BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14837_g1_i1 len=664 path=[682:0-663]

Length=664
                                                                      Score     E

ref|XP_002274030.1|  PREDICTED: mucin-17                              60.5    6e-15   Vitis vinifera
ref|XP_004307632.1|  PREDICTED: uncharacterized protein LOC101299528  59.7    6e-15   
ref|XP_009344713.1|  PREDICTED: mucin-5AC-like isoform X1             60.1    7e-15   
ref|XP_009344718.1|  PREDICTED: serine/arginine repetitive matrix...  60.1    7e-15   
ref|XP_011044062.1|  PREDICTED: LOW QUALITY PROTEIN: nascent poly...  60.1    7e-15   
ref|XP_002315162.1|  hypothetical protein POPTR_0010s19760g           59.7    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011035974.1|  PREDICTED: mucin-5AC-like                        59.7    1e-14   
ref|XP_011016320.1|  PREDICTED: serine/arginine repetitive matrix...  59.7    1e-14   
ref|XP_011016321.1|  PREDICTED: zonadhesin-like isoform X2            59.7    1e-14   
ref|XP_009603323.1|  PREDICTED: mucin-5B-like isoform X1              58.5    1e-14   
gb|KHG16426.1|  hypothetical protein F383_23799                       57.4    3e-14   
ref|XP_008362728.1|  PREDICTED: flocculation protein FLO11-like i...  60.1    3e-14   
ref|XP_008373857.1|  PREDICTED: LOW QUALITY PROTEIN: flocculation...  60.1    3e-14   
ref|XP_010067518.1|  PREDICTED: serine/arginine repetitive matrix...  60.5    3e-14   
ref|XP_007009023.1|  Uncharacterized protein TCM_042539               58.2    4e-14   
ref|XP_010095095.1|  hypothetical protein L484_026404                 55.8    4e-14   
ref|XP_008369241.1|  PREDICTED: flocculation protein FLO11-like       60.5    6e-14   
ref|XP_009369152.1|  PREDICTED: proteoglycan 4-like                   60.5    6e-14   
ref|XP_008233740.1|  PREDICTED: flocculation protein FLO11            60.5    8e-14   
ref|XP_007218953.1|  hypothetical protein PRUPE_ppa003504mg           60.5    8e-14   
ref|XP_009776738.1|  PREDICTED: mucin-5AC-like                        60.5    1e-13   
ref|XP_002312151.1|  hypothetical protein POPTR_0008s06680g           56.2    1e-13   Populus trichocarpa [western balsam poplar]
gb|KHF99477.1|  Low-density lipoprotein receptor-related              59.3    2e-13   
ref|XP_004239930.1|  PREDICTED: uncharacterized protein DDB_G0274915  58.5    3e-13   
ref|XP_009791262.1|  PREDICTED: mucin-5AC-like isoform X1             63.2    4e-13   
ref|XP_009791269.1|  PREDICTED: mucin-5AC-like isoform X2             63.2    4e-13   
ref|XP_003538456.1|  PREDICTED: flocculation protein FLO11-like       56.6    4e-13   
gb|KHN34732.1|  hypothetical protein glysoja_039028                   56.6    4e-13   
ref|XP_003552436.1|  PREDICTED: flocculation protein FLO11-like       56.6    4e-13   
ref|XP_007163529.1|  hypothetical protein PHAVU_001G241800g           56.6    5e-13   
ref|XP_004500676.1|  PREDICTED: flocculation protein FLO11-like       57.4    6e-13   
ref|XP_006355666.1|  PREDICTED: mucin-5AC-like                        60.1    6e-13   
ref|XP_009605096.1|  PREDICTED: mucin-5AC-like isoform X1             60.1    1e-12   
ref|XP_009605097.1|  PREDICTED: mucin-5AC-like isoform X2             60.1    1e-12   
ref|XP_010535052.1|  PREDICTED: mucin-17                              57.8    1e-12   
ref|XP_006575536.1|  PREDICTED: flocculation protein FLO11-like i...  56.2    2e-12   
ref|XP_006575535.1|  PREDICTED: flocculation protein FLO11-like i...  56.2    2e-12   
gb|KHN48560.1|  hypothetical protein glysoja_034183                   56.2    2e-12   
gb|KEH28283.1|  ATP-binding protein, putative                         57.4    2e-12   
gb|KEH34783.1|  ATP-binding protein, putative                         56.2    2e-12   
gb|KEH28284.1|  ATP-binding protein, putative                         57.4    2e-12   
ref|XP_002526897.1|  ATP binding protein, putative                    57.4    2e-12   Ricinus communis
ref|XP_006595866.1|  PREDICTED: flocculation protein FLO11-like i...  53.1    3e-12   
gb|KHN20852.1|  hypothetical protein glysoja_009160                   53.1    4e-12   
ref|XP_006595867.1|  PREDICTED: flocculation protein FLO11-like i...  53.1    4e-12   
ref|XP_008441457.1|  PREDICTED: zonadhesin isoform X2                 60.8    4e-12   
ref|XP_004235247.1|  PREDICTED: putative GPI-anchored protein PB1...  53.1    4e-12   
ref|XP_008441454.1|  PREDICTED: probable serine/threonine-protein...  60.5    4e-12   
ref|XP_006595868.1|  PREDICTED: flocculation protein FLO11-like i...  52.8    5e-12   
ref|XP_010262831.1|  PREDICTED: nascent polypeptide-associated co...  58.9    7e-12   
ref|XP_010262830.1|  PREDICTED: nascent polypeptide-associated co...  58.9    7e-12   
ref|XP_010262832.1|  PREDICTED: nascent polypeptide-associated co...  58.5    8e-12   
ref|XP_008795443.1|  PREDICTED: nascent polypeptide-associated co...  58.9    9e-12   
gb|KGN45784.1|  hypothetical protein Csa_6G011590                     60.5    1e-11   
ref|XP_004138425.1|  PREDICTED: uncharacterized protein LOC101204600  60.5    1e-11   
ref|XP_002323572.2|  hypothetical protein POPTR_0016s12230g           55.5    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004170203.1|  PREDICTED: uncharacterized protein LOC101230836  60.1    2e-11   
gb|KDP44785.1|  hypothetical protein JCGZ_01285                       57.4    2e-11   
emb|CDP14035.1|  unnamed protein product                              56.6    2e-11   
ref|XP_010910088.1|  PREDICTED: endochitinase A-like                  58.9    2e-11   
ref|XP_007141776.1|  hypothetical protein PHAVU_008G224800g           51.2    5e-11   
ref|XP_009782013.1|  PREDICTED: cell wall protein RBR3-like           48.5    5e-11   
ref|XP_004490980.1|  PREDICTED: flocculation protein FLO11-like       53.1    6e-11   
ref|XP_009412573.1|  PREDICTED: endochitinase A-like isoform X1       55.1    7e-11   
ref|XP_009600813.1|  PREDICTED: putative GPI-anchored protein PB1...  48.5    8e-11   
ref|XP_010508921.1|  PREDICTED: flocculation protein FLO11-like i...  55.8    1e-10   
ref|XP_009412575.1|  PREDICTED: vegetative cell wall protein gp1-...  54.3    1e-10   
ref|XP_006367372.1|  PREDICTED: uncharacterized protein LOC102588142  57.8    2e-10   
emb|CBI30400.3|  unnamed protein product                              57.8    3e-10   
gb|KFK36895.1|  hypothetical protein AALP_AA4G186400                  55.8    3e-10   
ref|XP_006293855.1|  hypothetical protein CARUB_v10022840mg           56.2    3e-10   
ref|NP_181536.3|  uncharacterized protein                             55.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505709.1|  PREDICTED: flocculation protein FLO11-like       55.8    3e-10   
ref|XP_010517399.1|  PREDICTED: flocculation protein FLO11-like       55.8    3e-10   
dbj|BAH57264.1|  AT2G40070                                            55.8    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078028.1|  uncharacterized protein                          55.5    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047445.1|  PREDICTED: mucin-2-like                          55.5    9e-10   
ref|XP_004302638.1|  PREDICTED: uncharacterized protein LOC101310429  56.6    9e-10   
ref|XP_008785362.1|  PREDICTED: nascent polypeptide-associated co...  61.6    1e-09   
gb|KDO69021.1|  hypothetical protein CISIN_1g026936mg                 65.1    1e-09   
ref|XP_010654168.1|  PREDICTED: zonadhesin-like isoform X1            56.2    1e-09   
emb|CDY07628.1|  BnaA03g18830D                                        55.8    1e-09   
ref|XP_009133405.1|  PREDICTED: uncharacterized serine-rich prote...  55.8    1e-09   
ref|XP_010654169.1|  PREDICTED: mucin-12-like isoform X2              56.2    1e-09   
emb|CDY60338.1|  BnaC03g72310D                                        55.8    1e-09   
emb|CAN77490.1|  hypothetical protein VITISV_010725                   56.6    2e-09   Vitis vinifera
ref|XP_006411252.1|  hypothetical protein EUTSA_v10016404mg           55.8    2e-09   
ref|XP_010256565.1|  PREDICTED: mucin-5AC-like                        58.9    2e-09   
ref|XP_006848188.1|  hypothetical protein AMTR_s00029p00238480        55.1    4e-09   
ref|XP_006435713.1|  hypothetical protein CICLE_v10030993mg           65.1    7e-09   
ref|XP_006435712.1|  hypothetical protein CICLE_v10030993mg           64.7    7e-09   
gb|KHG09845.1|  Maturase K                                            47.8    3e-08   
ref|XP_008243876.1|  PREDICTED: flocculation protein FLO11-like       52.0    3e-08   
gb|EYU20023.1|  hypothetical protein MIMGU_mgv1a003450mg              63.2    3e-08   
ref|XP_006429352.1|  hypothetical protein CICLE_v10011390mg           49.3    3e-08   
ref|XP_002528111.1|  conserved hypothetical protein                   51.2    4e-08   Ricinus communis
ref|XP_009377788.1|  PREDICTED: mucin-2-like                          53.1    5e-08   
ref|XP_010689824.1|  PREDICTED: cell wall protein RBR3                61.2    1e-07   
ref|XP_010923060.1|  PREDICTED: endochitinase A-like                  48.5    1e-07   
emb|CDY20509.1|  BnaC04g05350D                                        55.8    2e-07   
emb|CDX74811.1|  BnaA05g05570D                                        55.8    2e-07   
ref|XP_009143258.1|  PREDICTED: endochitinase A-like                  55.8    2e-07   
ref|XP_006356484.1|  PREDICTED: flocculation protein FLO11-like       47.8    2e-07   
ref|XP_007208455.1|  hypothetical protein PRUPE_ppa003864mg           50.1    4e-07   
dbj|BAN18468.1|  proteophosphoglycan                                  57.8    4e-07   
dbj|BAN18479.1|  proteophosphoglycan                                  57.8    4e-07   
dbj|BAN18471.1|  proteophosphoglycan                                  57.8    4e-07   
dbj|BAN18489.1|  proteophosphoglycan                                  57.8    4e-07   
dbj|BAN18487.1|  proteophosphoglycan                                  57.8    4e-07   
ref|XP_008655627.1|  PREDICTED: uncharacterized protein LOC103634815  54.7    5e-07   
ref|XP_011076684.1|  PREDICTED: cell wall protein RBR3 isoform X2     59.3    5e-07   
ref|XP_007026736.1|  Uncharacterized protein TCM_021711               58.9    6e-07   
ref|XP_011076682.1|  PREDICTED: cell wall protein RBR3 isoform X1     58.9    6e-07   
gb|KDP24464.1|  hypothetical protein JCGZ_25028                       51.6    7e-07   
gb|EEC69917.1|  hypothetical protein OsI_00338                        58.5    1e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001041987.1|  Os01g0141900                                     58.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457389.1|  hypothetical protein SORBIDRAFT_03g006540        58.2    1e-06   Sorghum bicolor [broomcorn]
dbj|BAD61066.1|  putative proteophosphoglycan                         58.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568404.1|  PREDICTED: nascent polypeptide-associated co...  58.2    1e-06   
ref|XP_004968162.1|  PREDICTED: mucin-5AC-like isoform X1             58.2    1e-06   
ref|XP_008370081.1|  PREDICTED: flocculation protein FLO11-like       53.1    1e-06   
ref|XP_004968163.1|  PREDICTED: mucin-5AC-like isoform X2             58.2    1e-06   
ref|XP_006643736.1|  PREDICTED: flocculation protein FLO11-like       57.8    1e-06   
ref|XP_009419731.1|  PREDICTED: nascent polypeptide-associated co...  57.0    3e-06   
ref|XP_010534575.1|  PREDICTED: mucin-17-like                         56.2    5e-06   
ref|NP_001145904.1|  hypothetical protein                             56.2    6e-06   Zea mays [maize]
ref|XP_008672700.1|  PREDICTED: hypothetical protein isoform X2       56.2    6e-06   
ref|XP_008672699.1|  PREDICTED: hypothetical protein isoform X1       55.8    6e-06   
gb|ACL54464.1|  unknown                                               55.8    7e-06   Zea mays [maize]
gb|EPS71355.1|  hypothetical protein M569_03402                       55.1    1e-05   
ref|XP_006471702.1|  PREDICTED: uncharacterized protein LOC102622828  54.3    2e-05   
ref|XP_009407549.1|  PREDICTED: mucin-1 isoform X2                    53.9    3e-05   
ref|XP_010109621.1|  hypothetical protein L484_015576                 49.7    9e-05   
ref|XP_009402293.1|  PREDICTED: nascent polypeptide-associated co...  52.4    1e-04   
ref|XP_004246841.1|  PREDICTED: endochitinase A-like                  52.0    2e-04   
ref|XP_006602654.1|  PREDICTED: flocculation protein FLO11 isofor...  46.6    3e-04   
gb|KHN07485.1|  hypothetical protein glysoja_034966                   46.6    3e-04   
gb|KDO47715.1|  hypothetical protein CISIN_1g008537mg                 50.1    6e-04   
ref|XP_008388204.1|  PREDICTED: uncharacterized protein DDB_G0271...  50.1    6e-04   
ref|XP_009588557.1|  PREDICTED: uncharacterized protein DDB_G0274...  49.7    7e-04   
gb|KEH23155.1|  hypothetical protein MTR_7g068220                     46.6    8e-04   
ref|XP_003623288.1|  hypothetical protein MTR_7g068220                47.0    8e-04   
gb|KEH23156.1|  hypothetical protein MTR_7g068220                     46.6    8e-04   
ref|XP_009588559.1|  PREDICTED: uncharacterized protein DDB_G0274...  49.7    9e-04   



>ref|XP_002274030.1| PREDICTED: mucin-17 [Vitis vinifera]
 emb|CBI25498.3| unnamed protein product [Vitis vinifera]
Length=545

 Score = 60.5 bits (145),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  449  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPTR  490


 Score = 47.4 bits (111),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQ-SPARVDGR  287
            +ATSS  +SEVSVN N+L +DG ++EDDI S+R  + SPA + GR
Sbjct  501  LATSSNASSEVSVNNNALCVDGGEIEDDIGSERGGRPSPASLRGR  545



>ref|XP_004307632.1| PREDICTED: uncharacterized protein LOC101299528 [Fragaria vesca 
subsp. vesca]
Length=566

 Score = 59.7 bits (143),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  471  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPAR  512


 Score = 48.1 bits (113),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +D   VEDDI S+R  +SPA V GR
Sbjct  523  LATSSNASSEVSVNNNGLCLDVSGVEDDIGSERGGRSPAGVQGR  566



>ref|XP_009344713.1| PREDICTED: mucin-5AC-like isoform X1 [Pyrus x bretschneideri]
Length=589

 Score = 60.1 bits (144),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  495  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  536


 Score = 47.4 bits (111),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DGC++ED+  S+R  +SPA V GR
Sbjct  547  LATSSNASSEVSVNNNGLCLDGCEIEDN-GSERGGRSPASVRGR  589



>ref|XP_009344718.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=588

 Score = 60.1 bits (144),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  494  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  535


 Score = 47.4 bits (111),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DGC++ED+  S+R  +SPA V GR
Sbjct  546  LATSSNASSEVSVNNNGLCLDGCEIEDN-GSERGGRSPASVRGR  588



>ref|XP_011044062.1| PREDICTED: LOW QUALITY PROTEIN: nascent polypeptide-associated 
complex subunit alpha, muscle-specific form [Populus euphratica]
Length=560

 Score = 60.1 bits (144),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  467  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPAR  508


 Score = 47.4 bits (111),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L +DG ++EDDI S R  +SP R
Sbjct  519  LATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSPLR  558



>ref|XP_002315162.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
 gb|EEF01333.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
Length=567

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  474  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPAR  515


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVS+N N L +DG ++EDDI S+R  +SP R
Sbjct  526  LATSSNASSEVSINNNGLCLDGIELEDDIGSERGGRSPLR  565



>ref|XP_011035974.1| PREDICTED: mucin-5AC-like [Populus euphratica]
Length=567

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  474  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPAR  515


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVS+N N L +DG ++EDDI S+R  +SP R
Sbjct  526  LATSSNASSEVSINNNGLCLDGIELEDDIGSERGGRSPLR  565



>ref|XP_011016320.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=564

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  471  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPTR  512


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L +DG ++EDDI S R  +SP R
Sbjct  523  LATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSPLR  562



>ref|XP_011016321.1| PREDICTED: zonadhesin-like isoform X2 [Populus euphratica]
Length=563

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R
Sbjct  470  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPTR  511


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L +DG ++EDDI S R  +SP R
Sbjct  522  LATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSPLR  561



>ref|XP_009603323.1| PREDICTED: mucin-5B-like isoform X1 [Nicotiana tomentosiformis]
Length=574

 Score = 58.5 bits (140),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P +T  PASS  SVRSGP +
Sbjct  479  KKSLDMAIRHMDIRRSIPGNLRPLLTNIPASSMYSVRSGPNK  520


 Score = 47.8 bits (112),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N+L +DG + +DDI S + ++SPA + GR
Sbjct  531  LATSSNASSEVSVNNNALCVDGIEADDDINSDKGARSPASLQGR  574



>gb|KHG16426.1| hypothetical protein F383_23799 [Gossypium arboreum]
Length=574

 Score = 57.4 bits (137),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSG
Sbjct  479  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSG  517


 Score = 48.1 bits (113),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            R +  L + +ATSS  +SE+SVN N    DG +VEDDI S+R  +SP+RV  R
Sbjct  522  RTISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHAR  574



>ref|XP_008362728.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=595

 Score = 60.1 bits (144),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  501  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  542


 Score = 45.4 bits (106),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DGC++ED+  S+R  +SP  V GR
Sbjct  553  LATSSNASSEVSVNNNGLCLDGCEIEDN-GSERGGRSPTSVRGR  595



>ref|XP_008373857.1| PREDICTED: LOW QUALITY PROTEIN: flocculation protein FLO11-like 
[Malus domestica]
 ref|XP_008362729.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=594

 Score = 60.1 bits (144),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  500  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  541


 Score = 45.4 bits (106),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DGC++ED+  S+R  +SP  V GR
Sbjct  552  LATSSNASSEVSVNNNGLCLDGCEIEDN-GSERGGRSPTSVRGR  594



>ref|XP_010067518.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Eucalyptus 
grandis]
 gb|KCW65668.1| hypothetical protein EUGRSUZ_G03055 [Eucalyptus grandis]
Length=557

 Score = 60.5 bits (145),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  462  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPTR  503


 Score = 45.1 bits (105),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L ++G  ++DDI S RD  SP R
Sbjct  514  LATSSNASSEVSVNNNGLCVEGNGLDDDITSDRDGHSPMR  553



>ref|XP_007009023.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
 gb|EOY17833.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
Length=591

 Score = 58.2 bits (139),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P+N +P M   PASS  SVRSGP R
Sbjct  496  KKSLDMAIRHMDIRRSIPNNLRPLMMNIPASSMYSVRSGPTR  537


 Score = 47.0 bits (110),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SVN N + +DG +VEDDI S+R   SPA V  R
Sbjct  548  LATSSNASSELSVNNNGICLDGIEVEDDIGSERGGPSPASVHAR  591



>ref|XP_010095095.1| hypothetical protein L484_026404 [Morus notabilis]
 gb|EXB58201.1| hypothetical protein L484_026404 [Morus notabilis]
Length=578

 Score = 55.8 bits (133),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVR+G
Sbjct  483  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRAG  521


 Score = 49.3 bits (116),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DG ++EDDI S+R  +SP  V GR
Sbjct  535  LATSSNASSEVSVNNNGLCLDGSELEDDIGSERGGRSPPSVLGR  578



>ref|XP_008369241.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=575

 Score = 60.5 bits (145),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  481  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  522


 Score = 43.9 bits (102),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DG +VED+  S+R  +SPA V GR
Sbjct  533  LATSSNASSEVSVNNNGLCLDGSEVEDN-GSERGGRSPASVRGR  575



>ref|XP_009369152.1| PREDICTED: proteoglycan 4-like [Pyrus x bretschneideri]
Length=569

 Score = 60.5 bits (145),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  475  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  516


 Score = 43.9 bits (102),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N L +DG +VED+  S+R  +SPA V GR
Sbjct  527  LATSSNASSEVSVNNNGLCLDGSEVEDN-GSERGGRSPASVRGR  569



>ref|XP_008233740.1| PREDICTED: flocculation protein FLO11 [Prunus mume]
Length=569

 Score = 60.5 bits (145),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  475  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  516


 Score = 43.5 bits (101),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N + +DG +VED+  S+R  +SPA V GR
Sbjct  527  LATSSNASSEVSVNNNGICLDGSEVEDN-GSERGGRSPASVRGR  569



>ref|XP_007218953.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
 gb|EMJ20152.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
Length=569

 Score = 60.5 bits (145),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  475  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPAR  516


 Score = 43.5 bits (101),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N + +DG +VED+  S+R  +SPA V GR
Sbjct  527  LATSSNASSEVSVNNNGICLDGSEVEDN-GSERGGRSPASVRGR  569



>ref|XP_009776738.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=570

 Score = 60.5 bits (145),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  475  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPNR  516


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE S N N+L +DG + +DDI S + ++SP  + GR
Sbjct  527  LATSSNASSEASFNNNALCVDGIEADDDINSDKGARSPPSLHGR  570



>ref|XP_002312151.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
 gb|EEE89518.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
Length=565

 Score = 56.2 bits (134),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  472  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  510


 Score = 47.0 bits (110),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L +DG ++EDDI S R  +SP R
Sbjct  524  LATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSPLR  563



>gb|KHF99477.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
 gb|KHG03855.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
Length=584

 Score = 59.3 bits (142),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR +P N +P MT  PASS  SVRSGP R
Sbjct  489  KKSLDMAIRHMDIRRRIPGNLRPLMTNIPASSMYSVRSGPTR  530


 Score = 43.1 bits (100),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SVN N + +DG ++EDDI S+   +SPA +  R
Sbjct  541  LATSSNASSELSVNNNGICLDGSEIEDDIGSEIGGRSPASMHAR  584



>ref|XP_004239930.1| PREDICTED: uncharacterized protein DDB_G0274915 [Solanum lycopersicum]
Length=578

 Score = 58.5 bits (140),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIR+S+  N +P MT  PASS  SVRSGP R
Sbjct  483  KKSLDMAMRHMDIRQSISGNLRPSMTNIPASSMYSVRSGPNR  524


 Score = 43.5 bits (101),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N++ +DG +V+D I   + ++SPA + GR
Sbjct  535  LATSSNASSEVSVNNNTMCLDGSEVDDAISGVKGARSPAYMHGR  578



>ref|XP_009791262.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana sylvestris]
Length=579

 Score = 63.2 bits (152),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  484  KKSLDMAMRHMDIRRSIPGNLRPSMTNIPASSMYSVRSGPNR  525


 Score = 38.5 bits (88),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            + TSS  +SEVS+N N++ +DG + +D I S +  +SPA + GR
Sbjct  536  LHTSSNASSEVSINNNAVCVDGSEADDAISSDKGVRSPASMRGR  579



>ref|XP_009791269.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana sylvestris]
Length=575

 Score = 63.2 bits (152),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  480  KKSLDMAMRHMDIRRSIPGNLRPSMTNIPASSMYSVRSGPNR  521


 Score = 38.5 bits (88),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            + TSS  +SEVS+N N++ +DG + +D I S +  +SPA + GR
Sbjct  532  LHTSSNASSEVSINNNAVCVDGSEADDAISSDKGVRSPASMRGR  575



>ref|XP_003538456.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
Length=614

 Score = 56.6 bits (135),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  519  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSG  557


 Score = 44.7 bits (104),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N + +D  +V+DDI S+R  QSPA V GR
Sbjct  572  ATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASVRGR  614



>gb|KHN34732.1| hypothetical protein glysoja_039028 [Glycine soja]
Length=619

 Score = 56.6 bits (135),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  524  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSG  562


 Score = 44.7 bits (104),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N + +D  +V+DDI S+R  QSPA V GR
Sbjct  577  ATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASVRGR  619



>ref|XP_003552436.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
 gb|KHN36386.1| hypothetical protein glysoja_041416 [Glycine soja]
Length=601

 Score = 56.6 bits (135),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  506  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSG  544


 Score = 44.7 bits (104),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N + +D  +V+DDI S+R  QSPA V GR
Sbjct  559  ATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASVRGR  601



>ref|XP_007163529.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
 gb|ESW35523.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
Length=595

 Score = 56.6 bits (135),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  500  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSG  538


 Score = 44.7 bits (104),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N + +D  +V+DDI S+R  QSPA V GR
Sbjct  553  ATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASVRGR  595



>ref|XP_004500676.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=613

 Score = 57.4 bits (137),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG +R
Sbjct  518  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGSQR  559


 Score = 43.5 bits (101),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N + +D  +++D+I S+R  QSPA V GR
Sbjct  571  ATSSNASSEMSVNQNGICLDSSEIDDEIGSERYGQSPASVRGR  613



>ref|XP_006355666.1| PREDICTED: mucin-5AC-like [Solanum tuberosum]
Length=578

 Score = 60.1 bits (144),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIRRS+  N +P MT  PASS  SVRSGP R
Sbjct  483  KKSLDMAMRHMDIRRSISGNLRPSMTNIPASSMYSVRSGPNR  524


 Score = 40.8 bits (94),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N++ +DG +V+D I   +  +SPA + GR
Sbjct  535  LATSSNASSEVSVNNNTVCLDGSEVDDAISGVKGVRSPAYMHGR  578



>ref|XP_009605096.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana tomentosiformis]
Length=579

 Score = 60.1 bits (144),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIRRS+P   +P MT  PASS  SVRSGP R
Sbjct  484  KKSLDMAMRHMDIRRSIPGILRPSMTNIPASSMYSVRSGPNR  525


 Score = 40.0 bits (92),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            + TSS  +SEVS+N N++ +DG +V+D I S +  +SPA + GR
Sbjct  536  LHTSSNASSEVSINNNAVCVDGSEVDDAISSDKGVRSPAGMRGR  579



>ref|XP_009605097.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana tomentosiformis]
Length=575

 Score = 60.1 bits (144),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMAMRHMDIRRS+P   +P MT  PASS  SVRSGP R
Sbjct  480  KKSLDMAMRHMDIRRSIPGILRPSMTNIPASSMYSVRSGPNR  521


 Score = 39.7 bits (91),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            + TSS  +SEVS+N N++ +DG +V+D I S +  +SPA + GR
Sbjct  532  LHTSSNASSEVSINNNAVCVDGSEVDDAISSDKGVRSPAGMRGR  575



>ref|XP_010535052.1| PREDICTED: mucin-17 [Tarenaya hassleriana]
Length=581

 Score = 57.8 bits (138),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSG
Sbjct  484  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSG  522


 Score = 42.0 bits (97),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SVN N L ++  + EDD+ S+R  +SPA + GR
Sbjct  538  LATSSNASSEISVNNNGLCLEVSEREDDVASERGCRSPASLQGR  581



>ref|XP_006575536.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=681

 Score = 56.2 bits (134),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR  P N +P  MTK PASS  SVRSGP+R
Sbjct  585  KKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQR  627


 Score = 43.1 bits (100),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            A+ S  +SEVSVN+N L ID  +++DDI+S R  QS A V GR
Sbjct  639  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQGR  681



>ref|XP_006575535.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=692

 Score = 56.2 bits (134),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR  P N +P  MTK PASS  SVRSGP+R
Sbjct  596  KKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQR  638


 Score = 43.1 bits (100),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            A+ S  +SEVSVN+N L ID  +++DDI+S R  QS A V GR
Sbjct  650  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQGR  692



>gb|KHN48560.1| hypothetical protein glysoja_034183 [Glycine soja]
Length=635

 Score = 56.2 bits (134),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR  P N +P  MTK PASS  SVRSGP+R
Sbjct  539  KKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQR  581


 Score = 43.1 bits (100),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            A+ S  +SEVSVN+N L ID  +++DDI+S R  QS A V GR
Sbjct  593  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQGR  635



>gb|KEH28283.1| ATP-binding protein, putative [Medicago truncatula]
Length=616

 Score = 57.4 bits (137),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIR+SVP N +P MT  PASS  SVRSG +R
Sbjct  513  KKSLDMALRHMDIRKSVPGNLRPLMTNIPASSMYSVRSGHQR  554


 Score = 41.6 bits (96),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVE-DDIISKRDSQSPARVDGR  287
            ATSS   SEVSVN+N L+ D  +++  D++S R  QSPA V GR
Sbjct  566  ATSSNAGSEVSVNQNGLYSDNSEIDYYDMVSDRGGQSPASVRGR  609



>gb|KEH34783.1| ATP-binding protein, putative [Medicago truncatula]
Length=628

 Score = 56.2 bits (134),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG  R
Sbjct  533  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGSHR  574


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SE+SVN+N L +D  +++D++ S+R  QSPA V GR
Sbjct  586  ATSSNASSEMSVNQNGLCLDSSEIDDEVGSERCVQSPASVRGR  628



>gb|KEH28284.1| ATP-binding protein, putative [Medicago truncatula]
Length=601

 Score = 57.4 bits (137),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIR+SVP N +P MT  PASS  SVRSG +R
Sbjct  502  KKSLDMALRHMDIRKSVPGNLRPLMTNIPASSMYSVRSGHQR  543


 Score = 41.6 bits (96),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVE-DDIISKRDSQSPARVDGR  287
            ATSS   SEVSVN+N L+ D  +++  D++S R  QSPA V GR
Sbjct  555  ATSSNAGSEVSVNQNGLYSDNSEIDYYDMVSDRGGQSPASVRGR  598



>ref|XP_002526897.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35528.1| ATP binding protein, putative [Ricinus communis]
Length=568

 Score = 57.4 bits (137),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSG
Sbjct  478  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSG  516


 Score = 41.6 bits (96),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SEVSVN N L +D  ++EDDI S+R  +SP
Sbjct  530  LATSSNGSSEVSVNNNGLCLDAIELEDDIGSERGGRSP  567



>ref|XP_006595866.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=678

 Score = 53.1 bits (126),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR-KEGSVS  145
            KKSLDMA+RHMDIRR  P + +P  MTK PASS  SVRSG +R + GS+S
Sbjct  582  KKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSIS  631


 Score = 45.1 bits (105),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SEVSVN+N L +D  +++DDI+S R  QS A V GR
Sbjct  636  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVRGR  678



>gb|KHN20852.1| hypothetical protein glysoja_009160 [Glycine soja]
Length=668

 Score = 53.1 bits (126),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR-KEGSVS  145
            KKSLDMA+RHMDIRR  P + +P  MTK PASS  SVRSG +R + GS+S
Sbjct  572  KKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSIS  621


 Score = 45.1 bits (105),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SEVSVN+N L +D  +++DDI+S R  QS A V GR
Sbjct  626  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVRGR  668



>ref|XP_006595867.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=668

 Score = 53.1 bits (126),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR-KEGSVS  145
            KKSLDMA+RHMDIRR  P + +P  MTK PASS  SVRSG +R + GS+S
Sbjct  572  KKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSIS  621


 Score = 45.1 bits (105),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SEVSVN+N L +D  +++DDI+S R  QS A V GR
Sbjct  626  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVRGR  668



>ref|XP_008441457.1| PREDICTED: zonadhesin isoform X2 [Cucumis melo]
Length=514

 Score = 60.8 bits (146),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  419  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSR  460


 Score = 37.4 bits (85),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SE+SVN N L +D  +++D+I S+R  +SP
Sbjct  471  LATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  508



>ref|XP_004235247.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Solanum 
lycopersicum]
Length=584

 Score = 53.1 bits (126),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHMDIR+ V  N +P MT  PASS  SVRSGP
Sbjct  485  KKSLDMAIRHMDIRQRVSGNLRPLMTNIPASSMYSVRSGP  524


 Score = 44.7 bits (104),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  114  QGLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +G   R +    + +ATSS  +SEVSV+ N + IDG ++++DI S + ++SPA V GR
Sbjct  527  RGRTSRSISVPDSPLATSSNASSEVSVSNNVVCIDGSEIDEDISSDKGARSPASVRGR  584



>ref|XP_008441454.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441455.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441456.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
Length=577

 Score = 60.5 bits (145),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  482  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSR  523


 Score = 37.4 bits (85),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SE+SVN N L +D  +++D+I S+R  +SP
Sbjct  534  LATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  571



>ref|XP_006595868.1| PREDICTED: flocculation protein FLO11-like isoform X3 [Glycine 
max]
Length=544

 Score = 52.8 bits (125),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR-KEGSVS  145
            KKSLDMA+RHMDIRR  P + +P  MTK PASS  SVRSG +R + GS+S
Sbjct  448  KKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSIS  497


 Score = 45.1 bits (105),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SEVSVN+N L +D  +++DDI+S R  QS A V GR
Sbjct  502  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVRGR  544



>ref|XP_010262831.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X2 [Nelumbo nucifera]
Length=535

 Score = 58.9 bits (141),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P + +P MT  PASS  SVRSGP R
Sbjct  441  KKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPAR  482


 Score = 38.5 bits (88),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQV-EDDIISKRDSQSPARVDGR  287
            R V    + +ATSS  +SE SVN N+L +DG  + +DD+ S+R   SPA   GR
Sbjct  482  RAVSVSDSPLATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPASQRGR  535



>ref|XP_010262830.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X1 [Nelumbo nucifera]
Length=546

 Score = 58.9 bits (141),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P + +P MT  PASS  SVRSGP R
Sbjct  452  KKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPAR  493


 Score = 38.5 bits (88),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQV-EDDIISKRDSQSPARVDGR  287
            +ATSS  +SE SVN N+L +DG  + +DD+ S+R   SPA   GR
Sbjct  502  LATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPASQRGR  546



>ref|XP_010262832.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X3 [Nelumbo nucifera]
Length=518

 Score = 58.5 bits (140),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P + +P MT  PASS  SVRSGP R
Sbjct  424  KKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPAR  465


 Score = 38.5 bits (88),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQV-EDDIISKRDSQSPARVDGR  287
            R V    + +ATSS  +SE SVN N+L +DG  + +DD+ S+R   SPA   GR
Sbjct  465  RAVSVSDSPLATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPASQRGR  518



>ref|XP_008795443.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=529

 Score = 58.9 bits (141),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P++ +P MTK PASS  S+RSGP R
Sbjct  441  KKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSMRSGPTR  482


 Score = 37.7 bits (86),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKR  254
            R V    + +ATSS  +SE SVN N++ +DG ++EDD+ S++
Sbjct  484  RPVSVSDSPLATSSNASSEQSVNNNTICVDGSELEDDLSSEK  525



>gb|KGN45784.1| hypothetical protein Csa_6G011590 [Cucumis sativus]
Length=576

 Score = 60.5 bits (145),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  481  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSR  522


 Score = 36.2 bits (82),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SE+SVN N L +D  +++D+I S+R  +SP
Sbjct  533  LATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  570



>ref|XP_004138425.1| PREDICTED: uncharacterized protein LOC101204600 [Cucumis sativus]
Length=575

 Score = 60.5 bits (145),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  480  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSR  521


 Score = 36.2 bits (82),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SE+SVN N L +D  +++D+I S+R  +SP
Sbjct  532  LATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  569



>ref|XP_002323572.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
 gb|EEF05333.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
Length=519

 Score = 55.5 bits (132),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVS  145
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSG   K  +VS
Sbjct  422  KKSLDMALRHMDIRRSISGNLRPLMTNIPASSMYSVRSGGSSKGRTVS  469


 Score = 40.8 bits (94),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSPARVDGR  287
            R V  L + +ATSS  +SE SVN NS   DG ++ED +  S+R + SP+   GR
Sbjct  466  RTVSVLDSPLATSSNASSEPSVNNNSYFADGIEIEDNEFGSERGNSSPSSHHGR  519



>ref|XP_004170203.1| PREDICTED: uncharacterized protein LOC101230836, partial [Cucumis 
sativus]
Length=435

 Score = 60.1 bits (144),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGP R
Sbjct  340  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSR  381


 Score = 35.8 bits (81),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSP  269
            +ATSS  +SE+SVN N L +D  +++D+I S+R  +SP
Sbjct  392  LATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  429



>gb|KDP44785.1| hypothetical protein JCGZ_01285 [Jatropha curcas]
Length=547

 Score = 57.4 bits (137),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSG  R
Sbjct  455  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGSAR  496


 Score = 38.1 bits (87),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPAR  275
            +ATSS  +SEVSVN N L +DG ++E ++ S+R  +SP R
Sbjct  507  LATSSNASSEVSVNNNGLCLDGIELE-EVGSERGGRSPLR  545



>emb|CDP14035.1| unnamed protein product [Coffea canephora]
Length=576

 Score = 56.6 bits (135),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  481  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  519


 Score = 38.9 bits (89),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSVN N+L  D  ++EDD+ S +  +SPA +  R
Sbjct  533  LATSSNASSEVSVNNNALCADAGEIEDDVNSDKVVRSPASMRAR  576



>ref|XP_010910088.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010910089.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=529

 Score = 58.9 bits (141),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P++ +P MTK PASS  S+RSGP R
Sbjct  441  KKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSMRSGPAR  482


 Score = 36.6 bits (83),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKR  254
            R V    + +ATSS  +SE SVN N + +DG ++EDD+ S++
Sbjct  484  RPVSVSDSPLATSSNASSEQSVNNNMICLDGSELEDDLSSEK  525



>ref|XP_007141776.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
 gb|ESW13770.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
Length=627

 Score = 51.2 bits (121),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPP-MTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRR VP N +   MT  PASS  SVRSGP R
Sbjct  531  KKSLDMAIRHMDIRRRVPGNLRSSLMTNIPASSMYSVRSGPPR  573


 Score = 43.1 bits (100),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            ATSS  +SEVSVN N + +   +++DDI S+R  QSPA V GR
Sbjct  585  ATSSNASSEVSVNPNGVCLYNSEIDDDIGSERSGQSPASVRGR  627



>ref|XP_009782013.1| PREDICTED: cell wall protein RBR3-like [Nicotiana sylvestris]
Length=570

 Score = 48.5 bits (114),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSV  109
            KKSLDMA+RHMDIR+ +P N +P MT  PASS  SV
Sbjct  472  KKSLDMAIRHMDIRQRIPGNLRPLMTNIPASSMYSV  507


 Score = 45.8 bits (107),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSV+ N+++ DG +++DDI S +  +SPA V GR
Sbjct  527  LATSSNASSEVSVSNNAVYFDGSEIDDDISSDKGVRSPASVHGR  570



>ref|XP_004490980.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=586

 Score = 53.1 bits (126),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIR+  P N +P MT  PASS  SVRSG +R
Sbjct  485  KKSLDMAIRHMDIRKRAPGNLRPLMTNIPASSMYSVRSGYQR  526


 Score = 40.8 bits (94),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGC-QVEDDIISKRDSQSPARVDGR  287
            ATSS   SEVSVN+N L+ D   +++ D++S R  QSPA V GR
Sbjct  538  ATSSNAGSEVSVNQNGLYSDYIEEIDYDMVSDRGVQSPANVQGR  581



>ref|XP_009412573.1| PREDICTED: endochitinase A-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=569

 Score = 55.1 bits (131),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRSVP++ +P M   PASS  SVRSG  R
Sbjct  473  KKSLDMALRHMDIRRSVPNSLRPLMANIPASSVYSVRSGATR  514


 Score = 38.9 bits (89),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVD  281
            +ATSS  +SE SVN N L +DG ++ED+I S +  + P  V 
Sbjct  525  LATSSTVSSEQSVNNNMLGLDGSEIEDEITSDKRGRCPPAVP  566



>ref|XP_009600813.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
 ref|XP_009600821.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
Length=571

 Score = 48.5 bits (114),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSV  109
            KKSLDMA+RHMDIR+ +P N +P MT  PASS  SV
Sbjct  473  KKSLDMAIRHMDIRQRIPGNLRPLMTNIPASSMYSV  508


 Score = 45.1 bits (105),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SEVSV+ N+++ DG +++DD+ S +  +SPA V GR
Sbjct  528  LATSSNASSEVSVSNNAVYFDGSEIDDDVSSDKGVRSPASVHGR  571



>ref|XP_010508921.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Camelina 
sativa]
 ref|XP_010508922.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Camelina 
sativa]
Length=607

 Score = 55.8 bits (133),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  510  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  548


 Score = 37.4 bits (85),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + +D  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLDASEKEDDAGSERGCRSPASLQGR  607



>ref|XP_009412575.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=522

 Score = 54.3 bits (129),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRSVP++ +P M   PASS  SVRSG
Sbjct  426  KKSLDMALRHMDIRRSVPNSLRPLMANIPASSVYSVRSG  464


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARV  278
            +ATSS  +SE SVN N L +DG ++ED+I S +  + P  V
Sbjct  478  LATSSTVSSEQSVNNNMLGLDGSEIEDEITSDKRGRCPPAV  518



>ref|XP_006367372.1| PREDICTED: uncharacterized protein LOC102588142 [Solanum tuberosum]
Length=175

 Score = 57.8 bits (138),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHMDIR+ VP N +P MT  PASS  SVRSGP
Sbjct  76   KKSLDMAIRHMDIRQRVPGNLRPLMTNIPASSMYSVRSGP  115


 Score = 34.7 bits (78),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  114  QGLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +G   R +    + +ATSS  +SEVSV+ N + +DG ++++DI S + ++SPA V GR
Sbjct  118  RGRTSRSINMPDSPLATSSNASSEVSVSNNVVWVDGSEIDEDISSDKGARSPASVHGR  175



>emb|CBI30400.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 57.8 bits (138),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSGP +
Sbjct  36   KKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGPTK  77


 Score = 33.9 bits (76),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDD-IISKRDSQSPARVDG  284
            +ATSS T+SE SVN+NS    G ++EDD + S R   SPA   G
Sbjct  88   LATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQG  131



>gb|KFK36895.1| hypothetical protein AALP_AA4G186400 [Arabis alpina]
Length=607

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  511  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  549


 Score = 35.8 bits (81),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCKSPASLQGR  607



>ref|XP_006293855.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
 gb|EOA26753.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
Length=607

 Score = 56.2 bits (134),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  510  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  548


 Score = 35.4 bits (80),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  607



>ref|NP_181536.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ23924.1| At2g40070 [Arabidopsis thaliana]
 dbj|BAE98974.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|AEC09771.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=607

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  510  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  548


 Score = 35.4 bits (80),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  607



>ref|XP_010505709.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  510  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  548


 Score = 35.4 bits (80),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  607



>ref|XP_010517399.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  510  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  548


 Score = 35.4 bits (80),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  563  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  607



>dbj|BAH57264.1| AT2G40070 [Arabidopsis thaliana]
Length=575

 Score = 55.8 bits (133),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  478  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  516


 Score = 35.4 bits (80),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  531  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  575



>ref|NP_001078028.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09772.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=567

 Score = 55.5 bits (132),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  470  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  508


 Score = 35.4 bits (80),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SPA + GR
Sbjct  523  LATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQGR  567



>ref|XP_011047445.1| PREDICTED: mucin-2-like [Populus euphratica]
Length=563

 Score = 55.5 bits (132),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVS  145
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSG   K  +VS
Sbjct  466  KKSLDMALRHMDIRRSISGNLRPLMTNIPASSMYSVRSGGSSKGRTVS  513


 Score = 34.7 bits (78),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSPA  272
            +ATSS  +SE SVN NS   DG ++ED +  S R + SP+
Sbjct  519  LATSSNASSEPSVNNNSYFADGIEIEDNEFGSDRGNSSPS  558



>ref|XP_004302638.1| PREDICTED: uncharacterized protein LOC101310429 [Fragaria vesca 
subsp. vesca]
Length=530

 Score = 56.6 bits (135),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVSNYTNCNKQP  172
            KKS DMAMRHMDIRRSV  N QP +TK PASS  SVR+ P +     S  TN    P
Sbjct  434  KKSFDMAMRHMDIRRSVQDNLQPVLTKVPASSVYSVRTRPTK-----SKTTNATDSP  485


 Score = 33.5 bits (75),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSPARVDGR  287
            +AT S  +SE SVN  S + + C++ED D  S++ + SPA  +GR
Sbjct  486  LATCSNASSEPSVNNVSAYFEACEIEDVDHGSEKGNSSPAFQEGR  530



>ref|XP_008785362.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
 ref|XP_008785363.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=542

 Score = 61.6 bits (148),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKE  133
            KKSLDMA+RHMDIRRS+P++ +P MTK PASS  SVRSGP R +
Sbjct  443  KKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSVRSGPSRSK  486


 Score = 28.5 bits (62),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQS  266
            +ATSS  +SE SV+ + + ++G ++EDD+ S++  +S
Sbjct  495  LATSSNASSEQSVDNHMICLNGGELEDDLRSEKGGRS  531



>gb|KDO69021.1| hypothetical protein CISIN_1g026936mg [Citrus sinensis]
Length=230

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGPR +  SVS+
Sbjct  136  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPRSRTVSVSD  184


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  117  GLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            G   R V    + +ATSS  +SE+SVN N L +DGC +EDDI S+R  +SPA V GR
Sbjct  174  GPRSRTVSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASVRGR  230



>ref|XP_010654168.1| PREDICTED: zonadhesin-like isoform X1 [Vitis vinifera]
Length=548

 Score = 56.2 bits (134),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSGP
Sbjct  452  KKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGP  491


 Score = 33.5 bits (75),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDII-SKRDSQSPARVDG  284
            +ATSS T+SE SVN+NS    G ++EDD + S R   SPA   G
Sbjct  504  LATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQG  547



>emb|CDY07628.1| BnaA03g18830D [Brassica napus]
Length=609

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  513  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  551


 Score = 33.9 bits (76),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SP+ + GR
Sbjct  565  LATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQGR  609



>ref|XP_009133405.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Brassica 
rapa]
Length=609

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  513  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  551


 Score = 33.9 bits (76),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SP+ + GR
Sbjct  565  LATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQGR  609



>ref|XP_010654169.1| PREDICTED: mucin-12-like isoform X2 [Vitis vinifera]
Length=544

 Score = 56.2 bits (134),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSGP
Sbjct  448  KKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGP  487


 Score = 33.5 bits (75),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDII-SKRDSQSPARVDG  284
            +ATSS T+SE SVN+NS    G ++EDD + S R   SPA   G
Sbjct  500  LATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQG  543



>emb|CDY60338.1| BnaC03g72310D [Brassica napus]
Length=610

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  514  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  552


 Score = 33.5 bits (75),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N + ++  + EDD  S+R  +SP+ + GR
Sbjct  566  LATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQGR  610



>emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera]
Length=569

 Score = 56.6 bits (135),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+  N +P MT  PASS  SVRSGP +
Sbjct  429  KKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGPTK  470


 Score = 32.7 bits (73),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDD-IISKRDSQSPA  272
            +ATSS T+SE SVN+NS    G ++EDD + S R   SPA
Sbjct  481  LATSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPA  520



>ref|XP_006411252.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
 gb|ESQ52705.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
Length=603

 Score = 55.8 bits (133),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  507  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  545


 Score = 33.5 bits (75),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +ATSS  +SE+SV N N   ++  + EDD  S+R  +SPA + GR
Sbjct  559  LATSSNASSEISVYNNNGNCLEASEKEDDAGSERGCRSPASLQGR  603



>ref|XP_010256565.1| PREDICTED: mucin-5AC-like [Nelumbo nucifera]
Length=569

 Score = 58.9 bits (141),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P + +P MT  PASS  SVRSGP R
Sbjct  470  KKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPAR  511


 Score = 30.0 bits (66),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 6/49 (12%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQV-EDDIISKRDSQ----SPARVDGR  287
            +ATSS  +SE SVN N+L +DG  + +DD+ S+R  +    SPA   GR
Sbjct  522  LATSSNASSE-SVNNNALCLDGSDIGDDDLGSERGERGGRSSPASQHGR  569



>ref|XP_006848188.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
 gb|ERN09769.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
Length=631

 Score = 55.1 bits (131),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+PS  +P +T  PASS  SVRSG
Sbjct  509  KKSLDMALRHMDIRRSIPSGLRPLITNIPASSMYSVRSG  547


 Score = 32.7 bits (73),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 2/50 (4%)
 Frame = +3

Query  129  RKVVYLTTRIATSSRTNSEVSVNKNS-LHIDGCQVEDDIISKRDS-QSPA  272
            R V    + +ATSS  +SE SVN N+ L IDG ++E+D  S+R S  SPA
Sbjct  552  RPVSVSDSPLATSSNASSEQSVNNNNILCIDGNEMEEDSRSERGSLSSPA  601



>ref|XP_006435713.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486332.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Citrus 
sinensis]
 gb|ESR48953.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=609

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGPR +  SVS+
Sbjct  515  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPRSRTVSVSD  563


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  117  GLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            G   R V    + +ATSS  +SE+SVN N L +DGC +EDDI S+R  +SPA V GR
Sbjct  553  GPRSRTVSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASVRGR  609



>ref|XP_006435712.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486333.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Citrus 
sinensis]
 gb|ESR48952.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=600

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSGPR +  SVS+
Sbjct  506  KKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPRSRTVSVSD  554


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  117  GLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            G   R V    + +ATSS  +SE+SVN N L +DGC +EDDI S+R  +SPA V GR
Sbjct  544  GPRSRTVSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASVRGR  600



>gb|KHG09845.1| Maturase K [Gossypium arboreum]
Length=568

 Score = 47.8 bits (112),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMAMRHMDIRRS+  +    MT  PASS  SVRSG
Sbjct  474  KKSLDMAMRHMDIRRSISGHKL--MTNVPASSIYSVRSG  510


 Score = 37.7 bits (86),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSP  269
            +ATSS  +SE SVN NS  +DG ++ED DI S+R   SP
Sbjct  524  LATSSTASSEPSVNNNSFFMDGSEMEDNDISSERGISSP  562



>ref|XP_008243876.1| PREDICTED: flocculation protein FLO11-like [Prunus mume]
Length=543

 Score = 52.0 bits (123),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKS DMAMRHMDIRRSV  N +P +T  PASS  SVR+ P
Sbjct  447  KKSFDMAMRHMDIRRSVTGNLRPVLTNVPASSVYSVRTRP  486


 Score = 33.1 bits (74),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSPARVDGR  287
            +AT S  +SE SVN   + ++GC++ED D+ S+  + SPA   GR
Sbjct  499  LATCSNASSEPSVNNIPVTLEGCEIEDVDLGSEGGNSSPASHQGR  543



>gb|EYU20023.1| hypothetical protein MIMGU_mgv1a003450mg [Erythranthe guttata]
Length=584

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRRKEGSVSN  148
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSGP R+  SVS+
Sbjct  490  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPPRRTVSVSD  538



>ref|XP_006429352.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 ref|XP_006429353.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42592.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42593.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
Length=562

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNT-QPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+ S + +P MT  PASS  SVRSG
Sbjct  463  KKSLDMALRHMDIRRSINSGSLRPLMTNIPASSMYSVRSG  502


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 2/52 (4%)
 Frame = +3

Query  120  LEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVED--DIISKRDSQSP  269
            ++ R V    + +ATSS  +SE SVN NS  +DG +++D  D  S+R + SP
Sbjct  504  IKSRTVSVTDSPLATSSNASSEPSVNNNSFILDGNELDDIHDFGSERGNSSP  555



>ref|XP_002528111.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34290.1| conserved hypothetical protein [Ricinus communis]
Length=513

 Score = 51.2 bits (121),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+  N + P+T  PASS  SVRSG
Sbjct  417  KKSLDMALRHMDIRRSISGNLR-PLTSIPASSVYSVRSG  454


 Score = 33.5 bits (75),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +3

Query  144  LTTRIATSSRTNSEVSVNKNSLHIDGCQVE-DDIISKRDSQSPARVDGR  287
            L + +ATSS  +SE SVN NSL  DG ++E +D  S+  + SP    G+
Sbjct  465  LDSPLATSSNASSEPSVNNNSLFADGIEMEVNDFGSENGNCSPTSHSGK  513



>ref|XP_009377788.1| PREDICTED: mucin-2-like [Pyrus x bretschneideri]
Length=549

 Score = 53.1 bits (126),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKS+DMAMRHMDIRRS+P N +P +T  PASS  SVR  P
Sbjct  455  KKSIDMAMRHMDIRRSMPGNLRPVLTNVPASSGYSVRIKP  494


 Score = 31.2 bits (69),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQS  266
            +AT S  +SE SVN   L ++GC++ED D+ S+R + S
Sbjct  507  LATCSNASSEPSVNNIPLSLEGCEIEDIDLGSERGNSS  544



>ref|XP_010689824.1| PREDICTED: cell wall protein RBR3 [Beta vulgaris subsp. vulgaris]
Length=612

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHMDIRRS+P N +P MTK PASS  SVRSGP
Sbjct  520  KKSLDMAIRHMDIRRSIPGNLRPLMTKIPASSMYSVRSGP  559



>ref|XP_010923060.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923061.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923062.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=542

 Score = 48.5 bits (114),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMA+RHMDIRRS+P++ +P M+K PASS
Sbjct  443  KKSLDMALRHMDIRRSIPNSLRPLMSKVPASS  474


 Score = 34.7 bits (78),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQS  266
            +ATSS  +SE SVN N + ++G ++EDD+ S++  +S
Sbjct  495  LATSSNASSEQSVNNNMICLNGSELEDDLSSEKGGRS  531



>emb|CDY20509.1| BnaC04g05350D [Brassica napus]
Length=601

 Score = 55.8 bits (133),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  503  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  541


 Score = 26.6 bits (57),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGC-QVEDDIISKRDSQS-PARVDGR  287
            +ATSS  +SE+SV N N + ++   + EDD  S+R  +S PA + GR
Sbjct  555  LATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPASLQGR  601



>emb|CDX74811.1| BnaA05g05570D [Brassica napus]
Length=588

 Score = 55.8 bits (133),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  490  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  528


 Score = 26.6 bits (57),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGC-QVEDDIISKRDSQS-PARVDGR  287
            +ATSS  +SE+SV N N + ++   + EDD  S+R  +S PA + GR
Sbjct  542  LATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPASLQGR  588



>ref|XP_009143258.1| PREDICTED: endochitinase A-like [Brassica rapa]
Length=604

 Score = 55.8 bits (133),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  506  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  544


 Score = 26.6 bits (57),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +3

Query  156  IATSSRTNSEVSV-NKNSLHIDGC-QVEDDIISKRDSQS-PARVDGR  287
            +ATSS  +SE+SV N N + ++   + EDD  S+R  +S PA + GR
Sbjct  558  LATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPASLQGR  604



>ref|XP_006356484.1| PREDICTED: flocculation protein FLO11-like [Solanum tuberosum]
Length=498

 Score = 47.8 bits (112),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   LDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            +DMA+RHMDIR+ V  N +P MT  PASS  SVRSGP
Sbjct  402  VDMAIRHMDIRQRVSGNLRPLMTNIPASSMYSVRSGP  438


 Score = 34.3 bits (77),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  114  QGLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVEDDIISKRDSQSPARVDGR  287
            +G   R +    + +ATSS  +SEVSV+ N + +DG ++++DI S + ++SPA V GR
Sbjct  441  RGRTSRSINMPDSPLATSSNASSEVSVSNNVVWVDGSEIDEDISSDKGARSPASVRGR  498



>ref|XP_007208455.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
 gb|EMJ09654.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
Length=543

 Score = 50.1 bits (118),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKS DMAMRHMDIRRS+  N +P +T  PASS  SVR+ P
Sbjct  447  KKSFDMAMRHMDIRRSMTGNLRPVLTNVPASSVYSVRTRP  486


 Score = 31.2 bits (69),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVED-DIISKRDSQSPARVDGR  287
            +AT S  +SE SV+   + ++GC++ED D+ S+  + SPA   GR
Sbjct  499  LATCSNASSEPSVSNIPVSLEGCEIEDVDLGSEGGNSSPASHQGR  543



>dbj|BAN18468.1| proteophosphoglycan, partial [Schiedea kealiae]
 dbj|BAN18469.1| proteophosphoglycan, partial [Schiedea spergulina]
 dbj|BAN18470.1| proteophosphoglycan, partial [Schiedea mannii]
 dbj|BAN18472.1| proteophosphoglycan, partial [Schiedea menziesii]
 dbj|BAN18473.1| proteophosphoglycan, partial [Schiedea hookeri]
 dbj|BAN18474.1| proteophosphoglycan, partial [Schiedea sarmentosa]
 dbj|BAN18475.1| proteophosphoglycan, partial [Schiedea lydgatei]
 dbj|BAN18476.1| proteophosphoglycan, partial [Schiedea ligustrina]
 dbj|BAN18477.1| proteophosphoglycan, partial [Schiedea salicaria]
 dbj|BAN18478.1| proteophosphoglycan, partial [Schiedea globosa]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHM IR+S+P N +P MTK PASS  SVRSGP
Sbjct  116  KKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGP  155



>dbj|BAN18479.1| proteophosphoglycan, partial [Schiedea laui]
 dbj|BAN18480.1| proteophosphoglycan, partial [Schiedea pentandra]
 dbj|BAN18481.1| proteophosphoglycan, partial [Schiedea kauaiensis]
 dbj|BAN18482.1| proteophosphoglycan, partial [Schiedea perlmanii]
 dbj|BAN18483.1| proteophosphoglycan, partial [Schiedea stellarioides]
 dbj|BAN18484.1| proteophosphoglycan, partial [Schiedea nuttallii]
 dbj|BAN18485.1| proteophosphoglycan, partial [Schiedea helleri]
 dbj|BAN18486.1| proteophosphoglycan, partial [Schiedea membranacea]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHM IR+S+P N +P MTK PASS  SVRSGP
Sbjct  116  KKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGP  155



>dbj|BAN18471.1| proteophosphoglycan, partial [Schiedea adamantis]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHM IR+S+P N +P MTK PASS  SVRSGP
Sbjct  116  KKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGP  155



>dbj|BAN18489.1| proteophosphoglycan, partial [Schiedea verticillata]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHM IR+S+P N +P MTK PASS  SVRSGP
Sbjct  116  KKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGP  155



>dbj|BAN18487.1| proteophosphoglycan, partial [Schiedea trinervis]
 dbj|BAN18488.1| proteophosphoglycan, partial [Schiedea obovata]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKSLDMA+RHM IR+S+P N +P MTK PASS  SVRSGP
Sbjct  116  KKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGP  155



>ref|XP_008655627.1| PREDICTED: uncharacterized protein LOC103634815 [Zea mays]
Length=258

 Score = 54.7 bits (130),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RS   R
Sbjct  168  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSASTR  209


 Score = 26.2 bits (56),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDDIISKR  254
            +ATS   +SE SVN N + +D   ++D++ S R
Sbjct  220  LATSRNASSEPSVNNNLMCLDSIDIDDELCSDR  252



>ref|XP_011076684.1| PREDICTED: cell wall protein RBR3 isoform X2 [Sesamum indicum]
Length=569

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRS-GPRRKEGSVSN  148
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRS GP R+  SVS+
Sbjct  474  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGGPTRRTVSVSD  523



>ref|XP_007026736.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
 gb|EOY07238.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
Length=556

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P N +P MT  PASS  SVRSG
Sbjct  460  KKSLDMALRHMDIRRSIPGNQRPLMTNVPASSIYSVRSG  498



>ref|XP_011076682.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
 ref|XP_011076683.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
Length=573

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRS-GPRRKEGSVSN  148
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRS GP R+  SVS+
Sbjct  474  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGGPTRRTVSVSD  523



>gb|KDP24464.1| hypothetical protein JCGZ_25028 [Jatropha curcas]
Length=512

 Score = 51.6 bits (122),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+  N + P+T  PASS  SVRSG
Sbjct  427  KKSLDMALRHMDIRRSISGNLR-PLTSIPASSVYSVRSG  464


 Score = 28.9 bits (63),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVED  236
            ATSS  +SE SVN +S  ID  ++ED
Sbjct  480  ATSSNASSEPSVNNSSFSIDAIEMED  505



>gb|EEC69917.1| hypothetical protein OsI_00338 [Oryza sativa Indica Group]
Length=600

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  510  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  548



>ref|NP_001041987.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAF03901.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAG92172.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  516  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  554



>ref|XP_002457389.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
 gb|EES02509.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
Length=600

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  510  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  548



>dbj|BAD61066.1| putative proteophosphoglycan [Oryza sativa Japonica Group]
 gb|EEE53843.1| hypothetical protein OsJ_00320 [Oryza sativa Japonica Group]
Length=601

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  511  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  549



>ref|XP_003568404.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form [Brachypodium distachyon]
Length=605

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  515  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  553



>ref|XP_004968162.1| PREDICTED: mucin-5AC-like isoform X1 [Setaria italica]
Length=591

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  501  KKSLDMALRHMDIRRSIPNNLRPLMTTIPASSVHSARSG  539



>ref|XP_008370081.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=552

 Score = 53.1 bits (126),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGP  121
            KKS+DMAMRHMDIRRS+P N +P +T  PASS  SVR  P
Sbjct  458  KKSIDMAMRHMDIRRSMPGNLRPVLTNVPASSGYSVRIKP  497


 Score = 26.6 bits (57),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVE  233
            +AT S  +SE SVN   L ++GC++E
Sbjct  510  LATCSNASSEPSVNNIPLSLEGCEIE  535



>ref|XP_004968163.1| PREDICTED: mucin-5AC-like isoform X2 [Setaria italica]
Length=568

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  478  KKSLDMALRHMDIRRSIPNNLRPLMTTIPASSVHSARSG  516



>ref|XP_006643736.1| PREDICTED: flocculation protein FLO11-like [Oryza brachyantha]
Length=513

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  PASS +S RSG
Sbjct  423  KKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSG  461



>ref|XP_009419731.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form [Musa acuminata subsp. malaccensis]
Length=519

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 44/81 (54%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR------------------  127
            KKSLDMA+RHMDIRRSVP++ +P M   PASS   VRSGP R                  
Sbjct  426  KKSLDMALRHMDIRRSVPNSLRPLMANIPASSAFGVRSGPTRSRAISVSDSPLATSSTAS  485

Query  128  KEGSVSNYTNCNKQPDKL*SE  190
             E SV+N   C +  D L SE
Sbjct  486  SEQSVNNNIICLEIEDDLTSE  506



>ref|XP_010534575.1| PREDICTED: mucin-17-like [Tarenaya hassleriana]
Length=586

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRR++P N +P MT  PASS  SVRSG
Sbjct  494  KKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  532



>ref|NP_001145904.1| hypothetical protein [Zea mays]
 gb|ACL52822.1| unknown [Zea mays]
Length=640

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  P SS +S RSG
Sbjct  550  KKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSG  588



>ref|XP_008672700.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACN36549.1| unknown [Zea mays]
Length=570

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  P SS +S RSG
Sbjct  480  KKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSG  518



>ref|XP_008672699.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN27636.1| unknown [Zea mays]
 gb|ACN34315.1| unknown [Zea mays]
 gb|ACR36057.1| unknown [Zea mays]
Length=600

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  P SS +S RSG
Sbjct  510  KKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSG  548



>gb|ACL54464.1| unknown [Zea mays]
Length=566

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+P+N +P MT  P SS +S RSG
Sbjct  476  KKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSG  514



>gb|EPS71355.1| hypothetical protein M569_03402 [Genlisea aurea]
Length=566

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG---PRRKEG----SVSNYTNC  160
            KKSLDMA+RHMDIRR++P N +P M+  PASS  SVRS    PRR  G     V+  +N 
Sbjct  475  KKSLDMAIRHMDIRRTIPGNLRPLMSNVPASSMYSVRSPSGQPRRTVGVSDSPVATSSNA  534

Query  161  NKQ  169
            N +
Sbjct  535  NSE  537



>ref|XP_006471702.1| PREDICTED: uncharacterized protein LOC102622828 [Citrus sinensis]
Length=262

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNT-QPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+ S + QP MT  PASS  SVRSG
Sbjct  160  KKSLDMALRHMDIRRSINSGSLQPLMTNIPASSMYSVRSG  199



>ref|XP_009407549.1| PREDICTED: mucin-1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=522

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKSLDMA+RHMDIRRSVP++++P MT  PA S   VRSGP R
Sbjct  427  KKSLDMALRHMDIRRSVPNSSRPSMTNVPALSVY-VRSGPTR  467



>ref|XP_010109621.1| hypothetical protein L484_015576 [Morus notabilis]
 gb|EXC23666.1| hypothetical protein L484_015576 [Morus notabilis]
Length=518

 Score = 49.7 bits (117),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+  N +P +T  P SS  S+RSG
Sbjct  431  KKSLDMALRHMDIRRSMQGNLRPVVTSIPVSSMYSIRSG  469


 Score = 23.5 bits (49),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 19/39 (49%), Gaps = 0/39 (0%)
 Frame = +3

Query  117  GLEERKVVYLTTRIATSSRTNSEVSVNKNSLHIDGCQVE  233
            G + R      + +ATSS  +SE SVN     +DG   E
Sbjct  470  GTKNRATSNSDSPLATSSNASSEPSVNNAFTCLDGSDAE  508



>ref|XP_009402293.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402294.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
Length=527

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSG  118
            K+SLDMA RHMDIRRS+P++ +P M   PASS  SVRSG
Sbjct  431  KQSLDMAFRHMDIRRSIPNSLRPLMANIPASSVYSVRSG  469



>ref|XP_004246841.1| PREDICTED: endochitinase A-like [Solanum lycopersicum]
Length=535

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVR-SGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRSV    +P +T+  ASS N VR S  + K GSVS+
Sbjct  444  KKSLDMALRHMDIRRSVNGTLRPVLTRVSASSANGVRSSSTKNKTGSVSD  493



>ref|XP_006602654.1| PREDICTED: flocculation protein FLO11 isoform X1 [Glycine max]
 ref|XP_006602655.1| PREDICTED: flocculation protein FLO11 isoform X2 [Glycine max]
 ref|XP_006602656.1| PREDICTED: flocculation protein FLO11 isoform X3 [Glycine max]
Length=515

 Score = 46.6 bits (109),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMAMRHMDIRRS+  N +P +T  PASS
Sbjct  426  KKSLDMAMRHMDIRRSIQGNLRPLVTSIPASS  457


 Score = 24.6 bits (52),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDD  239
            +ATSS T+SE SVN NS+  DG  VE++
Sbjct  479  LATSSTTSSEPSVNTNSMSYDGSGVEEN  506



>gb|KHN07485.1| hypothetical protein glysoja_034966 [Glycine soja]
Length=515

 Score = 46.6 bits (109),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMAMRHMDIRRS+  N +P +T  PASS
Sbjct  426  KKSLDMAMRHMDIRRSIQGNLRPLVTSIPASS  457


 Score = 24.6 bits (52),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  IATSSRTNSEVSVNKNSLHIDGCQVEDD  239
            +ATSS T+SE SVN NS+  DG  VE++
Sbjct  479  LATSSTTSSEPSVNTNSMSYDGSGVEEN  506



>gb|KDO47715.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
 gb|KDO47716.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
Length=562

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNT-QPPMTKNPASSTNSVRSG  118
            KKSLDMA+RHMDIRRS+ S + +P MT  PASS  SVRSG
Sbjct  463  KKSLDMALRHMDIRRSINSGSLRPLMTNIPASSMYSVRSG  502



>ref|XP_008388204.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
 ref|XP_008359786.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=546

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVRSGPRR  127
            KKS DMAMRHMDI+RS+  N +P +T  PASS  SVR+ P +
Sbjct  450  KKSFDMAMRHMDIKRSMAGNLRPVLTNVPASSGYSVRTKPXK  491



>ref|XP_009588557.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X1 [Nicotiana tomentosiformis]
Length=550

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVR-SGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRSV    +P +T+  +SS N +R S  + K GSVS+
Sbjct  452  KKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANGIRSSSTKNKTGSVSD  501



>gb|KEH23155.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=405

 Score = 46.6 bits (109),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMAMRHMDIRRSV  N +P +T  PASS
Sbjct  325  KKSLDMAMRHMDIRRSVQGNMRPHVTSIPASS  356


 Score = 23.1 bits (48),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (4%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDI  242
            ATSS  +SE+SVN NS+   G + E D 
Sbjct  379  ATSSTASSELSVNNNSISY-GSENEKDF  405



>ref|XP_003623288.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
 gb|AES79506.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=503

 Score = 47.0 bits (110),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMAMRHMDIRRSV  N +P +T  PASS
Sbjct  423  KKSLDMAMRHMDIRRSVQGNMRPHVTSIPASS  454


 Score = 23.1 bits (48),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (4%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDI  242
            ATSS  +SE+SVN NS+   G + E D 
Sbjct  477  ATSSTASSELSVNNNSISY-GSENEKDF  503



>gb|KEH23156.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=424

 Score = 46.6 bits (109),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASS  97
            KKSLDMAMRHMDIRRSV  N +P +T  PASS
Sbjct  344  KKSLDMAMRHMDIRRSVQGNMRPHVTSIPASS  375


 Score = 23.1 bits (48),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (4%)
 Frame = +3

Query  159  ATSSRTNSEVSVNKNSLHIDGCQVEDDI  242
            ATSS  +SE+SVN NS+   G + E D 
Sbjct  398  ATSSTASSELSVNNNSISY-GSENEKDF  424



>ref|XP_009588559.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X2 [Nicotiana tomentosiformis]
Length=535

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    KKSLDMAMRHMDIRRSVPSNTQPPMTKNPASSTNSVR-SGPRRKEGSVSN  148
            KKSLDMA+RHMDIRRSV    +P +T+  +SS N +R S  + K GSVS+
Sbjct  437  KKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANGIRSSSTKNKTGSVSD  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 972449972052