-31   
ref|XP_004136687.1|  PREDICTED: eukaryotic translation initiation...    119   9e-31   
ref|XP_008443373.1|  PREDICTED: eukaryotic translation initiation...    119   9e-31   
gb|KDP38201.1|  hypothetical protein JCGZ_04844                         119   9e-31   
gb|KDO58631.1|  hypothetical protein CISIN_1g020461mg                   119   9e-31   
ref|XP_003596914.1|  Eukaryotic translation initiation factor 3 s...    119   1e-30   
gb|AES67165.2|  eukaryotic translation initiation factor 3 subunit I    119   1e-30   
ref|XP_006448046.1|  hypothetical protein CICLE_v10015917mg             119   1e-30   
ref|XP_006448047.1|  hypothetical protein CICLE_v10015917mg             119   2e-30   
ref|XP_002521889.1|  eukaryotic translation initiation factor 3 s...    119   2e-30   Ricinus communis
ref|XP_010062244.1|  PREDICTED: eukaryotic translation initiation...    118   2e-30   
ref|XP_003517705.1|  PREDICTED: eukaryotic translation initiation...    117   4e-30   
ref|XP_007157442.1|  hypothetical protein PHAVU_002G070400g             117   4e-30   
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...    117   5e-30   
ref|XP_007222666.1|  hypothetical protein PRUPE_ppa008567mg             117   6e-30   
ref|XP_008220972.1|  PREDICTED: eukaryotic translation initiation...    117   6e-30   
gb|ABK94219.1|  unknown                                                 116   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011021700.1|  PREDICTED: eukaryotic translation initiation...    116   1e-29   
ref|XP_002315834.2|  TGF-beta receptor-interacting protein 1            116   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007016708.1|  Transducin/WD40 repeat-like superfamily prot...    116   1e-29   
ref|XP_002285281.1|  PREDICTED: eukaryotic translation initiation...    116   2e-29   Vitis vinifera
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...    115   2e-29   
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...    116   2e-29   
gb|KHG16392.1|  Eukaryotic translation initiation factor 3 subuni...    115   3e-29   
ref|XP_010557463.1|  PREDICTED: eukaryotic translation initiation...    115   3e-29   
ref|XP_002311556.2|  TGF-beta receptor-interacting protein 1            115   4e-29   Populus trichocarpa [western balsam poplar]
gb|EYU22708.1|  hypothetical protein MIMGU_mgv1a009949mg                114   9e-29   
gb|EYU22777.1|  hypothetical protein MIMGU_mgv1a009964mg                114   1e-28   
ref|XP_010521568.1|  PREDICTED: eukaryotic translation initiation...    113   1e-28   
ref|XP_010678072.1|  PREDICTED: eukaryotic translation initiation...    113   1e-28   
gb|EPS73291.1|  hypothetical protein M569_01462                         113   1e-28   
ref|XP_011024978.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_011095354.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_008340535.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_009351622.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_008350825.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_008389128.1|  PREDICTED: eukaryotic translation initiation...    113   2e-28   
ref|XP_009129412.1|  PREDICTED: eukaryotic translation initiation...    112   5e-28   
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...    112   5e-28   
emb|CDY34145.1|  BnaA02g28950D                                          112   5e-28   
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...    112   6e-28   
gb|EPS65969.1|  hypothetical protein M569_08807                         111   8e-28   
ref|XP_010514644.1|  PREDICTED: eukaryotic translation initiation...    110   3e-27   
emb|CDY03970.1|  BnaC02g36850D                                          112   4e-27   
ref|XP_010502959.1|  PREDICTED: eukaryotic translation initiation...    108   7e-27   
ref|XP_010425732.1|  PREDICTED: eukaryotic translation initiation...    109   7e-27   
gb|KCW69348.1|  hypothetical protein EUGRSUZ_F02830                     108   9e-27   
ref|XP_006395439.1|  hypothetical protein EUTSA_v10004580mg             108   2e-26   
ref|XP_002882056.1|  TGF-beta receptor interacting protein 1            108   2e-26   
ref|XP_010249002.1|  PREDICTED: eukaryotic translation initiation...    107   2e-26   
ref|XP_010937470.1|  PREDICTED: eukaryotic translation initiation...    107   3e-26   
ref|XP_010275011.1|  PREDICTED: eukaryotic translation initiation...    107   3e-26   
gb|KFK37423.1|  hypothetical protein AALP_AA4G255300                    107   3e-26   
ref|XP_009151956.1|  PREDICTED: eukaryotic translation initiation...    106   5e-26   
emb|CDY71621.1|  BnaAnng38210D                                          106   6e-26   
ref|XP_004297796.1|  PREDICTED: eukaryotic translation initiation...    106   7e-26   
emb|CDY13713.1|  BnaA06g32100D                                          106   7e-26   
ref|XP_008808070.1|  PREDICTED: eukaryotic translation initiation...    104   1e-25   
gb|AAC62877.1|  eukaryotic translation initiation factor 3 delta ...    105   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182152.2|  transducin/WD40 repeat-like superfamily protein       105   1e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43524.1|  putative eukaryotic translation initiation facto...    105   1e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDP11515.1|  unnamed protein product                                103   2e-25   
ref|XP_008782131.1|  PREDICTED: eukaryotic translation initiation...    105   2e-25   
ref|XP_010926275.1|  PREDICTED: eukaryotic translation initiation...    105   2e-25   
ref|XP_008808069.1|  PREDICTED: eukaryotic translation initiation...    105   2e-25   
gb|ABK26793.1|  unknown                                                 104   3e-25   Picea sitchensis
gb|ABR18068.1|  unknown                                                 104   3e-25   Picea sitchensis
ref|XP_006663589.1|  PREDICTED: eukaryotic translation initiation...    103   5e-25   
ref|NP_001055036.1|  Os05g0256000                                       103   7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061508.1|  Os08g0308100                                       103   7e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CDP20306.1|  unnamed protein product                                103   8e-25   
ref|XP_002862549.1|  eukaryotic translation initiation factor 3 d...    103   9e-25   
ref|XP_002882057.1|  hypothetical protein ARALYDRAFT_322284             103   9e-25   
ref|XP_007215753.1|  hypothetical protein PRUPE_ppa009367mg             102   1e-24   
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...    102   2e-24   
ref|XP_010506629.1|  PREDICTED: eukaryotic translation initiation...    102   3e-24   
gb|AIZ68198.1|  eukaryotic translation initiation factor 3 subuni...    101   4e-24   
ref|XP_010508042.1|  PREDICTED: eukaryotic translation initiation...    101   4e-24   
ref|XP_003577379.1|  PREDICTED: eukaryotic translation initiation...    101   4e-24   
ref|XP_006854979.1|  hypothetical protein AMTR_s00052p00194740        99.8    8e-24   
ref|XP_006294579.1|  hypothetical protein CARUB_v10023615mg             100   1e-23   
gb|EMS51995.1|  Eukaryotic translation initiation factor 3 subunit I    100   1e-23   
gb|EMT33770.1|  hypothetical protein F775_29343                         100   1e-23   
dbj|BAJ85385.1|  predicted protein                                      100   1e-23   
gb|AFM95335.1|  eukaryotic translation initiation factor 3 subunit i    100   1e-23   
ref|NP_182151.1|  TGF-beta receptor interacting protein 1             97.1    1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAG53616.1|AF285835_1  eukaryotic initiation factor 3I1 subunit    97.1    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43862.1|AF370485_1  eukaryotic translation initiation facto...  97.1    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395438.1|  hypothetical protein EUTSA_v10004580mg           96.3    3e-22   
gb|ACF82853.1|  unknown                                               95.1    3e-22   Zea mays [maize]
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383           95.9    4e-22   
ref|XP_001758941.1|  predicted protein                                95.1    7e-22   
ref|NP_001147501.1|  eukaryotic translation initiation factor 3 s...  94.7    1e-21   Zea mays [maize]
ref|XP_008670966.1|  PREDICTED: eukaryotic translation initiation...  94.7    1e-21   
ref|XP_004955547.1|  PREDICTED: eukaryotic translation initiation...  94.7    1e-21   
ref|XP_002461510.1|  hypothetical protein SORBIDRAFT_02g003760        94.7    1e-21   Sorghum bicolor [broomcorn]
dbj|BAH19940.1|  AT2G46280                                            94.4    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49079.1|  TGF-beta receptor interacting protein 1 homolog       94.4    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757566.1|  predicted protein                                94.0    2e-21   
gb|AFK47032.1|  unknown                                               89.4    3e-21   
ref|XP_001763986.1|  predicted protein                                93.2    3e-21   
gb|ABK92672.1|  unknown                                               87.0    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002500789.1|  predicted protein                                85.9    2e-18   Micromonas commoda
ref|XP_003059370.1|  predicted protein                                85.9    2e-18   
ref|XP_007512918.1|  predicted protein                                85.1    3e-18   
ref|XP_001418365.1|  predicted protein                                84.0    9e-18   Ostreococcus lucimarinus CCE9901
gb|KFM28081.1|  Eukaryotic translation initiation factor 3 subunit I  83.6    9e-18   
ref|XP_002431936.1|  eukaryotic translation initiation factor 3 s...  83.6    1e-17   Pediculus humanus corporis [human body lice]
gb|EHJ63876.1|  eukaryotic translation initiation factor 3 subunit I  83.2    1e-17   
ref|NP_001040433.1|  eukaryotic translation initiation factor 3 s...  83.2    1e-17   Bombyx mori [silk moth]
dbj|BAM18089.1|  eukaryotic translation initiation factor 3 subun...  82.8    2e-17   
gb|EFN69223.1|  Eukaryotic translation initiation factor 3 subunit I  82.4    3e-17   
ref|XP_011055583.1|  PREDICTED: eukaryotic translation initiation...  82.4    3e-17   
gb|EGI64611.1|  Eukaryotic translation initiation factor 3 subunit I  82.4    3e-17   
gb|EFZ22632.1|  hypothetical protein SINV_00160                       82.0    4e-17   
ref|XP_003396808.1|  PREDICTED: eukaryotic translation initiation...  82.0    4e-17   
ref|XP_003707661.1|  PREDICTED: eukaryotic translation initiation...  82.0    4e-17   
ref|XP_003487069.1|  PREDICTED: eukaryotic translation initiation...  82.0    4e-17   
ref|XP_392780.2|  PREDICTED: eukaryotic translation initiation fa...  82.0    4e-17   Apis mellifera [bee]
ref|XP_005823889.1|  translation initiation factor 3, subunit I       82.0    4e-17   
ref|XP_003079673.1|  TGF-beta receptor-interacting protein 1 (ISS)    82.0    4e-17   
gb|EZA54998.1|  Eukaryotic translation initiation factor 3 subunit I  81.6    5e-17   
gb|AGM32572.1|  WD40 domain containing protein                        80.9    7e-17   
gb|AEE62555.1|  unknown                                               81.3    8e-17   
ref|XP_002066637.1|  GK24461                                          80.9    9e-17   Drosophila willistoni
ref|XP_008553489.1|  PREDICTED: eukaryotic translation initiation...  80.9    1e-16   
gb|EFN80705.1|  Eukaryotic translation initiation factor 3 subunit I  80.5    1e-16   
gb|EFX80147.1|  hypothetical protein DAPPUDRAFT_304176                80.5    1e-16   
gb|EFN80704.1|  Eukaryotic translation initiation factor 3 subunit I  80.5    1e-16   
ref|XP_005181692.1|  PREDICTED: eukaryotic translation initiation...  80.5    1e-16   
ref|XP_967415.1|  PREDICTED: eukaryotic translation initiation fa...  80.5    1e-16   Tribolium castaneum [rust-red flour beetle]
ref|XP_004531427.1|  PREDICTED: eukaryotic translation initiation...  80.5    2e-16   
ref|XP_002734611.1|  PREDICTED: eukaryotic translation initiation...  79.0    2e-16   Saccoglossus kowalevskii
ref|XP_001965147.1|  GF23646                                          80.5    2e-16   Drosophila ananassae
ref|XP_002001737.1|  GI15375                                          80.1    2e-16   Drosophila mojavensis
ref|XP_006003298.1|  PREDICTED: eukaryotic translation initiation...  79.7    2e-16   
ref|XP_008549768.1|  PREDICTED: eukaryotic translation initiation...  80.1    2e-16   
ref|XP_002051937.1|  GJ17275                                          80.1    2e-16   Drosophila virilis
ref|XP_002021487.1|  GL26537                                          79.7    2e-16   Drosophila persimilis
sp|B3MVL6.2|EIF3I_DROAN  RecName: Full=Eukaryotic translation ini...  79.7    2e-16   Drosophila ananassae
sp|B4LUA5.2|EIF3I_DROVI  RecName: Full=Eukaryotic translation ini...  79.7    2e-16   Drosophila virilis
ref|XP_010221644.1|  PREDICTED: eukaryotic translation initiation...  78.2    3e-16   
gb|KDR14214.1|  hypothetical protein L798_11754                       79.7    3e-16   
ref|XP_009814792.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  79.3    3e-16   
ref|XP_009866332.1|  PREDICTED: eukaryotic translation initiation...  79.3    3e-16   
ref|XP_009964403.1|  PREDICTED: eukaryotic translation initiation...  79.7    3e-16   
gb|ACD65081.1|  eukaryotic translation initiation factor              79.3    3e-16   Forcipomyia taiwana
ref|XP_008188704.1|  PREDICTED: eukaryotic translation initiation...  78.2    4e-16   
ref|XP_002115720.1|  expressed hypothetical protein                   79.3    4e-16   Trichoplax adhaerens
ref|XP_002078185.1|  GD22675                                          79.3    4e-16   Drosophila simulans
ref|XP_009927166.1|  PREDICTED: eukaryotic translation initiation...  79.0    4e-16   
ref|NP_523478.1|  Trip1                                               79.3    4e-16   Drosophila melanogaster
gb|KFQ11963.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    4e-16   
gb|EMC82690.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    4e-16   
ref|XP_001639587.1|  predicted protein                                79.0    4e-16   Nematostella vectensis
ref|XP_010767678.1|  PREDICTED: eukaryotic translation initiation...  77.8    4e-16   
ref|XP_001968738.1|  GG24335                                          79.3    4e-16   Drosophila erecta
gb|KFO85136.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    4e-16   
gb|KFP87471.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    4e-16   
ref|XP_003387873.1|  PREDICTED: eukaryotic translation initiation...  79.0    5e-16   
ref|XP_005142501.1|  PREDICTED: eukaryotic translation initiation...  79.3    5e-16   
gb|KFQ71196.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    5e-16   
ref|XP_009482861.1|  PREDICTED: eukaryotic translation initiation...  78.6    5e-16   
ref|XP_010280277.1|  PREDICTED: eukaryotic translation initiation...  79.3    5e-16   
gb|KFW72870.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    5e-16   
ref|XP_010731470.1|  PREDICTED: eukaryotic translation initiation...  78.6    5e-16   
gb|KGL92853.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    5e-16   
ref|XP_009330494.1|  PREDICTED: eukaryotic translation initiation...  78.6    5e-16   
gb|KFW07927.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    5e-16   
ref|NP_001157823.1|  eukaryotic translation initiation factor 3 s...  79.0    5e-16   Taeniopygia guttata
gb|ACH44280.1|  putative eukaryotic translation initiation factor...  79.0    5e-16   Taeniopygia guttata
ref|XP_005058303.1|  PREDICTED: eukaryotic translation initiation...  79.0    5e-16   
ref|XP_009068306.1|  PREDICTED: eukaryotic translation initiation...  79.0    5e-16   
gb|KFP75614.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    5e-16   
ref|XP_005707349.1|  translation initiation factor eIF-3 subunit 2    79.0    6e-16   
ref|XP_009579506.1|  PREDICTED: eukaryotic translation initiation...  79.0    6e-16   
gb|KFO60217.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    6e-16   
gb|KFM11279.1|  Eukaryotic translation initiation factor 3 subunit I  79.0    6e-16   
ref|XP_005509744.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-16   
gb|ACO15193.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    6e-16   Caligus clemensi
ref|XP_002088703.1|  Trip1                                            79.0    6e-16   Drosophila yakuba
ref|XP_008633416.1|  PREDICTED: eukaryotic translation initiation...  79.0    6e-16   
ref|XP_010140742.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-16   
ref|XP_010574327.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-16   
gb|KFQ08008.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    6e-16   
ref|NP_001157867.1|  eukaryotic translation initiation factor 3 s...  78.6    6e-16   Gallus gallus [bantam]
ref|XP_009283047.1|  PREDICTED: eukaryotic translation initiation...  79.0    6e-16   
gb|KFQ49075.1|  Eukaryotic translation initiation factor 3 subunit I  78.2    6e-16   
sp|B4NW98.2|EIF3I_DROYA  RecName: Full=Eukaryotic translation ini...  78.6    7e-16   Drosophila yakuba
gb|KFP10887.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
gb|KFV75063.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
ref|XP_009708532.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  78.6    7e-16   
ref|XP_001989068.1|  GH10244                                          78.6    7e-16   Drosophila grimshawi
ref|XP_002167671.1|  PREDICTED: eukaryotic translation initiation...  78.6    7e-16   
ref|XP_005239876.1|  PREDICTED: eukaryotic translation initiation...  78.6    7e-16   
ref|XP_010012332.1|  PREDICTED: eukaryotic translation initiation...  78.2    7e-16   
ref|XP_010574326.1|  PREDICTED: eukaryotic translation initiation...  78.6    7e-16   
gb|EOB00694.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
ref|XP_009882825.1|  PREDICTED: eukaryotic translation initiation...  79.0    7e-16   
ref|XP_009646824.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  78.6    7e-16   
ref|XP_002400973.1|  translation initiation factor 3 and TGF-beta...  77.4    7e-16   Ixodes scapularis [blacklegged tick]
gb|KFO08490.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
gb|KFZ50593.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
gb|KFP00122.1|  Eukaryotic translation initiation factor 3 subunit I  78.6    7e-16   
ref|XP_002899797.1|  eukaryotic translation initiation factor 3 s...  78.6    7e-16   
ref|XP_009906815.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
ref|XP_008491107.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
ref|XP_009538303.1|  hypothetical protein PHYSODRAFT_551045           78.6    8e-16   
ref|XP_005020506.1|  PREDICTED: eukaryotic translation initiation...  79.0    8e-16   
ref|XP_010168387.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
gb|ETO77218.1|  hypothetical protein F444_07544                       78.6    8e-16   
ref|XP_010295903.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
ref|XP_005427180.1|  PREDICTED: eukaryotic translation initiation...  77.8    8e-16   
ref|XP_009977243.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
ref|XP_010721802.1|  PREDICTED: eukaryotic translation initiation...  79.0    8e-16   
ref|XP_008294825.1|  PREDICTED: eukaryotic translation initiation...  78.6    8e-16   
ref|XP_008904158.1|  hypothetical protein PPTG_10533                  78.6    8e-16   
ref|XP_010151135.1|  PREDICTED: eukaryotic translation initiation...  78.2    8e-16   
ref|XP_009503195.1|  PREDICTED: eukaryotic translation initiation...  77.8    8e-16   
gb|KFP52286.1|  Eukaryotic translation initiation factor 3 subunit I  77.8    8e-16   
gb|KFO76878.1|  Eukaryotic translation initiation factor 3 subunit I  77.8    8e-16   
gb|ACO14914.1|  Eukaryotic translation initiation factor 3 subunit I  78.2    9e-16   Caligus clemensi
ref|XP_010083431.1|  PREDICTED: eukaryotic translation initiation...  77.8    9e-16   
ref|XP_009560176.1|  PREDICTED: eukaryotic translation initiation...  77.8    9e-16   
ref|XP_008937943.1|  PREDICTED: eukaryotic translation initiation...  77.8    9e-16   
gb|KFW91111.1|  Eukaryotic translation initiation factor 3 subunit I  77.8    1e-15   
gb|KFV10110.1|  Eukaryotic translation initiation factor 3 subunit I  78.2    1e-15   
ref|XP_010198429.1|  PREDICTED: eukaryotic translation initiation...  77.8    1e-15   
ref|XP_008918903.1|  PREDICTED: eukaryotic translation initiation...  79.3    1e-15   
ref|NP_998155.1|  eukaryotic translation initiation factor 3 subu...  78.2    1e-15   Danio rerio [leopard danio]
ref|XP_010902262.1|  PREDICTED: eukaryotic translation initiation...  78.2    1e-15   
ref|XP_006806095.1|  PREDICTED: eukaryotic translation initiation...  78.2    1e-15   
ref|XP_007363750.1|  WD40 repeat-like protein                         78.2    1e-15   
gb|ACQ58286.1|  Eukaryotic translation initiation factor 3 subunit I  78.2    1e-15   Anoplopoma fimbria
ref|XP_003443814.1|  PREDICTED: eukaryotic translation initiation...  78.2    1e-15   
gb|KFQ29136.1|  Eukaryotic translation initiation factor 3 subunit I  77.4    1e-15   
gb|KFP30991.1|  Eukaryotic translation initiation factor 3 subunit I  77.8    1e-15   
emb|CCA18540.1|  eukaryotic translation initiation factor 3 subun...  78.2    1e-15   
gb|KFD50597.1|  hypothetical protein M513_08546                       78.2    1e-15   
ref|XP_003228758.1|  PREDICTED: eukaryotic translation initiation...  77.8    1e-15   
gb|ACO09379.1|  Eukaryotic translation initiation factor 3 subunit 2  77.8    1e-15   Osmerus mordax
ref|XP_009679337.1|  PREDICTED: eukaryotic translation initiation...  77.8    1e-15   
ref|XP_007432017.1|  PREDICTED: eukaryotic translation initiation...  77.8    1e-15   
ref|XP_008613397.1|  translation initiation factor 3 subunit I        77.8    2e-15   
gb|EKC38588.1|  Eukaryotic translation initiation factor 3 subunit I  77.8    2e-15   
gb|KFM68458.1|  Eukaryotic translation initiation factor 3 subunit I  77.4    2e-15   
ref|XP_001509369.3|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008862518.1|  hypothetical protein H310_01239                  77.4    2e-15   
ref|NP_001156064.1|  eukaryotic translation initiation factor 3 s...  77.4    2e-15   Acyrthosiphon pisum
ref|XP_005102454.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   
ref|XP_005102453.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   
ref|XP_001693266.1|  eukaryotic initiation factor                     77.4    2e-15   Chlamydomonas reinhardtii
ref|XP_006274867.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   
ref|XP_006019466.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   
emb|CAF99511.1|  unnamed protein product                              77.4    2e-15   Tetraodon nigroviridis
ref|XP_003969003.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-15   
emb|CDQ91911.1|  unnamed protein product                              77.4    2e-15   
ref|XP_007563815.1|  PREDICTED: eukaryotic translation initiation...  77.0    3e-15   
ref|XP_005812506.1|  PREDICTED: eukaryotic translation initiation...  77.0    3e-15   
ref|NP_001133273.1|  Eukaryotic translation initiation factor 3 s...  77.0    3e-15   Salmo salar
ref|NP_001187527.1|  eukaryotic translation initiation factor 3 s...  77.0    3e-15   
ref|NP_001280295.1|  uncharacterized protein LOC100162604             77.0    3e-15   
gb|KHJ45297.1|  WD domain, G-beta repeat protein                      79.0    3e-15   
gb|ADO28015.1|  eukaryotic translation initiation factor 3 subunit i  76.6    3e-15   
ref|XP_008419625.1|  PREDICTED: eukaryotic translation initiation...  76.6    3e-15   
gb|AAI27353.1|  eif3s2 protein                                        76.6    4e-15   Xenopus tropicalis [western clawed frog]
emb|CDW54634.1|  Eukaryotic translation initiation factor 3           76.6    4e-15   
ref|XP_007873769.1|  hypothetical protein PNEG_01801                  76.6    4e-15   
ref|NP_001015781.1|  eukaryotic translation initiation factor 3 s...  76.6    4e-15   Xenopus tropicalis [western clawed frog]
ref|XP_007492943.1|  PREDICTED: eukaryotic translation initiation...  76.6    4e-15   
ref|NP_001087664.1|  eukaryotic translation initiation factor 3 s...  76.6    4e-15   Xenopus laevis [clawed frog]
ref|NP_001279068.1|  eukaryotic translation initiation factor 3, ...  76.6    4e-15   
ref|XP_002122597.1|  PREDICTED: eukaryotic translation initiation...  76.6    4e-15   
emb|CCI46504.1|  unnamed protein product                              76.3    5e-15   
ref|XP_004074467.1|  PREDICTED: eukaryotic translation initiation...  76.3    5e-15   
ref|XP_003765492.1|  PREDICTED: eukaryotic translation initiation...  76.6    6e-15   
ref|XP_009821601.1|  hypothetical protein H257_00561                  75.9    6e-15   
ref|XP_002802333.1|  PREDICTED: eukaryotic translation initiation...  75.9    6e-15   
gb|KFB49333.1|  AGAP006607-PA-like protein                            75.9    8e-15   
gb|ACO13175.1|  Eukaryotic translation initiation factor 3 subunit I  75.9    8e-15   
dbj|BAE90204.1|  unnamed protein product                              75.1    9e-15   
ref|XP_007197322.1|  PREDICTED: eukaryotic translation initiation...  74.7    1e-14   
ref|XP_006777450.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  75.9    1e-14   
gb|EDL80550.1|  rCG30571, isoform CRA_b                               74.7    1e-14   
ref|XP_010352245.1|  PREDICTED: eukaryotic translation initiation...  74.7    1e-14   
emb|CDK24887.1|  unnamed protein product                              75.5    1e-14   
gb|ACO10455.1|  Eukaryotic translation initiation factor 3 subunit I  75.1    1e-14   
ref|XP_004372060.1|  PREDICTED: eukaryotic translation initiation...  75.9    1e-14   
ref|XP_007170666.1|  PREDICTED: eukaryotic translation initiation...  75.1    1e-14   
ref|XP_006158209.1|  PREDICTED: eukaryotic translation initiation...  74.7    1e-14   
ref|XP_006862226.1|  PREDICTED: eukaryotic translation initiation...  75.1    1e-14   
gb|EWM21585.1|  WD40-repeat-containing protein                        75.5    1e-14   
ref|XP_005395112.1|  PREDICTED: eukaryotic translation initiation...  75.5    1e-14   
ref|XP_006901315.1|  PREDICTED: eukaryotic translation initiation...  75.1    1e-14   
ref|XP_004850898.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  75.9    1e-14   
gb|KHJ35878.1|  putative eukaryotic translation initiation factor 3   75.1    1e-14   
gb|AFR92732.1|  translation initiation factor 3 subunit I             75.1    2e-14   
gb|EHB12852.1|  Eukaryotic translation initiation factor 3 subunit I  75.5    2e-14   
ref|XP_008692694.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_003191596.1|  hypothetical protein CGB_A6310C                  75.1    2e-14   
ref|XP_008064944.1|  PREDICTED: eukaryotic translation initiation...  75.1    2e-14   
ref|NP_001108507.1|  eukaryotic translation initiation factor 3 s...  75.1    2e-14   
gb|AAX36269.1|  eukaryotic translation initiation factor 3 subuni...  74.7    2e-14   
gb|AAV38402.1|  eukaryotic translation initiation factor 3, subun...  74.7    2e-14   
ref|XP_567255.1|  hypothetical protein                                75.1    2e-14   
ref|XP_007007848.1|  hypothetical protein TREMEDRAFT_72409            75.5    2e-14   
ref|NP_003748.1|  eukaryotic translation initiation factor 3 subu...  74.7    2e-14   
ref|XP_005317802.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_003276408.2|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_001792230.1|  hypothetical protein SNOG_01594                  75.1    2e-14   
ref|XP_006117620.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_004900249.1|  PREDICTED: eukaryotic translation initiation...  75.9    2e-14   
ref|XP_005302240.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_003801293.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_004665214.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  75.1    2e-14   
ref|XP_006895022.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|NP_001015628.1|  eukaryotic translation initiation factor 3 s...  74.7    2e-14   
ref|XP_004406473.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_008155232.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
gb|EPQ15220.1|  Eukaryotic translation initiation factor 3 subunit I  74.7    2e-14   
gb|ELR48735.1|  Eukaryotic translation initiation factor 3 subunit I  74.7    2e-14   
dbj|BAE42882.1|  unnamed protein product                              74.7    2e-14   
ref|NP_001126286.1|  eukaryotic translation initiation factor 3 s...  74.7    2e-14   
ref|NP_061269.1|  eukaryotic translation initiation factor 3 subu...  74.7    2e-14   
ref|NP_001231553.1|  eukaryotic translation initiation factor 3, ...  74.7    2e-14   
ref|XP_009230695.1|  PREDICTED: eukaryotic translation initiation...  74.3    2e-14   
gb|EDL30181.1|  eukaryotic translation initiation factor 3, subun...  74.7    2e-14   
ref|XP_003937672.1|  PREDICTED: eukaryotic translation initiation...  74.3    2e-14   
ref|XP_535328.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic tran...  75.1    2e-14   
ref|XP_007948641.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
gb|EFB27372.1|  hypothetical protein PANDA_010855                     74.7    2e-14   
dbj|BAD96203.1|  eukaryotic translation initiation factor 3, subu...  74.7    2e-14   
ref|XP_009451208.1|  PREDICTED: eukaryotic translation initiation...  73.9    2e-14   
gb|AAX41399.1|  eukaryotic translation initiation factor 3 subuni...  74.7    2e-14   
gb|AHH54970.1|  eukaryotic translation initiation factor 3 subunit I  73.9    2e-14   
ref|XP_005878403.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  75.1    2e-14   
ref|XP_006054762.1|  PREDICTED: eukaryotic translation initiation...  75.5    2e-14   
ref|XP_007468733.1|  PREDICTED: eukaryotic translation initiation...  75.9    2e-14   
ref|XP_007125162.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_006094311.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_004705070.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_004266574.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_003500685.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_004603791.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_001503867.4|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  74.7    2e-14   
dbj|BAE01324.1|  unnamed protein product                              73.2    2e-14   
ref|XP_008037635.1|  WD40 repeat-like protein                         75.1    2e-14   
ref|XP_005139430.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  75.1    2e-14   
ref|XP_006994436.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  74.7    2e-14   
gb|ETN60290.1|  eukaryotic translation initiation factor 3 subunit    74.3    2e-14   
ref|XP_004591787.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_002957235.1|  eukaryotic translation initiation factor 3i      74.3    2e-14   
ref|XP_008330275.1|  PREDICTED: eukaryotic translation initiation...  74.3    2e-14   
ref|XP_004679476.1|  PREDICTED: eukaryotic translation initiation...  74.7    2e-14   
ref|XP_007067631.1|  PREDICTED: eukaryotic translation initiation...  73.6    3e-14   
ref|XP_008330273.1|  PREDICTED: eukaryotic translation initiation...  74.7    3e-14   
ref|XP_316636.4|  AGAP006607-PA                                       74.3    3e-14   
gb|EJT48020.1|  hypothetical protein A1Q1_02936                       74.3    3e-14   
ref|XP_008330274.1|  PREDICTED: eukaryotic translation initiation...  74.3    3e-14   
ref|XP_002556539.1|  KLTH0H15752p                                     74.3    3e-14   
ref|XP_010593652.1|  PREDICTED: eukaryotic translation initiation...  74.3    3e-14   
gb|KGG49952.1|  subunit I of eukaryotic translation initiation fa...  74.3    3e-14   
ref|XP_004485231.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  74.7    3e-14   
ref|XP_777869.1|  hypothetical protein CNBA5660                       74.7    4e-14   
gb|ELW48627.1|  Eukaryotic translation initiation factor 3 subunit I  75.1    4e-14   
emb|CDO77164.1|  hypothetical protein BN946_scf184657.g40             73.6    4e-14   
ref|XP_798959.3|  PREDICTED: eukaryotic translation initiation fa...  73.2    4e-14   
ref|XP_010619869.1|  PREDICTED: eukaryotic translation initiation...  73.9    4e-14   
gb|ERE85417.1|  eukaryotic translation initiation factor 3 subuni...  74.3    4e-14   
ref|XP_794303.3|  PREDICTED: eukaryotic translation initiation fa...  73.2    4e-14   
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I    73.9    4e-14   
gb|ELK02020.1|  Eukaryotic translation initiation factor 3 subunit I  75.1    5e-14   
ref|XP_009013860.1|  hypothetical protein HELRODRAFT_185422           73.6    6e-14   
ref|XP_007249463.1|  PREDICTED: eukaryotic translation initiation...  73.6    6e-14   
ref|XP_001656392.1|  eukaryotic translation initiation factor 3 s...  73.6    6e-14   
ref|XP_001400369.2|  eukaryotic translation initiation factor 3 s...  73.6    6e-14   
ref|XP_007380240.1|  WD40 repeat-like protein                         73.6    6e-14   
gb|EJU03377.1|  WD40 repeat-like protein                              73.6    6e-14   
ref|XP_003844805.1|  similar to eukaryotic translation initiation...  73.6    6e-14   
gb|KFW78228.1|  Eukaryotic translation initiation factor 3 subunit I  72.8    7e-14   
ref|XP_009047818.1|  hypothetical protein LOTGIDRAFT_200332           73.2    7e-14   
ref|XP_008079360.1|  WD40 repeat-like protein                         73.6    7e-14   
ref|XP_008024458.1|  hypothetical protein SETTUDRAFT_168745           73.6    7e-14   
ref|XP_003647153.1|  hypothetical protein Ecym_5599                   73.6    8e-14   
gb|EAZ42270.1|  hypothetical protein OsJ_26838                        73.6    8e-14   
ref|XP_001557202.1|  eukaryotic translation initiation factor 3       73.2    9e-14   
ref|XP_001595804.1|  eukaryotic translation initiation factor 3       73.2    1e-13   
gb|EMP28420.1|  Alpha-taxilin                                         75.1    1e-13   
ref|XP_002840508.1|  hypothetical protein                             72.8    1e-13   
ref|XP_001208970.1|  eukaryotic translation initiation factor 3 s...  72.8    1e-13   
dbj|GAA84383.1|  eukaryotic translation initiation factor 3 subun...  72.8    1e-13   
gb|EHA23450.1|  hypothetical protein ASPNIDRAFT_207376                72.8    1e-13   
gb|ELU14583.1|  hypothetical protein CAPTEDRAFT_180537                72.8    1e-13   
gb|EHH14557.1|  hypothetical protein EGK_00504                        72.8    1e-13   
sp|A2QEV8.1|EIF3I_ASPNC  RecName: Full=Eukaryotic translation ini...  72.8    1e-13   
ref|XP_754751.1|  eukaryotic translation initiation factor 3 subu...  72.8    1e-13   
ref|XP_001263576.1|  eukaryotic translation initiation factor 3 s...  72.8    1e-13   
ref|XP_007295961.1|  eukaryotic translation initiation factor 3       72.8    1e-13   
ref|XP_007692855.1|  hypothetical protein COCMIDRAFT_108319           72.8    1e-13   
ref|XP_007092475.1|  PREDICTED: eukaryotic translation initiation...  72.4    1e-13   
ref|XP_008230147.1|  PREDICTED: protein argonaute 2-like              74.3    1e-13   
emb|CBY20744.1|  unnamed protein product                              72.4    2e-13   
ref|XP_004994801.1|  eukaryotic translation initiation factor 3 s...  72.4    2e-13   
gb|KDD75202.1|  hypothetical protein H632_c812p0                      72.0    2e-13   
ref|XP_007350612.1|  WD40 repeat-like protein                         72.4    2e-13   
gb|ESZ97118.1|  eukaryotic translation initiation factor 3 subunit 2  72.4    2e-13   
ref|XP_007911781.1|  putative eukaryotic translation initiation f...  72.4    2e-13   
ref|XP_005647023.1|  TGF-beta receptor-interacting protein 1          72.0    2e-13   
dbj|GAA27675.2|  translation initiation factor 3 subunit I            70.9    2e-13   
ref|XP_001933019.1|  eukaryotic translation initiation factor 3 s...  72.0    2e-13   
gb|KFO34423.1|  Eukaryotic translation initiation factor 3 subunit I  73.9    2e-13   
gb|KEQ92579.1|  hypothetical protein AUEXF2481DRAFT_423089            72.0    2e-13   
gb|KEQ86784.1|  putative eukaryotic translation initiation factor...  72.0    3e-13   
ref|XP_007584752.1|  putative eukaryotic translation initiation f...  72.0    3e-13   
ref|XP_009167677.1|  hypothetical protein T265_04631                  70.9    3e-13   
gb|KEQ76375.1|  eukaryotic translation initiation factor 3 subunit I  71.6    3e-13   
gb|KEQ62058.1|  putative eukaryotic translation initiation factor...  71.6    3e-13   
gb|EPS26962.1|  hypothetical protein PDE_01902                        71.6    3e-13   
ref|XP_007784030.1|  eukaryotic translation initiation factor 3 s...  71.6    3e-13   
gb|EKG12028.1|  hypothetical protein MPH_10851                        71.6    3e-13   
gb|KDB12673.1|  eukaryotic translation initiation factor 3 subunit 2  71.6    3e-13   
ref|XP_007304716.1|  WD40 repeat-like protein                         71.6    3e-13   
ref|XP_449079.1|  hypothetical protein                                71.6    3e-13   
gb|EMD39788.1|  hypothetical protein CERSUDRAFT_112055                71.6    3e-13   
ref|XP_009546467.1|  hypothetical protein HETIRDRAFT_147751           71.6    4e-13   
ref|XP_001750974.1|  hypothetical protein                             71.2    4e-13   
gb|EYE99281.1|  eukaryotic translation initiation factor 3 subunit I  71.6    4e-13   
ref|XP_001270884.1|  eukaryotic translation initiation factor 3 s...  71.6    4e-13   
ref|XP_003686526.1|  hypothetical protein TPHA_0G02570                71.2    4e-13   
ref|XP_007399384.1|  hypothetical protein PHACADRAFT_261788           71.2    4e-13   
ref|XP_003686473.1|  hypothetical protein TPHA_0G02030                71.2    4e-13   
gb|EPQ62701.1|  hypothetical protein BGT96224_A21121                  70.5    5e-13   
gb|AGO12732.1|  AaceriADR264Cp                                        71.2    5e-13   
gb|AAY32924.1|  TGF-beta receptor interacting protein 1               70.9    5e-13   
gb|KID97044.1|  eukaryotic translation initiation factor 3 subunit 2  68.9    5e-13   
ref|XP_006676014.1|  hypothetical protein BATDEDRAFT_84729            70.9    6e-13   
ref|XP_001903926.1|  hypothetical protein                             70.9    6e-13   
ref|XP_009155937.1|  eukaryotic translation initiation factor 3 s...  70.9    7e-13   
gb|EFW45229.2|  Trip1-PA                                              70.5    7e-13   
ref|XP_001868509.1|  eukaryotic translation initiation factor 3 s...  70.5    7e-13   
ref|XP_004364074.1|  Trip1-PA                                         70.5    7e-13   
ref|NP_594958.1|  translation initiation factor eIF3i                 70.5    7e-13   
ref|NP_984360.1|  ADR264Cp                                            70.9    8e-13   
dbj|BAA13849.1|  unnamed protein product                              70.5    8e-13   
ref|XP_004341724.1|  eTGF-beta receptor-interacting protein, puta...  70.5    9e-13   
ref|XP_009216201.1|  eukaryotic translation initiation factor 3 3...  70.5    9e-13   
emb|CDS27796.1|  eukaryotic translation initiation factor 3           70.5    9e-13   
ref|XP_455416.1|  hypothetical protein                                70.5    1e-12   
emb|CCU81582.1|  eukaryotic translation initiation factor 3           70.1    1e-12   
emb|CEJ88530.1|  Putative Eukaryotic translation initiation facto...  70.5    1e-12   
ref|XP_003381662.1|  eukaryotic translation initiation factor 3 s...  70.1    1e-12   
gb|KDN63708.1|  putative WD domain-containing protein                 70.1    1e-12   
ref|XP_002488027.1|  eukaryotic translation initiation factor 3 s...  70.1    1e-12   
ref|XP_003034029.1|  hypothetical protein SCHCODRAFT_66951            70.1    1e-12   
gb|EPX75306.1|  translation initiation factor eIF3i                   70.1    1e-12   
ref|XP_007755968.1|  eukaryotic translation initiation factor 3 s...  70.1    1e-12   
ref|XP_003739333.1|  PREDICTED: eukaryotic translation initiation...  70.1    1e-12   
ref|XP_008723623.1|  eukaryotic translation initiation factor 3 s...  70.1    1e-12   
ref|XP_006963216.1|  predicted protein                                70.1    1e-12   
emb|CDS04160.1|  hypothetical protein LRAMOSA07115                    70.1    1e-12   
ref|XP_007270677.1|  WD40 repeat-like protein                         70.9    1e-12   
ref|XP_007725205.1|  eukaryotic translation initiation factor 3 s...  70.1    1e-12   
gb|KEF62513.1|  eukaryotic translation initiation factor 3 subunit I  70.1    1e-12   
gb|KDQ15156.1|  hypothetical protein BOTBODRAFT_55005                 70.1    2e-12   
emb|CCX32511.1|  Similar to Eukaryotic translation initiation fac...  69.7    2e-12   
emb|CDO95669.1|  unnamed protein product                              69.7    2e-12   
ref|XP_002183663.1|  predicted protein                                69.7    2e-12   
ref|XP_390444.1|  hypothetical protein FG10268.1                      69.7    2e-12   
emb|CCD75866.1|  putative eukaryotictranslation initiation factor...  68.2    2e-12   
emb|CDF88477.1|  BN860_11166g1_1                                      69.7    2e-12   
emb|CCG84178.1|  protein of unknown function                          69.3    2e-12   
emb|CDH13083.1|  probable Eukaryotic translation initiation facto...  69.7    2e-12   
ref|XP_001818333.1|  eukaryotic translation initiation factor 3 s...  69.3    2e-12   
gb|KDQ62747.1|  hypothetical protein JAAARDRAFT_30657                 69.3    2e-12   
ref|XP_003051107.1|  predicted protein                                69.3    2e-12   
ref|XP_003664486.1|  hypothetical protein MYCTH_2307366               69.3    2e-12   
gb|KID66371.1|  eukaryotic translation initiation factor 3 subunit 2  69.3    2e-12   
ref|XP_002489628.1|  Subunit of the core complex of translation i...  69.3    2e-12   
ref|XP_003650868.1|  hypothetical protein THITE_2110768               69.3    2e-12   
ref|XP_660601.1|  hypothetical protein AN2997.2                       69.3    2e-12   
gb|EPZ33787.1|  hypothetical protein O9G_004435                       68.9    2e-12   
ref|XP_002286220.1|  predicted protein                                68.9    3e-12   
gb|ERZ95383.1|  hypothetical protein GLOINDRAFT_341253                68.9    3e-12   
gb|KFY42253.1|  hypothetical protein V494_02500                       68.9    3e-12   
emb|CCA68444.1|  probable TIF34-translation initiation factor eIF...  68.9    3e-12   
emb|CDH49815.1|  eukaryotic translation initiation factor 3subunit    68.9    3e-12   
ref|XP_007814077.1|  eukaryotic translation initiation factor 3 s...  68.9    3e-12   
gb|ERG82626.1|  eukaryotic translation initiation factor 3 subunit i  68.9    3e-12   
ref|XP_007816213.1|  eukaryotic translation initiation factor 3 s...  68.9    3e-12   
gb|KFY64993.1|  hypothetical protein V496_02881                       68.9    3e-12   
gb|EFQ28334.1|  WD domain-containing protein                          68.9    3e-12   
gb|KDQ25934.1|  hypothetical protein PLEOSDRAFT_1066937               68.9    3e-12   
ref|XP_007797965.1|  putative eukaryotic translation initiation f...  68.9    3e-12   



>gb|KHN32457.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   120 bits (300),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  109  TLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  167



>gb|KHN14569.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   118 bits (295),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  109  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  167



>gb|KDO58633.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=268

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  167  LIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  224



>ref|XP_006591952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
 gb|ACU23631.1| unknown [Glycine max]
Length=326

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_003534423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_004136687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 ref|XP_004159618.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 gb|KGN59537.1| hypothetical protein Csa_3G824820 [Cucumis sativus]
Length=326

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_008443373.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis melo]
Length=326

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>gb|KDP38201.1| hypothetical protein JCGZ_04844 [Jatropha curcas]
Length=326

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>gb|KDO58631.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=313

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  225  LIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_003596914.1| Eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=321

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  219  SLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  277



>gb|AES67165.2| eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=326

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  224  SLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_006448046.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|ESR61286.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
Length=313

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  225  LIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_006448047.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 ref|XP_006492275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
 gb|ESR61287.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|KDO58630.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=326

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  225  LIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_002521889.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF40525.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=326

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEE+G
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEVG  282



>ref|XP_010062244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Eucalyptus grandis]
 gb|KCW69347.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=326

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVT TDHRAGKFEAKFFDKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_003517705.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_007157442.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
 gb|AAK49947.1|AF335551_1 TGF-beta receptor-interacting protein 1 [Phaseolus vulgaris]
 gb|ESW29436.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
Length=326

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_004492932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  224  SLVKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_007222666.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
 gb|EMJ23865.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
Length=326

 Score =   117 bits (293),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIG  282



>ref|XP_008220972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Prunus mume]
Length=326

 Score =   117 bits (293),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIG  282



>gb|ABK94219.1| unknown [Populus trichocarpa]
Length=326

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  224  TLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIG  282



>ref|XP_011021700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  224  TLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIG  282



>ref|XP_002315834.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEF02005.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=328

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  226  TLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIG  284



>ref|XP_007016708.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016709.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34327.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34328.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVALSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_002285281.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vitis vinifera]
 emb|CAN80198.1| hypothetical protein VITISV_030908 [Vitis vinifera]
 emb|CBI26753.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY+TERPVNAVTMSPLLDH+VLGGGQDAS VTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYLTERPVNAVTMSPLLDHVVLGGGQDASHVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_004489218.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +L+KTYVTERPVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  224  SLVKTYVTERPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  282



>ref|XP_010111947.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
 gb|EXC32128.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
Length=429

 Score =   116 bits (291),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  327  TLIKTYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFFDKILQEEIG  385



>gb|KHG16392.1| Eukaryotic translation initiation factor 3 subunit I -like protein 
[Gossypium arboreum]
Length=326

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYSTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_010557463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+L EEIG
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKLLLEEIG  282



>ref|XP_002311556.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEE88923.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=326

 Score =   115 bits (287),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKNYTTERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIG  282



>gb|EYU22708.1| hypothetical protein MIMGU_mgv1a009949mg [Erythranthe guttata]
Length=326

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  224  TLMKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILTEEIG  282



>gb|EYU22777.1| hypothetical protein MIMGU_mgv1a009964mg [Erythranthe guttata]
Length=326

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILTEEIG  282



>ref|XP_010521568.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  224  TLIKTYGTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILLEEIG  282



>ref|XP_010678072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   113 bits (283),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY+T RPVNAVTMSPLLDH+VLGGGQDAS VTT+DHRAGKFEAKFFDKIL+EEIG
Sbjct  225  TLIKTYITGRPVNAVTMSPLLDHVVLGGGQDASTVTTSDHRAGKFEAKFFDKILEEEIG  283



>gb|EPS73291.1| hypothetical protein M569_01462 [Genlisea aurea]
Length=326

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  225  LIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIG  282



>ref|XP_011024978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   113 bits (283),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  224  TLIKNYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIG  282



>ref|XP_009629813.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Nicotiana tomentosiformis]
Length=326

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ+EIG
Sbjct  224  TLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIG  282



>ref|XP_009777666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nicotiana sylvestris]
Length=326

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ+EIG
Sbjct  224  TLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIG  282



>ref|XP_011095354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Sesamum indicum]
Length=326

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  225  LIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIG  282



>ref|XP_008340535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQEEIG  282



>ref|XP_009777665.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nicotiana sylvestris]
Length=331

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ+EIG
Sbjct  229  TLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIG  287



>ref|XP_009351622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pyrus x bretschneideri]
Length=326

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQEEIG  282



>ref|XP_008350825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=328

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQEEIG  282



>ref|XP_008389128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKF+DKILQEEIG
Sbjct  224  TLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQEEIG  282



>ref|XP_009129412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brassica rapa]
Length=328

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_004250371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum lycopersicum]
Length=326

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  224  TLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIG  282



>emb|CDY34145.1| BnaA02g28950D [Brassica napus]
Length=330

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  228  TLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  286



>ref|XP_006351166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum tuberosum]
Length=326

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  224  TLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIG  282



>gb|EPS65969.1| hypothetical protein M569_08807 [Genlisea aurea]
Length=326

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            L+KTYVTERPVNAV +SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKIL EEIG
Sbjct  225  LIKTYVTERPVNAVAISPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIG  282



>ref|XP_010514644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Camelina sativa]
 ref|XP_010514645.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Camelina sativa]
Length=328

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLLKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>emb|CDY03970.1| BnaC02g36850D [Brassica napus]
Length=680

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  578  TLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  636



>ref|XP_010502959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=328

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_010425732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camelina sativa]
Length=356

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  254  TLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  312



>gb|KCW69348.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=280

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  166
            TL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVT TDHRAGKFEAKFFDK L+
Sbjct  224  TLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKFLK  278



>ref|XP_006395439.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32725.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=328

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_002882056.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58315.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_010249002.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Nelumbo nucifera]
Length=326

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLDH+V+GGGQ+AS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLVKTYVTERPVNAVAMSPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_010937470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNA  +SPLLDH+VLGGGQDAS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNACAISPLLDHVVLGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_010275011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nelumbo nucifera]
Length=326

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K YVTERPVNAV MSPLLDH+VLGGGQ+AS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKAYVTERPVNAVAMSPLLDHVVLGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>gb|KFK37423.1| hypothetical protein AALP_AA4G255300 [Arabis alpina]
Length=328

 Score =   107 bits (267),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/59 (83%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY +  PVNAV++SPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  226  TLIKTYTSNVPVNAVSISPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_009151956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151957.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
Length=328

 Score =   106 bits (265),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKF+DKILQEEIG
Sbjct  226  TLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIG  284



>emb|CDY71621.1| BnaAnng38210D [Brassica napus]
Length=344

 Score =   106 bits (265),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKF+DKILQEEIG
Sbjct  242  TLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIG  300



>ref|XP_004297796.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   106 bits (264),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY TE PVNAV MSPLL+H+VLGGGQDA  VTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  227  TLIKTYRTESPVNAVAMSPLLNHVVLGGGQDAINVTTTDHRAGKFEAKFYDKILQEEIG  285



>emb|CDY13713.1| BnaA06g32100D [Brassica napus]
Length=344

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKF+DKILQEEIG
Sbjct  242  TLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIG  300



>ref|XP_008808070.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Phoenix dactylifera]
Length=254

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K YVTERPVNA  +SPLLDH+V+GGGQDAS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  152  TLIKAYVTERPVNACAISPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIG  210



>gb|AAC62877.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+D ILQEEIG
Sbjct  226  TLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIG  284



>ref|NP_182152.2| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEC10672.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+D ILQEEIG
Sbjct  253  TLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIG  311



>dbj|BAC43524.1| putative eukaryotic translation initiation factor 3 delta subunit 
[Arabidopsis thaliana]
Length=355

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+D ILQEEIG
Sbjct  253  TLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIG  311



>emb|CDP11515.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  26   ERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            ERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  117  ERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIG  167



>ref|XP_008782131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Phoenix dactylifera]
Length=326

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNA  +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_010926275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
 ref|XP_010926276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNA  +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_008808069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Phoenix dactylifera]
Length=326

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K YVTERPVNA  +SPLLDH+V+GGGQDAS VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKAYVTERPVNACAISPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIG  282



>gb|ABK26793.1| unknown [Picea sitchensis]
Length=326

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKFF KIL+EEIG
Sbjct  224  TLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILEEEIG  282



>gb|ABR18068.1| unknown [Picea sitchensis]
Length=326

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKFF KIL+EEIG
Sbjct  224  TLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILEEEIG  282



>ref|XP_006663589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oryza brachyantha]
Length=310

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKFF KILQEEIG
Sbjct  208  TLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIG  266



>ref|NP_001055036.1| Os05g0256000 [Oryza sativa Japonica Group]
 gb|AAV31388.1| putative TGF-beta receptor interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF16950.1| Os05g0256000 [Oryza sativa Japonica Group]
 dbj|BAG97027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78857.1| hypothetical protein OsI_19205 [Oryza sativa Indica Group]
 gb|EEE63021.1| hypothetical protein OsJ_17829 [Oryza sativa Japonica Group]
Length=326

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIG  282



>ref|NP_001061508.1| Os08g0308100 [Oryza sativa Japonica Group]
 gb|AAQ56413.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Japonica Group]
 gb|AAQ56424.1| TGF-beta receptor-interacting protein-like protein [Oryza sativa 
Japonica Group]
 dbj|BAC92643.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAC92579.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF23422.1| Os08g0308100 [Oryza sativa Japonica Group]
 dbj|BAI39771.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
 dbj|BAI39984.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
Length=326

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIG  282



>emb|CDP20306.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   103 bits (257),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  26   ERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            ERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+LQEEIG
Sbjct  232  ERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIG  282



>ref|XP_002862549.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38807.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=328

 Score =   103 bits (256),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K+Y T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+D IL+EEIG
Sbjct  226  TLIKSYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIG  284



>ref|XP_002882057.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58316.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K+Y T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+D IL+EEIG
Sbjct  257  TLIKSYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIG  315



>ref|XP_007215753.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
 gb|EMJ16952.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
Length=295

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSPLLD +VLGGGQDASAVTTTDHRAGKFEAKF+D+ L+   G
Sbjct  218  TLIKTYVTERPVNAVAMSPLLDDVVLGGGQDASAVTTTDHRAGKFEAKFYDRFLKWSGG  276



>ref|XP_009389562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389563.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNA  +SPLLDH+V+GGGQ+A  VTTTD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNACAISPLLDHVVIGGGQEAVHVTTTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_010506629.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=361

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K+Y T  PVNAV MSPLL+H++LGGGQDASAVTTTDHRAGKFEAKF+D IL+EEIG
Sbjct  259  TLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIG  317



>gb|AIZ68198.1| eukaryotic translation initiation factor 3 subunit I-like isoform 
X1 [Galtonia saundersiae]
Length=328

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTYVT  PVNA  +SPLLDH+V+GGGQDA  VT TDHRAGKFEAKFF KILQEEIG
Sbjct  226  TLLKTYVTSAPVNACAISPLLDHVVMGGGQDAVNVTMTDHRAGKFEAKFFHKILQEEIG  284



>ref|XP_010508042.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=360

 Score =   101 bits (252),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+K+Y T  PVNAV MSPLL+H++LGGGQDASAVTTTDHRAG FEAKF+D ILQEEIG
Sbjct  258  TLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGNFEAKFYDTILQEEIG  316



>ref|XP_003577379.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brachypodium distachyon]
Length=326

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKFF KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIG  282



>ref|XP_006854979.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
 gb|ERN16446.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
Length=238

 Score = 99.8 bits (247),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNA  +SPL DH+V+GGGQ+AS VTTTD RAGKFEAKFF +IL+EEIG
Sbjct  136  TLIKTYVTERPVNACAISPLHDHVVIGGGQEASHVTTTDRRAGKFEAKFFHQILEEEIG  194



>ref|XP_006294579.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
 gb|EOA27477.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
Length=328

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAVTMSPLL+HIVLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  236  PVNAVTMSPLLNHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>gb|EMS51995.1| Eukaryotic translation initiation factor 3 subunit I [Triticum 
urartu]
Length=341

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV MSP LD++V+GGGQDA  VT TD RAGKFEAKFF KILQEEIG
Sbjct  190  TLIKTYVTERPVNAVDMSPTLDNVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIG  248



>gb|EMT33770.1| hypothetical protein F775_29343 [Aegilops tauschii]
Length=406

 Score =   100 bits (249),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKFF KIL+EEIG
Sbjct  323  TLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIG  381



>dbj|BAJ85385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKFF KIL+EEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIG  282



>gb|AFM95335.1| eukaryotic translation initiation factor 3 subunit i [Triticum 
aestivum]
Length=326

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKFF KIL+EEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIG  282



>ref|NP_182151.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 ref|NP_850450.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 sp|Q38884.2|EIF3I_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TGF-beta receptor-interacting 
protein 1; Short=TRIP-1; AltName: Full=eIF-3-beta; 
AltName: Full=eIF3 p36 [Arabidopsis thaliana]
 gb|AAC62878.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 dbj|BAE98705.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AEC10670.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10671.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=328

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  236  PVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>gb|AAG53616.1|AF285835_1 eukaryotic initiation factor 3I1 subunit [Arabidopsis thaliana]
Length=328

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  236  PVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>gb|AAK43862.1|AF370485_1 eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AAL47346.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  236  PVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  284



>ref|XP_006395438.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32724.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=289

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKI  160
            TL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DK+
Sbjct  226  TLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKV  278



>gb|ACF82853.1| unknown [Zea mays]
Length=211

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKF+ KILQEEIG
Sbjct  109  TLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIG  167



>ref|XP_002988251.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
 ref|XP_002991383.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ07495.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ10670.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
Length=323

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTY TERPVNAV +SPL++H+V+GGGQ+AS VTT+D RAGKFEAKFF KI  +EIG
Sbjct  222  TLLKTYSTERPVNAVAISPLMNHVVVGGGQEASQVTTSDRRAGKFEAKFFHKIFCDEIG  280



>ref|XP_001758941.1| predicted protein [Physcomitrella patens]
 gb|EDQ76447.1| predicted protein [Physcomitrella patens]
Length=326

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            T+LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  RAGKFEAKFF KI +EEIG
Sbjct  224  TVLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFEEEIG  282



>ref|NP_001147501.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 gb|ACG27749.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 tpg|DAA59664.1| TPA: eukaryotic translation initiation factor 3 subunit 2 [Zea 
mays]
Length=326

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKF+ KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIG  282



>ref|XP_008670966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 ref|XP_008670967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 tpg|DAA42586.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42587.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42588.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
Length=326

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKF+ KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIG  282



>ref|XP_004955547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Setaria italica]
Length=326

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKF+ KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIG  282



>ref|XP_002461510.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
 gb|EER98031.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
Length=326

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKF+ KILQEEIG
Sbjct  224  TLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIG  282



>dbj|BAH19940.1| AT2G46280 [Arabidopsis thaliana]
Length=328

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQE IG
Sbjct  236  PVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEGIG  284



>gb|AAC49079.1| TGF-beta receptor interacting protein 1 homolog [Arabidopsis 
thaliana]
Length=328

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  32   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            PVNAV++SPLL+H+VLGGG+DASAVTTTDHRAGKFEAKF DKILQEEIG
Sbjct  236  PVNAVSLSPLLNHVVLGGGEDASAVTTTDHRAGKFEAKFCDKILQEEIG  284



>ref|XP_001757566.1| predicted protein [Physcomitrella patens]
 gb|EDQ77623.1| predicted protein [Physcomitrella patens]
Length=326

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  RAGKFEAKFF KI +EEIG
Sbjct  225  MLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFEEEIG  282



>gb|AFK47032.1| unknown [Medicago truncatula]
Length=87

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +2

Query  50   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG
Sbjct  1    MSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  43



>ref|XP_001763986.1| predicted protein [Physcomitrella patens]
 gb|EDQ71125.1| predicted protein [Physcomitrella patens]
Length=326

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            T+LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  R GKFEAKFF KI +EEIG
Sbjct  224  TVLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRVGKFEAKFFHKIFEEEIG  282



>gb|ABK92672.1| unknown [Populus trichocarpa]
Length=87

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +2

Query  50   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKILQEEIG
Sbjct  1    MSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIG  43



>ref|XP_002500789.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62047.1| predicted protein [Micromonas sp. RCC299]
Length=317

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
             LKTY  +RPVNA  +SP+LDHI+LGGGQDA AVTTT  +AGKF++K F KI +EEIG
Sbjct  217  CLKTYAADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIG  274



>ref|XP_003059370.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56502.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
             LKTYV +RPVNA  +SP+LDHIVLGGGQDA AVTTT  +AGKF++K + K+ +EEIG
Sbjct  234  CLKTYVADRPVNAAIISPILDHIVLGGGQDAMAVTTTSSKAGKFDSKIYFKVYEEEIG  291



>ref|XP_007512918.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16476.1| predicted protein [Bathycoccus prasinos]
Length=327

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLKTYV +RPVNA  +SP+ +HI+LGGGQDA AVTTT  +AGKF++K + KI +EEIG
Sbjct  227  LLKTYVADRPVNAAIISPIREHIILGGGQDAMAVTTTSSKAGKFDSKIYHKIFEEEIG  284



>ref|XP_001418365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
             LKTY  +RPVNA  +SP+ DHIVLGGGQDA AVTTT  +AGKF++K + KI +EEIG
Sbjct  223  CLKTYSADRPVNAAILSPIRDHIVLGGGQDAMAVTTTSSKAGKFDSKIYHKIFEEEIG  280



>gb|KFM28081.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
Length=324

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LKTY +  PVN+  +SP+ DH++LGGGQDAS VTTT  RAG+FE++FF K+ QEE G
Sbjct  222  VLKTYQSNVPVNSAALSPVYDHVILGGGQDASQVTTTSSRAGRFESRFFHKVFQEEFG  279



>ref|XP_002431936.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
 gb|EEB19198.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
Length=320

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+  +SPLLDH+VLGGGQDA  VTTT  R GKF+++FF  + +EE G
Sbjct  218  LKTYKTERPVNSAAISPLLDHVVLGGGQDAMEVTTTSTRIGKFDSRFFHMVFEEEFG  274



>gb|EHJ63876.1| eukaryotic translation initiation factor 3 subunit I [Danaus 
plexippus]
Length=325

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+FF  + +EE G
Sbjct  219  LLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFG  276



>ref|NP_001040433.1| eukaryotic translation initiation factor 3 subunit I [Bombyx 
mori]
 sp|Q1HPW4.1|EIF3I_BOMMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Bombyx mori]
 gb|ABF51377.1| eukaryotic translation initiation factor 3 subunit 2 beta [Bombyx 
mori]
Length=329

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+FF  + +EE G
Sbjct  223  LLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFG  280



>dbj|BAM18089.1| eukaryotic translation initiation factor 3 subunit I [Papilio 
xuthus]
Length=329

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+FF  + +EE G
Sbjct  223  LLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFG  280



>gb|EFN69223.1| Eukaryotic translation initiation factor 3 subunit I [Camponotus 
floridanus]
Length=322

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  219  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  274



>ref|XP_011055583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Acromyrmex echinatior]
Length=326

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  278



>gb|EGI64611.1| Eukaryotic translation initiation factor 3 subunit I [Acromyrmex 
echinatior]
Length=322

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  219  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  274



>gb|EFZ22632.1| hypothetical protein SINV_00160 [Solenopsis invicta]
Length=326

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  278



>ref|XP_003396808.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Bombus terrestris]
Length=301

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  198  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEE  253



>ref|XP_003707661.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Megachile rotundata]
Length=326

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEE  278



>ref|XP_003487069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Bombus impatiens]
Length=326

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEE  278



>ref|XP_392780.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Apis mellifera]
 ref|XP_003693606.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Apis florea]
 ref|XP_006570172.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Apis mellifera]
 ref|XP_006612554.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Apis dorsata]
 ref|XP_006612555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Apis dorsata]
Length=326

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEE  278



>ref|XP_005823889.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
 gb|EKX36909.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
Length=319

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            ++ YV++RP+N+  +SPL+DH+V+GGGQDASAVTTT  R+G+F+A F+ KI + EIG
Sbjct  220  IRKYVSDRPINSAAISPLMDHVVIGGGQDASAVTTTAGRSGRFQALFYHKIFENEIG  276



>ref|XP_003079673.1| TGF-beta receptor-interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL53318.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=323

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
             +KTY  +RPVNA  +SP+ DHIVLGGGQDA +VTTT  +AGKF++K + KI +EEIG
Sbjct  223  CMKTYSADRPVNAAILSPIRDHIVLGGGQDAMSVTTTSSKAGKFDSKIYHKIFEEEIG  280



>gb|EZA54998.1| Eukaryotic translation initiation factor 3 subunit I [Cerapachys 
biroi]
Length=326

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  223  LLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  278



>gb|AGM32572.1| WD40 domain containing protein, partial [Coptotermes formosanus]
Length=290

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+  +SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE G
Sbjct  224  LKTYKTERPVNSAAVSPIFDHVVLGGGQDAMDVTTTSTRIGKFDSRFFHLVFEEEFG  280



>gb|AEE62555.1| unknown [Dendroctonus ponderosae]
 gb|ENN81757.1| hypothetical protein YQE_01850, partial [Dendroctonus ponderosae]
 gb|ERL89282.1| hypothetical protein D910_06655 [Dendroctonus ponderosae]
Length=326

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLKTY TERPVN+  +SP+ +H+VLGGGQ+A  VTTT  RAGKF+++FF  + +EE G
Sbjct  223  LLKTYKTERPVNSAAISPIAEHVVLGGGQEAMEVTTTSTRAGKFDSRFFHLVFEEEFG  280



>ref|XP_002066637.1| GK24461 [Drosophila willistoni]
 sp|B4N0L0.1|EIF3I_DROWI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
willistoni]
 gb|EDW77623.1| GK24461 [Drosophila willistoni]
Length=322

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEI  175
             LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE 
Sbjct  220  CLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEF  276



>ref|XP_008553489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+ T+SP+ DH++LGGGQDA  VTTT  R GKF+A+F+  + +EE
Sbjct  224  LKTYQTERPVNSATISPIFDHVILGGGQDAMDVTTTSARQGKFDARFYHLVFEEE  278



>gb|EFN80705.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=320

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  217  LLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  272



>gb|EFX80147.1| hypothetical protein DAPPUDRAFT_304176 [Daphnia pulex]
Length=327

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  R GKF+A+FF  + +EE
Sbjct  225  LKTYKTERPVNSAAISPIMDHVVLGGGQDAMDVTTTSTRVGKFDARFFHLVFEEE  279



>gb|EFN80704.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=324

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++FF  + +EE
Sbjct  221  LLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEE  276



>ref|XP_005181692.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Musca domestica]
Length=324

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  224  LKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  278



>ref|XP_967415.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Tribolium castaneum]
 gb|EEZ99635.1| hypothetical protein TcasGA2_TC002391 [Tribolium castaneum]
Length=326

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLKTY TERPVN+  +SP+ +H+V+GGGQDA  VTTT  R GKF+++FF  + +EE G
Sbjct  223  LLKTYKTERPVNSAAISPIFEHVVVGGGQDAMDVTTTSARVGKFDSRFFHMVFEEEFG  280



>ref|XP_004531427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Ceratitis capitata]
Length=326

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>ref|XP_002734611.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Saccoglossus kowalevskii]
Length=179

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+ ++SP+ DH+VLGGGQ+A  VTTT  R GKF+A+FF  + +EE G
Sbjct  76   LKTYKTERPVNSASISPIRDHVVLGGGQEAMDVTTTSTRIGKFDARFFHLVFEEEFG  132



>ref|XP_001965147.1| GF23646 [Drosophila ananassae]
 gb|EDV33281.1| GF23646 [Drosophila ananassae]
Length=332

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  231  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  285



>ref|XP_002001737.1| GI15375 [Drosophila mojavensis]
 sp|B4KGX9.1|EIF3I_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
mojavensis]
 gb|EDW11179.1| GI15375 [Drosophila mojavensis]
Length=322

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  221  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  275



>ref|XP_006003298.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Latimeria chalumnae]
Length=299

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SPL+DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  MKTFRTERPVNSAAISPLMDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_008549768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+A+F+  + +EE
Sbjct  224  LKTYKTERPVNSATISPIYDHVVLGGGQDAMDVTTTSTRQGKFDARFYHLVFEEE  278



>ref|XP_002051937.1| GJ17275 [Drosophila virilis]
 gb|EDW64092.1| GJ17275 [Drosophila virilis]
Length=325

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  224  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  278



>ref|XP_002021487.1| GL26537 [Drosophila persimilis]
 ref|XP_001355946.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GSH1.1|EIF3I_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
persimilis]
 sp|Q29L19.2|EIF3I_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
pseudoobscura pseudoobscura]
 gb|EDW25330.1| GL26537 [Drosophila persimilis]
 gb|EAL33005.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
Length=326

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>sp|B3MVL6.2|EIF3I_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
ananassae]
Length=322

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  221  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  275



>sp|B4LUA5.2|EIF3I_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
virilis]
Length=322

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  221  LKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  275



>ref|XP_010221644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like, partial [Tinamus guttatus]
Length=158

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  56   LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  112



>gb|KDR14214.1| hypothetical protein L798_11754 [Zootermopsis nevadensis]
Length=338

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            + LKTY TERPVN+  +SP+ DH+V+GGGQDA  VTTT  R GKF+++FF  + +EE G
Sbjct  233  SCLKTYKTERPVNSAAISPIYDHVVVGGGQDAMDVTTTSTRIGKFDSRFFHLVFEEEFG  291



>ref|XP_009814792.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I, partial [Gavia stellata]
Length=292

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  190  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  246



>ref|XP_009866332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Apaloderma vittatum]
Length=310

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  191  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  247



>ref|XP_009964403.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tyto alba]
Length=324

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  222  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  278



>gb|ACD65081.1| eukaryotic translation initiation factor [Forcipomyia taiwana]
Length=325

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SPLL+H+VLGGGQDA  VTTT  R GKF+++FF  I +EE
Sbjct  224  LKTYKTERPVNSAAISPLLEHVVLGGGQDAMEVTTTSARQGKFDSRFFHLIYEEE  278



>ref|XP_008188704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like, partial [Acyrthosiphon pisum]
Length=191

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEI  175
            ++ K YVTERPVN+ ++SP+ DH+VLGGGQDA  VTTT  +AGKF+A+FF  I +EE 
Sbjct  87   SVHKVYVTERPVNSASLSPVYDHVVLGGGQDAMDVTTTAAQAGKFDARFFHVIFEEEF  144



>ref|XP_002115720.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV21572.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=325

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            TLLKTY TERPVN+  +S L DH+VLGGGQ+A  VTTT  +AGKF+A+F+  + +EEIG
Sbjct  221  TLLKTYKTERPVNSAALSSLKDHVVLGGGQEAIDVTTTAAQAGKFDARFYHVVFEEEIG  279



>ref|XP_002078185.1| GD22675 [Drosophila simulans]
 sp|B4Q354.1|EIF3I_DROSI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
simulans]
 gb|EDX03770.1| GD22675 [Drosophila simulans]
Length=326

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>ref|XP_009927166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Haliaeetus albicilla]
Length=300

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  198  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  254



>ref|NP_523478.1| Trip1 [Drosophila melanogaster]
 ref|XP_002037884.1| GM18055 [Drosophila sechellia]
 sp|O02195.1|EIF3I_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog; AltName: 
Full=eIF-3-beta [Drosophila melanogaster]
 sp|B4I195.1|EIF3I_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
sechellia]
 gb|AAB53431.1| TRIP-1 homolog [Drosophila melanogaster]
 gb|AAF52183.1| Trip1 [Drosophila melanogaster]
 gb|AAM49896.1| LD24026p [Drosophila melanogaster]
 gb|EDW54302.1| GM18055 [Drosophila sechellia]
 gb|ACL84827.1| Trip1-PA, partial [synthetic construct]
 gb|ACL89803.1| Trip1-PA [synthetic construct]
Length=326

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>gb|KFQ11963.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Haliaeetus albicilla]
Length=291

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  189  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  245



>gb|EMC82690.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Columba livia]
Length=293

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  191  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  247



>ref|XP_001639587.1| predicted protein [Nematostella vectensis]
 sp|A7RM20.1|EIF3I_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Nematostella vectensis]
 gb|EDO47524.1| predicted protein [Nematostella vectensis]
Length=321

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY T+RPVN+  +SP+ DH+V+GGGQ+A  VTTT  R GKF+A+FF  + +EEIG
Sbjct  219  LKTYKTDRPVNSAALSPIKDHVVVGGGQEAMEVTTTSTRVGKFDARFFHVVFEEEIG  275



>ref|XP_010767678.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Notothenia coriiceps]
Length=174

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  98   IKTFRTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHACYEEEFG  154



>ref|XP_001968738.1| GG24335 [Drosophila erecta]
 sp|B3N4C7.1|EIF3I_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
erecta]
 gb|EDV57797.1| GG24335 [Drosophila erecta]
Length=326

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>gb|KFO85136.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Buceros rhinoceros silvestris]
Length=301

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  226  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  282



>gb|KFP87471.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Apaloderma vittatum]
Length=275

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  191  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  247



>ref|XP_003387873.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Amphimedon queenslandica]
Length=320

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +L+KT+ T+RPVN+  +SP+ DH+VLGGGQ+A  VTTT  ++GKFEAKFF  I  EEIG
Sbjct  216  SLIKTFRTDRPVNSAAISPIKDHVVLGGGQEAMEVTTTTTKSGKFEAKFFHLIHAEEIG  274



>ref|XP_005142501.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Melopsittacus undulatus]
Length=347

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  245  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  301



>gb|KFQ71196.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Phaethon lepturus]
Length=314

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  212  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  268



>ref|XP_009482861.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pelecanus crispus]
Length=270

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  168  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  224



>ref|XP_010280277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Phaethon lepturus]
Length=336

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  234  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  290



>gb|KFW72870.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pygoscelis adeliae]
Length=277

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  175  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  231



>ref|XP_010731470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Larimichthys crocea]
Length=296

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  194  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  250



>gb|KGL92853.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Charadrius vociferus]
Length=319

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  217  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  273



>ref|XP_009330494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pygoscelis adeliae]
Length=279

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  177  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  233



>gb|KFW07927.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Fulmarus glacialis]
Length=325

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|NP_001157823.1| eukaryotic translation initiation factor 3 subunit I [Taeniopygia 
guttata]
 sp|B5FZ19.2|EIF3I_TAEGU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Taeniopygia guttata]
 gb|ACH44281.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44283.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44284.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44285.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44286.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
Length=325

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>gb|ACH44280.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
Length=325

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_005058303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Ficedula albicollis]
 ref|XP_005529814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Pseudopodoces humilis]
 ref|XP_009096805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Serinus canaria]
Length=325

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_009068306.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Acanthisitta chloris]
Length=324

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  222  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  278



>gb|KFP75614.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Acanthisitta chloris]
Length=325

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_005707349.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
 gb|EME30829.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
Length=324

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LKT++T+RPVN+  +SP+L H++LGGGQ+AS VTTT  RAG+FEA+ F  I ++EIG
Sbjct  222  VLKTFLTDRPVNSAAISPILPHVLLGGGQEASQVTTTGDRAGRFEARLFHLIYEDEIG  279



>ref|XP_009579506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fulmarus glacialis]
Length=331

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  229  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  285



>gb|KFO60217.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Corvus brachyrhynchos]
Length=325

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>gb|KFM11279.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Aptenodytes forsteri]
Length=325

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_005509744.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Columba livia]
Length=307

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  205  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  261



>gb|ACO15193.1| Eukaryotic translation initiation factor 3 subunit I [Caligus 
clemensi]
Length=324

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+ ++SP +DH+VLGGGQ+A  VT T  R GKF+A+FF  + +EE G
Sbjct  222  LKTYKTERPVNSASLSPKMDHVVLGGGQEAMEVTMTSTRIGKFDARFFHVVFEEEFG  278



>ref|XP_002088703.1| Trip1 [Drosophila yakuba]
 gb|EDW88415.1| Trip1 [Drosophila yakuba]
Length=325

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LK+Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  224  LKSYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  278



>ref|XP_008633416.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus brachyrhynchos]
 ref|XP_010406518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus cornix cornix]
Length=326

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  224  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  280



>ref|XP_010140742.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Buceros rhinoceros silvestris]
Length=309

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  233  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  289



>ref|XP_010574327.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Haliaeetus leucocephalus]
Length=325

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>gb|KFQ08008.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Leptosomus discolor]
 gb|KFQ21940.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Mesitornis unicolor]
 gb|KFR03530.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Nipponia nippon]
 gb|KFZ48523.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Podiceps cristatus]
Length=325

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|NP_001157867.1| eukaryotic translation initiation factor 3 subunit I [Gallus 
gallus]
 ref|XP_009469099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Nipponia nippon]
 ref|XP_009998862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chaetura pelagica]
Length=325

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_009283047.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Aptenodytes forsteri]
Length=331

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  229  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  285



>gb|KFQ49075.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Nestor notabilis]
Length=263

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  161  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  217



>sp|B4NW98.2|EIF3I_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
yakuba]
Length=322

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LK+Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  221  LKSYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  275



>gb|KFP10887.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Egretta garzetta]
Length=324

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  222  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  278



>gb|KFV75063.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Picoides pubescens]
Length=324

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  222  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  278



>ref|XP_009708532.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Cariama cristata]
Length=329

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  227  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  283



>ref|XP_001989068.1| GH10244 [Drosophila grimshawi]
 sp|B4JB43.1|EIF3I_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
grimshawi]
 gb|EDW03935.1| GH10244 [Drosophila grimshawi]
Length=326

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            LKTY TERPVN+  +SP+ DH+VLGGGQDA  VTTT  +AGKF+++FF  I +EE
Sbjct  225  LKTYKTERPVNSAAISPIFDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEE  279



>ref|XP_002167671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Hydra vulgaris]
Length=325

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LLKTY T+RPVN+  +SP+ D +VLGGGQ+A  VTTT  R GKF+A+FF  I +EEIG
Sbjct  222  LLKTYKTDRPVNSAAISPIRDQVVLGGGQEAMEVTTTSTRIGKFDARFFHMIFEEEIG  279



>ref|XP_005239876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco peregrinus]
 ref|XP_005432815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco cherrug]
 ref|XP_009946176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Leptosomus discolor]
 ref|XP_010180366.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Mesitornis unicolor]
Length=331

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  229  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  285



>ref|XP_010012332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Nestor notabilis]
Length=263

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  161  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  217



>ref|XP_010574326.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Haliaeetus leucocephalus]
Length=332

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  230  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  286



>gb|EOB00694.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Anas platyrhynchos]
 gb|KFU91822.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Chaetura pelagica]
Length=325

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_009882825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Charadrius vociferus]
Length=339

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  237  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  293



>ref|XP_009646824.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Egretta garzetta]
Length=331

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  229  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  285



>ref|XP_002400973.1| translation initiation factor 3 and TGF-beta interacting protein, 
putative [Ixodes scapularis]
 gb|EEC00610.1| translation initiation factor 3 and TGF-beta interacting protein, 
putative [Ixodes scapularis]
Length=195

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+ ++SP+ +H+VLGGGQ+A  VTT+  +AGKF+A+FF  I +EE G
Sbjct  93   LKTYKTERPVNSASLSPIKEHVVLGGGQEAMDVTTSSTKAGKFDARFFHLIFEEEFG  149



>gb|KFO08490.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Balearica regulorum gibbericeps]
Length=312

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  210  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  266



>gb|KFZ50593.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Caprimulgus carolinensis]
Length=325

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>gb|KFP00122.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Calypte anna]
Length=325

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  279



>ref|XP_002899797.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY60851.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
Length=327

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+FF  + QEE G
Sbjct  224  VLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFG  281



>ref|XP_009906815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Picoides pubescens]
Length=340

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  238  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  294



>ref|XP_008491107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Calypte anna]
Length=340

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  238  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  294



>ref|XP_009538303.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
 gb|EGZ06406.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
Length=327

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+FF  + QEE G
Sbjct  224  VLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFG  281



>ref|XP_005020506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anas platyrhynchos]
Length=359

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  257  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  313



>ref|XP_010168387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Caprimulgus carolinensis]
Length=331

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  229  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  285



>gb|ETO77218.1| hypothetical protein F444_07544 [Phytophthora parasitica P1976]
Length=327

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+FF  + QEE G
Sbjct  224  VLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFG  281



>ref|XP_010295903.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Balearica regulorum gibbericeps]
Length=329

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  227  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  283



>ref|XP_005427180.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Geospiza fortis]
Length=249

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  147  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  203



>ref|XP_009977243.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tauraco erythrolophus]
Length=338

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  236  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  292



>ref|XP_010721802.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Meleagris gallopavo]
Length=351

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  249  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  305



>ref|XP_008294825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Stegastes partitus]
Length=325

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_008904158.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETI48440.1| hypothetical protein F443_07533 [Phytophthora parasitica P1569]
 gb|ETK88380.1| hypothetical protein L915_07354 [Phytophthora parasitica]
 gb|ETL41778.1| hypothetical protein L916_07299 [Phytophthora parasitica]
 gb|ETL94935.1| hypothetical protein L917_07189 [Phytophthora parasitica]
 gb|ETM48172.1| hypothetical protein L914_07247 [Phytophthora parasitica]
 gb|ETN10397.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETP18232.1| hypothetical protein F441_07512 [Phytophthora parasitica CJ01A1]
 gb|ETP46176.1| hypothetical protein F442_07542 [Phytophthora parasitica P10297]
Length=327

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+FF  + QEE G
Sbjct  224  VLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFG  281



>ref|XP_010151135.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Eurypyga helias]
Length=290

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  215  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  271



>ref|XP_009503195.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}, partial [Phalacrocorax 
carbo]
Length=247

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  172  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  228



>gb|KFP52286.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cathartes aura]
 gb|KFV16729.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pterocles gutturalis]
Length=263

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  161  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  217



>gb|KFO76878.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cuculus canorus]
Length=263

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  161  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  217



>gb|ACO14914.1| Eukaryotic translation initiation factor 3 subunit I [Caligus 
clemensi]
Length=324

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKTY TERPVN+ ++SP +DH+VLGGGQ+A  VT T  R GKF+A+FF  + +EE G
Sbjct  222  LKTYKTERPVNSASLSPKMDHVVLGGGQEAMEVTMTSTRIGKFDARFFHVVFEEEFG  278



>ref|XP_010083431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pterocles gutturalis]
 ref|XP_010121524.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Chlamydotis macqueenii]
Length=263

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  161  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  217



>ref|XP_009560176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Cuculus canorus]
Length=266

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  164  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  220



>ref|XP_008937943.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Merops nubicus]
Length=258

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  156  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  212



>gb|KFW91111.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Phalacrocorax carbo]
Length=288

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  213  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  269



>gb|KFV10110.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Tauraco erythrolophus]
Length=321

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  219  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  275



>ref|XP_010198429.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Colius striatus]
Length=306

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  204  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHWAFEEEFG  260



>ref|XP_008918903.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Manacus vitellinus]
Length=444

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  342  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLPFEEEFG  398



>ref|NP_998155.1| eukaryotic translation initiation factor 3 subunit I [Danio rerio]
 sp|Q7ZV55.1|EIF3I_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Danio rerio]
 gb|AAH45995.1| Eukaryotic translation initiation factor 3, subunit 2 beta [Danio 
rerio]
 gb|AAH65874.1| Eif3s2 protein [Danio rerio]
Length=325

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  VKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_010902262.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Esox lucius]
Length=325

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_006806095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Neolamprologus brichardi]
Length=325

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_007363750.1| WD40 repeat-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF63198.1| WD40 repeat-like protein [Dichomitus squalens LYAD-421 SS1]
Length=334

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            T+LKTYVTE P+N+  ++PL  +++LGGGQDA +VTTT  R GKFE +F+ K+L+EE+G
Sbjct  224  TVLKTYVTETPLNSAALAPLKPYVLLGGGQDAMSVTTTSLRQGKFETRFWHKVLEEEVG  282



>gb|ACQ58286.1| Eukaryotic translation initiation factor 3 subunit I [Anoplopoma 
fimbria]
Length=325

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_003443814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oreochromis niloticus]
 ref|XP_004563737.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Maylandia zebra]
 ref|XP_005745286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pundamilia nyererei]
 ref|XP_005950654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Haplochromis burtoni]
Length=325

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>gb|KFQ29136.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Merops nubicus]
Length=242

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  140  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  196



>gb|KFP30991.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Colius striatus]
Length=305

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  203  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHWAFEEEFG  259



>emb|CCA18540.1| eukaryotic translation initiation factor 3 subunit p [Albugo 
laibachii Nc14]
Length=331

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    LLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            +LKTY T+RPVN+  MSP+ +H+VLGGGQ+A +VTTT  + GKFEA+FF  + QEE
Sbjct  224  VLKTYETDRPVNSAAMSPIREHVVLGGGQEAMSVTTTSGQVGKFEARFFHMVFQEE  279



>gb|KFD50597.1| hypothetical protein M513_08546 [Trichuris suis]
 gb|KFD67691.1| hypothetical protein M514_08546 [Trichuris suis]
Length=328

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    TLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEE  172
            T+LKTY  E+PVN+V +SP+ DH+VLGGG +A +VTTTD R G+FEAKF+  I ++E
Sbjct  224  TVLKTYKAEKPVNSVAISPIRDHVVLGGGLEAMSVTTTDTRQGQFEAKFYHMIFEDE  280



>ref|XP_003228758.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anolis carolinensis]
Length=325

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF   ++EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFG  279



>gb|ACO09379.1| Eukaryotic translation initiation factor 3 subunit 2 [Osmerus 
mordax]
Length=325

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  223  IKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFG  279



>ref|XP_009679337.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Struthio camelus australis]
Length=338

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF    +EE G
Sbjct  236  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFG  292



>ref|XP_007432017.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Python bivittatus]
Length=325

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  8    LKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIG  178
            LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+FF   ++EE G
Sbjct  223  LKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFG  279



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509996894868