BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14820_g1_i1 len=915 path=[920:0-914]

Length=915
                                                                      Score     E

gb|AAK21256.1|AF335243_1  MADS-box transcription factor FBP25           224   1e-68   Petunia x hybrida [garden petunia]
gb|AAV65498.1|  MPF1                                                    222   1e-67   Physalis pubescens [capuli]
gb|ACH53558.1|  MADS-box transcription factor MPF1                      221   3e-67   
gb|AAV65499.1|  MPP1                                                    220   7e-67   Physalis peruviana [Cape-gooseberry]
ref|XP_009802201.1|  PREDICTED: MADS-box protein SVP-like isoform X2    219   2e-66   
gb|AAV65500.1|  MPP2                                                    219   2e-66   Physalis peruviana [Cape-gooseberry]
gb|ACH53559.1|  MADS-box transcription factor MPP2                      218   3e-66   
ref|XP_009802200.1|  PREDICTED: MADS-box protein SVP-like isoform X1    218   4e-66   
ref|XP_009802202.1|  PREDICTED: MADS-box protein SVP-like isoform X3    214   1e-64   
ref|NP_001274754.1|  MADS transcriptional factor                        214   1e-64   
gb|AAV65497.1|  MSM1                                                    214   2e-64   Solanum macrocarpon
ref|XP_006351733.1|  PREDICTED: MADS-box protein SVP                    213   5e-64   
gb|ACH53556.1|  MADS-box transcription factor MADS11                    211   1e-63   
ref|XP_006487503.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    211   2e-63   
ref|XP_004230624.1|  PREDICTED: MADS-box protein SVP                    207   4e-62   
ref|XP_006487501.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    206   1e-61   
gb|AFA37970.1|  SVP4                                                    206   2e-61   
gb|AFA37966.1|  SVP4                                                    204   8e-61   
dbj|BAB70736.1|  putative MADS-domain transcription factor MpMADS1      199   8e-59   Magnolia praecocissima
gb|AIK35209.1|  MADS-box transcription factor protein 1                 197   6e-58   
ref|XP_002285687.1|  PREDICTED: MADS-box protein SVP                    194   8e-57   Vitis vinifera
ref|XP_008235579.1|  PREDICTED: MADS-box protein SVP                    194   8e-57   
ref|XP_011087945.1|  PREDICTED: MADS-box protein SVP-like isoform X1    193   2e-56   
ref|XP_009783886.1|  PREDICTED: MADS-box protein JOINTLESS-like         192   6e-56   
ref|XP_010254525.1|  PREDICTED: MADS-box protein SVP isoform X2         192   7e-56   
ref|XP_010254524.1|  PREDICTED: MADS-box protein SVP isoform X1         191   1e-55   
ref|XP_009631749.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    191   1e-55   
ref|XP_011021843.1|  PREDICTED: MADS-box protein SVP                    191   2e-55   
ref|XP_002310310.1|  SHORT VEGETATIVE PHASE family protein              190   3e-55   Populus trichocarpa [western balsam poplar]
gb|KDP29759.1|  hypothetical protein JCGZ_18694                         190   4e-55   
ref|XP_008440538.1|  PREDICTED: MADS-box protein SVP-like isoform X1    189   5e-55   
ref|XP_010277487.1|  PREDICTED: MADS-box protein SVP-like isoform X1    189   6e-55   
ref|XP_004143442.1|  PREDICTED: MADS-box protein SVP-like               189   6e-55   
gb|EYU18428.1|  hypothetical protein MIMGU_mgv1a013294mg                189   7e-55   
ref|XP_007018219.1|  K-box region and MADS-box transcription fact...    189   8e-55   
gb|AIY25020.1|  short vegetative phase 1                                189   9e-55   
ref|XP_007047796.1|  K-box region and MADS-box transcription fact...    189   1e-54   
ref|XP_010277489.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    189   1e-54   
gb|AFA37963.1|  SVP1                                                    189   1e-54   
ref|XP_007205845.1|  hypothetical protein PRUPE_ppa011063mg             188   2e-54   
ref|XP_011099987.1|  PREDICTED: MADS-box protein SVP-like               188   3e-54   
emb|CAX51221.1|  MPF1-like-A                                            186   3e-54   Withania sp. W010
gb|AGW23365.1|  MADS box protein MADS63                                 187   3e-54   
ref|XP_006487504.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    187   3e-54   
emb|CAX51215.1|  MPF1-like-A                                            186   3e-54   Withania frutescens
gb|AFA37967.1|  SVP1                                                    187   4e-54   
ref|XP_006573007.1|  PREDICTED: MADS-box protein SVP-like isoform X3    186   7e-54   
gb|ABR18574.1|  MPF1-like protein                                       186   8e-54   Withania somnifera [ashwagandha]
ref|XP_011087946.1|  PREDICTED: MADS-box protein SVP-like isoform X2    186   9e-54   
ref|XP_011016930.1|  PREDICTED: MADS-box protein JOINTLESS              186   2e-53   
gb|ABR18600.1|  MPF1-like protein                                       185   2e-53   Physalis alkekengi [Chinese-lantern]
gb|ACJ61500.1|  MADS-box short vegitative phase                         184   2e-53   
ref|XP_008237143.1|  PREDICTED: MADS-box protein SVP-like isoform X3    185   3e-53   
ref|XP_006574410.1|  PREDICTED: MADS-box protein SVP-like isoform X4    184   3e-53   
gb|ABR18573.1|  MPF1-like protein                                       184   3e-53   Witheringia coccoloboides
ref|XP_009623750.1|  PREDICTED: MADS-box protein JOINTLESS              185   3e-53   
gb|AEX92969.1|  MADS box protein 5                                      185   3e-53   
emb|CAX51232.1|  MPF1-like-A                                            184   4e-53   Withania somnifera [ashwagandha]
emb|CAX51214.1|  MPF1-like-A                                            184   4e-53   Withania frutescens
gb|AAR92206.1|  MADS box transcription factor                           184   5e-53   Populus tomentosa [Chinese white poplar]
ref|XP_009631750.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    184   5e-53   
gb|EYU30938.1|  hypothetical protein MIMGU_mgv1a021820mg                185   5e-53   
ref|XP_007042844.1|  MIKC mads-box transcription factor, putative...    184   6e-53   
ref|XP_003517407.1|  PREDICTED: MADS-box protein SVP-like isoform X1    184   7e-53   
gb|ABR18569.1|  MPF1-like protein                                       183   8e-53   Capsicum baccatum
gb|ACV74250.1|  EXTRAPETALS                                             184   8e-53   
ref|XP_009364259.1|  PREDICTED: MADS-box protein JOINTLESS-like         184   9e-53   
emb|CAX51216.1|  MPF1-like-A                                            182   1e-52   Withania somnifera [ashwagandha]
emb|CDP01559.1|  unnamed protein product                                183   1e-52   
gb|AIK35210.1|  MADS-box transcription factor protein 2                 183   1e-52   
gb|ABR18582.1|  MPF1-like protein                                       182   2e-52   Tubocapsicum anomalum
emb|CAX51247.1|  MPF1-like-A                                            182   2e-52   Withania frutescens
ref|NP_001240951.1|  MADS-box protein SVP-like                          182   3e-52   
gb|ABR18604.1|  MPF1-like protein                                       181   3e-52   Dunalia fasciculata
emb|CAX51239.1|  MPF1-like-A                                            181   3e-52   Withania somnifera [ashwagandha]
ref|XP_004288518.1|  PREDICTED: MADS-box protein JOINTLESS-like         182   3e-52   
ref|XP_006574407.1|  PREDICTED: MADS-box protein SVP-like isoform X1    182   4e-52   
gb|ABR18580.1|  MPF1-like protein                                       181   4e-52   Vassobia breviflora
emb|CAX51213.1|  MPF1-like-A                                            181   5e-52   Withania frutescens
ref|XP_006380343.1|  hypothetical protein POPTR_0007s03260g             182   5e-52   
emb|CAX51231.1|  MPF1-like-A                                            181   6e-52   Withania somnifera [ashwagandha]
emb|CAX51240.1|  MPF1-like-A                                            181   6e-52   Withania riebeckii
gb|AIA58526.1|  SVP-like MADS-box protein                               182   6e-52   
ref|XP_004250145.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    182   7e-52   
emb|CAX51256.1|  MPF1-like-B                                            180   8e-52   Tubocapsicum anomalum
ref|XP_011092451.1|  PREDICTED: MADS-box protein SVP-like               181   1e-51   
ref|XP_008237142.1|  PREDICTED: MADS-box protein SVP-like isoform X2    181   1e-51   
ref|XP_010942683.1|  PREDICTED: MADS-box protein SVP-like               181   1e-51   
gb|ABR18575.1|  MPF1-like protein                                       180   1e-51   Withania somnifera [ashwagandha]
gb|ABR18581.1|  MPF1-like protein                                       180   1e-51   Tubocapsicum anomalum
ref|XP_011043063.1|  PREDICTED: MADS-box protein JOINTLESS-like         180   2e-51   
ref|XP_008440541.1|  PREDICTED: MADS-box protein SVP-like isoform X2    180   2e-51   
gb|AFM77897.1|  MADS-box protein AGL24                                  180   2e-51   
emb|CBI38273.3|  unnamed protein product                                180   2e-51   
gb|ABR18570.1|  MPF1-like protein                                       179   2e-51   Lycianthes biflora [hong si xian]
emb|CAN68106.1|  hypothetical protein VITISV_009637                     180   2e-51   Vitis vinifera
dbj|BAN89455.1|  short vegetative phase                                 180   2e-51   
gb|AHW58043.1|  SVP-3                                                   181   2e-51   
emb|CAX51242.1|  MPF1-like-A                                            179   2e-51   Withania riebeckii
ref|XP_007158373.1|  hypothetical protein PHAVU_002G147600g             180   3e-51   
gb|AFI49342.1|  jointless                                               180   3e-51   
dbj|BAF46766.1|  DNA-binding protein                                    180   3e-51   Ipomoea nil [qian niu]
gb|AHW58026.1|  SVP-1                                                   180   3e-51   
gb|ABR18598.1|  MPF1-like protein                                       179   3e-51   Physalis coztomatl
ref|XP_009137455.1|  PREDICTED: MADS-box protein AGL24-like isofo...    179   4e-51   
gb|AHC92622.1|  NSVP2                                                   179   4e-51   
emb|CDO97392.1|  unnamed protein product                                181   5e-51   
gb|AGB05618.1|  DAM3                                                    179   5e-51   
emb|CAX51228.1|  MPF1-like-A                                            178   5e-51   Withania sp. W009
ref|XP_006472470.1|  PREDICTED: MADS-box protein SVP-like isoform X1    179   5e-51   
gb|ABR18572.1|  MPF1-like protein                                       178   6e-51   Witheringia solanacea
emb|CAX51229.1|  MPF1-like-A                                            178   6e-51   Withania somnifera [ashwagandha]
gb|AFM77902.1|  MADS-box protein AGL24                                  179   6e-51   
emb|CAX51258.1|  MPF1-like-A                                            178   6e-51   Tubocapsicum anomalum
gb|ABY60423.1|  dormancy associated MADS-box 2                          179   7e-51   Euphorbia esula [wolf's milk]
ref|XP_006353175.1|  PREDICTED: MADS-box protein JOINTLESS-like         179   7e-51   
ref|XP_008237141.1|  PREDICTED: MADS-box protein SVP-like isoform X1    179   8e-51   
gb|ABR18606.1|  MPF1-like protein                                       177   9e-51   Margaranthus solanaceus
ref|XP_002310488.1|  MADS-box transcription factor family protein       178   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011097479.1|  PREDICTED: MADS-box protein JOINTLESS              178   1e-50   
ref|XP_011043061.1|  PREDICTED: MADS-box protein JOINTLESS-like         177   2e-50   
gb|AHI85951.1|  AGL24                                                   178   2e-50   
gb|ABZ89556.1|  MPF1-like protein                                       177   2e-50   Physalis acutifolia
gb|ABR18588.1|  MPF1-like protein                                       176   3e-50   Physalis minima [pygmy groundcherry]
ref|XP_010107287.1|  MADS-box protein JOINTLESS                         177   3e-50   
gb|ABR18590.1|  MPF1-like protein                                       176   3e-50   Physalis mexicana
gb|ABR18587.1|  MPF1-like protein                                       176   4e-50   Physalis philadelphica [Mexican groundcherry]
gb|ABR18585.1|  MPF1-like protein                                       176   4e-50   Physalis pubescens [capuli]
gb|ABR18593.1|  MPF1-like protein                                       176   4e-50   Physalis ixocarpa [tomatillo]
gb|AFK36521.1|  unknown                                                 177   5e-50   
ref|XP_008237145.1|  PREDICTED: MADS-box protein SVP-like isoform X5    176   6e-50   
ref|XP_010060099.1|  PREDICTED: MADS-box protein SVP-like isoform X2    176   6e-50   
ref|XP_009137453.1|  PREDICTED: MADS-box protein AGL24-like isofo...    176   7e-50   
gb|ABR18597.1|  MPF1-like protein                                       175   7e-50   Physalis crassifolia
gb|ABR18571.1|  MPF1-like protein                                       175   8e-50   Witheringia solanacea
gb|AGW23339.1|  MADS box protein MADS37                                 176   8e-50   
ref|XP_008363740.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    176   8e-50   
emb|CAX51226.1|  MPF1-like-A                                            175   1e-49   Withania sp. W009
emb|CAX51252.1|  MPF1-like-A                                            174   1e-49   Withania coagulans [Indian rennet]
gb|ABR18595.1|  MPF1-like protein                                       174   1e-49   Physalis fuscomaculata
gb|ABR18576.1|  MPF1-like protein                                       174   1e-49   Withania somnifera [ashwagandha]
ref|XP_006413417.1|  hypothetical protein EUTSA_v10026757mg             175   2e-49   
emb|CAX51230.1|  MPF1-like-A                                            174   2e-49   Withania somnifera [ashwagandha]
ref|XP_002867660.1|  hypothetical protein ARALYDRAFT_492389             175   2e-49   
sp|Q9FUY6.1|JOIN_SOLLC  RecName: Full=MADS-box protein JOINTLESS;...    176   2e-49   Solanum lycopersicum
gb|AFA37969.1|  SVP3                                                    175   2e-49   
gb|AFA37965.1|  SVP3                                                    175   2e-49   
ref|XP_009345716.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    175   2e-49   
emb|CAX51245.1|  MPF1-like-A                                            174   2e-49   Withania riebeckii
ref|NP_001280915.1|  MADS-box protein JOINTLESS                         175   3e-49   
gb|ABR18592.1|  MPF1-like protein                                       174   3e-49   Physalis lanceifolia
ref|XP_010523348.1|  PREDICTED: MADS-box protein AGL24 isoform X2       175   3e-49   
emb|CDX92641.1|  BnaC07g38990D                                          175   3e-49   
emb|CDY11019.1|  BnaA03g46780D                                          174   3e-49   
ref|XP_008237144.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    174   3e-49   
ref|XP_010448551.1|  PREDICTED: MADS-box protein AGL24-like isofo...    174   3e-49   
gb|ABR18589.1|  MPF1-like protein                                       173   4e-49   Physalis minima [pygmy groundcherry]
gb|AAP40641.1|  SVP-like floral repressor                               174   4e-49   Eucalyptus occidentalis
ref|NP_001289637.1|  MADS-box protein JOINTLESS                         174   4e-49   
ref|XP_006282462.1|  hypothetical protein CARUB_v10005653mg             174   5e-49   
emb|CAX51238.1|  MPF1-like-A                                            173   5e-49   Withania somnifera [ashwagandha]
ref|XP_010439015.1|  PREDICTED: MADS-box protein AGL24 isoform X2       174   5e-49   
ref|XP_010027953.1|  PREDICTED: MADS-box protein JOINTLESS              174   6e-49   
emb|CAL36572.1|  incomposita homologue                                  174   6e-49   Misopates orontium
gb|AHC92621.1|  NSVP1                                                   174   7e-49   
gb|ABR18594.1|  MPF1-like protein                                       172   7e-49   Physalis fuscomaculata
gb|ABR18584.1|  MPF1-like protein                                       172   9e-49   Physalis viscosa
ref|NP_194185.1|  MADS-box protein AGL24                                173   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CAG27846.1|  incomposita protein                                    173   1e-48   Antirrhinum majus [garden snapdragon]
emb|CAX51217.1|  MPF1-like-A                                            172   1e-48   Withania frutescens
ref|XP_008455140.1|  PREDICTED: MADS-box protein SVP-like isoform X1    173   1e-48   
ref|XP_010526675.1|  PREDICTED: MADS-box protein SVP-like               173   2e-48   
ref|XP_010680338.1|  PREDICTED: MADS-box protein JOINTLESS              173   2e-48   
gb|ABR18577.1|  MPF1-like protein                                       171   3e-48   Withania coagulans [Indian rennet]
ref|XP_008455141.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    172   3e-48   
ref|XP_004136891.1|  PREDICTED: MADS-box protein SVP-like               172   3e-48   
emb|CAX51224.1|  MPF1-like-A                                            171   3e-48   Withania sp. W009
gb|AFA37968.1|  SVP2                                                    172   3e-48   
ref|XP_010926365.1|  PREDICTED: MADS-box protein JOINTLESS-like         172   3e-48   
gb|AAF22455.1|  MADS box protein                                        172   4e-48   Paulownia kawakamii
ref|XP_010520750.1|  PREDICTED: MADS-box protein AGL24-like isofo...    172   4e-48   
gb|AFA37964.1|  SVP2                                                    172   4e-48   
emb|CAX51219.1|  MPF1-like-B                                            171   5e-48   Withania sp. W011
ref|XP_008363737.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    171   5e-48   
gb|ADU56833.1|  MADS-box protein STMADS11 subfamily                     171   5e-48   
ref|XP_010523346.1|  PREDICTED: MADS-box protein AGL24 isoform X1       171   6e-48   
gb|AGW23358.1|  MADS box protein MADS56                                 171   6e-48   
emb|CAX51223.1|  MPF1-like-B                                            170   6e-48   Withania sp. W010
emb|CAX51233.1|  MPF1-like-B                                            170   6e-48   Withania somnifera [ashwagandha]
ref|XP_010448550.1|  PREDICTED: MADS-box protein AGL24-like isofo...    171   7e-48   
gb|EPS73619.1|  hypothetical protein M569_01137                         171   7e-48   
ref|XP_010439014.1|  PREDICTED: MADS-box protein AGL24 isoform X1       171   1e-47   
ref|XP_010060098.1|  PREDICTED: MADS-box protein SVP-like isoform X1    171   1e-47   
ref|XP_009345714.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    171   1e-47   
gb|AIK35208.1|  SVP1 protein                                            171   1e-47   
ref|XP_006580977.1|  PREDICTED: uncharacterized protein LOC100776...    170   1e-47   
gb|AFM77899.1|  MADS-box protein AGL24                                  170   2e-47   
emb|CDY03445.1|  BnaC01g16370D                                          169   2e-47   
ref|XP_010646795.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box pro...    171   3e-47   
ref|XP_004515126.1|  PREDICTED: MADS-box protein SVP-like isoform X1    169   3e-47   
gb|AGW23342.1|  MADS box protein MADS40                                 169   3e-47   
gb|AAW66885.1|  MADS box transcription factor                           169   4e-47   Elaeis guineensis
ref|XP_010472243.1|  PREDICTED: MADS-box protein SVP-like               169   4e-47   
ref|XP_003613086.1|  MADS-box transcription factor                      169   5e-47   
gb|AFC96914.1|  SVP-like MADS-box protein                               169   8e-47   
gb|AAK27151.1|  MADS box transcription factor                           168   1e-46   Ipomoea batatas [batate]
ref|XP_004490446.1|  PREDICTED: MADS-box protein SVP-like isoform X1    167   1e-46   
ref|XP_009138187.1|  PREDICTED: MADS-box protein AGL24 isoform X2       167   2e-46   
ref|XP_009391344.1|  PREDICTED: MADS-box transcription factor 22-...    167   2e-46   
ref|NP_179840.2|  MADS-box protein SVP                                  167   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520749.1|  PREDICTED: MADS-box protein AGL24-like isofo...    167   3e-46   
ref|XP_006466301.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    167   3e-46   
gb|ABJ96361.2|  dam1                                                    167   3e-46   Prunus persica
gb|AGW23356.1|  MADS box protein MADS54                                 166   3e-46   
gb|AFM77900.1|  MADS-box protein AGL24                                  166   4e-46   
ref|XP_010648095.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    166   4e-46   
ref|XP_011023054.1|  PREDICTED: MADS-box protein JOINTLESS-like         167   4e-46   
emb|CAX51212.1|  MPF1-like-B                                            165   5e-46   Withania frutescens
ref|XP_010312646.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    165   6e-46   
gb|AIU94278.1|  DAM6 for dormancy associated MADS-box transcripti...    166   6e-46   
ref|XP_006426275.1|  hypothetical protein CICLE_v10026457mg             166   6e-46   
gb|AFM77909.1|  MADS-box protein SVP                                    166   7e-46   
ref|XP_006282463.1|  hypothetical protein CARUB_v10005653mg             166   7e-46   
ref|XP_003631742.2|  PREDICTED: MADS-box protein JOINTLESS-like i...    166   7e-46   
ref|XP_009138200.1|  PREDICTED: MADS-box protein AGL24 isoform X4       166   8e-46   
gb|KFK32803.1|  mads-box protein svp                                    166   8e-46   
ref|XP_010648099.1|  PREDICTED: MADS-box protein AGL24-like isofo...    166   8e-46   
ref|XP_008219269.1|  PREDICTED: MADS-box protein AGL24-like             166   8e-46   
gb|AAQ55452.1|  short vegetative phase protein                          166   8e-46   Brassica rapa
ref|NP_001239872.1|  uncharacterized protein LOC100776749               166   9e-46   
gb|AFM77901.1|  MADS-box protein AGL24                                  165   1e-45   
gb|ABK92958.1|  unknown                                                 165   1e-45   Populus trichocarpa [western balsam poplar]
gb|AFM77906.1|  MADS-box protein SVP                                    166   1e-45   
ref|XP_010417014.1|  PREDICTED: MADS-box protein SVP isoform X2         166   1e-45   
gb|AFU85632.1|  short vegetative phase                                  166   1e-45   
gb|AGW23370.1|  MADS box protein MADS68                                 165   1e-45   
ref|XP_004152597.1|  PREDICTED: MADS-box protein SVP-like               165   1e-45   
gb|AIY25021.1|  short vegetative phase 2                                164   2e-45   
ref|XP_006294892.1|  hypothetical protein CARUB_v10023941mg             165   2e-45   
ref|XP_010417013.1|  PREDICTED: MADS-box protein SVP isoform X1         165   2e-45   
gb|AFM77908.1|  MADS-box protein SVP                                    165   3e-45   
gb|AFM77910.1|  MADS-box protein SVP                                    165   3e-45   
gb|KDP41475.1|  hypothetical protein JCGZ_15882                         164   3e-45   
dbj|BAE98676.1|  short vegegative phase protein                         164   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299728.1|  PREDICTED: MADS-box protein SVP-like               164   3e-45   
ref|XP_011023057.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    164   3e-45   
gb|KDP29972.1|  hypothetical protein JCGZ_18739                         164   3e-45   
ref|XP_009138166.1|  PREDICTED: MADS-box protein AGL24 isoform X1       164   4e-45   
dbj|BAD43004.1|  short vegegative phase protein (SVP)                   164   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AGA01527.1|  SVP-like protein                                        164   4e-45   
ref|XP_010555411.1|  PREDICTED: MADS-box protein SVP-like               164   4e-45   
ref|XP_006294891.1|  hypothetical protein CARUB_v10023941mg             164   5e-45   
gb|AFM77907.1|  MADS-box protein SVP                                    164   5e-45   
gb|AEJ76850.1|  MADS29                                                  163   5e-45   
ref|XP_007042845.1|  MIKC mads-box transcription factor, putative...    163   5e-45   
ref|NP_001280191.1|  MADS-box protein AGL24-like                        164   5e-45   
gb|AAK27150.1|  MADS box transcription factor                           164   6e-45   Ipomoea batatas [batate]
ref|XP_004147540.1|  PREDICTED: MADS-box protein SVP-like               164   7e-45   
ref|XP_006404717.1|  hypothetical protein EUTSA_v10000308mg             164   8e-45   
ref|XP_009112514.1|  PREDICTED: MADS-box protein SVP                    164   8e-45   
ref|XP_009140365.1|  PREDICTED: MADS-box protein SVP-like               163   1e-44   
ref|XP_009138194.1|  PREDICTED: MADS-box protein AGL24 isoform X3       162   1e-44   
ref|XP_010520751.1|  PREDICTED: MADS-box protein AGL24-like isofo...    162   1e-44   
gb|AAF66690.1|AF144623_1  MADS-box transcription factor                 162   1e-44   Canavalia lineata
gb|AHY82603.1|  short vegetative phase protein                          163   1e-44   
ref|XP_010661294.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    162   1e-44   
gb|AFM77905.1|  MADS-box protein SVP                                    162   2e-44   
gb|AFG73587.1|  short vegetative phase protein                          162   2e-44   
ref|NP_001280193.1|  MADS-box protein AGL24-like                        162   2e-44   
ref|XP_003613054.1|  MADS-box protein SVP                               162   2e-44   
gb|AAQ55451.1|  short vegetative phase protein                          162   2e-44   Brassica rapa
gb|AES98247.2|  MADS-box transcription factor                           162   3e-44   
gb|ACJ84016.1|  unknown                                                 162   3e-44   Medicago truncatula
gb|KCW66638.1|  hypothetical protein EUGRSUZ_F00420                     159   3e-44   
ref|XP_008444930.1|  PREDICTED: MADS-box protein SVP isoform X1         161   4e-44   
ref|XP_008444932.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    161   4e-44   
ref|XP_004509780.1|  PREDICTED: MADS-box protein SVP-like               161   4e-44   
ref|XP_009417612.1|  PREDICTED: MADS-box protein SVP-like               161   4e-44   
ref|XP_008651770.1|  PREDICTED: MADS-box transcription factor 47 ...    161   6e-44   
ref|XP_002878622.1|  short vegetative phase protein                     161   7e-44   
gb|ACH86229.1|  MADS box protein                                        160   8e-44   
gb|ACJ09169.1|  SVP-like protein                                        160   9e-44   
ref|XP_008651762.1|  PREDICTED: MADS-box transcription factor 47 ...    160   1e-43   
gb|ACG34827.1|  MADS-box transcription factor 47                        160   1e-43   
ref|NP_001154528.1|  MADS-box protein SVP                               160   1e-43   
ref|XP_008782197.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box pro...    158   2e-43   
gb|ACJ84526.1|  unknown                                                 160   2e-43   
ref|XP_010429177.1|  PREDICTED: MADS-box protein SVP-like isoform X2    160   2e-43   
ref|XP_003608427.1|  Myocyte-specific enhancer factor 2B                160   2e-43   
gb|KCW66637.1|  hypothetical protein EUGRSUZ_F00420                     159   2e-43   
ref|XP_010530248.1|  PREDICTED: MADS-box protein AGL24-like             159   3e-43   
gb|ABJ96360.1|  dam6                                                    159   3e-43   
ref|XP_010429176.1|  PREDICTED: MADS-box protein SVP-like isoform X1    159   4e-43   
gb|EPS58809.1|  hypothetical protein M569_16006                         155   4e-43   
gb|AAK21250.1|AF335237_1  MADS-box transcription factor FBP13           159   4e-43   
emb|CAX51222.1|  MPF1-like-B                                            157   5e-43   
ref|NP_001288323.1|  MADS-box transcription factor 47-like              158   5e-43   
pir||H84613  probable MADS-box protein [imported] - Arabidopsis t...    158   5e-43
ref|XP_006829974.1|  hypothetical protein AMTR_s00127p00060060          158   6e-43   
gb|ACN26076.1|  unknown                                                 158   6e-43   
emb|CDX89487.1|  BnaC04g35060D                                          158   6e-43   
ref|XP_011023055.1|  PREDICTED: MADS-box protein SVP-like isoform X1    159   6e-43   
ref|XP_004953998.1|  PREDICTED: MADS-box transcription factor 22-...    158   7e-43   
gb|AAZ17549.1|  MADS10                                                  158   7e-43   
ref|XP_007227562.1|  hypothetical protein PRUPE_ppa010714mg             158   8e-43   
ref|NP_001048193.1|  Os02g0761000                                       157   1e-42   
gb|AHH28298.1|  MADS-box transcription factor                           157   1e-42   
ref|XP_011023053.1|  PREDICTED: MADS-box protein JOINTLESS-like         157   1e-42   
ref|XP_010229795.1|  PREDICTED: MADS-box transcription factor 47-...    157   1e-42   
gb|ACF80425.1|  unknown                                                 157   1e-42   
emb|CAD23409.1|  putative MADS-domain transcription factor              157   1e-42   
gb|EAY87613.1|  hypothetical protein OsI_09024                          157   1e-42   
emb|CDY13746.1|  BnaA09g42480D                                          157   2e-42   
ref|NP_001105148.1|  MADS19                                             157   2e-42   
gb|ABJ96368.1|  dam1                                                    156   2e-42   
gb|AHH28268.1|  MADS-box transcription factor                           157   2e-42   
gb|AIU94277.1|  DAM5 for dormancy associated MADS-box transcripti...    157   2e-42   
ref|NP_001105154.1|  m26 protein                                        157   2e-42   
sp|Q5K4R0.2|MAD47_ORYSJ  RecName: Full=MADS-box transcription fac...    157   2e-42   
gb|ABJ96366.1|  dam5                                                    156   3e-42   
gb|AAZ17550.1|  MADS14                                                  156   4e-42   
ref|XP_009785678.1|  PREDICTED: MADS-box protein AGL24-like isofo...    157   4e-42   
ref|XP_006649065.1|  PREDICTED: MADS-box transcription factor 22-...    157   4e-42   
ref|XP_009380237.1|  PREDICTED: MADS-box transcription factor 22-...    156   5e-42   
gb|ABJ96359.1|  dam5                                                    156   5e-42   
ref|XP_007223866.1|  hypothetical protein PRUPE_ppa010822mg             156   5e-42   
gb|ABF94360.1|  SHORT VEGETATIVE PHASE protein, putative, expressed     156   6e-42   
ref|XP_010690400.1|  PREDICTED: MADS-box protein AGL24-like             155   6e-42   
gb|AGW23341.1|  MADS box protein MADS39                                 155   8e-42   
ref|XP_008651772.1|  PREDICTED: MADS-box transcription factor 47 ...    155   9e-42   
gb|AHM92095.1|  MADS-box protein 19                                     155   1e-41   
gb|AAQ23142.1|  transcription factor MADS47                             155   1e-41   
emb|CAX51255.1|  MPF1-like-B                                            154   1e-41   
emb|CAC29335.1|  MADS box transcription factor                          155   2e-41   
gb|ADZ72841.1|  AGAMOUS-like 24-like protein 2                          154   2e-41   
ref|XP_007136341.1|  hypothetical protein PHAVU_009G037300g             154   2e-41   
ref|NP_001049203.2|  Os03g0186600                                       154   3e-41   
emb|CDX76906.1|  BnaC08g34920D                                          154   3e-41   
ref|XP_009627164.1|  PREDICTED: MADS-box protein SVP-like isoform X3    153   5e-41   
emb|CAM59074.1|  MIKC-type MADS-box transcription factor WM28A          153   5e-41   
gb|KDP40987.1|  hypothetical protein JCGZ_24986                         153   6e-41   
ref|XP_006594670.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    153   8e-41   
gb|ADX96027.1|  MPF2-like transcription factor                          152   1e-40   
ref|XP_009785671.1|  PREDICTED: MADS-box protein AGL24-like isofo...    153   1e-40   
gb|AGR42634.1|  MADS1                                                   152   1e-40   
gb|EEC74650.1|  hypothetical protein OsI_10300                          152   1e-40   
gb|AHM92094.1|  MADS-box protein 18                                     152   2e-40   
ref|XP_006584956.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    151   2e-40   
gb|ACU24504.1|  unknown                                                 149   2e-40   
emb|CDY34289.1|  BnaA01g13920D                                          160   2e-40   
emb|CAM59075.1|  MIKC-type MADS-box transcription factor WM28B          152   2e-40   
ref|XP_006584958.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    150   2e-40   
gb|AAX47170.1|  SHORT VEGETATIVE PHASE                                  151   2e-40   
gb|AHH28264.1|  MADS-box transcription factor                           151   3e-40   
ref|XP_006584957.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    150   4e-40   
ref|XP_003528394.2|  PREDICTED: MADS-box protein SVP-like isoform X1    150   5e-40   
emb|CAB97350.1|  MADS-box protein 1-2                                   150   5e-40   
emb|CAX84147.1|  MPF2-like                                              151   5e-40   
ref|XP_004985440.1|  PREDICTED: MADS-box transcription factor 47-...    150   7e-40   
ref|XP_009627161.1|  PREDICTED: MADS-box protein AGL24-like isofo...    150   1e-39   
gb|ABQ51099.1|  MPF2-like                                               151   1e-39   
ref|XP_003541785.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    149   1e-39   
emb|CAX84157.1|  MPF2-like                                              150   1e-39   
ref|XP_004985436.1|  PREDICTED: MADS-box transcription factor 47-...    149   1e-39   
ref|XP_010675143.1|  PREDICTED: MADS-box protein JOINTLESS              149   1e-39   
ref|XP_009380238.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    147   2e-39   
emb|CAX51278.1|  MPF2-like-B                                            149   2e-39   
emb|CAM59068.1|  MIKC-type MADS-box transcription factor WM22B          149   2e-39   
gb|ABW82562.1|  MADS1                                                   149   2e-39   
emb|CAB97349.1|  MADS box protein 1                                     149   2e-39   
ref|XP_003547095.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    148   3e-39   
gb|ABM21529.1|  MADS-box protein 10                                     148   3e-39   
ref|NP_001288317.1|  MADS-box transcription factor 22-like              148   4e-39   
ref|XP_008219270.1|  PREDICTED: MADS-box protein JOINTLESS-like         149   4e-39   
dbj|BAK00304.1|  predicted protein                                      148   4e-39   
gb|ABF57916.1|  MADS-box transcription factor TaAGL11                   148   4e-39   
ref|XP_006583776.1|  PREDICTED: MADS-box protein SVP-like isoform X2    147   4e-39   
ref|XP_009627163.1|  PREDICTED: MADS-box protein SVP-like isoform X2    148   4e-39   
ref|XP_010094804.1|  MADS-box protein AGL24                             147   4e-39   
gb|AAC84133.1|  MADS box protein                                        145   5e-39   
ref|XP_008454463.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    147   7e-39   
ref|XP_009376231.1|  PREDICTED: MADS-box protein AGL24-like             147   7e-39   
ref|XP_004964865.1|  PREDICTED: MADS-box transcription factor 55-...    147   7e-39   
gb|ABF57917.1|  MADS-box transcription factor TaAGL13                   147   8e-39   
gb|KHN46260.1|  MADS-box protein SVP                                    148   1e-38   
emb|CAM59067.1|  MIKC-type MADS-box transcription factor WM22A          147   1e-38   
gb|AFK37879.1|  unknown                                                 145   2e-38   
ref|NP_001280194.1|  MADS-box protein JOINTLESS-like                    147   2e-38   
gb|KCW68505.1|  hypothetical protein EUGRSUZ_F02146                     144   2e-38   
gb|AFW73551.1|  putative MADS-box transcription factor family pro...    144   3e-38   
emb|CAX11663.1|  MADS domain MPF2-like transcription factor             146   3e-38   
ref|XP_010648133.1|  PREDICTED: MADS-box protein SVP-like isoform X2    144   5e-38   
ref|XP_010061538.1|  PREDICTED: MADS-box protein SVP-like isoform X4    144   5e-38   
ref|XP_010061537.1|  PREDICTED: MADS-box protein SVP-like isoform X3    144   6e-38   
ref|XP_010061536.1|  PREDICTED: MADS-box protein SVP-like isoform X2    144   8e-38   
ref|XP_010061535.1|  PREDICTED: MADS-box protein SVP-like isoform X1    144   9e-38   
gb|ADU56842.1|  MADS-box protein STMADS11 subfamily                     141   1e-37   
gb|AFW64371.1|  putative MADS-box transcription factor family pro...    145   1e-37   
gb|AFW64372.1|  putative MADS-box transcription factor family pro...    143   2e-37   
ref|XP_004299084.1|  PREDICTED: MADS-box protein SVP-like               144   2e-37   
gb|ABJ96370.1|  dam2                                                    144   2e-37   
gb|AHH28332.1|  MADS-box transcription factor                           143   2e-37   
ref|XP_010094805.1|  MADS-box protein JOINTLESS                         144   2e-37   
gb|ACN26305.1|  unknown                                                 142   2e-37   
gb|AIU94275.1|  DAM3 for dormancy associated MADS-box transcripti...    143   4e-37   
ref|XP_008219275.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    143   4e-37   
ref|XP_006597363.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    142   5e-37   
gb|ABL11476.1|  MADS10 protein                                          142   6e-37   
ref|XP_007148366.1|  hypothetical protein PHAVU_006G202200g             142   7e-37   
emb|CAN60992.1|  hypothetical protein VITISV_018685                     141   7e-37   
ref|XP_007223848.1|  hypothetical protein PRUPE_ppa010758mg             142   8e-37   
gb|ABJ96364.1|  dam3                                                    142   8e-37   
ref|XP_010061534.1|  PREDICTED: MADS-box protein JOINTLESS-like         141   1e-36   
ref|XP_008219274.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    142   1e-36   
ref|XP_004299056.1|  PREDICTED: MADS-box protein SVP-like               142   1e-36   
gb|ABQ51132.1|  MPF2-like                                               142   1e-36   
gb|KHN33563.1|  MADS-box protein JOINTLESS                              140   1e-36   
gb|KCW68497.1|  hypothetical protein EUGRSUZ_F02145                     141   1e-36   
gb|KCW68496.1|  hypothetical protein EUGRSUZ_F02145                     141   2e-36   
gb|AFK37369.1|  unknown                                                 139   2e-36   
gb|ABR17226.1|  unknown                                                 140   3e-36   
gb|ABJ96363.1|  dam2                                                    140   5e-36   
ref|XP_010691403.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    139   6e-36   
ref|NP_001280197.1|  MADS-box protein JOINTLESS-like                    140   7e-36   
ref|XP_010691402.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    139   7e-36   
emb|CAX84150.1|  MPF2-like                                              140   8e-36   
emb|CAX51287.1|  MPF2-like-B                                            139   9e-36   
ref|XP_002262889.1|  PREDICTED: MADS-box protein SVP isoform X2         138   1e-35   
emb|CAX51300.1|  MPF2-like-B                                            139   1e-35   
ref|XP_010661297.1|  PREDICTED: MADS-box protein SVP isoform X3         137   1e-35   
gb|AHH28263.1|  MADS-box transcription factor                           139   1e-35   
ref|XP_003543140.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    138   1e-35   
gb|AAV65501.1|  MSM2                                                    139   2e-35   
emb|CAX51299.1|  MPF2-like-A                                            138   3e-35   
gb|ABJ96371.1|  dam3                                                    138   4e-35   
ref|XP_008219271.1|  PREDICTED: MADS-box protein JOINTLESS-like         138   4e-35   
gb|ACJ83294.1|  unknown                                                 135   5e-35   
ref|XP_003523783.1|  PREDICTED: MADS-box protein JOINTLESS-like         137   5e-35   
emb|CAX51297.1|  MPF2-like-A                                            137   5e-35   
gb|AIE58043.1|  MADS10                                                  137   6e-35   
emb|CAX51263.1|  MPF2-like-A                                            137   8e-35   
ref|XP_004237993.1|  PREDICTED: MADS-box protein SVP isoform X1         137   1e-34   
gb|KHN08262.1|  MADS-box protein JOINTLESS                              136   1e-34   
ref|NP_001057149.1|  Os06g0217300                                       136   1e-34   
emb|CAX51262.1|  MPF2-like-B                                            136   1e-34   
ref|XP_006338063.1|  PREDICTED: MADS-box protein SVP isoform X1         136   1e-34   
gb|ABJ96369.1|  dam2 alpha                                              136   1e-34   
emb|CAX11664.1|  MADS domain MPF2-like transcription factor             137   2e-34   
gb|AFK42723.1|  unknown                                                 133   2e-34   
ref|XP_010320206.1|  PREDICTED: MADS-box protein SVP isoform X2         136   2e-34   
ref|XP_008378580.1|  PREDICTED: MADS-box protein JOINTLESS-like         135   2e-34   
emb|CAX51308.1|  MPF2-like-B                                            135   2e-34   
dbj|BAI48074.1|  dormancy-associated MADS-box transcription factor      135   2e-34   
ref|XP_006338064.1|  PREDICTED: MADS-box protein SVP isoform X2         135   3e-34   
emb|CAX51276.1|  MPF2-like-A                                            135   3e-34   
emb|CAX51305.1|  MPF2-like-B                                            135   3e-34   
gb|ABB13345.1|  MADS box protein VRT-2                                  135   4e-34   
emb|CAX51260.1|  MPF2-like-B                                            135   4e-34   
ref|XP_010107679.1|  MADS-box protein SVP                               136   4e-34   
ref|NP_001275284.1|  MADS16 protein                                     135   5e-34   
emb|CAX51264.1|  MPF2-like-A                                            135   5e-34   
ref|XP_010228829.1|  PREDICTED: MADS-box transcription factor 47-...    135   6e-34   
ref|XP_010229445.1|  PREDICTED: MADS-box transcription factor 47-...    135   7e-34   
emb|CAX51268.1|  MPF2-like-B                                            134   8e-34   
gb|KCW68494.1|  hypothetical protein EUGRSUZ_F02141                     132   8e-34   
gb|ACG36350.1|  MADS-box transcription factor 22                        134   9e-34   
emb|CAX51261.1|  MPF2-like-B                                            134   9e-34   
ref|XP_010061528.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    132   9e-34   
gb|ABZ89555.1|  MPF1-like protein                                       132   9e-34   
emb|CAX51275.1|  MPF2-like-A                                            134   1e-33   
ref|XP_003615289.1|  MPF2-like-B                                        138   1e-33   
emb|CAX51307.1|  MPF2-like-B                                            134   1e-33   
emb|CAX51259.1|  MPF2-like-B                                            134   1e-33   
gb|AHH28262.1|  MADS-box transcription factor                           130   2e-33   
ref|XP_010061527.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    132   2e-33   
ref|NP_001280195.1|  MADS-box protein JOINTLESS-like                    133   3e-33   
gb|ACF86590.1|  unknown                                                 131   3e-33   
ref|XP_006655913.1|  PREDICTED: MADS-box transcription factor 55-...    132   3e-33   
emb|CAX51295.1|  MPF2-like-A                                            132   4e-33   
emb|CAX51279.1|  MPF2-like-B                                            132   4e-33   
emb|CAM59070.1|  MIKC-type MADS-box transcription factor WM24B          132   4e-33   
emb|CAX51296.1|  MPF2-like-B                                            132   5e-33   
gb|ABJ96362.1|  dam2 alpha                                              132   5e-33   
gb|ADZ72840.1|  AGAMOUS-like E 24-like protein 1                        131   5e-33   
gb|ABF57936.1|  MADS-box transcription factor TaAGL36                   132   5e-33   
ref|XP_004299729.1|  PREDICTED: MADS-box protein SVP-like               132   5e-33   
emb|CAM59069.1|  MIKC-type MADS-box transcription factor WM24A          132   5e-33   
gb|EEC80232.1|  hypothetical protein OsI_22169                          132   6e-33   
ref|XP_008659116.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box tra...    131   7e-33   
emb|CAD23411.1|  m21                                                    131   7e-33   
gb|AAB94005.1|  MADS transcriptional factor                             132   8e-33   
gb|ABJ96358.1|  dam4                                                    131   9e-33   
emb|CAX51281.1|  MPF2-like-A                                            131   1e-32   
emb|CAX51283.1|  MPF2-like-B                                            131   1e-32   
emb|CAX51270.1|  MPF2-like-A                                            131   1e-32   
emb|CAX51292.1|  MPF2-like-A                                            131   1e-32   
gb|AAY43789.1|  MADS box protein VRT-2                                  130   2e-32   
emb|CAX51285.1|  MPF2-like-A                                            130   2e-32   
emb|CAX51267.1|  MPF2-like-A                                            130   2e-32   
gb|AAZ17551.1|  MADS16                                                  130   2e-32   



>gb|AAK21256.1|AF335243_1 MADS-box transcription factor FBP25 [Petunia x hybrida]
Length=219

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTA QVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS S
Sbjct  1    MVRQKIQIKKIDNLTAGQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSGS  60

Query  361  NMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M ++I +H +H E+ ++  E   S +LQ +  TY  L+KEF EK+RELRQ+ GE+LQ L
Sbjct  61   SMMQLIEKHKIHSERDMDNPEQLQSSNLQCQKKTYGMLSKEFLEKNRELRQIKGEELQGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG-  714
            G+ EL+KLEK+VEGG+ R+M+ KGD  + EI++LKKKEA+L EEN+QLKQ+SE  +    
Sbjct  121  GLEELMKLEKLVEGGIGRVMKMKGDKFMKEISSLKKKEAQLQEENSQLKQQSEARLSQNA  180

Query  715  --PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
              P +S+ S+TN C  F       Y  SDTSLKLGLPFP
Sbjct  181  TEPGHSANSITN-CPSFVYGDHQDYNDSDTSLKLGLPFP  218



>gb|AAV65498.1| MPF1 [Physalis pubescens]
Length=221

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 169/222 (76%), Gaps = 9/222 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M ++I +H MH E+ ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ L
Sbjct  61   SMMQLIEKHKMHSERDMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG-  714
            G+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+  +  G 
Sbjct  121  GLEELMKLEKLVEGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEGG  180

Query  715  -----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                   +S++S+ N   L     QD Y  SDTSLKLGL +P
Sbjct  181  QNVIEQGHSADSIANNLSLVNSH-QD-YDDSDTSLKLGLAYP  220



>gb|ACH53558.1| MADS-box transcription factor MPF1 [Physalis pubescens]
Length=222

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M ++I +H MH E+ ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ L
Sbjct  61   SMMQLIEKHKMHSERDMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG--VQG  711
            G+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+     +G
Sbjct  121  GLEELMKLEKLVEGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQQARLNEG  180

Query  712  GPP-----YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+ N   L     QD Y  SDTSLKLGL +P
Sbjct  181  GQNVIEQGHSADSIANNLSLVNSH-QD-YDDSDTSLKLGLAYP  221



>gb|AAV65499.1| MPP1 [Physalis peruviana]
Length=222

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 168/223 (75%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++ VE   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERDNMDSVEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG  714
            LG+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+  +  G
Sbjct  121  LGLEELMKLEKLVEGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEG  180

Query  715  ------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                    +S++S+ N   L     QD Y  SDTSLKLGL +P
Sbjct  181  GQNVIEQGHSADSIANNLSLVNSH-QD-YDDSDTSLKLGLAYP  221



>ref|XP_009802201.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Nicotiana sylvestris]
Length=228

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 170/227 (75%), Gaps = 14/227 (6%)
 Frame = +1

Query  175  VKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYS  354
            VKMVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS
Sbjct  5    VKMVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYS  64

Query  355  NSNMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            +S+M ++I +H +H ++ ++  +   S +LQ E   Y  L++EF EK+RELRQLNGE+LQ
Sbjct  65   SSSMMQLIDKHKVHSDRDMDSPDQLQSFNLQSEKKNYGILSREFAEKNRELRQLNGEELQ  124

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----  699
             LG+ EL+KLEK+VEGG+SR+M+ KG+  + EI++LKKKEA+L EEN+QLK++SE     
Sbjct  125  GLGLEELMKLEKIVEGGISRVMKIKGEKFMREISSLKKKEAQLQEENSQLKKQSEARLNE  184

Query  700  -----GVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                  ++GG  +S++S+T    L    L   Y  S TSLKLGLP P
Sbjct  185  VEGHNAIEGG--HSADSITTNRSLVNGHLD--YIDSVTSLKLGLPIP  227



>gb|AAV65500.1| MPP2 [Physalis peruviana]
Length=222

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERANMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL Q+S+  +  +
Sbjct  121  LGLEELMKLEKLVEGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQARLNEE  180

Query  709  GG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+ N   L     QD Y  SDTSLKLGL +P
Sbjct  181  GQNVIEQGHSADSIANNLSLVNSH-QD-YNDSDTSLKLGLAYP  221



>gb|ACH53559.1| MADS-box transcription factor MPP2 [Physalis peruviana]
Length=223

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 170/224 (76%), Gaps = 11/224 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERANMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE---IGV  705
            LG+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL Q+S+   +  
Sbjct  121  LGLEELMKLEKLVEGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQQARLNE  180

Query  706  QGG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            +G       +S++S+ N   L     QD Y  SDTSLKLGL +P
Sbjct  181  EGQNVIEQGHSADSIANNLSLVNSH-QD-YNDSDTSLKLGLAYP  222



>ref|XP_009802200.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Nicotiana sylvestris]
Length=229

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 170/228 (75%), Gaps = 15/228 (7%)
 Frame = +1

Query  175  VKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYS  354
            VKMVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS
Sbjct  5    VKMVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYS  64

Query  355  NSNMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            +S+M ++I +H +H ++ ++  +   S +LQ E   Y  L++EF EK+RELRQLNGE+LQ
Sbjct  65   SSSMMQLIDKHKVHSDRDMDSPDQLQSFNLQSEKKNYGILSREFAEKNRELRQLNGEELQ  124

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE-----  696
             LG+ EL+KLEK+VEGG+SR+M+ KG+  + EI++LKKKEA+L EEN+QLK++SE     
Sbjct  125  GLGLEELMKLEKIVEGGISRVMKIKGEKFMREISSLKKKEAQLQEENSQLKKQSEQARLN  184

Query  697  -----IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                   ++GG  +S++S+T    L    L   Y  S TSLKLGLP P
Sbjct  185  EVEGHNAIEGG--HSADSITTNRSLVNGHLD--YIDSVTSLKLGLPIP  228



>ref|XP_009802202.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009802203.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009802205.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Nicotiana sylvestris]
Length=223

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 168/226 (74%), Gaps = 15/226 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK-VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M ++I +H +H ++ ++  +   S +LQ E   Y  L++EF EK+RELRQLNGE+LQ L
Sbjct  61   SMMQLIDKHKVHSDRDMDSPDQLQSFNLQSEKKNYGILSREFAEKNRELRQLNGEELQGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE-------  696
            G+ EL+KLEK+VEGG+SR+M+ KG+  + EI++LKKKEA+L EEN+QLK++SE       
Sbjct  121  GLEELMKLEKIVEGGISRVMKIKGEKFMREISSLKKKEAQLQEENSQLKKQSEQARLNEV  180

Query  697  ---IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                 ++GG  +S++S+T    L    L   Y  S TSLKLGLP P
Sbjct  181  EGHNAIEGG--HSADSITTNRSLVNGHLD--YIDSVTSLKLGLPIP  222



>ref|NP_001274754.1| MADS transcriptional factor [Solanum tuberosum]
 gb|AAB94006.1| MADS transcriptional factor [Solanum tuberosum]
 gb|AAV65496.1| MADS11 [Solanum tuberosum]
Length=221

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++  E   S +L  E  T+A L+++F EK+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERDSMDNPEQLHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ +L+KLEK+VEGG+SR++R KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +  +
Sbjct  121  LGLDDLMKLEKLVEGGISRVLRIKGDKFMKEISSLKKKEAQLQEENSQLKQQSQARLNEE  180

Query  709  GG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+TN   L  +  QD Y  SDTSLKL L FP
Sbjct  181  GQNVIEQGHSADSITNNRSLV-NSHQD-YNDSDTSLKLCLAFP  221



>gb|AAV65497.1| MSM1 [Solanum macrocarpon]
 gb|ACH53557.1| MADS-box transcription factor MSM1 [Solanum macrocarpon]
Length=222

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 165/223 (74%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H    E+  +   E   S +LQ E  TYA L++E  EK+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKTQSERDNMNGSEQLKSSNLQSEKKTYAMLSRELVEKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ EL+KLEK+VEGG+SR+++ K D    EI++LKKKEA+L EEN+QLK +S+  +  +
Sbjct  121  LGLDELMKLEKLVEGGISRVLKIKSDKFTREISSLKKKEAQLQEENSQLKHQSQARLNEE  180

Query  709  GGPP----YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+TN   L     QD Y  SDTSLKLGL FP
Sbjct  181  GQNAIEQGHSADSITNNRSLVSSH-QD-YDDSDTSLKLGLGFP  221



>ref|XP_006351733.1| PREDICTED: MADS-box protein SVP [Solanum tuberosum]
Length=221

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++  E   S +L  E  T+A L+++F EK+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERDSMDNPEQLHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ +L+KLEK+VEGG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +  +
Sbjct  121  LGLDDLMKLEKLVEGGISRVLKIKGDKFMKEISSLKKKEAQLQEENSQLKQQSQARLNEE  180

Query  709  GG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+TN   L  +  QD Y  SDTSLKL L FP
Sbjct  181  GQNVIEQGHSADSITNNRSLV-NSHQD-YNDSDTSLKLCLAFP  221



>gb|ACH53556.1| MADS-box transcription factor MADS11 [Solanum tuberosum]
Length=221

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 169/223 (76%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++  E   S +L  E  T+A L+++F EK+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERDSMDNPEQLHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ +L+KLEK+VEGG+SR++  KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +  +
Sbjct  121  LGLDDLMKLEKLVEGGISRVLXIKGDKFMKEISSLKKKEAQLQEENSQLKQQSQARLNEE  180

Query  709  GG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+TN   L  +  QD Y  SDTSLKL L FP
Sbjct  181  GQNVIEQGHSADSITNNRSLV-NSHQD-YNDSDTSLKLCLAFP  221



>ref|XP_006487503.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X3 [Citrus 
sinensis]
Length=212

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 4/215 (2%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KIEIKKIDN TARQVTFSKRRRGLFKKAQELSTLCD ++ LIVFS TG+L  YS+S
Sbjct  1    MTRQKIEIKKIDNPTARQVTFSKRRRGLFKKAQELSTLCDAEVALIVFSTTGRLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++VI RH++H + +   + QPS  LQ ES TYA L+KE  +++RELRQ+ GE+LQEL 
Sbjct  61   SMKQVIDRHNLHSQNLHKFD-QPSLQLQLESSTYAILSKEMADRTRELRQMKGEELQELN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            M EL++LEK +EGGLSR+++ KG+ LL+EI+AL++KEA+L EEN +LKQ  E G+     
Sbjct  120  MEELMRLEKSLEGGLSRVVQTKGERLLNEIDALRRKEAQLTEENLRLKQH-ETGINTNVQ  178

Query  721  YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
              S + T  C    D  QD  +SS+TSLKLGLPFP
Sbjct  179  GHSFN-TFICSSSGDNSQDR-ESSNTSLKLGLPFP  211



>ref|XP_004230624.1| PREDICTED: MADS-box protein SVP [Solanum lycopersicum]
Length=215

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 166/223 (74%), Gaps = 16/223 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +M ++I +H M  E+  ++  E   S ++  E  T+A L ++F EK+RELRQL+GE+LQ 
Sbjct  61   SMMQLIEKHKMQSERDGMDNPEQLHSSNILSEKKTHAMLNRDFVEKNRELRQLHGEELQG  120

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ  708
            LG+ EL+KLEK+VEGG+SR+++ KGD  + EI++LKKKEAKL EEN+QLK++S+  +  +
Sbjct  121  LGLDELMKLEKLVEGGISRVLKIKGDKFMKEISSLKKKEAKLQEENSQLKKQSQARLNEE  180

Query  709  GG----PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            G       +S++S+TN   L  D        SDTSLKL L FP
Sbjct  181  GQNVIEQGHSADSITNNRSLVND--------SDTSLKLCLAFP  215



>ref|XP_006487501.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487502.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Citrus 
sinensis]
Length=213

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 5/216 (2%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KIEIKKIDN TARQVTFSKRRRGLFKKAQELSTLCD ++ LIVFS TG+L  YS+S
Sbjct  1    MTRQKIEIKKIDNPTARQVTFSKRRRGLFKKAQELSTLCDAEVALIVFSTTGRLFDYSSS  60

Query  361  -NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             +M++VI RH++H + +   + QPS  LQ ES TYA L+KE  +++RELRQ+ GE+LQEL
Sbjct  61   RSMKQVIDRHNLHSQNLHKFD-QPSLQLQLESSTYAILSKEMADRTRELRQMKGEELQEL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             M EL++LEK +EGGLSR+++ KG+ LL+EI+AL++KEA+L EEN +LKQ  E G+    
Sbjct  120  NMEELMRLEKSLEGGLSRVVQTKGERLLNEIDALRRKEAQLTEENLRLKQH-ETGINTNV  178

Query  718  PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
               S + T  C    D  QD  +SS+TSLKLGLPFP
Sbjct  179  QGHSFN-TFICSSSGDNSQDR-ESSNTSLKLGLPFP  212



>gb|AFA37970.1| SVP4 [Actinidia chinensis]
Length=215

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATG+L  YS+S
Sbjct  1    MVRQRIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGRLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH++  + +   ++QPS  LQ E+ TYA L  E  E++RELRQL GE+L  LG
Sbjct  61   SMNQVIERHNLQGDNL-VQQNQPSLELQLENSTYAMLCNEVEERTRELRQLRGEELHGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL  LEK +EGGL RI++ K +    EI ALK+KE +L EEN  L+QR +I V    P
Sbjct  120  VEELKNLEKSLEGGLGRILKTKDERFEKEITALKRKETRLREENLWLQQRLQI-VNASTP  178

Query  721  ---YSSESVT-NGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                SSES+T NG    P   QD Y SSDTSLKL LPFP+
Sbjct  179  EQGQSSESITNNGSSTAPP--QD-YDSSDTSLKLSLPFPN  215



>gb|AFA37966.1| SVP4 [Actinidia deliciosa]
Length=215

 Score =   204 bits (519),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 156/219 (71%), Gaps = 7/219 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATG+L  YS+S
Sbjct  1    MVRQRIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGRLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH++    +  + +QPS  LQ E+ TYA L  E  EK+RELRQL GE+L  LG
Sbjct  61   SMNQVIERHNLQGNNLVQL-NQPSLELQLENSTYAMLCNEVEEKTRELRQLRGEELHGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL KLEK +E GL R+++ K +    EI ALK+KE +L EEN  L+QR +I     P 
Sbjct  120  VEELKKLEKSLEEGLGRVLKTKDEKFEKEITALKRKETRLREENLWLQQRLQIANASTPE  179

Query  721  --YSSESVT-NGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
               SSES+T NG    P   QD Y SSDTSLKL LPFP+
Sbjct  180  QGQSSESITNNGSSTAPP--QD-YDSSDTSLKLSLPFPN  215



>dbj|BAB70736.1| putative MADS-domain transcription factor MpMADS1 [Magnolia praecocissima]
Length=229

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 159/231 (69%), Gaps = 21/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  YS+S
Sbjct  1    MARGKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E+I RH+MH + ++ ++ QPS  LQ E+  Y  L+K+  EKS  +RQ+ GED+Q L 
Sbjct  61   SMKEIIERHTMHSKNLQKLDQQPSLELQLENSNYNRLSKQVAEKSHLIRQMRGEDIQGLT  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL KLEK +E GLSR+M +K + ++ EI+ L+ K  KLMEEN +L+QR          
Sbjct  121  VEELQKLEKTLETGLSRVMERKAEQIMKEISGLQIKGVKLMEENMRLRQRIIEMSRGDSK  180

Query  691  -------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   SEI V      SS+SVTN C       QD Y+SSDTSLKLG+PF
Sbjct  181  GDRQIIESEI-VVNEDGQSSDSVTNACN--SGAPQD-YESSDTSLKLGVPF  227



>gb|AIK35209.1| MADS-box transcription factor protein 1 [Camellia sinensis]
Length=218

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 162/220 (74%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IKKIDN+TARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSATG+L  Y++S
Sbjct  1    MVRQRIQIKKIDNVTARQVTFSKRRRGLFKKAHELSTLCDAEIALIVFSATGRLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +  +VI RH++  + +  + +QPS  LQ E+ T A L+KE  E++ ELRQL GE+L ELG
Sbjct  61   STRQVIERHNLQPQNLVQL-NQPSLELQLENSTRAMLSKEAEERTLELRQLRGEELHELG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG-VQGGP  717
              EL KLEK +EGGLSR+++ K D +  EI AL++KEA+LMEENA  KQ+ ++  V  G 
Sbjct  120  FEELKKLEKSLEGGLSRVLKTKDDRVEKEIAALRRKEARLMEENAWSKQQVQMQIVNMGQ  179

Query  718  P----YSSESVT-NGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            P     SSES+T NG  + P   QD Y SSDTSLKLGLP+
Sbjct  180  PQEQGQSSESITNNGSTVAPP--QD-YDSSDTSLKLGLPY  216



>ref|XP_002285687.1| PREDICTED: MADS-box protein SVP [Vitis vinifera]
 ref|XP_010664403.1| PREDICTED: MADS-box protein SVP [Vitis vinifera]
 emb|CBI19262.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   194 bits (494),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 160/229 (70%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN++ARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIKIRKIDNVSARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R++MH   +E +E  PS  LQ E+  +  L+KE  +KS +LRQ+ GED+Q L 
Sbjct  61   SMKDILGRYTMHSNNLEKLEG-PSLELQLENSNHVRLSKEIADKSHQLRQMRGEDIQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG--  714
            + EL+KLEKM+E GLSR+++ K D +++EI  L+ K A+LMEEN +L+Q+ EI  +G   
Sbjct  120  IEELLKLEKMLEAGLSRVLKSKSDRIMTEIATLQTKGAQLMEENNKLRQKMEIICKGKRL  179

Query  715  -----------PPYSSESVTN--GCCLFPDKLQDHYKSSDTSLKLGLPF  822
                          SSES+TN   C   P +  D   SSDTSLKLGLPF
Sbjct  180  MTMESDNMILEEGQSSESITNVYSCSSGPPQEDD---SSDTSLKLGLPF  225



>ref|XP_008235579.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235586.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235594.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235603.1| PREDICTED: MADS-box protein SVP [Prunus mume]
Length=228

 Score =   194 bits (494),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 157/228 (69%), Gaps = 16/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAQELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            + +E++ RH++H + +  +E QPS  LQ  E+  Y+ L+KE T +S++LRQ+ GED+Q L
Sbjct  61   STKEILERHNLHAKNLSKIE-QPSLELQLVENSNYSALSKEITAQSQQLRQIRGEDIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------SEI  699
             + EL +LEK +E GL R++ KKG+ ++ EI+ L+    +L+EEN +L+Q+      S+ 
Sbjct  120  NLEELQQLEKSLEAGLGRVIEKKGEKIMKEISDLESNAMRLVEENERLRQQVLEKHNSQR  179

Query  700  GVQGGPP-------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             V+            SSESVT   C      QD Y+SSDTSLKLGLP+
Sbjct  180  PVRADSENMVMEEGQSSESVTTNLCNSNSAPQD-YESSDTSLKLGLPY  226



>ref|XP_011087945.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Sesamum indicum]
Length=221

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 160/226 (71%), Gaps = 17/226 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I RHS+  EK      QP  + Q  S  +A ++KE  + + EL+QL GE+LQ LG
Sbjct  61   SMMQLIQRHSLQSEKSNKPGQQPLHT-QSGSSNHAKISKELGDLTLELKQLMGEELQGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLK----QRSEIGV-  705
            M++L+KLEK+VE GL+R+ + K D LLSEI+ LK +E++LM ENA+LK    QR ++G  
Sbjct  120  MSDLMKLEKLVETGLNRVGKTKNDKLLSEISKLKTRESELMAENARLKQEANQRQKLGCA  179

Query  706  -----QGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                 QG    S+ES+TN      D +    + SDTSLKLGLPF +
Sbjct  180  RNGMEQGN---SAESITN---FHQDLVHRPDEDSDTSLKLGLPFSN  219



>ref|XP_009783886.1| PREDICTED: MADS-box protein JOINTLESS-like [Nicotiana sylvestris]
Length=235

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 158/235 (67%), Gaps = 23/235 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ R  +H + +E ++H PS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKEILERRDLHSKNLEKLDH-PSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GL+R++ +KGD ++SEIN L++K  +LMEEN +LKQ+         
Sbjct  120  SIEELQQLERSLEAGLTRVIERKGDKIMSEINQLQQKGMQLMEENERLKQQVMEISNNGY  179

Query  691  -----------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                       SE G       SSESVTN C       QD   SSDTSLKLGLP+
Sbjct  180  NNPAAVLVAVESENGYINEEGQSSESVTNACNSTGPPPQDD-DSSDTSLKLGLPY  233



>ref|XP_010254525.1| PREDICTED: MADS-box protein SVP isoform X2 [Nelumbo nucifera]
Length=224

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 158/227 (70%), Gaps = 16/227 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ RH++H + ++ ++ QPS  LQ E+  YA L+KE  EKS +LR++ GEDLQ L 
Sbjct  61   SMKEILERHNLHSKNLQKLD-QPSLELQLENSNYARLSKEVAEKSHQLRRMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RSE  696
            + +L +LEK +E GLSR++  KG+ ++ EI+ L++K  +L+EEN +LKQ        +  
Sbjct  120  IEDLQQLEKSLETGLSRVLETKGERIMKEISNLERKGMELLEENERLKQQMMEMSKGQKH  179

Query  697  IGVQG-----GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            +G            SS+SVTN  C      QD Y SSDTSLKLGLPF
Sbjct  180  VGADSENIVYEEGQSSDSVTN-VCSSSGPPQD-YDSSDTSLKLGLPF  224



>ref|XP_010254524.1| PREDICTED: MADS-box protein SVP isoform X1 [Nelumbo nucifera]
Length=226

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 161/229 (70%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ RH++H + ++ ++ QPS  LQ E+  YA L+KE  EKS +LR++ GEDLQ L 
Sbjct  61   SMKEILERHNLHSKNLQKLD-QPSLELQLENSNYARLSKEVAEKSHQLRRMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE-IGVQGGP  717
            + +L +LEK +E GLSR++  KG+ ++ EI+ L++K  +L+EEN +LKQ+ + + +  G 
Sbjct  120  IEDLQQLEKSLETGLSRVLETKGERIMKEISNLERKGMELLEENERLKQQLQMMEMSKGQ  179

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +              SS+SVTN  C      QD Y SSDTSLKLGLPF
Sbjct  180  KHVGADSENIVYEEGQSSDSVTN-VCSSSGPPQD-YDSSDTSLKLGLPF  226



>ref|XP_009631749.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Nicotiana 
tomentosiformis]
Length=233

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 160/235 (68%), Gaps = 23/235 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MV+ KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MVKDKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++  + ++ +E QPS  LQ  E+  YA L KE ++KS +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHNLLSKNLQKLE-QPSLELQLVENSDYARLTKEISQKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + +L +LE+ +E GLSR++  KGD ++ EIN L+ K  +LMEEN +LKQ+         
Sbjct  120  SVEQLQQLERSLEAGLSRVIENKGDKIMKEINQLQVKGMQLMEENERLKQQVMEISNNSS  179

Query  691  --SEIGVQGGPP-------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPFP  825
                I V  G          SSESV N C    P  L+DH  SSDTSLKLGLP+P
Sbjct  180  KHPAIVVAVGSENIYYEERQSSESVNNACNSTSPPPLEDH--SSDTSLKLGLPYP  232



>ref|XP_011021843.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
 ref|XP_011021844.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
 ref|XP_011021845.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
Length=227

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 162/232 (70%), Gaps = 21/232 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R +I+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MARERIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E  T + L+KE  EKS +LRQ+ GEDL+ L
Sbjct  61   SMKEILERHNLHSKNLEKLE-QPSLELQLVEDSTCSRLSKEVAEKSHQLRQMRGEDLRGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL++LEK +E GLS ++ KKG+ +++EI  L++K  +LMEEN +LKQ+         
Sbjct  120  NIDELLQLEKSLEAGLSCVIEKKGEKIMNEITDLQRKGMQLMEENERLKQQVVEISNGRK  179

Query  691  ------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                    +G + G   SSESVTN  C     L D Y+SSDTSLKLGLPF +
Sbjct  180  HVTADSENVGYEEGQ--SSESVTN-VCNSNGPLHD-YESSDTSLKLGLPFSN  227



>ref|XP_002310310.1| SHORT VEGETATIVE PHASE family protein [Populus trichocarpa]
 gb|EEE90760.1| SHORT VEGETATIVE PHASE family protein [Populus trichocarpa]
Length=227

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 162/232 (70%), Gaps = 21/232 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R +I+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MARERIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E  T + L+KE  EKS +LRQ+ GEDL+ L
Sbjct  61   SMKEILERHNLHSKNLEKLE-QPSLELQLVEDSTCSRLSKEVAEKSHQLRQMRGEDLRGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL++LEK +E GLS ++ KKG+ +++EI  L++K  +LMEEN +LKQ+         
Sbjct  120  DIDELLQLEKSLEAGLSCVIEKKGEKIMNEITDLQRKGMQLMEENERLKQQVVEISNGRK  179

Query  691  ------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                    +G + G   SSESVTN  C     L D Y+SSDTSLKLGLPF +
Sbjct  180  HVTADSENVGYEEGQ--SSESVTN-VCNSNGPLHD-YESSDTSLKLGLPFSN  227



>gb|KDP29759.1| hypothetical protein JCGZ_18694 [Jatropha curcas]
Length=227

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 158/228 (69%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI N TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FSATGK+  Y +S
Sbjct  1    MAREKIQIKKIHNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKMFDYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQ-RESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+  ++ L+KE TEKS +LRQ+ GE+LQ L
Sbjct  61   SMKELLERHNLHSKNLEKLE-QPSLELQVVENTNHSRLSKEITEKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LEK +E GLSR++ KKG+ ++ EI+ L++K  +LMEEN +L+Q+      GG 
Sbjct  120  NIEELQRLEKSLEAGLSRVIEKKGEKIMKEIDELQRKGMQLMEENERLRQQVVEMSNGGK  179

Query  718  P-------------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                           SSESVTN C    +     Y+SSDTSLKLGLP+
Sbjct  180  QTAADSEIVVYEEGQSSESVTNVCN--SNGAPHDYESSDTSLKLGLPY  225



>ref|XP_008440538.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]
 ref|XP_008440540.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]
Length=228

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 158/227 (70%), Gaps = 14/227 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M + KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FSATGKL  YS+S
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ +I RH++H + ++ +E QPS  LQ  E+  Y  L KE  EK+ +LRQ+ GE+LQ L
Sbjct  61   SMKGIIERHNLHSKNLQKLE-QPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ-  708
             + EL +LEK +E GLSR+M KKG+ ++ EI  L++K A+LM+EN +LKQ++E   GV+ 
Sbjct  120  NIEELQQLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQAEKMNGVRH  179

Query  709  -GGPP--------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             G  P         SS SVT  C    +      +SSDTSLKLGLP+
Sbjct  180  LGVEPEILVVEDGQSSNSVTEVCVSNSNGPPQDLESSDTSLKLGLPY  226



>ref|XP_010277487.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Nelumbo nucifera]
 ref|XP_010277488.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Nelumbo nucifera]
Length=229

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 162/231 (70%), Gaps = 21/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ RH++H + +  ++ QPS  LQ E+  YA L+KE  EKS +LRQ+ GE+LQ L 
Sbjct  61   SMKEILERHNLHSKNLHKLD-QPSLELQLENSNYARLSKEVAEKSHQLRQMRGENLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-GVQGGP  717
            + EL +LEK +E GLSR++  KG+ ++ EI+ L++K  +L+EEN +LKQ+ +I  +  G 
Sbjct  120  IEELQQLEKSLETGLSRVLETKGERIMKEISTLQRKGVELLEENERLKQQLQIVEMSKGQ  179

Query  718  PY---------------SSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
             +               SS+SVTN C  + P   QD Y SSDTSLKLGLP+
Sbjct  180  RHIISAESENLVYEDGQSSDSVTNVCSSIGPP--QD-YDSSDTSLKLGLPY  227



>ref|XP_004143442.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
Length=228

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 158/227 (70%), Gaps = 14/227 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M + KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FSATGKL  YS+S
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ +I RH++H + ++ +E QPS  LQ  E+  Y  L KE  EK+ +LRQ+ GE+LQ L
Sbjct  61   SMKGIIERHNLHSKNLQKLE-QPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ-  708
             + EL +LEK +E GLSR+M KKG+ ++ EI  L++K A+LM+EN +LKQ++E   GV+ 
Sbjct  120  NIEELQQLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQAEKMNGVRH  179

Query  709  -GGPP--------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             G  P         SS SVT  C    +      +SSDTSLKLGLP+
Sbjct  180  LGVEPEILVVEDGQSSNSVTEVCVSNSNGPPQDLESSDTSLKLGLPY  226



>gb|EYU18428.1| hypothetical protein MIMGU_mgv1a013294mg [Erythranthe guttata]
Length=224

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 156/220 (71%), Gaps = 8/220 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD DI LIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIALIVFSATGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKV-ECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M E+I RH++  EK  + + +     +Q  S  +A L+KE  +++ EL+QL GE+LQEL
Sbjct  61   SMMELIQRHNVQSEKSNKLLGNTQHLHIQTASSNHAVLSKELADRTTELKQLMGEELQEL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
            G+ EL+K+EK+VE GLSR+ + K D LL++I+ +K +E +LMEEN  LKQ+ E+   G  
Sbjct  121  GLNELMKVEKLVEAGLSRVGKIKNDKLLNDISKMKTRELELMEENEWLKQQVEMQKPGCT  180

Query  718  ------PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                    S+ES+T    L P  L+     SDTSL+LGLP
Sbjct  181  RNTTEQGNSAESITICQSLVP-CLEADKSFSDTSLRLGLP  219



>ref|XP_007018219.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY15444.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=227

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 160/229 (70%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  ++ QPS  LQ E+  +  L+KEF+ KS +LRQ+ GEDLQ L 
Sbjct  61   SMRDILGRYNVHSNNLNKLD-QPSLELQLENSNHIRLSKEFSVKSHQLRQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEKM+E GL+R++  KG+ + SEI+AL++K  +L+EEN QLKQ+     +G  P
Sbjct  120  IDELQQLEKMLEAGLTRVLETKGERISSEISALERKGVQLLEENKQLKQKMVTLCKGKRP  179

Query  721  -------------YSSESVTN--GCCLFPDKLQDHYKSSDTSLKLGLPF  822
                          SSESVTN   C   P  L+D   SSDTSLKLGLPF
Sbjct  180  ILAESDAAVQEEGMSSESVTNVYSCSSGP-PLEDD--SSDTSLKLGLPF  225



>gb|AIY25020.1| short vegetative phase 1 [Dimocarpus longan]
Length=226

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 157/228 (69%), Gaps = 18/228 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E ++ QPS  LQ  E+ +Y  L+KE  +KS  LRQL GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLEKLD-QPSLELQLVENSSYTRLSKEIADKSHRLRQLRGEELQAL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + EL  LEK +E GLSR++ KKG  ++ EI+ L+ K  +LME+N +L+Q        R 
Sbjct  120  NIEELQVLEKSLEVGLSRVIEKKGQKIMKEISHLQAKGIQLMEDNERLRQQVVEITSGRR  179

Query  694  EIGVQGGPPY----SSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
             +G      Y    SSESVTN C    P      Y+SSDTSLKLGLP+
Sbjct  180  HVGDLENVVYEEGQSSESVTNPCNSTGPPH---DYESSDTSLKLGLPY  224



>ref|XP_007047796.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOX91953.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=224

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 157/225 (70%), Gaps = 14/225 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ L++FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDADVALVIFSSTGKLFQYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+   + L+KE  EKS +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLEKLE-QPSLELQLVENGNQSMLSKEVAEKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLK-----QRSEIG  702
             + EL +LEK +E GLSR++ KKG  ++ EIN L++K   LMEEN +LK      R +I 
Sbjct  120  SIEELQQLEKSLESGLSRVIEKKGQKIMREINDLQRKGMHLMEENERLKLQIFNGRKQIA  179

Query  703  -----VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                 V G    SSESVTN C    +     Y+SSDTSLKLGLP+
Sbjct  180  SDSEIVFGEDGQSSESVTNVCA--SNGTPHDYESSDTSLKLGLPY  222



>ref|XP_010277489.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 161/230 (70%), Gaps = 21/230 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ RH++H + +  ++ QPS  LQ E+  YA L+KE  EKS +LRQ+ GE+LQ L 
Sbjct  61   SMKEILERHNLHSKNLHKLD-QPSLELQLENSNYARLSKEVAEKSHQLRQMRGENLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR++  KG+ ++ EI+ L++K  +L+EEN +LKQ+  + +  G  
Sbjct  120  IEELQQLEKSLETGLSRVLETKGERIMKEISTLQRKGVELLEENERLKQQI-VEMSKGQR  178

Query  721  Y---------------SSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
            +               SS+SVTN C  + P   QD Y SSDTSLKLGLP+
Sbjct  179  HIISAESENLVYEDGQSSDSVTNVCSSIGPP--QD-YDSSDTSLKLGLPY  225



>gb|AFA37963.1| SVP1 [Actinidia deliciosa]
Length=227

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 161/231 (70%), Gaps = 23/231 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KI+N TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL HYS+S
Sbjct  1    MAREKIKIRKINNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFHYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ ++ RH++H + +E +E QPS  LQ  E+  Y  L+KE  EKS +LR++ GE+LQ L
Sbjct  61   DMKGILERHNVHSKNLEKLE-QPSTELQLVENSNYTRLSKEVVEKSHQLRKMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GL R++ KKG+ +++EI  L++K   LM+EN +L+Q+         
Sbjct  120  NIEELQQLERSLEAGLDRVIEKKGEKIMNEITHLQQKGMHLMDENERLRQQVMEACKARK  179

Query  691  -----SE--IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                 SE  I  QG    SSESVTN  C     +QD Y+SSDTSLKLGLP+
Sbjct  180  HSATDSENVINEQG---QSSESVTN-ICNSTGPMQD-YESSDTSLKLGLPY  225



>ref|XP_007205845.1| hypothetical protein PRUPE_ppa011063mg [Prunus persica]
 gb|EMJ07044.1| hypothetical protein PRUPE_ppa011063mg [Prunus persica]
Length=225

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 155/225 (69%), Gaps = 16/225 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAQELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +  +E QPS  LQ  E+  Y+ L+KE T +S++LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHAKNLSKIE-QPSLELQLVENSNYSALSKEITAQSQQLRQIRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------SEI  699
             + EL +LEK +E GL R++ KKG+ ++ EI+ L+    +L+EEN +L+Q+      S+ 
Sbjct  120  NLEELQQLEKSLEAGLGRVIEKKGEKIMKEISDLESNAMRLVEENERLRQQVLEKHNSQK  179

Query  700  GVQGGPP-------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
             V+            SSESVT   C      QD Y+SSDTSLKLG
Sbjct  180  PVRADSENIVMEEGQSSESVTTNLCNSNSAPQD-YESSDTSLKLG  223



>ref|XP_011099987.1| PREDICTED: MADS-box protein SVP-like [Sesamum indicum]
Length=229

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 160/229 (70%), Gaps = 17/229 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD D+GLI+FS+TGKL  +++S
Sbjct  1    MAREKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVGLIIFSSTGKLFEFASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E   ++ L KE  E+S +LR++ GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLDKLE-QPSLELQLVEDNDHSRLIKEVAERSHQLRRMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----SEIGV  705
             + EL  LE+ +E GLSR++ KKG+ ++ EIN L++K  +LMEEN +L+Q+    S  G 
Sbjct  120  SIEELQHLERSLEAGLSRVIDKKGEKIMKEINQLQEKGMQLMEENERLRQQVLDISNSGR  179

Query  706  QGGPP----------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            + G             SSESVTN  C      QD Y SSDTSLKLGLP+
Sbjct  180  KMGTADVENIVYEEGQSSESVTNANCSSAGPPQD-YDSSDTSLKLGLPY  227



>emb|CAX51221.1| MPF1-like-A [Withania sp. W010]
 emb|CAX51248.1| MPF1-like-A [Withania frutescens]
 emb|CAX51253.1| MPF1-like-A [Withania aristata]
 emb|CAX51254.1| MPF1-like-A [Withania aristata]
Length=194

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 144/186 (77%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQGEKRTYAKLSREFVEKNRELRQLHGEELQGLGLDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP------YSSESV  738
            GG+SR+++ KGD  + EIN+LKKKEA+L EEN+QLKQ+S+  + GG        +S++S+
Sbjct  121  GGISRVLKIKGDKYMREINSLKKKEAQLQEENSQLKQQSQARLNGGGKTAIEQGHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>gb|AGW23365.1| MADS box protein MADS63 [Gossypium hirsutum]
Length=217

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R +IEIKKI N  ARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSATGKL  YS++
Sbjct  1    MTRQRIEIKKIANTAARQVTFSKRRRGLFKKAHELSTLCDAEIALIVFSATGKLFKYSST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH +  E+++ +E  PS  LQ ES T++ L+KE  EK++ELRQL GEDL  L 
Sbjct  61   SMRQVIERHRLQSERIDGLEGAPSVELQLESATHSVLSKEIAEKTQELRQLRGEDLHGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE---IGVQG  711
            + +L +LEK+V+GGLS+I   K +  L EI+ L+KK A+L EEN  LKQ+ E   + V+G
Sbjct  121  LDQLKQLEKLVQGGLSQITETKDERFLKEISTLEKKGAELKEENLILKQQVENLPLVVKG  180

Query  712  GP--PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
             P  P+     +      P      Y +SD SL LGLPFP
Sbjct  181  QPSEPFPHLHKSGD----PPPPPQGYNTSDISLTLGLPFP  216



>ref|XP_006487504.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X4 [Citrus 
sinensis]
Length=202

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KIEIKKIDN TARQVTFSKRRRGLFKKAQELSTLCD ++ LIVFS TG+L  YS+S
Sbjct  1    MTRQKIEIKKIDNPTARQVTFSKRRRGLFKKAQELSTLCDAEVALIVFSTTGRLFDYSSS  60

Query  361  -NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             +M++VI RH++H + +   + QPS  LQ ES TYA L+KE  +++RELRQ+ GE+LQEL
Sbjct  61   RSMKQVIDRHNLHSQNLHKFD-QPSLQLQLESSTYAILSKEMADRTRELRQMKGEELQEL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEI  630
             M EL++LEK +EGGLSR+++ KG+ LL+EI
Sbjct  120  NMEELMRLEKSLEGGLSRVVQTKGERLLNEI  150



>emb|CAX51215.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 144/186 (77%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQGEKRTYAKLSREFVEKNRELRQLHGEELQGLGLDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  + GG        +S++S+
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLKQQSQARLNGGGQNAIEQGHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>gb|AFA37967.1| SVP1 [Actinidia chinensis]
Length=227

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 160/231 (69%), Gaps = 23/231 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KI+N TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL HYS++
Sbjct  1    MAREKIKIRKINNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFHYSST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ ++ RH++H + +E +E QPS  LQ  E+  Y  L+KE  EKS +LR++ GE+LQ L
Sbjct  61   DMKGILERHNVHSKNLEKLE-QPSTELQLVENSNYTRLSKEVVEKSHQLRKMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GL R++ KKG+ +++EI  L++K   LM+EN +L+Q+         
Sbjct  120  NIEELQQLERSLEAGLGRVIEKKGEKIMNEITHLQQKGMHLMDENERLRQQVMEACKARK  179

Query  691  -------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   + I  QG    SSESVTN  C     +QD Y+SSDTSLKLGLP+
Sbjct  180  HSATDSDNVINEQG---QSSESVTN-ICNSTGPMQD-YESSDTSLKLGLPY  225



>ref|XP_006573007.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Glycine max]
Length=203

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 150/215 (70%), Gaps = 15/215 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE  +E GL RI+ KKG+ ++SEI  L++K   LMEEN +LK+          
Sbjct  120  NIEELQQLEMSLETGLGRIIEKKGEKIMSEIADLQRKGMLLMEENERLKR----------  169

Query  718  PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +SSESVT  C      L   Y+SSDTSLKLGLP+
Sbjct  170  -HSSESVTYVCN--STGLPQDYESSDTSLKLGLPY  201



>gb|ABR18574.1| MPF1-like protein [Withania somnifera]
 gb|ABR18579.1| MPF1-like protein [Withania coagulans]
Length=197

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 141/182 (77%), Gaps = 8/182 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+V
Sbjct  61   ERDNMDSTEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        YS++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGYSTDS  180

Query  736  VT  741
            VT
Sbjct  181  VT  182



>ref|XP_011087946.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Sesamum indicum]
Length=219

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 158/226 (70%), Gaps = 19/226 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATGKL  YS+S
Sbjct  1    MVRQKIQIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I RHS+  EK      QP  + Q  S  +A ++KE  + +  L QL GE+LQ LG
Sbjct  61   SMMQLIQRHSLQSEKSNKPGQQPLHT-QSGSSNHAKISKELGDLT--LEQLMGEELQGLG  117

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLK----QRSEIGV-  705
            M++L+KLEK+VE GL+R+ + K D LLSEI+ LK +E++LM ENA+LK    QR ++G  
Sbjct  118  MSDLMKLEKLVETGLNRVGKTKNDKLLSEISKLKTRESELMAENARLKQEANQRQKLGCA  177

Query  706  -----QGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                 QG    S+ES+TN      D +    + SDTSLKLGLPF +
Sbjct  178  RNGMEQGN---SAESITN---FHQDLVHRPDEDSDTSLKLGLPFSN  217



>ref|XP_011016930.1| PREDICTED: MADS-box protein JOINTLESS [Populus euphratica]
Length=225

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 157/228 (69%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ +I+FSATGKL  YS+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++V+ R+++H   ++ + +QPS  LQ E+  +  L+KE +EKS +LR++ GEDLQ L 
Sbjct  61   SMKDVLARYNLHSNNLDKI-NQPSLELQLENSNHMRLSKEISEKSHQLRRMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR++  KG+ +++EI  L++K  +L+EEN QLKQ+     +G  P
Sbjct  120  IEELQQLEKALEVGLSRVLETKGERIMNEITTLERKGVQLLEENKQLKQKIATICKGKRP  179

Query  721  -------------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                          SSES TN C C     ++D   SSDTSLKLGL  
Sbjct  180  ALVDLDTAVQEEGMSSESTTNVCSCSSGPPVEDD--SSDTSLKLGLAI  225



>gb|ABR18600.1| MPF1-like protein [Physalis alkekengi]
 gb|ABR18601.1| MPF1-like protein [Physalis alkekengi]
Length=197

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 150/198 (76%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMVQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSPEQLQSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLGLDELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGGPP----YSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLHEENSQLKQQSQARLNEEGQNAIEQGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            +TN   L  +  QD+  S
Sbjct  181  ITNNLSLV-NSHQDYNDS  197



>gb|ACJ61500.1| MADS-box short vegitative phase [Glycine max]
Length=203

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 153/215 (71%), Gaps = 15/215 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS +CD D+ LI+FS+TGKL  YS+S
Sbjct  1    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE+ +E GL R++ KKG+ ++SEI  L++K   LMEEN +LK+          
Sbjct  120  NIEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKR----------  169

Query  718  PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +SSESVT   C      QD ++SSDTSLKLGLP+
Sbjct  170  -HSSESVTY-VCNSTGPPQD-FESSDTSLKLGLPY  201



>ref|XP_008237143.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Prunus mume]
Length=219

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 151/220 (69%), Gaps = 9/220 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  +++S
Sbjct  1    MTRRKIQIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEFTSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++++VI RH +     + + H PS  LQ ES T A L+KE  EK+ ELR+L GE+LQEL 
Sbjct  61   SVQQVIERHHLLSSDFDKLNH-PSLELQLESSTSAALSKEIAEKTHELRKLRGEELQELN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ-----RSEIGV  705
            M EL +LEK++  GL R+   K +I+L EI +LK K ++LM+EN +LKQ     R    +
Sbjct  120  MKELQELEKLLGSGLRRVRDAKCEIVLKEITSLKWKGSQLMQENKRLKQVMMENRQVQTL  179

Query  706  QGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            +     SSE +  G  +  D  QDH  SSD SLKLGL FP
Sbjct  180  ELEQGQSSEPI--GDFIHSDPSQDH-DSSDISLKLGLAFP  216



>ref|XP_006574410.1| PREDICTED: MADS-box protein SVP-like isoform X4 [Glycine max]
Length=210

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 153/215 (71%), Gaps = 15/215 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS +CD D+ LI+FS+TGKL  YS+S
Sbjct  8    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  67

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  68   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  126

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE+ +E GL R++ KKG+ ++SEI  L++K   LMEEN +LK+          
Sbjct  127  NIEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKR----------  176

Query  718  PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +SSESVT   C      QD ++SSDTSLKLGLP+
Sbjct  177  -HSSESVTY-VCNSTGPPQD-FESSDTSLKLGLPY  208



>gb|ABR18573.1| MPF1-like protein [Witheringia coccoloboides]
Length=197

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S  LQRE  TYA L++E+ EK+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSPEQLQSSYLQREKKTYAMLSREYVEKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGGPP----YSSES  735
            EGG+ R+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +  +G       +S++S
Sbjct  121  EGGIGRVLKIKGDKFMREISSLKKKEAQLQEENSQLKQQSQARLNEEGQNAIERGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            +TN   L     QD+  S
Sbjct  181  ITNNLSLVNSH-QDYNDS  197



>ref|XP_009623750.1| PREDICTED: MADS-box protein JOINTLESS [Nicotiana tomentosiformis]
Length=238

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 155/238 (65%), Gaps = 26/238 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M+E++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   GMKEILERRDLHSKNLEKLD-QPSLELQLVENSNYSKLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GL+R++ +KGD ++ EIN L++K  +LMEEN  LKQ+         
Sbjct  120  SIEELQQLERSLEAGLTRVIERKGDKIMREINQLQQKGMQLMEENEILKQQVMEISNNGY  179

Query  691  --------------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                          SE G       SSESVTN C       QD   SSDTSLKLGLP+
Sbjct  180  QNPAAAAELLIAVESENGFINEEGQSSESVTNACNSTGPPPQDD-DSSDTSLKLGLPY  236



>gb|AEX92969.1| MADS box protein 5, partial [Agave tequilana]
Length=229

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 157/226 (69%), Gaps = 16/226 (7%)
 Frame = +1

Query  184  VRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSN  363
             R KI I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD ++GLI+FSATGKL  +S+S+
Sbjct  1    AREKINIRKIDNTTARQVTFSKRRRGLFKKAEELSILCDAEVGLIIFSATGKLFEFSSSS  60

Query  364  MEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGM  543
             +E+I RHSMH +K+   E QPS  L  ++  YA L+K+  E SR+LR++ GEDLQ L +
Sbjct  61   TKEIIERHSMHSKKILSPE-QPSLDLNLQNSNYARLSKQVVETSRQLRKMRGEDLQGLTI  119

Query  544  AELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----SEIGVQ-  708
             EL  LEK +E GLSR++ +K + ++ +IN L++K  +LMEEN +L+Q+    S++G Q 
Sbjct  120  EELQNLEKTLETGLSRVLGRKSEQIMEQINGLQQKGLQLMEENTRLRQQVVDMSQVGKQV  179

Query  709  -----GGP---PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                  G      SS+SVTN      D  QD++ SSDTSLKL LP+
Sbjct  180  VTGLENGSHEEGQSSDSVTNASN--SDAPQDYHDSSDTSLKLCLPW  223



>emb|CAX51232.1| MPF1-like-A [Withania somnifera]
 emb|CAX51236.1| MPF1-like-A [Withania somnifera]
 emb|CAX51251.1| MPF1-like-A [Withania coagulans]
Length=194

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSTEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        YS++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGYSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>emb|CAX51214.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLI FSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIGFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQGEKRTYAKLSREFVEKNRELRQLHGEELQGLGLDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  + GG        +S++S+
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLKQQSQARLNGGGQNAIEQGHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>gb|AAR92206.1| MADS box transcription factor [Populus tomentosa]
Length=225

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 157/228 (69%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ +I+FSATGKL  YS+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+ V+ R+++H   ++ + +QPS  LQ E+  +  L+KE +EKS +LR++ GEDLQ L 
Sbjct  61   SMKGVLARYNLHSNNLDKI-NQPSLELQLENSNHMRLSKEVSEKSHQLRRMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR++  KG+ +++EI+ L++K  +L+EEN QLKQ+     +G  P
Sbjct  120  IEELQQLEKALEVGLSRVLETKGERIMNEISTLERKGVQLLEENKQLKQKIATITRGKRP  179

Query  721  -------------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                          SSES TN C C     ++D   SSDTSLKLGL  
Sbjct  180  ALVDLDTAVQEEGMSSESTTNVCSCSSGPPVEDD--SSDTSLKLGLAI  225



>ref|XP_009631750.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Nicotiana 
tomentosiformis]
Length=219

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 152/224 (68%), Gaps = 15/224 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MV+ KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MVKDKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++  + ++ +E QPS  LQ  E+  YA L KE ++KS +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHNLLSKNLQKLE-QPSLELQLVENSDYARLTKEISQKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + +L +LE+ +E GLSR++  KG  L+ E    ++ + ++ME +    +   I V  G 
Sbjct  120  SVEQLQQLERSLEAGLSRVIENKGMQLMEE---NERLKQQVMEISNNSSKHPAIVVAVGS  176

Query  718  P-------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPFP  825
                     SSESV N C    P  L+DH  SSDTSLKLGLP+P
Sbjct  177  ENIYYEERQSSESVNNACNSTSPPPLEDH--SSDTSLKLGLPYP  218



>gb|EYU30938.1| hypothetical protein MIMGU_mgv1a021820mg [Erythranthe guttata]
Length=235

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 159/232 (69%), Gaps = 19/232 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI+N+TARQVTFSKRRRGLFKKA+ELS LCD D+GLI+FS+TGKL  YS++
Sbjct  1    MAREKIKIKKIENVTARQVTFSKRRRGLFKKAEELSILCDADVGLIIFSSTGKLFEYSST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ RH++H + +  +E QPS  LQ  E  T + L KE  E+S++LR++ GE+L  L
Sbjct  61   SMKDIVERHNLHSKNLNRLE-QPSLELQLVEDSTISWLNKEVAERSQQLRRMRGEELDGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
            G+ EL +LEK +E GL+R+M KKG+ +++EIN L++K  +LMEEN  L+Q+         
Sbjct  120  GIEELHRLEKSLELGLNRVMEKKGEKIMNEINQLQEKGRQLMEENRLLRQQVADIENNGV  179

Query  691  --------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                    SE  V      SSESV N C    +  QD+Y  SDTSLKLGL +
Sbjct  180  GKKTVTTESEKMVYDEEGQSSESVANVCNSAGEHPQDYYDCSDTSLKLGLVY  231



>ref|XP_007042844.1| MIKC mads-box transcription factor, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98675.1| MIKC mads-box transcription factor, putative isoform 1 [Theobroma 
cacao]
Length=219

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 148/224 (66%), Gaps = 13/224 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I L+VFSATGKL  YS++
Sbjct  1    MTRQKIQIKKIDNTAARQVTFSKRRRGLFKKAHELSTLCDAEIALVVFSATGKLFEYSST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +  +VI R ++  E+   ++  PS  +Q ES  +A L KE  EK+RELR L GE+LQ L 
Sbjct  61   STGQVIERRNLQSERTNGLDRVPSLEMQIESSAHAMLGKEIAEKNRELRHLRGEELQGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RSE  696
            + EL  LEK++E GLSR+   K +  L EI+ LK+K A+LMEEN QLKQ        ++ 
Sbjct  121  LEELKHLEKLLEAGLSRVTETKDERFLKEISNLKRKGAELMEENQQLKQQIGNSSMDQAI  180

Query  697  IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
            +  QG P  S+  V     +  D  Q  Y +SD SL+LGLPFP+
Sbjct  181  VPQQGQPSESAARV----WISADPPQG-YNNSDISLRLGLPFPN  219



>ref|XP_003517407.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Glycine max]
 ref|XP_006573006.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Glycine max]
 gb|KHN14511.1| MADS-box protein SVP [Glycine soja]
Length=227

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 153/229 (67%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE  +E GL RI+ KKG+ ++SEI  L++K   LMEEN +LK R   G+  G 
Sbjct  120  NIEELQQLEMSLETGLGRIIEKKGEKIMSEIADLQRKGMLLMEENERLK-RHVAGIINGQ  178

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +              SSESVT  C      L   Y+SSDTSLKLGLP+
Sbjct  179  RHGGAESENFVMDEGQSSESVTYVCN--STGLPQDYESSDTSLKLGLPY  225



>gb|ABR18569.1| MPF1-like protein [Capsicum baccatum]
Length=193

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 144/192 (75%), Gaps = 7/192 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  KVECVEHQ-PSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVEG  579
            +      Q  S +LQ E  TYA L+++F EK+RELRQL+GE+LQ LG+ EL+KLEK+VEG
Sbjct  61   RDNNTPEQLQSSNLQSEKKTYATLSRDFVEKNRELRQLHGEELQGLGLDELMKLEKLVEG  120

Query  580  GLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGGPP----YSSESVT  741
            G+SR+++ KGD  + EI++LK+KEA+L EEN+QLKQ+S+  +  +G       +S++S+T
Sbjct  121  GISRVLKFKGDKFMREISSLKRKEAQLQEENSQLKQQSQARLNEEGQNAIEQGHSADSIT  180

Query  742  NGCCLFPDKLQD  777
            N   L     QD
Sbjct  181  NNRSLVNSSHQD  192



>gb|ACV74250.1| EXTRAPETALS [Petunia x hybrida]
 gb|ACY82403.1| MADS-box protein 20 [Petunia x hybrida]
Length=233

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 158/235 (67%), Gaps = 25/235 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ R  +H + +E ++ QPS  LQ  E+  Y+ L++E +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKEILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSREISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS-EIGVQG-  711
             + EL +LE+ +E GL R++ +KGD ++ EIN L++K  +LMEEN +L+Q+  EI   G 
Sbjct  120  SIEELQQLERTLEAGLGRVIERKGDKIMREINQLQQKGLELMEENEKLRQQVMEISNNGY  179

Query  712  -GPPY----------------SSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
              P                  SSESVTN C    P +  D   SSDTSLKLGLP+
Sbjct  180  KNPAAAVVAVELENAANEEGQSSESVTNACNSTGPPQDDD---SSDTSLKLGLPY  231



>ref|XP_009364259.1| PREDICTED: MADS-box protein JOINTLESS-like [Pyrus x bretschneideri]
 ref|XP_009364260.1| PREDICTED: MADS-box protein JOINTLESS-like [Pyrus x bretschneideri]
Length=227

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 155/228 (68%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+  Y  L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLEKLE-QPSLQLQLVENSNYTMLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + EL +LEK +E GL R++ KK + ++ EI  L++   +LMEEN +L+Q        R 
Sbjct  120  NLEELQQLEKSLETGLGRVIEKKSEKIMKEIGDLQRNGMQLMEENERLRQEVAEKSDGRR  179

Query  694  EIGVQGGPPY-----SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             + V     +     SSESVTN C    +  QD Y SSDTSLKLGLP+
Sbjct  180  LVQVDSENMFTEEGQSSESVTNPCN-SNNGPQD-YDSSDTSLKLGLPY  225



>emb|CAX51216.1| MPF1-like-A [Withania somnifera]
 emb|CAX51218.1| MPF1-like-A [Withania sp. W011]
 emb|CAX51220.1| MPF1-like-A [Withania sp. W010]
 emb|CAX51235.1| MPF1-like-A [Withania somnifera]
 emb|CAX51244.1| MPF1-like-A [Withania riebeckii]
 emb|CAX51249.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSTEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSMLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>emb|CDP01559.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 160/229 (70%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALILFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+   + L+KE  EKS +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLEKME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIGVQGG  714
             + +L +LE+ +E GL+R++ KKG+ ++ EIN L++K  +LMEEN +LKQ+  E+    G
Sbjct  120  TVDDLQQLERSLEAGLNRVIEKKGEKIMKEINHLQRKGMQLMEENERLKQQVMEVSNGSG  179

Query  715  -------------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                            SSESVTN  C      QD Y+SSDTSLKLGLP+
Sbjct  180  QMAADDSENVLYEEGQSSESVTN-VCSSTGGPQD-YESSDTSLKLGLPY  226



>gb|AIK35210.1| MADS-box transcription factor protein 2 [Camellia sinensis]
Length=230

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 159/228 (70%), Gaps = 12/228 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IKKIDN+T+RQVTFSKRR+GLFKKAQELSTLCD +I LIVFSATGKL  +S+S
Sbjct  1    MVRQRIQIKKIDNVTSRQVTFSKRRKGLFKKAQELSTLCDAEIALIVFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH++    +  + +QPS   Q E+     L+KE  +K  ELRQL GE+LQ L 
Sbjct  61   SMRQVIERHNLESGNLVNL-NQPSLEQQLENSGCTILSKEVNKKIHELRQLRGEELQGLD  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG-VQGGP  717
              EL  LEK +EGGLSR+++ KG+I+  EI A ++KEA+L+EEN  LKQ+  +  V+ G 
Sbjct  120  AEELKNLEKSLEGGLSRVLKTKGEIMEKEITARERKEARLVEENVWLKQKVPMEIVKIGQ  179

Query  718  PY------SSESVT-NGCCLFPDKLQDHYKSSDTSLKLGLPFPD*GLK  840
             +      S+E +T NG    P +  D   SSDTSLKLGLPFP+  L+
Sbjct  180  THDDQQGQSAEFITNNGSSAAPPQDND---SSDTSLKLGLPFPELNLR  224



>gb|ABR18582.1| MPF1-like protein [Tubocapsicum anomalum]
Length=197

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 145/190 (76%), Gaps = 14/190 (7%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  Y++S+M ++I +H M +
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYASSSMMQLIEKHKMQL  60

Query  400  EKV--ECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+V  +  E   S +LQ E  TYA L+++F EK+RELRQL+GE+LQ L + EL+KLEK+V
Sbjct  61   ERVNMDSPEQLQSSNLQSEKKTYAMLSRDFVEKNRELRQLHGEELQGLDLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGV---------QGGPPYS  726
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +         QG   +S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLKQQSQARLNEEVQNVIEQG---HS  177

Query  727  SESVTNGCCL  756
            ++S+TN   L
Sbjct  178  ADSITNNRSL  187



>emb|CAX51247.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  KVECV--EHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +   V  E   S SLQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMVSTEQLLSSSLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG  714
            GG+SR++R KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG
Sbjct  121  GGISRVLRVKGDKYVREISSLKKKEAQLQEENSMLKQQSQARLNGG  166



>ref|NP_001240951.1| MADS-box protein SVP-like [Glycine max]
 ref|XP_006574408.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Glycine max]
 ref|XP_006574409.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Glycine max]
 gb|ABY78023.1| short vegetative phase-like protein [Glycine max]
 gb|KHN00417.1| MADS-box protein SVP [Glycine soja]
Length=227

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 156/229 (68%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS +CD D+ LI+FS+TGKL  YS+S
Sbjct  1    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE+ +E GL R++ KKG+ ++SEI  L++K   LMEEN +LK R   G+  G 
Sbjct  120  NIEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLK-RHVAGIINGQ  178

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +              SSESVT   C      QD ++SSDTSLKLGLP+
Sbjct  179  RHGGAESENFVMDEGQSSESVTY-VCNSTGPPQD-FESSDTSLKLGLPY  225



>gb|ABR18604.1| MPF1-like protein [Dunalia fasciculata]
 gb|ABR18605.1| MPF1-like protein [Iochroma australe]
Length=197

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 146/187 (78%), Gaps = 8/187 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H++  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHTLQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA +++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSPEQLHSSNLQSEKKTYAKVSREFVEKNRELRQLHGEELQGLGLDELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L +EN+QLKQ+++  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQDENSQLKQQTQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCL  756
            +TN   L
Sbjct  181  ITNNLSL  187



>emb|CAX51239.1| MPF1-like-A [Withania somnifera]
Length=194

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 139/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKR RGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRSRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSTEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        YS++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGYSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>ref|XP_004288518.1| PREDICTED: MADS-box protein JOINTLESS-like [Fragaria vesca subsp. 
vesca]
Length=232

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 155/233 (67%), Gaps = 22/233 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGL KKA+ELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLLKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + ++ +E QPS  LQ  E+  Y+ L+KE T KS +LRQ+ GE+L  L
Sbjct  61   SMKEILERHHLHSKNLDKLE-QPSLELQLVENSNYSRLSKEITAKSHQLRQMRGEELHGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKK----GDILLSEInalkkkeaklmeenaQLKQRSEIGV  705
             + EL +LEK +E G+ R++ KK    G+ ++ EI  L++   +L+EEN +LKQ+     
Sbjct  120  NLEELQQLEKSLESGMGRVIEKKVILLGEKIMKEITDLQRNAIQLIEENERLKQQVVERT  179

Query  706  QGGPPY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             GG  +              SSESVTN  C   +  QD Y SSDTSLKLGLP+
Sbjct  180  DGGRRHVHADSDNRFTEEGQSSESVTN-LCNSNNSPQD-YDSSDTSLKLGLPY  230



>ref|XP_006574407.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Glycine max]
Length=234

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 156/229 (68%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS +CD D+ LI+FS+TGKL  YS+S
Sbjct  8    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  67

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L+KE  EKS +LRQL GEDLQ L
Sbjct  68   SMKEILERHHLHSKNLARME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGL  126

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE+ +E GL R++ KKG+ ++SEI  L++K   LMEEN +LK R   G+  G 
Sbjct  127  NIEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLK-RHVAGIINGQ  185

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +              SSESVT   C      QD ++SSDTSLKLGLP+
Sbjct  186  RHGGAESENFVMDEGQSSESVTY-VCNSTGPPQD-FESSDTSLKLGLPY  232



>gb|ABR18580.1| MPF1-like protein [Vassobia breviflora]
Length=197

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 146/187 (78%), Gaps = 8/187 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H++  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHTLQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA +++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDIMDSPEQLHSSNLQSEKKTYAKVSREFVEKNRELRQLHGEELQGLGLDELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L +EN+QLKQ+S+  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDRYMREISSLKKKEAQLQDENSQLKQQSQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCL  756
            +TN   L
Sbjct  181  ITNNLSL  187



>emb|CAX51213.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGL KKAQELSTLCD DIGLIVFSATGKL +YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLLKKAQELSTLCDADIGLIVFSATGKLFNYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQGEKRTYAKLSREFVEKNRELRQLHGEELQGLGLDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ +GD  + EI++LKKKEA+L EEN+QLKQ+S+  + GG        +S++ +
Sbjct  121  GGISRVLKIRGDKYMREISSLKKKEAQLQEENSQLKQQSQARLNGGGQSAIEQGHSTDFI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>ref|XP_006380343.1| hypothetical protein POPTR_0007s03260g [Populus trichocarpa]
 gb|ERP58140.1| hypothetical protein POPTR_0007s03260g [Populus trichocarpa]
Length=237

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 155/225 (69%), Gaps = 7/225 (3%)
 Frame = +1

Query  172  VVKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHY  351
            +VKM R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I L+VFSATGKL  Y
Sbjct  14   LVKMTRKKIQIKKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALMVFSATGKLFEY  73

Query  352  SNSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            SNS+M +VI R ++H + +  ++ QPS   Q +   +A L KE  +K+RELR + GEDLQ
Sbjct  74   SNSSMGQVIERRNLHPKNINTLD-QPSLEKQLDGGVHAMLIKEIAKKNRELRHMRGEDLQ  132

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR--SEIGV  705
             L + EL KLEK++EG L R++ +KG  +++EI+ALK K  +L+EEN +LKQ+  S +  
Sbjct  133  GLDLEELQKLEKIMEGSLRRLVEEKGGKIINEIDALKTKGEQLIEENQRLKQQVMSLLAG  192

Query  706  QGG---PPYSSES-VTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
            QG    P  SS+S VTN   +     +    SS   LKLGLPFPD
Sbjct  193  QGHLLEPGQSSDSLVTNISSMGSVDPRQDCDSSCAFLKLGLPFPD  237



>emb|CAX51231.1| MPF1-like-A [Withania somnifera]
Length=194

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 139/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++  +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFGYSSSSMMQLTEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSTEQLLSSNLQGEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        YS++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGYSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>emb|CAX51240.1| MPF1-like-A [Withania riebeckii]
Length=194

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLF+KAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFRKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   SP+LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSPEQLLSPNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S   + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSHARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>gb|AIA58526.1| SVP-like MADS-box protein [Carya cathayensis]
Length=227

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 156/229 (68%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGL KKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLLKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R+++    ++ ++ QPS  LQ E+  +  L+KE  +K+ +LRQ  GEDL+ L 
Sbjct  61   SMKDILERYNLQSNGIKQMD-QPSLELQLENNNHIRLSKEVADKTHQLRQTRGEDLEGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEKM+E GLSR++  K + LL+EI  L++K A+L+EEN QLKQ+  +  +G  P
Sbjct  120  LEELQQLEKMLEAGLSRVLETKEERLLTEITTLERKGAQLLEENRQLKQKMVMSSKGKRP  179

Query  721  -------------YSSESVTNGCCLF--PDKLQDHYKSSDTSLKLGLPF  822
                          SSESVTN C     P  L+D   SSDTSLKLGL  
Sbjct  180  VLVESDVLVQEEGMSSESVTNVCSSSGGPPSLEDD--SSDTSLKLGLSL  226



>ref|XP_004250145.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Solanum 
lycopersicum]
Length=242

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 157/242 (65%), Gaps = 30/242 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKQILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GLSR++ +KGD ++ EIN L++K   LMEEN +L+Q+         
Sbjct  120  NIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISNNNN  179

Query  691  ------SEIGVQGGPP------------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
                   E GV    P             SSESVTN C       QD   SSDTSLKLGL
Sbjct  180  NNNNGYREAGVVIFEPENGFNNNNNEDGQSSESVTNPCNSIDPPPQDD-DSSDTSLKLGL  238

Query  817  PF  822
            P+
Sbjct  239  PY  240



>emb|CAX51256.1| MPF1-like-B [Tubocapsicum anomalum]
Length=194

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 14/189 (7%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  Y++S+M ++I +H M +E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYASSSMMQLIEKHKMQLE  60

Query  403  KV--ECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +V  +  E   S +LQ E  TYA L+++F EK+RELRQL+GE+LQ L + EL+KLEK+VE
Sbjct  61   RVNMDSPEQLQSSNLQSEKKTYAMLSRDFVEKNRELRQLHGEELQGLDLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGV---------QGGPPYSS  729
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ+S+  +         QG   +S+
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLKQQSQARLNEEVQNVIEQG---HSA  177

Query  730  ESVTNGCCL  756
            +S+TN   L
Sbjct  178  DSITNNRSL  186



>ref|XP_011092451.1| PREDICTED: MADS-box protein SVP-like [Sesamum indicum]
Length=220

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 151/226 (67%), Gaps = 18/226 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KIEIKKI +L+ARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATGKL HYS+S
Sbjct  1    MVRQKIEIKKISDLSARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFHYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRE---SITYAGLAKEFTEKSRELRQLNGEDLQ  531
            +M ++I RH+   E  +   H   PSLQ +   S ++  L K   +K+ ELRQ+ GEDL+
Sbjct  61   SMMQIIRRHNRQSEDSKLGYH---PSLQFQTGSSDSHDMLRKHLADKTTELRQVKGEDLE  117

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG  711
             L M +L+KLEK+VEGGLSR+ + K D  L+ I+ LK +E++L++EN QLKQ +E    G
Sbjct  118  GLSMDDLMKLEKLVEGGLSRVAKTKDDKFLNLISMLKTRESELVKENTQLKQLAEKSRGG  177

Query  712  --GPPYSSESVTNG-----CCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                 +   ++TN       C   DK       SD SLKLGLP P+
Sbjct  178  LDNVVHHQANITNSHGLLVYCPAADK-----NDSDISLKLGLPCPN  218



>ref|XP_008237142.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Prunus mume]
Length=223

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 150/224 (67%), Gaps = 13/224 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  +++S
Sbjct  1    MTRRKIQIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEFTSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR------ESITYAGLAKEFTEKSRELRQLNGE  522
            ++++VI RH +     + + H PS  LQ       ES T A L+KE  EK+ ELR+L GE
Sbjct  61   SVQQVIERHHLLSSDFDKLNH-PSLELQSFCMSQLESSTSAALSKEIAEKTHELRKLRGE  119

Query  523  DLQELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG  702
            +LQEL M EL +LEK++  GL R+   K +I+L EI +LK K ++LM+EN +LKQ     
Sbjct  120  ELQELNMKELQELEKLLGSGLRRVRDAKCEIVLKEITSLKWKGSQLMQENKRLKQMENRQ  179

Query  703  VQG---GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            VQ        SSE +  G  +  D  QDH  SSD SLKLGL FP
Sbjct  180  VQTLELEQGQSSEPI--GDFIHSDPSQDH-DSSDISLKLGLAFP  220



>ref|XP_010942683.1| PREDICTED: MADS-box protein SVP-like [Elaeis guineensis]
 ref|XP_010942684.1| PREDICTED: MADS-box protein SVP-like [Elaeis guineensis]
Length=228

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 157/226 (69%), Gaps = 16/226 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+I+KIDN TARQVTFSKRRRGL KKA+ELS LCD ++ LIVFS+TGKL  YS+S
Sbjct  1    MVREKIQIRKIDNATARQVTFSKRRRGLLKKAEELSILCDAEVALIVFSSTGKLYEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E+I +HSMH + ++  + QP   L  E+  +A L+K+  + S +LRQ+ GE+L+ L 
Sbjct  61   SMKEIIEKHSMHSKNLQKPD-QPPLDLNLENSKHASLSKQVADMSLQLRQMRGEELEGLS  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----SEIGVQ  708
            + EL +LEK +E GLSR++ +KG+ ++ +IN L++K  KLMEEN +L+++    S +G Q
Sbjct  120  IEELQQLEKALEAGLSRVIDRKGEQIMEQINGLQQKGLKLMEENTRLREQVLKLSRVGKQ  179

Query  709  ---------GGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                          SSESVTN   L P   QD+  SSDTSLKLGLP
Sbjct  180  MMNDKENALNEDGQSSESVTN--VLNPGGSQDYDDSSDTSLKLGLP  223



>gb|ABR18575.1| MPF1-like protein [Withania somnifera]
 gb|ABR18578.1| MPF1-like protein [Withania coagulans]
Length=197

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 141/182 (77%), Gaps = 8/182 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  T+A L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+V
Sbjct  61   ERDNMDRTEQLLSSNLQSEKRTHAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGHSTDS  180

Query  736  VT  741
            VT
Sbjct  181  VT  182



>gb|ABR18581.1| MPF1-like protein [Tubocapsicum anomalum]
Length=197

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMLS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+V
Sbjct  61   ERDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLALDELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQGG--PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN QLKQ+S+      VQ      +S++S
Sbjct  121  EGGISRVVKIKGDKYMREISSLKKKEAQLQEENLQLKQQSQARLNEEVQNAIEQGHSTDS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            +TN   L     QD+  S
Sbjct  181  ITNNRSLVNSH-QDYNDS  197



>ref|XP_011043063.1| PREDICTED: MADS-box protein JOINTLESS-like [Populus euphratica]
Length=220

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 151/222 (68%), Gaps = 8/222 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN +ARQV+FSKRRRGLFKKA ELS LCD +I L+VFSATGK   YSNS
Sbjct  1    MTRKKIQIKKIDNTSARQVSFSKRRRGLFKKAFELSILCDAEIALMVFSATGKFFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI R ++H + ++    QPS  LQ +S  +A L KE  EK+RELR+  GEDLQ L 
Sbjct  61   SIGQVIERRNLHPKNLDTFS-QPSVELQLDSAVHAMLNKEIAEKTRELRRARGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG---  711
            M EL KLEK++EG L R+M  KG+ +L E++ALK KE +L+EEN +LKQR     +G   
Sbjct  120  MEELEKLEKLIEGSLCRVMETKGEKILREVDALKSKEHQLIEENQRLKQRLMSLSKGQGH  179

Query  712  --GPPYSSES-VTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                  SS+S VTN      ++ QD Y +  + L LGLPFPD
Sbjct  180  LLAQGQSSDSMVTNISSNSANRRQD-YDNICSFLTLGLPFPD  220



>ref|XP_008440541.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cucumis melo]
Length=214

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 145/227 (64%), Gaps = 28/227 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M + KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FSATGKL  YS+S
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ +I RH++H + ++ +E QPS  LQ  E+  Y  L KE  EK+ +LRQ+ GE+LQ L
Sbjct  61   SMKGIIERHNLHSKNLQKLE-QPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQ-  708
             + EL +LEK +E GLSR+M KK   L+ E              N +LKQ++E   GV+ 
Sbjct  120  NIEELQQLEKSLESGLSRVMEKKSAELMDE--------------NKRLKQQAEKMNGVRH  165

Query  709  -GGPP--------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             G  P         SS SVT  C    +      +SSDTSLKLGLP+
Sbjct  166  LGVEPEILVVEDGQSSNSVTEVCVSNSNGPPQDLESSDTSLKLGLPY  212



>gb|AFM77897.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 154/221 (70%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++H   ++ V  QPSP  Q E    + L++E  +K+++LR+L GEDL+ L 
Sbjct  61   RMRDILGRYNLHASNIDRVMGQPSPYHQVEDCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK++E GLSR+  KKG+ L+S+I++L+K+ ++L++EN +L++R  + ++    
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENKRLRERV-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     L+D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYESGAPLEDDF--SDTSLKLGLP  218



>emb|CBI38273.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 158/228 (69%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ +HS+  + +E +E QPS  LQ  E+  ++ L+KE  +KS +LRQ+ GE+LQ L
Sbjct  61   SMKEILEKHSLQSKNLEKLE-QPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + +L +LEK +E GLSR+++KKG+ ++ EI  L+ K  +LMEEN +L+Q        R 
Sbjct  120  NIEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRR  179

Query  694  EIGVQGGPPY-----SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            ++       +     SSESVTN         QD Y+SSDTSLKLGLP+
Sbjct  180  QVAGDSENMFHEEGQSSESVTN-VSNSNGPPQD-YESSDTSLKLGLPY  225



>gb|ABR18570.1| MPF1-like protein [Lycianthes biflora]
Length=194

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S + Q E  TYA L++EF EK+RELR L+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDSMDNPEQLQSSNFQSEKKTYAVLSREFVEKNRELRHLHGEELQGLGLDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGGPP----YSSESV  738
            GG+SR+++ KGD  + EI++LK+KEA+L EEN+QLKQ+S+  +  +G       +S++S+
Sbjct  121  GGISRVLKIKGDKFMKEISSLKRKEAQLQEENSQLKQQSQAILNEEGQNATEQGHSADSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>emb|CAN68106.1| hypothetical protein VITISV_009637 [Vitis vinifera]
Length=208

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 150/214 (70%), Gaps = 9/214 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN++ARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIKIRKIDNVSARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R++MH   +E +E  PS  LQ E+  +  L+KE  +KS +LRQ+ GED+Q L 
Sbjct  61   SMKDILGRYTMHSNNLEKLEG-PSLELQLENSNHVRLSKEIADKSHQLRQMRGEDIQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE-IGVQGGP  717
            + EL+KLEKM+E GLSR+++ K D +++EI  L+ K   + +    +   S+ + ++ G 
Sbjct  120  IEELLKLEKMLEAGLSRVLKSKSDRIMTEIATLQTKMEIICKGKRLMTMESDNMILEEGQ  179

Query  718  PYSSESVTN--GCCLFPDKLQDHYKSSDTSLKLG  813
              SSES+TN   C   P +  D   SSDTSLKLG
Sbjct  180  --SSESITNVYSCSSGPPQEDD---SSDTSLKLG  208



>dbj|BAN89455.1| short vegetative phase [Shorea beccariana]
Length=225

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 161/229 (70%), Gaps = 20/229 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            NM+++++R+++H   +  ++ QPS  LQ E+ +   L+KE  +KS +L+Q+ GEDLQ L 
Sbjct  61   NMKDILSRYNLHSSNINKLD-QPSLELQLEN-SNQMLSKEVADKSHQLKQMRGEDLQGLS  118

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL +LEKM+E GL+R++  KG+ +L+EI+AL++K A+L+EEN +LK +          
Sbjct  119  IEELQQLEKMLESGLTRVLETKGERILNEISALEQKGAELLEENKRLKDKMVALSKGKRP  178

Query  691  ----SEIGVQGGPPYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                S+I VQ     SSESVTN C C     + D   SSDTSLKLGL  
Sbjct  179  LPAESDIAVQ-EEGMSSESVTNVCSCNSGPPVDDD--SSDTSLKLGLSL  224



>gb|AHW58043.1| SVP-3 [Coffea arabica]
Length=239

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 148/221 (67%), Gaps = 16/221 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IK+IDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATGKL  Y +S
Sbjct  1    MVRQRIQIKRIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH +  E +   +  P    QRE+ T+A LA+E  EK+ ELR L GE+L  L 
Sbjct  61   SMMQVIERHRLCSEDIGRQDKHPPHLTQRENHTHAMLAEEIKEKTAELRHLKGEELVGLS  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            M +L+KLEK+VE GLSRI + KGD  + EI  LKKKEA L EENA+L+Q+     +   P
Sbjct  121  MEDLVKLEKLVEAGLSRIAKTKGDKFMKEIGILKKKEALLKEENAKLRQKVAGTSEDETP  180

Query  721  Y-----SSESVTN-----GCCLFPDKLQDHYKSSDTSLKLG  813
                  SSESVT      G C  P  L +    SDT L+LG
Sbjct  181  LLEQGISSESVTRLSDQAGSC--PQDLNN----SDTFLQLG  215



>emb|CAX51242.1| MPF1-like-A [Withania riebeckii]
Length=194

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQPE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>ref|XP_007158373.1| hypothetical protein PHAVU_002G147600g [Phaseolus vulgaris]
 gb|ESW30367.1| hypothetical protein PHAVU_002G147600g [Phaseolus vulgaris]
Length=227

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 151/228 (66%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YSNS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  ++ QPS  LQ  E+     L+KE  EKS  LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLAKMD-QPSLELQLVENSNCTRLSKEVAEKSHLLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG--  711
             + EL +LE+ +E GLSR++ KKG+ +++EI  L++K   LMEEN +LK      V G  
Sbjct  120  NIEELQQLERSLETGLSRVIEKKGEKIMNEITDLQRKGMVLMEENERLKHHVAGIVNGER  179

Query  712  -----------GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                           SSESVT   C      QD Y+SSDTSLKLGLP+
Sbjct  180  RGGAENENFVVDEGQSSESVTY-VCNSTGPPQD-YESSDTSLKLGLPY  225



>gb|AFI49342.1| jointless [Capsicum annuum]
Length=234

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 155/236 (66%), Gaps = 26/236 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+ GKL  YS+S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSNGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE++Q L
Sbjct  61   SMKQILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GLSR++ KKGD ++ EIN L+ K  +LMEEN +L+Q+         
Sbjct  120  NIEELQQLEKSLETGLSRVIEKKGDKIMREINQLQHKGMQLMEENEKLRQQVMEISSNKN  179

Query  691  -----------SEIGVQGGPPYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                        EI        SSESVTN C    P +  D   SSDTSLKLGLP+
Sbjct  180  NNGYKNPIVFEPEIEFNYEEGQSSESVTNPCNSTGPPQDDD---SSDTSLKLGLPY  232



>dbj|BAF46766.1| DNA-binding protein [Ipomoea nil]
Length=234

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 160/235 (68%), Gaps = 24/235 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN+TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS++ KL HYSNS
Sbjct  1    MARDKIQIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSAKLFHYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M E++ + ++H + ++ +  QPS  LQ  E+  ++  +KE  EK++ LRQ+  E+LQEL
Sbjct  61   SMREILEKRNLHSKNLQKMGLQPSVELQLVENSNHSRSSKEIAEKTQRLRQMRVEELQEL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ ++ GL  ++ KKG+ ++ EIN L++K   LMEEN +L+Q+         
Sbjct  121  SIEELQQLERSLQIGLDHVINKKGEKIMKEINQLQEKGVHLMEENDRLRQQVVETSKGQR  180

Query  691  --------SE--IGVQGGPPYSSESVTNGCCLFPDKLQDHYKS-SDTSLKLGLPF  822
                    SE  +  +GG   SSESVTN C  +P   QD+Y+  SDTSLKLGLP+
Sbjct  181  SMAVAPRDSENLLNEEGG--LSSESVTNACK-YPGTPQDYYEDCSDTSLKLGLPY  232



>gb|AHW58026.1| SVP-1 [Coffea arabica]
Length=232

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 159/229 (69%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALILFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+   + L+KE  EKS +LRQ+  E+LQ L
Sbjct  61   SMKEILERHNLHSKNLEKME-QPSLELQLVENSNCSRLSKEVAEKSHQLRQMRREELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIGVQGG  714
             + +L +LE+ +E GL+R++ KKG+ ++ EIN L++K  +LMEEN +LKQ+  E+    G
Sbjct  120  TVDDLQQLERSLEAGLNRVIEKKGEKIMKEINHLQRKGMQLMEENERLKQQVMEVSNGSG  179

Query  715  -------------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                            SSESVTN  C      QD Y+SSDTSLKLGLP+
Sbjct  180  QMAADDSENVLYEEGQSSESVTN-VCSSTGGPQD-YESSDTSLKLGLPY  226



>gb|ABR18598.1| MPF1-like protein [Physalis coztomatl]
Length=197

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 149/201 (74%), Gaps = 15/201 (7%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFMDKNRELRQLHGEELQGLGLDELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGV---------QGGPPYS  726
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL Q+S++ +         QG   +S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQVRLNEEGQNVIEQG---HS  177

Query  727  SESVTNGCCLFPDKLQDHYKS  789
            ++S+ N   L     QD+  S
Sbjct  178  ADSIANNLSLVNSH-QDYNDS  197



>ref|XP_009137455.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Brassica rapa]
Length=221

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 154/221 (70%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R K  IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M++++ R+++H   +  V  QPSP  Q E+   + L++E  +K+++LR+L GEDL+ L 
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEKM+E GLSR+  KKG+ L+S+I++L+K+ ++L++EN +L++R  + ++    
Sbjct  121  LEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV-VTMEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     L+D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSGAPLEDDF--SDTSLKLGLP  218



>gb|AHC92622.1| NSVP2, partial [Narcissus tazetta var. chinensis]
Length=211

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 145/214 (68%), Gaps = 4/214 (2%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD ++GLI+FSATGKL  +S+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVGLIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+++I RHS+H +K+   E QPS  L  E+  +  L ++  E S++LR++ GEDLQ L 
Sbjct  61   SMKDIIERHSVHSKKILSPE-QPSLDLNLENSYHGRLREQVAEASQQLRKMRGEDLQGLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL  LEK ++ GL+R++ +K   ++ +I+ L+KK   L     Q+   SE G      
Sbjct  120  VEELQNLEKKLDTGLTRVLERKSIQIMEQIDGLQKKVVDLRSAGKQVATDSENGFY-EDQ  178

Query  721  YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             SSESVTN    +   L  +  SSDTSLKLGLP+
Sbjct  179  QSSESVTNAS--YSGALHGNDDSSDTSLKLGLPW  210



>emb|CDO97392.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 147/221 (67%), Gaps = 16/221 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR +I+IK+IDNLTARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSATGKL  Y +S
Sbjct  1    MVRQRIQIKRIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI RH +  E +   +  P    QRE+ T+A LA+E  EK+ ELR L GE+L  L 
Sbjct  61   SMMQVIERHRLCSEDIGRQDKHPPHHTQRENHTHAMLAEEIKEKTAELRHLKGEELVGLS  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            M +L+KLEK+VE GLSRI + KGD  + EI  LKKK A L EENA+L+Q+     +   P
Sbjct  121  MEDLVKLEKLVEAGLSRIAKTKGDKFMKEIGILKKKAALLKEENAKLRQKVAGTSEDETP  180

Query  721  Y-----SSESVTN-----GCCLFPDKLQDHYKSSDTSLKLG  813
                  SSESVT      G C  P  L +    SDT L+LG
Sbjct  181  LLEQGISSESVTRLSDQAGSC--PRDLNN----SDTFLQLG  215



>gb|AGB05618.1| DAM3 [Euphorbia esula]
Length=220

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 150/225 (67%), Gaps = 14/225 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSATGKL  Y++S
Sbjct  1    MTRQKIQIKKIDNITARQVTFSKRRRGLFKKAHELSTLCDAEIALIVFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++  VI R+ +H + +  ++ QPS  LQ E+   + L+ E  +K++ELR++ GE+LQ LG
Sbjct  61   SVTRVIERYHLHPKNLSKMD-QPSLELQLENGPLSALSNEVADKTQELRKMRGEELQGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP-  717
              EL  LEK++EGGL +++  KG+ L++EI  LK K  +LMEEN +LK +    +   P 
Sbjct  120  FEELQILEKLLEGGLKKVVETKGNALMNEIKELKSKGNQLMEENERLKHQ----ITSSPL  175

Query  718  -------PYSSESVTNGCCLFPDKLQDHYKSS-DTSLKLGLPFPD  828
                    +S +SVT       D  QD   S  DT L+LGLPFP+
Sbjct  176  ELLHFEKGHSPDSVTTNTSSLIDHSQDFGGSDLDTFLRLGLPFPN  220



>emb|CAX51228.1| MPF1-like-A [Withania sp. W009]
 emb|CAX51237.1| MPF1-like-A [Withania somnifera]
 emb|CAX51250.1| MPF1-like-A [Withania coagulans]
Length=194

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  T+A L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDRTEQLLSSNLQSEKRTHAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>ref|XP_006472470.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Citrus sinensis]
 ref|XP_006472471.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Citrus sinensis]
Length=226

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 156/228 (68%), Gaps = 18/228 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++G+I+FSATGKL   S+S
Sbjct  1    MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFESSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R+ MH   +  + H PS  LQ E+  +  L++E  +KSR+LRQ+ GEDL  L 
Sbjct  61   SMKDIMARYHMHSSNIGKLNH-PSLELQLENSKHLSLSREIADKSRQLRQMRGEDLHGLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + +L  LE M+E GLSR+++ KGD +++EI+AL++K AKL+EEN  LKQ+          
Sbjct  120  IEQLQHLETMLEQGLSRVLQTKGDRIMNEISALERKGAKLLEENKNLKQKVASLCKGKRV  179

Query  691  ----SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                S+I +Q     SSESV    C      +D   SSDTSLKLGLP+
Sbjct  180  VLVDSDIAIQ-EEGMSSESVNVCSCSSGPPPED--DSSDTSLKLGLPY  224



>gb|ABR18572.1| MPF1-like protein [Witheringia solanacea]
Length=197

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHRMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+V
Sbjct  61   ERDNMDSPEQLQSSNLQSEKKTYAMLSREFGEKNRELRQLHGEELQGLSLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGGPP----YSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDKCMREISSLKKKEAQLQEENSLLKQQSQARLNEEGQNAIEQGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            +TN   +  +  QDH  S
Sbjct  181  ITNNLSVV-NSHQDHNDS  197



>emb|CAX51229.1| MPF1-like-A [Withania somnifera]
Length=194

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMLSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLALDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQGG--PPYSSESV  738
            GG+SR+++ KGD  + EI++LK +EA+L EEN QLKQ+S+      VQ      +S++S+
Sbjct  121  GGISRVVKIKGDKYMREISSLKVEEAQLQEENLQLKQQSQARLNEEVQNAIEQRHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNSRSL  186



>gb|AFM77902.1| MADS-box protein AGL24 [Brassica juncea]
Length=221

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 153/221 (69%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++    ++ V  QPSP  Q E    + L++E  +K+++LR+L GEDL+ L 
Sbjct  61   RMRDILGRYNLQASNIDRVMGQPSPYHQVEDCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK++E GLSR+  KKG+ L+S+I++L+K+ ++L++EN +L++R  + ++    
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENKRLRERV-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     L+D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYESGAPLEDDF--SDTSLKLGLP  218



>emb|CAX51258.1| MPF1-like-A [Tubocapsicum anomalum]
Length=194

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMLSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLALDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQGG--PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN QLKQ+S+      VQ      +S++S+
Sbjct  121  GGISRVVKIKGDKYMREISSLKKKEAQLQEENLQLKQQSQARLNEEVQNAIEQGHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>gb|ABY60423.1| dormancy associated MADS-box 2 [Euphorbia esula]
Length=220

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 149/225 (66%), Gaps = 14/225 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSATGKL  Y++S
Sbjct  1    MTRQKIQIKKIDNITARQVTFSKRRRGLFKKAHELSTLCDAEIALIVFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++  VI R+ +H + +  ++ QPS  LQ E+   + L+ E  +K++ELR + GE+LQ LG
Sbjct  61   SVTRVIERYHLHPKNLSKMD-QPSLELQLENGPLSALSNEVADKTQELRNMRGEELQGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP-  717
              EL  LEK++EGGL +++  KG+ L++EI  LK K  +LMEEN +LK +    +   P 
Sbjct  120  FEELQILEKLLEGGLKKVVETKGNALMNEIKELKSKGNQLMEENERLKHQ----ITSSPL  175

Query  718  -------PYSSESVTNGCCLFPDKLQDHYKSS-DTSLKLGLPFPD  828
                    +S +SVT       D  QD   S  DT L+LGLPFP+
Sbjct  176  ELLHFEKGHSPDSVTTNTSSLIDHSQDFGGSDLDTFLRLGLPFPN  220



>ref|XP_006353175.1| PREDICTED: MADS-box protein JOINTLESS-like [Solanum tuberosum]
Length=238

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 155/238 (65%), Gaps = 26/238 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  Y NS
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYCNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKQILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIGVQGG  714
             + +L +LE+ +E GLSR++ +KGD ++ EIN L++K  +LMEEN +L+Q+  EI     
Sbjct  120  NIEDLQQLERSLETGLSRVIERKGDKIMREINQLQQKGMQLMEENEKLRQQLMEISNNNN  179

Query  715  PPY----------------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
              Y                      SSESVTN C       QD   SSD SLKLGLP+
Sbjct  180  NGYKEPVVVAFESENGFNSNNEEGQSSESVTNPCNSTGPPPQDD-DSSDISLKLGLPY  236



>ref|XP_008237141.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Prunus mume]
Length=225

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 151/226 (67%), Gaps = 15/226 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  +++S
Sbjct  1    MTRRKIQIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEFTSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR------ESITYAGLAKEFTEKSRELRQLNGE  522
            ++++VI RH +     + + H PS  LQ       ES T A L+KE  EK+ ELR+L GE
Sbjct  61   SVQQVIERHHLLSSDFDKLNH-PSLELQSFCMSQLESSTSAALSKEIAEKTHELRKLRGE  119

Query  523  DLQELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ-----  687
            +LQEL M EL +LEK++  GL R+   K +I+L EI +LK K ++LM+EN +LKQ     
Sbjct  120  ELQELNMKELQELEKLLGSGLRRVRDAKCEIVLKEITSLKWKGSQLMQENKRLKQVMMEN  179

Query  688  RSEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            R    ++     SSE +  G  +  D  QDH  SSD SLKLGL FP
Sbjct  180  RQVQTLELEQGQSSEPI--GDFIHSDPSQDH-DSSDISLKLGLAFP  222



>gb|ABR18606.1| MPF1-like protein [Margaranthus solanaceus]
Length=197

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGV-QGGPP-----YSSES  735
            EGG+SR+++ KGD    EI++LKKKEA+L EEN+QL ++S+  + +GG       +S++S
Sbjct  121  EGGISRVLKIKGDKYTREISSLKKKEAQLQEENSQLIKQSQARLNEGGQNVIEQGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            + N   L     QD+  S
Sbjct  181  IANNLSLVNSH-QDYNDS  197



>ref|XP_002310488.1| MADS-box transcription factor family protein [Populus trichocarpa]
 gb|EEE90938.1| MADS-box transcription factor family protein [Populus trichocarpa]
Length=221

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 152/222 (68%), Gaps = 7/222 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I L+VFSATGKL  YSNS
Sbjct  1    MTRKKIQIKKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALMVFSATGKLFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI R ++H + +  ++ QPS   Q +   +A L KE  +K+RELR + GEDLQ L 
Sbjct  61   SMGQVIERRNLHPKNINTLD-QPSLEKQLDGGVHAMLIKEIAKKNRELRHMRGEDLQGLD  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR--SEIGVQGG  714
            + EL KLEK++EG L R++ +KG  +++EI+ALK K  +L+EEN +LKQ+  S +  QG 
Sbjct  120  LEELQKLEKIMEGSLRRLVEEKGGKIINEIDALKTKGEQLIEENQRLKQQVMSLLAGQGH  179

Query  715  ---PPYSSES-VTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
               P  SS+S VTN   +     +    SS   LKLGLPFPD
Sbjct  180  LLEPGQSSDSLVTNISSMGSVDPRQDCDSSCAFLKLGLPFPD  221



>ref|XP_011097479.1| PREDICTED: MADS-box protein JOINTLESS [Sesamum indicum]
Length=227

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 156/230 (68%), Gaps = 21/230 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MDREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + ++ +E QPS  LQ  E    + L+KE  E+S +LR++ GE+LQ L
Sbjct  61   SMKEILERHKLHAKNLDKME-QPSLELQLVEDSNCSRLSKEVAERSHQLRRMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG-  714
             + EL +LE  +E GLSR++ KKG+ ++ EIN L++K  +LME NA+L+QR  + +  G 
Sbjct  120  SIEELQQLESSLESGLSRVIEKKGEKIMKEINQLQEKGTQLMEGNARLRQRV-VDISNGR  178

Query  715  --------------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                             SSESV     + P   QD Y+SSDTSLKLGLP+
Sbjct  179  RNNATADSENIVYDEGQSSESVNACNSIGPP--QD-YESSDTSLKLGLPY  225



>ref|XP_011043061.1| PREDICTED: MADS-box protein JOINTLESS-like [Populus euphratica]
Length=220

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQV+FSKRRRGLFKKA ELS LCD +I L+VFSATGK   YSNS
Sbjct  1    MTRKKIQIKKIDNTTARQVSFSKRRRGLFKKAFELSILCDAEIALMVFSATGKFFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI R ++H + ++    QPS  LQ +S   A L K+  +K+RELR+  GEDLQ L 
Sbjct  61   SIGQVIERRNLHPKNLDTF-SQPSVELQLDSAVLAMLNKDIADKTRELRRARGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG--  714
            M EL KLEK++EG L R+M  KG+ +L E++ALK KE +L+EEN +LKQR     +G   
Sbjct  120  MEELEKLEKLIEGSLCRVMETKGEKILREVDALKSKEHQLIEENQRLKQRLMSLTKGQGH  179

Query  715  ---PPYSSES-VTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                  SS+S VTN      ++ QD Y +  + L LGLPFPD
Sbjct  180  LLEKGQSSDSMVTNISSNSANRRQD-YDNICSFLTLGLPFPD  220



>gb|AHI85951.1| AGL24 [Carya cathayensis]
Length=226

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 156/229 (68%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGL KKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLLKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R+++    ++ ++ QPS  LQ E+  +  L+KE  +K+ +LRQ  GEDL+ L 
Sbjct  61   SMKDILERYNLQSNGIKQMD-QPSLELQLEN-NHIRLSKEVADKTHQLRQTRGEDLEGLN  118

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEKM+E GLSR++  K + LL+EI  L++K A+L+EEN QLKQ+  +  +G  P
Sbjct  119  LEELQQLEKMLEAGLSRVLETKEERLLTEITTLERKGAQLLEENRQLKQKMVMSSKGKRP  178

Query  721  -------------YSSESVTNGCCLF--PDKLQDHYKSSDTSLKLGLPF  822
                          SSESVTN C     P  L+D   SSDTSLKLGL  
Sbjct  179  VLVESDVLVQEEGMSSESVTNVCSSSGGPPSLEDD--SSDTSLKLGLSL  225



>gb|ABZ89556.1| MPF1-like protein [Physalis acutifolia]
Length=198

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H +  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHQLQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L +EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLTREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL ++S+         V     YS++
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIKQSQARLNEEGQNVIEQGQYSAD  180

Query  733  SVTNGCCLFPDKLQDHYKS  789
            S+ N   L     QD+  S
Sbjct  181  SIANNLSLVNSH-QDYNDS  198



>gb|ABR18588.1| MPF1-like protein [Physalis minima]
Length=197

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ ++   S +LQ E  T+A L KEF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLDQLQSSNLQSEKKTHAMLTKEFGDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL ++S+  +  +G       +SS+S
Sbjct  121  EGGISRVLKIKGDKYMKEISSLKKKEAQLQEENSQLIKQSQARLNEEGQNVIEQGHSSDS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            + N   L     QD+  S
Sbjct  181  IANNLSLVNSH-QDYNDS  197



>ref|XP_010107287.1| MADS-box protein JOINTLESS [Morus notabilis]
 gb|EXC14620.1| MADS-box protein JOINTLESS [Morus notabilis]
Length=213

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 148/212 (70%), Gaps = 11/212 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+GLI+FS+TGKL      
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVGLIIFSSTGKLF-----  55

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+  ++ L+KE  EKS +LRQL GE+LQ L
Sbjct  56   DMKEILERHNLHSKNLEKLE-QPSLQLQLVENSNHSRLSKEIAEKSHQLRQLRGEELQGL  114

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LEK +E GLSR++ KKG+ ++ EIN L++K  +L +  A +   + I  +G  
Sbjct  115  NIEELQRLEKSLESGLSRVIEKKGEKIMKEINDLQRKAMELSQRQAGVDSDNVINEEG--  172

Query  718  PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
              SSES+TN C       QD   +SDTSLKLG
Sbjct  173  -QSSESITNACN-SSGPPQDCDSTSDTSLKLG  202



>gb|ABR18590.1| MPF1-like protein [Physalis mexicana]
Length=198

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+         V     +S++
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEEDQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>gb|ABR18587.1| MPF1-like protein [Physalis philadelphica]
 gb|ABR18596.1| MPF1-like protein [Physalis curassavica]
 gb|ABR18603.1| MPF1-like protein [Physalis aequata]
Length=198

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+         V     +S++
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEEGQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>gb|ABR18585.1| MPF1-like protein [Physalis pubescens]
 gb|ABR18586.1| MPF1-like protein [Physalis pruinosa]
Length=197

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 143/187 (76%), Gaps = 8/187 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIDKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCL  756
            + N   L
Sbjct  181  IANNLSL  187



>gb|ABR18593.1| MPF1-like protein [Physalis ixocarpa]
 gb|ABR18599.1| MPF1-like protein [Physalis angulata]
 gb|ABR18602.1| MPF1-like protein [Physalis aequata]
Length=198

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+         V     +S++
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEEGQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>gb|AFK36521.1| unknown [Lotus japonicus]
Length=227

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M   KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ L+VFS+TGKL  YSN 
Sbjct  1    MAGEKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALVVFSSTGKLFEYSNL  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + +  +E QPS  LQ  E+   + L KE  EKSR LRQL GEDLQ L
Sbjct  61   SMKEILERHHLHSKNLAKLE-QPSLELQLVENSNCSRLNKEVAEKSRLLRQLRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS----EIGV  705
             + EL +LE+ +E GL R++ KKG+ +++EIN L+ K  +LMEEN +LK+        G+
Sbjct  120  NIEELQQLERSLETGLGRVIEKKGEKIMNEINGLQIKGKQLMEENERLKRHVAGMISTGL  179

Query  706  QGGPP----------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
              G            +SSESVTN C       L+D   SSDTSLKLGLP+
Sbjct  180  MHGDTESELLVMEEGHSSESVTNVCNSTTGPPLED--DSSDTSLKLGLPY  227



>ref|XP_008237145.1| PREDICTED: MADS-box protein SVP-like isoform X5 [Prunus mume]
Length=209

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 138/221 (62%), Gaps = 21/221 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  +++S
Sbjct  1    MTRRKIQIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEFTSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR------ESITYAGLAKEFTEKSRELRQLNGE  522
            ++++VI RH +     + + H PS  LQ       ES T A L+KE  EK+ ELR+L GE
Sbjct  61   SVQQVIERHHLLSSDFDKLNH-PSLELQSFCMSQLESSTSAALSKEIAEKTHELRKLRGE  119

Query  523  DLQELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG  702
            +LQEL M EL +LEK++  GL R+   KG  L+ E            +   Q++ R    
Sbjct  120  ELQELNMKELQELEKLLGSGLRRVRDAKGSQLMQE-----------NKRLKQMENRQVQT  168

Query  703  VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            ++     SSE +  G  +  D  QDH  SSD SLKLGL FP
Sbjct  169  LELEQGQSSEPI--GDFIHSDPSQDH-DSSDISLKLGLAFP  206



>ref|XP_010060099.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Eucalyptus grandis]
 gb|KCW66636.1| hypothetical protein EUGRSUZ_F00420 [Eucalyptus grandis]
Length=225

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 149/228 (65%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA ELS LCD ++ +++FSATGKL  YS+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++ + R+++H   +E ++ QPS  LQ E      L+KE  EKS  LRQL GEDLQ L 
Sbjct  61   SMKDTLERYTLHHNNLENMD-QPSLELQLEHSNNMRLSKEVAEKSHRLRQLRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG---  711
            + EL +LEKM+E GL+R++  K + + +EI  L+ K A+L+EEN  LKQ      +G   
Sbjct  120  IEELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTMTTLTKGKRH  179

Query  712  -------GPP---YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                     P    SSES TN C C     L+D    SDTSLKLGLPF
Sbjct  180  IVTEPDVALPEEGVSSESATNVCSCNSGPPLEDD--GSDTSLKLGLPF  225



>ref|XP_009137453.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Brassica rapa]
 ref|XP_009137454.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Brassica rapa]
Length=222

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 155/222 (70%), Gaps = 12/222 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R K  IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M++++ R+++H   +  V  QPSP  Q+ E+   + L++E  +K+++LR+L GEDL+ L
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LEKM+E GLSR+  KKG+ L+S+I++L+K+ ++L++EN +L++R  + ++   
Sbjct  121  NLEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV-VTMEMAK  179

Query  718  PYS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
              +      +ES T     +     L+D +  SDTSLKLGLP
Sbjct  180  TMALKEAVETESATTNVSSYDSGAPLEDDF--SDTSLKLGLP  219



>gb|ABR18597.1| MPF1-like protein [Physalis crassifolia]
Length=197

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQL--KQRSEIGVQGG----PPYSSES  735
            EGG+SR+++ K D  + EI++LKKKEA+L EEN+QL  K ++ +  +G       +S++S
Sbjct  121  EGGISRVLKIKSDKYMKEISSLKKKEAQLQEENSQLIKKSQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            V N   L     QD+  S
Sbjct  181  VANNISLVNSH-QDYNDS  197



>gb|ABR18571.1| MPF1-like protein [Witheringia solanacea]
 gb|ABR18583.1| MPF1-like protein [Physalis nicandroides]
Length=197

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQGERKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL ++S+  +  +G       +S++S
Sbjct  121  EGGISRVLKLKGDKYMREISSLKKKEAQLQEENSQLIKQSQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCLFPDKLQDHYKS  789
            + N   L     QD+  S
Sbjct  181  IANNLSLVNSH-QDYNDS  197



>gb|AGW23339.1| MADS box protein MADS37 [Gossypium hirsutum]
Length=222

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 153/224 (68%), Gaps = 13/224 (6%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDNLTARQVTFSKRRRGLFKKA+ELS LCD ++ LI+FSATGKL  +++S
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEFASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++ + R+++H   +  ++ QPS  LQ E+     L KE  +K+ +LRQ+ GEDLQ L 
Sbjct  61   SMKDTLGRYNLHSNNINKLD-QPSLDLQLENNNNIRLNKEIVDKTHQLRQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RSE  696
            + EL +LE M+E GL  ++  K + +++EI++L+ K A+L+EEN QLK+        + +
Sbjct  120  IEELQQLEGMLESGLKCVLETKSNRIMNEISSLENKGARLLEENKQLKEKMATLYKRKRD  179

Query  697  IGVQGGPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLPF  822
              V G    SSESVTN C        L+D   SSDTSL+LGLPF
Sbjct  180  SDVVGEEGVSSESVTNVCSCSSSCPPLEDD--SSDTSLRLGLPF  221



>ref|XP_008363740.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Malus 
domestica]
Length=227

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 151/228 (66%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E+  Y+ L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLDKLE-QPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG--  711
             + EL +LEK +E GL  ++ KK + ++ EIN L++   +L EEN +L+Q+      G  
Sbjct  120  SLEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNAMQLTEENERLRQQVVEKSNGRR  179

Query  712  -----------GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                           SSESVTN  C      QD Y +S TSLKLGLPF
Sbjct  180  LVHVDSENLITEEGQSSESVTN-LCKSNSGPQD-YDNSVTSLKLGLPF  225



>emb|CAX51226.1| MPF1-like-A [Withania sp. W009]
Length=194

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 138/181 (76%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGL VFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLTVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  T+A L++EF EK+RELRQL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDRTEQLLSSNLQSEKRTHAMLSREFVEKNRELRQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR ++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRALKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>emb|CAX51252.1| MPF1-like-A [Withania coagulans]
Length=194

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 139/181 (77%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  T+A L++EF EK+REL QL+GE+LQ LG+ EL KLEK+VE
Sbjct  61   RDNMDRTEQLLSSNLQSERRTHAMLSREFVEKNRELMQLHGEELQGLGLDELTKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSLLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>gb|ABR18595.1| MPF1-like protein [Physalis fuscomaculata]
Length=198

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H +  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKIQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+ + KGD  + EI++LKKKEA+L EEN+QL Q+S+         V     +S++
Sbjct  121  EGGISRVHKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQARLNEEGQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>gb|ABR18576.1| MPF1-like protein [Withania somnifera]
Length=197

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++  E   S +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSPEQLQSSNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI  699
            EGG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++
Sbjct  121  EGGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQV  162



>ref|XP_006413417.1| hypothetical protein EUTSA_v10026757mg [Eutrema salsugineum]
 gb|ESQ54870.1| hypothetical protein EUTSA_v10026757mg [Eutrema salsugineum]
Length=221

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 157/222 (71%), Gaps = 11/222 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++H   ++ +  QPS + Q E+   + L+K+  +K+++LR+L GEDL+ L 
Sbjct  61   RMRDILGRYNLHASNIDKLMDQPSLNHQPENCNLSRLSKDIEDKTKQLRKLRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLK------QRSEIG  702
            + EL +LEK++E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+      +R+++ 
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREKLVTLERAKM-  179

Query  703  VQGGPPYSSESVTNGCCLFPDK--LQDHYKSSDTSLKLGLPF  822
            +       +ES T     +  +  L+D +  SDTSLKLGLP+
Sbjct  180  MAFKEAMETESATTNMSSYDSEAPLEDDF--SDTSLKLGLPY  219



>emb|CAX51230.1| MPF1-like-A [Withania somnifera]
Length=194

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKK QELSTLCD DIGLIVFSATGKL  YS+S+M ++  +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKTQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLFEKHKMLSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLALDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQGGPP--YSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN QLKQ+S+      VQ      +S++S+
Sbjct  121  GGISRVVKIKGDKYMREISSLKKKEAQLQEENLQLKQQSQARLNEEVQNAIERGHSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRSL  186



>ref|XP_002867660.1| hypothetical protein ARALYDRAFT_492389 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43919.1| hypothetical protein ARALYDRAFT_492389 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 149/220 (68%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+S+H   +  +   PS  LQ E+   + L+KE  +K+++LR+L GEDL  L 
Sbjct  61   RMRDILGRYSLHASNINRLMDPPSTHLQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG--  714
            + EL +LEK++E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+ + E   +    
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENKRLRDKLETLERAKLI  180

Query  715  ---PPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
                   +ESVT     +     L+D    SDTSLKLGLP
Sbjct  181  TFMEALETESVTTNVSSYDSGAPLEDD---SDTSLKLGLP  217



>sp|Q9FUY6.1|JOIN_SOLLC RecName: Full=MADS-box protein JOINTLESS; AltName: Full=LeMADS 
[Solanum lycopersicum]
 gb|AAG09811.1| MADS-box transcription factor JOINTLESS [Solanum lycopersicum]
Length=265

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 155/240 (65%), Gaps = 30/240 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKQILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GLSR++ +KGD ++ EIN L++K   LMEEN +L+Q+         
Sbjct  120  NIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISNNNN  179

Query  691  ------SEIGVQGGPP------------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
                   E GV    P             SSESVTN C       QD   SSDTSLKLGL
Sbjct  180  NNNNGYREAGVVIFEPENGFNNNNNEDGQSSESVTNPCNSIDPPPQDD-DSSDTSLKLGL  238



>gb|AFA37969.1| SVP3 [Actinidia chinensis]
Length=232

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 158/235 (67%), Gaps = 24/235 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I ++S+H   +E ++ QPS +LQ E      L K+ +EK+ +LRQ+ GEDLQ L 
Sbjct  61   SMSDIIGKYSLHTNNIEQID-QPSLALQLEDSNLVKLGKDVSEKTTQLRQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------  699
            + EL  LEKM+E GLSR++  KG+ +++EI  L++K A+L+EEN +LKQ+ ++       
Sbjct  120  INELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKGAELVEENQRLKQKLQMNAISEGK  179

Query  700  ----GVQGGP---------PYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                GV G             SSESVTN C C      +D    SDTSLKLGLPF
Sbjct  180  WAVTGVVGAELDNVVAEEQGQSSESVTNVCSCNSAPPPEDD--CSDTSLKLGLPF  232



>gb|AFA37965.1| SVP3 [Actinidia deliciosa]
Length=230

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 157/233 (67%), Gaps = 22/233 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I ++S+H   +E ++ QPS +LQ E      L K+ +EK+ +LRQ+ GEDLQ L 
Sbjct  61   SMSDIIGKYSLHTNNIEQID-QPSLALQLEDSNLVKLGKDVSEKTTQLRQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------S  693
            + EL  LEKM+E GLSR++  KG+ +++EI  L++K A+L+EEN +LKQ+         +
Sbjct  120  INELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKGAELVEENQRLKQKMNAISEGKWA  179

Query  694  EIGVQGGP---------PYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
              GV G             SSESVTN C C      +D    SDTSLKLGLPF
Sbjct  180  VTGVVGAELDNVVAEEQGQSSESVTNVCSCNSAPPPEDD--CSDTSLKLGLPF  230



>ref|XP_009345716.1| PREDICTED: MADS-box protein JOINTLESS isoform X2 [Pyrus x bretschneideri]
Length=227

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 151/228 (66%), Gaps = 17/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD DI LI+FS+TGKL  Y+++
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASA  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E+  Y+ L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLDKLE-QPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG--  711
             + EL +LEK +E GL  ++ KK + ++ EIN L++   +L EEN +L+Q+      G  
Sbjct  120  SLEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNAMQLTEENERLRQQVVEKSNGRR  179

Query  712  -----------GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                           SSESVTN  C      QD Y SS TSLKLGLP+
Sbjct  180  LVHVDSENLITEEGQSSESVTN-LCKSNSGPQD-YDSSVTSLKLGLPY  225



>emb|CAX51245.1| MPF1-like-A [Withania riebeckii]
Length=194

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 137/181 (76%), Gaps = 8/181 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGL KKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLLKKAQELSTLCDADIGLIVFSATGKLFDYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL KLEK+V 
Sbjct  61   RDNMDSTEQLLSSNLQSEKRTYAMLSREFVEKNRELRQLHGEELQGLDLDELTKLEKLVG  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG------PPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ+S+  + GG        +S++SV
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSMLKQQSQARLNGGGQNAIEQGHSTDSV  180

Query  739  T  741
            T
Sbjct  181  T  181



>ref|NP_001280915.1| MADS-box protein JOINTLESS [Malus domestica]
 ref|XP_008385673.1| PREDICTED: MADS-box protein JOINTLESS [Malus domestica]
 gb|ABD66219.2| JOINTLESS [Malus domestica]
 gb|ADL36738.1| MADS domain class transcription factor [Malus domestica]
Length=224

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 151/225 (67%), Gaps = 17/225 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGL KKA+ELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLLKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +E +E QPS  LQ  E+  Y  L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLEKLE-QPSLQLQLVENSNYTRLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + EL +LEK +E GL R++ KK + ++ EI  L++   +LMEEN +L+Q        R 
Sbjct  120  NLEELQQLEKSLETGLGRVIEKKSEKIMKEIGDLQRNGMQLMEENERLRQQVAEKSDGRR  179

Query  694  EIGVQGGPPY-----SSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
             + V     +     SSESVTN C    +  QD Y SSDTSLKLG
Sbjct  180  LVQVDSENMFTEEGQSSESVTNPCN-SNNGPQD-YDSSDTSLKLG  222



>gb|ABR18592.1| MPF1-like protein [Physalis lanceifolia]
Length=197

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 143/187 (76%), Gaps = 8/187 (4%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K++ELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHAMLSREFVDKNQELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSE--IGVQGG----PPYSSES  735
            EGG+SR+++ KGD  + EI++LKKKEA+L EEN+QL  +S+  +  +G       +S++S
Sbjct  121  EGGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLIHQSQARLNEEGQNVIEQGHSADS  180

Query  736  VTNGCCL  756
            + N   L
Sbjct  181  IANNLSL  187



>ref|XP_010523348.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Tarenaya hassleriana]
Length=229

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 148/231 (64%), Gaps = 21/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++H   +  +   P  +LQ E+   A L+K+  +K+R+LRQL GEDLQ L 
Sbjct  61   RMRDILARYNLHASNLNKL--NPPLALQPENSNLARLSKDIEDKTRQLRQLRGEDLQGLS  118

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + +L +LEK+VE GL R+  KKG+ ++ EI++L+++ A+L EEN  L+QR          
Sbjct  119  LDDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLMMLERGKTA  178

Query  691  ------SEIGVQGGPPYSSESVTN-GCCLFPDKLQDHYKSSDTSLKLGLPF  822
                  +  GVQ G    S   TN         L D +  SDTSLKL LPF
Sbjct  179  AFREGETVAGVQEGMSLESAVTTNVSSSSSASPLDDDF--SDTSLKLALPF  227



>emb|CDX92641.1| BnaC07g38990D [Brassica napus]
Length=229

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = +1

Query  169  LVVKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCH  348
            +V KM R K  IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  
Sbjct  9    VVKKMAREKRRIKKIDNITARQVTFSKRRRGIFKKAGELSVLCDADVALIIFSATGKLFE  68

Query  349  YSNSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDL  528
            +S+S M +++ R+++H   +  V   PSP  Q E    + L++E  +K+++LR+L GEDL
Sbjct  69   FSSSRMRDILGRYNLHASNINKVMGLPSPYHQLEDCNLSRLSQEVEDKTKQLRKLRGEDL  128

Query  529  QELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQ  708
            + L + EL +LEKM+E GLSR+  KKG+ L+S+I++L+K+ ++L +EN +L++R    ++
Sbjct  129  EGLNLEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELADENRRLRERVVTTME  188

Query  709  GGPPYS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLG  813
                 +      +ES T     +     L+D +  SDTSLKLG
Sbjct  189  MAKTMALKEAVETESATTNVSSYDSGAPLEDDF--SDTSLKLG  229



>emb|CDY11019.1| BnaA03g46780D [Brassica napus]
Length=216

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 152/219 (69%), Gaps = 11/219 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R K  IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M++++ R+++H   +  V  QPSP  Q E+   + L++E  +K+++LR+L GEDL+ L 
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEKM+E GLSR+  KKG+ L+S+I++L+K+ ++L++EN +L++R  + ++    
Sbjct  121  LEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV-VTMEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLG  813
             +      +ES T     +     L+D +  SDTSLKLG
Sbjct  180  MALKEAVETESATTNVSSYDSGAPLEDDF--SDTSLKLG  216



>ref|XP_008237144.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X4 [Prunus 
mume]
Length=211

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 141/221 (64%), Gaps = 19/221 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  +++S
Sbjct  1    MTRRKIQIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEFTSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR------ESITYAGLAKEFTEKSRELRQLNGE  522
            ++++VI RH +     + + H PS  LQ       ES T A L+KE  EK+ ELR+L GE
Sbjct  61   SVQQVIERHHLLSSDFDKLNH-PSLELQSFCMSQLESSTSAALSKEIAEKTHELRKLRGE  119

Query  523  DLQELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG  702
            +LQEL M EL +LEK++  GL R+   KG  L+ E         +L +   + +Q   + 
Sbjct  120  ELQELNMKELQELEKLLGSGLRRVRDAKGSQLMQE-------NKRLKQVMMENRQVQTLE  172

Query  703  VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
            ++ G   SSE +  G  +  D  QDH  SSD SLKLGL FP
Sbjct  173  LEQG--QSSEPI--GDFIHSDPSQDH-DSSDISLKLGLAFP  208



>ref|XP_010448551.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Camelina sativa]
Length=220

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 149/220 (68%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++H   +  +   PS  LQ E+   + L+KE  +K+++LR+L GEDL  L 
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG---  711
            + EL +LEK++E GLSR+  KKGD ++S+I++L+K+ ++L++EN +L+++ E   +    
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGDCVMSQISSLEKRGSELVDENKRLREKLETFERSKML  180

Query  712  --GPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
                   +ES T     +     ++D    SDTSLKLGLP
Sbjct  181  AFKEAVETESATTNVSSYDSGAPIEDE---SDTSLKLGLP  217



>gb|ABR18589.1| MPF1-like protein [Physalis minima]
Length=197

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+A L++EF +K++ELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDDMDSLEQLQSSNLQSEKKTHAMLSREFVDKNQELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEI  630
            EGG+SR+++ KGD  + EI
Sbjct  121  EGGISRVLKIKGDKYMREI  139



>gb|AAP40641.1| SVP-like floral repressor [Eucalyptus occidentalis]
Length=227

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 153/227 (67%), Gaps = 15/227 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI N TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS++GKL  Y +S
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH  H E +  ++ QPS  LQ  E+  Y+ L+KE  EK  +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHHSHSENLGKLD-QPSLKLQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIG----  702
             + EL +LEK +E GL+R++ KKG+ ++ EI  L++K AKLMEEN +LKQ+ +EI     
Sbjct  120  NIDELQQLEKSLEAGLNRVIEKKGEKIMKEITDLQQKGAKLMEENKRLKQQVTEISGRKT  179

Query  703  -------VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   +      SSES+TN C       Q+   SSD SLKLGLP+
Sbjct  180  TATDSETIINEEGLSSESITNVCSSSSGPPQED-DSSDISLKLGLPY  225



>ref|NP_001289637.1| MADS-box protein JOINTLESS [Eucalyptus grandis]
 gb|AAP33087.1| SVP-like floral repressor [Eucalyptus grandis]
Length=227

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 152/227 (67%), Gaps = 15/227 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI N TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS++GKL  Y +S
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH  H E +  ++ QPS  LQ  E+  Y+ L+KE  EK  +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHHSHSENLGKLD-QPSLKLQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIG----  702
             + EL +LEK +E GL+R++ KKG+ ++ EI  L++K AKLMEE  +LKQ+ +EI     
Sbjct  120  NIDELQQLEKSLEAGLNRVIEKKGEKIMKEITDLQQKGAKLMEETKRLKQQVTEISGRKT  179

Query  703  -------VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   +      SSES+TN C       Q+   SSD SLKLGLP+
Sbjct  180  TATDSETIINEEGLSSESITNVCSSSSGPPQED-DSSDISLKLGLPY  225



>ref|XP_006282462.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
 gb|EOA15360.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
Length=220

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 149/220 (68%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ L++FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALVIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ ++++H   +  +   PS  LQ E+   + L+KE  +K+++LR+L GEDL  L 
Sbjct  61   RMRDILGKYNLHASNINKMMDPPSTHLQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG-----V  705
            + EL +LEKM+E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++ E       +
Sbjct  121  LEELQRLEKMLESGLSRVTEKKGECVMSQISSLEKRGSELVDENKRLREKLETFERAKMM  180

Query  706  QGGPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
                   +ES T     +     L+D    SDTSLKLGLP
Sbjct  181  ASKEAVETESATTNLSSYDSGAPLEDE---SDTSLKLGLP  217



>emb|CAX51238.1| MPF1-like-A [Withania somnifera]
Length=194

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 131/161 (81%), Gaps = 2/161 (1%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLQSSNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI  699
            GG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++
Sbjct  121  GGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQV  161



>ref|XP_010439015.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Camelina sativa]
Length=220

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 148/220 (67%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+++H   +  +   PS  LQ E+   + L+KE  +K+++LR+L GEDL  L 
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG-----V  705
            + EL +LEK++E GLSR+  KKG+ ++S+I++L+K+ + L++EN +L+++ E       V
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSDLVDENKRLREKLETFERSKMV  180

Query  706  QGGPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
                   +ES T     +     L+D    SDTSLKLGLP
Sbjct  181  AFKEAVETESATTNMSSYDSGAPLEDE---SDTSLKLGLP  217



>ref|XP_010027953.1| PREDICTED: MADS-box protein JOINTLESS [Eucalyptus grandis]
 gb|KCW54607.1| hypothetical protein EUGRSUZ_I00556 [Eucalyptus grandis]
Length=227

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 153/227 (67%), Gaps = 15/227 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI N TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS++GKL  Y +S
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH  H E +  ++ QPS  LQ  E+  Y+ L+KE  EK  +LRQ+ GE+LQ L
Sbjct  61   SMKEILERHHSHSENLGKLD-QPSLELQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEIG----  702
             + EL +LEK +E GL+R++ KKG+ ++ EI  L++K AKLMEEN +LKQ+ +EI     
Sbjct  120  NIDELQQLEKSLEAGLNRVIEKKGEKIVKEITDLQQKGAKLMEENKRLKQQVTEISGRKT  179

Query  703  -------VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   +      SSESVTN C       Q+   SSD SLKLGLP+
Sbjct  180  TATDSETIINEEGLSSESVTNVCSSSSGPPQED-DSSDFSLKLGLPY  225



>emb|CAL36572.1| incomposita homologue [Misopates orontium]
Length=229

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 155/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +  +E QPS  LQ  E    A L++E  E+S++LR++ GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLGKME-QPSLELQLVEDSNCARLSREVAERSQQLRRMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+ +E GLSR++ KKG+ +++EIN L++K  +LM+EN +LKQ+         
Sbjct  120  NIEELQRLERSLEVGLSRVLDKKGEKIMNEINQLQEKGQQLMQENQRLKQQVVDISNCQQ  179

Query  691  ------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                  SEI        SSESVT  C      L   Y  SDT LKLGLP+
Sbjct  180  ITATPDSEIIHLYEEGQSSESVTYTC--NSTGLPQDYDCSDTYLKLGLPY  227



>gb|AHC92621.1| NSVP1, partial [Narcissus tazetta var. chinensis]
Length=242

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 145/214 (68%), Gaps = 4/214 (2%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD ++GLI+FSATG+L  +S+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVGLIIFSATGRLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+++I RHS+H +K+   E QPS  L  E+  +  L ++  E S++LR++ GEDLQ L 
Sbjct  61   SMKDIIERHSVHSKKILSPE-QPSLDLNLENSYHGRLREQVAETSQQLRKMRGEDLQGLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL  LEK ++ GL+R++ +K   ++ +I+ L+KK   L     Q+   SE G      
Sbjct  120  IEELQNLEKNLDTGLARVLERKSIQIMEQIDGLQKKVVDLRSAGKQVVTDSENGFYEDQQ  179

Query  721  YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             SSESVTN    +   LQ +  SSDTSLKLGL +
Sbjct  180  -SSESVTNAS--YSGALQGNDDSSDTSLKLGLSW  210



>gb|ABR18594.1| MPF1-like protein [Physalis fuscomaculata]
Length=198

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 140/188 (74%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H +  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKIQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E   S +LQ E  T+  L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQSSNLQSEKKTHVMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+ + KGD  + EI++LKKKEA+L EEN+QL Q+S+         V     +S++
Sbjct  121  EGGISRVHKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQARLNEEGQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>gb|ABR18584.1| MPF1-like protein [Physalis viscosa]
 gb|ABR18591.1| MPF1-like protein [Physalis mendocina]
Length=198

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 140/188 (74%), Gaps = 9/188 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H +  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKIQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            E+  ++ +E     +LQ E  T+A L++EF +K+RELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   ERDNMDSLEQLQYSNLQSEKKTHAMLSREFVDKNRELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------GVQGGPPYSSE  732
            EGG+SR+ + KGD  + EI++LKKKEA+L EEN+QL Q+S+         V     +S++
Sbjct  121  EGGISRVHKIKGDKYMREISSLKKKEAQLQEENSQLIQQSQARLNEEGQNVIHEQGHSAD  180

Query  733  SVTNGCCL  756
            S+ N   L
Sbjct  181  SIANNLSL  188



>ref|NP_194185.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 sp|O82794.1|AGL24_ARATH RecName: Full=MADS-box protein AGL24; AltName: Full=Protein AGAMOUS-LIKE 
24 [Arabidopsis thaliana]
 gb|AAC63139.1| MADS-box Protein [Arabidopsis thaliana]
 gb|AAC63140.1| MADS-box protein [Arabidopsis thaliana]
 emb|CAA23009.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 emb|CAB79364.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 gb|ABE77409.1| At4g24540 [Arabidopsis thaliana]
 dbj|BAH30535.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84922.1| MADS-box protein AGL24 [Arabidopsis thaliana]
Length=220

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 148/220 (67%), Gaps = 10/220 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
             M +++ R+S+H   +  +   PS  L+ E+   + L+KE  +K+++LR+L GEDL  L 
Sbjct  61   RMRDILGRYSLHASNINKLMDPPSTHLRLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG---  711
            + EL +LEK++E GLSR+  KKG+ ++S+I +L+K+ ++L++EN +L+ + E   +    
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQIFSLEKRGSELVDENKRLRDKLETLERAKLT  180

Query  712  --GPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
                   +ESVT     +     L+D    SDTSLKLGLP
Sbjct  181  TLKEALETESVTTNVSSYDSGTPLEDD---SDTSLKLGLP  217



>emb|CAG27846.1| incomposita protein [Antirrhinum majus]
Length=229

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + +  +E QPS  LQ  E      L+ E  E+S++LR++ GE+LQ L
Sbjct  61   SMKEILERHNLHSKNLGKME-QPSLELQLVEDSNCTRLSNEVAERSQQLRRMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             M EL +LE+ +E GLSR++ KKG+ +++EIN L++K  +LM+EN +LKQ+         
Sbjct  120  NMEELQRLERSLEVGLSRVLDKKGEKIMNEINQLQEKGMQLMQENQRLKQQVVDISNYQQ  179

Query  691  ------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                  SEI        SSESVT  C      L   Y  SDT LKLGLP+
Sbjct  180  ITATPDSEIIHVYEEGQSSESVTYTCN--STGLPQDYDCSDTYLKLGLPY  227



>emb|CAX51217.1| MPF1-like-A [Withania frutescens]
Length=194

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKK QE STLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKTQEPSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMLSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+RELRQL+GE+LQ L + EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNRELRQLHGEELQGLALDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG----VQGGPP--YSSESV  738
            GG+SR+++ KGD  + EI++L+KKEA+L EEN QLKQRS+      VQ       S++S+
Sbjct  121  GGISRVIKIKGDKYMREISSLEKKEAQLQEENLQLKQRSQARLNEEVQNAIERGRSTDSI  180

Query  739  TNGCCL  756
            TN   L
Sbjct  181  TNNRGL  186



>ref|XP_008455140.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]
Length=222

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 145/223 (65%), Gaps = 9/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+ ARQV FSKRR+GLFKKA+EL+ LCD +IGL+VFSA+GKL  Y++S
Sbjct  1    MTRKKIQIKKIDNIAARQVAFSKRRKGLFKKAKELAILCDAEIGLLVFSASGKLFDYASS  60

Query  361  NMEEVITRH-SMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +++E++ RH ++H + +  + ++PS  LQ ES   A L +E  +KS ELRQ+ GE+LQ L
Sbjct  61   SIQEILERHNNVHSDNLPNL-NEPSVELQLESNIRAKLNEEVEKKSHELRQMKGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSR---IMRKKGDILLSEInalkkkeaklmeenaQL---KQRSEI  699
            GM EL KLEK ++GGLSR   IM  K   LLS I        +  +   +L   K   +I
Sbjct  120  GMEELKKLEKSLQGGLSRVAEIMDGKNSELLSVIGRKVDLLIEENKRLNELEVEKMGEQI  179

Query  700  GVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
             +Q     SSESV N      +  QD Y SSDTSLKLGLP  D
Sbjct  180  IMQNIQGNSSESVGNNSTSSNNPSQD-YDSSDTSLKLGLPLLD  221



>ref|XP_010526675.1| PREDICTED: MADS-box protein SVP-like [Tarenaya hassleriana]
Length=239

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 158/240 (66%), Gaps = 29/240 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  Y +S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++  + +E + +QPS  LQ  E+  ++ L+KE  EKS  LRQ+ GE+LQ L
Sbjct  61   SMKEMLERHNLQSKNLEKL-NQPSLELQLVENSDHSRLSKELAEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + +L +LEK +E GL+R++ KK + +++EI  L++K  +LMEEN +L+Q+         
Sbjct  120  NIEDLQQLEKALEAGLNRVIEKKSEKIMNEIGDLQRKGMELMEENKRLRQQGMRLMEENE  179

Query  694  EIGVQ--------GGPP---------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
             +G Q        GG           +SSESVTN        + D  +SSDTSLKLGLP+
Sbjct  180  RLGQQVSNEYERYGGAESKNVVYEEGHSSESVTNAGNSAGPPVDD--ESSDTSLKLGLPY  237



>ref|XP_010680338.1| PREDICTED: MADS-box protein JOINTLESS [Beta vulgaris subsp. vulgaris]
Length=227

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 152/228 (67%), Gaps = 15/228 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ L++FSATGKL  YS+S
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELSVLCDADVALVIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+ ++ +H +H + ++ +E QPS  LQ  E+  Y  L +E   KS++LR + GE+LQ L
Sbjct  61   SMKTILEKHKLHSKNLDKLE-QPSLKLQLVENSNYTELNEEIARKSQQLRHMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---SEIGVQ  708
            G+ EL +LEK +E GL  +M KKG+ + +EI+ L++K AKLMEEN  L+Q+   +  G Q
Sbjct  120  GIEELQQLEKSLEFGLKHVMDKKGEKITNEIDLLEQKGAKLMEENEWLRQQVLEASKGTQ  179

Query  709  GGPP---------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                          SSES++NG        QD  + SDT LKLGLP+ 
Sbjct  180  QAADSDYVVYEEGQSSESISNGYS-SGGTSQDCDEGSDTYLKLGLPYS  226



>gb|ABR18577.1| MPF1-like protein [Withania coagulans]
Length=199

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 10/189 (5%)
 Frame = +1

Query  220  LTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHI  399
            LTARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  
Sbjct  1    LTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQS  60

Query  400  EK--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMV  573
            ++  ++  E     +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+V
Sbjct  61   KRDNMDSPEQLQFYNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLV  120

Query  574  EGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP--------YSS  729
            EGG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++ V+            +S+
Sbjct  121  EGGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQVKVRLNEEVQNVIEQGHSA  180

Query  730  ESVTNGCCL  756
            +S+ N   L
Sbjct  181  DSIANHRSL  189



>ref|XP_008455141.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Cucumis 
melo]
Length=208

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 143/220 (65%), Gaps = 17/220 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+ ARQV FSKRR+GLFKKA+EL+ LCD +IGL+VFSA+GKL  Y++S
Sbjct  1    MTRKKIQIKKIDNIAARQVAFSKRRKGLFKKAKELAILCDAEIGLLVFSASGKLFDYASS  60

Query  361  NMEEVITRH-SMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +++E++ RH ++H + +  + ++PS  LQ ES   A L +E  +KS ELRQ+ GE+LQ L
Sbjct  61   SIQEILERHNNVHSDNLPNL-NEPSVELQLESNIRAKLNEEVEKKSHELRQMKGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSR---IMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQ  708
            GM EL KLEK ++GGLSR   IM  K   LLS I   + +           K   +I +Q
Sbjct  120  GMEELKKLEKSLQGGLSRVAEIMDGKNSELLSVIGRKEVE-----------KMGEQIIMQ  168

Query  709  GGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                 SSESV N      +  QD Y SSDTSLKLGLP  D
Sbjct  169  NIQGNSSESVGNNSTSSNNPSQD-YDSSDTSLKLGLPLLD  207



>ref|XP_004136891.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
Length=217

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 145/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+ ARQV FSKRR+GLFKKA+EL+ LCD +IGL+VFSA+GKL  Y++S
Sbjct  1    MTRKKIQIKKIDNIAARQVAFSKRRKGLFKKAKELAILCDAEIGLLVFSASGKLFDYASS  60

Query  361  NMEEVITRH-SMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +++E++ RH S+H E +  + ++PS  LQ ES   A L +E  +KS ELRQ+ GE+LQ L
Sbjct  61   SIQEILERHNSVHSENLPNL-NEPSVELQLESNIRAKLNEEVEKKSHELRQMKGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSR---IMRKKGDILLSEInalkkkeaklmeenaQLK--QRSEIG  702
            GM EL KLEK ++GGLSR   IM  K   LLS+I        +  +   QL+  +  E  
Sbjct  120  GMEELKKLEKSLQGGLSRVAEIMDGKNTDLLSDIGRKVDLLIEENKRLNQLEVDKLGEQI  179

Query  703  VQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
            +Q    +SSES+ N      +  QD Y SSDTSLKLGL
Sbjct  180  MQNIQGHSSESIGNNSTSSNNPSQD-YDSSDTSLKLGL  216



>emb|CAX51224.1| MPF1-like-A [Withania sp. W009]
Length=194

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 142/194 (73%), Gaps = 9/194 (5%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKK QELSTLCD DIGLIVFSAT KL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKTQELSTLCDADIGLIVFSATRKLFEYSSSSMMQLIEKHKMLSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E   S +LQ E  TYA L++EF EK+ ELR L+GE+LQ L + EL+KLEK+VE
Sbjct  61   RDNMDSPEQLLSSNLQSEKKTYAMLSREFVEKNGELRHLHGEELQGLALDELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQGGPP--YSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN QLKQ+S+     GVQ      +S++S+
Sbjct  121  GGISRVVKIKGDKYMREISSLKKKEAQLQEENLQLKQQSQARLNEGVQNAIKRGHSTDSI  180

Query  739  TNGCCLFPDKLQDH  780
            TN   L  +  QD+
Sbjct  181  TNNRSLV-NSYQDY  193



>gb|AFA37968.1| SVP2 [Actinidia chinensis]
Length=229

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 157/231 (68%), Gaps = 20/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I R+S+H + +E ++ QPS  LQ E    A L K+ +EK+ +L Q+ GEDLQ L 
Sbjct  61   SMSDIIGRYSLHTDNIEQMD-QPSLPLQLEDSNLAKLGKDVSEKTTQLWQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------SEIG  702
            + EL  LEKM+E GLSR++  KG+ +++EI  L++K+ KL+EEN +LKQ+       ++G
Sbjct  120  INELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKDEKLVEENHRLKQKMKAISEGKLG  179

Query  703  VQGGPP----------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
            V GG             SSES TN C C      +D    +DTSLKLGL F
Sbjct  180  VTGGAESDNMVAEEQGQSSESGTNVCSCNSAPPPEDD--CADTSLKLGLSF  228



>ref|XP_010926365.1| PREDICTED: MADS-box protein JOINTLESS-like [Elaeis guineensis]
 ref|XP_010926366.1| PREDICTED: MADS-box protein JOINTLESS-like [Elaeis guineensis]
Length=228

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 149/227 (66%), Gaps = 18/227 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELAILCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ +HS+H + ++ VE  PS  L  E+  Y  L K+  E S +LRQ+ GE+LQ L 
Sbjct  61   SMKEILEKHSLHSKNLQKVE-PPSLDLNLENSNYTRLDKQVAEASLQLRQMRGEELQGLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQL-KQRSEIGVQG--  711
            M EL +LEK +E GLS ++ +KG  ++ +IN L++K   LMEEN +L KQ  E+   G  
Sbjct  120  MQELQQLEKNLETGLSCVLERKGQQIMEQINHLQQKGMHLMEENERLRKQVVEMARAGRR  179

Query  712  ----------GPPYSSESVTNGCCL-FPDKLQDHYKSSDTSLKLGLP  819
                          SSESVTN   L  P    D   SSDTSLKLGLP
Sbjct  180  VLTDSENVMYEDGQSSESVTNASQLVVPPNYDD---SSDTSLKLGLP  223



>gb|AAF22455.1| MADS box protein [Paulownia kawakamii]
Length=227

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 155/229 (68%), Gaps = 19/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRG+FKKA+ELS LCD D+GLI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVGLIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E   Y+ L+KE  E+S +LR++ GE+LQ L
Sbjct  61   SMKEILGRHNLHSKNLDKLE-QPSLELQLVEDSNYSRLSKEVAERSHQLRRMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-SEI-----  699
             + +L  L+K +E GLSR++ KKG+ ++    +  +K  +LMEEN +L+Q+ ++I     
Sbjct  120  SIEKLQHLKKSLESGLSRVIEKKGEKIMKGDQSTSRKGKQLMEENERLRQQVADISNDCK  179

Query  700  --------GVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                     +      SSESV     + P   QD Y SSDTSLKLGLP+
Sbjct  180  NNAASDSENIVYDEGQSSESVNACNSVGPP--QD-YDSSDTSLKLGLPY  225



>ref|XP_010520750.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Tarenaya hassleriana]
Length=228

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 147/230 (64%), Gaps = 20/230 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSP-SLQRESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M +++ R+++H   +   +  P P  +Q E+     L+KE  +K+++LRQL GEDLQ L
Sbjct  61   RMRDMLARYNLHASNLN--KFNPPPLDIQLENSNLVRLSKEVEDKTKQLRQLRGEDLQGL  118

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + +L +LEK+VE GL R++ KKG+ ++ EI++L+K+ A L EEN++LK+R         
Sbjct  119  SLDDLQRLEKLVESGLGRVLEKKGESIMGEISSLEKRGAALAEENSKLKERLMTLERGKT  178

Query  691  ------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                    +  + G    S   TN        L D +  SDTSLKL LPF
Sbjct  179  TAFGEGEIVATRDGISLESALTTNLSSSASGSLPDDF--SDTSLKLALPF  226



>gb|AFA37964.1| SVP2 [Actinidia deliciosa]
Length=229

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 157/231 (68%), Gaps = 20/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRR+GLFKKAQEL+ LCD ++ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRQGLFKKAQELAVLCDAEVALIIFSATGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M ++I R+S+H + +E ++ QPS  LQ E    A L K+ +EK+ +L Q+ GEDLQ L 
Sbjct  61   SMSDIIGRYSLHTDNIEQMD-QPSLPLQLEDSNLAKLGKDVSEKTTQLWQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------SEIG  702
            + EL  LEKM+E GLSR++  KG+ +++EI  L++K+ KL+EEN +LKQ+       ++G
Sbjct  120  INELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKDEKLVEENHRLKQKMKAISEGKLG  179

Query  703  VQGGPP----------YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
            V GG             SSES TN C C      +D    +DTSLKLGL F
Sbjct  180  VTGGAESDNMVAEEQGQSSESGTNVCSCNSAPPPEDD--CADTSLKLGLSF  228



>emb|CAX51219.1| MPF1-like-B [Withania sp. W011]
Length=194

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E     +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLQFSNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI----GVQG--GPPYSSESV  738
            GG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++     VQ      +S++S+
Sbjct  121  GGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQVRLNEKVQNVIEQGHSADSI  180

Query  739  TNGCCL  756
             N   L
Sbjct  181  ANHRSL  186



>ref|XP_008363737.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
 ref|XP_008363738.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
 ref|XP_008363739.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
Length=231

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 149/235 (63%), Gaps = 27/235 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD DI LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E+  Y+ L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLDKLE-QPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GL  ++ KK + ++ EIN L++       +  +  +R         
Sbjct  120  SLEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNMNVQAMQLTEENERLRQQVVEKS  179

Query  691  ---------SE--IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                     SE  I  +G    SSESVTN  C      QD Y +S TSLKLGLPF
Sbjct  180  NGRRLVHVDSENLITEEG---QSSESVTN-LCKSNSGPQD-YDNSVTSLKLGLPF  229



>gb|ADU56833.1| MADS-box protein STMADS11 subfamily [Coffea arabica]
 gb|AHW58042.1| SVP-2 [Coffea arabica]
 emb|CDP11501.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 159/229 (69%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FSATGKL  +++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ ++ +H   +E  E QPS  LQ E+  +  L+KE  +++ +LRQ+ GEDLQ L 
Sbjct  61   SMSDILGKYKLHSSNLEKTE-QPSLELQLENSCHVRLSKEVADRTHQLRQMKGEDLQGLK  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK++E GL+R+++ KG+ +++EINAL+KK A+L EEN QLKQ+  +  +G  P
Sbjct  120  IEELQQLEKVLEAGLTRVLQTKGERIMNEINALQKKGAELFEENKQLKQKMAMLYEGKRP  179

Query  721  Y--------------SSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                           SSES+TN C C      +D    SDTSLKLGLPF
Sbjct  180  VIPDLDKDMLIEEGQSSESITNVCSCNSGPPPEDD--CSDTSLKLGLPF  226



>ref|XP_010523346.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Tarenaya hassleriana]
 ref|XP_010523347.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Tarenaya hassleriana]
Length=230

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 149/232 (64%), Gaps = 22/232 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M +++ R+++H   +  +   P  +LQ+ E+   A L+K+  +K+R+LRQL GEDLQ L
Sbjct  61   RMRDILARYNLHASNLNKL--NPPLALQQPENSNLARLSKDIEDKTRQLRQLRGEDLQGL  118

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + +L +LEK+VE GL R+  KKG+ ++ EI++L+++ A+L EEN  L+QR         
Sbjct  119  SLDDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLMMLERGKT  178

Query  691  -------SEIGVQGGPPYSSESVTN-GCCLFPDKLQDHYKSSDTSLKLGLPF  822
                   +  GVQ G    S   TN         L D +  SDTSLKL LPF
Sbjct  179  AAFREGETVAGVQEGMSLESAVTTNVSSSSSASPLDDDF--SDTSLKLALPF  228



>gb|AGW23358.1| MADS box protein MADS56 [Gossypium hirsutum]
Length=215

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I L+VFS TGKL  YS++
Sbjct  1    MTRQKIQIKKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALLVFSNTGKLLEYSST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +  +VI R ++  E+++ ++   +  LQ +S T A L  E  EK++ELRQL GE+LQ L 
Sbjct  61   STRQVIERRNLQSERIDLLDPISTLELQLQSSTCAMLGTEIAEKTKELRQLRGEELQGLD  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL  LEK++EGGL+R+ + K ++   EI+ LK+KE +LMEEN QLK++      G  P
Sbjct  121  LEELKHLEKLLEGGLNRVTQTKDELFFKEISILKRKEVELMEENQQLKEK-----MGNSP  175

Query  721  YSSE-SVTNGCCLFPDKLQDHYK---SSDTSLKLGLPFPD  828
            +  + +V       P     H     SSD SL+LGLP+P+
Sbjct  176  HVVQPTVAQQGLGQPSDCNGHAWRSYSSDISLRLGLPYPN  215



>emb|CAX51223.1| MPF1-like-B [Withania sp. W010]
 emb|CAX51246.1| MPF1-like-B [Withania frutescens]
Length=194

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 130/161 (81%), Gaps = 2/161 (1%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E     +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDNMDSPEQLQFSNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI  699
            GG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++
Sbjct  121  GGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQV  161



>emb|CAX51233.1| MPF1-like-B [Withania somnifera]
Length=194

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 14/189 (7%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHKMQSE  60

Query  403  K--VECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
            +  ++  E     +LQRE  TYA L+++  EK++ELRQL+GE+LQ LG+ EL+KLEK+VE
Sbjct  61   RDDMDSPEQLQFSNLQREKKTYAMLSRDLVEKNQELRQLHGEELQGLGLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGV---------QGGPPYSS  729
            GG SR+++ KGD  + EI++LKKKEA+L EEN+ LKQ++++ +         QG   +S+
Sbjct  121  GGKSRVLKIKGDKYMREISSLKKKEAQLQEENSHLKQQTQVRLNEEVQNVIEQG---HSA  177

Query  730  ESVTNGCCL  756
            +S+ N   L
Sbjct  178  DSIANHRSL  186



>ref|XP_010448550.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Camelina sativa]
Length=221

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 148/219 (68%), Gaps = 7/219 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M +++ R+++H   +  +   PS  LQ+ E+   + L+KE  +K+++LR+L GEDL  L
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQG--  711
             + EL +LEK++E GLSR+  KKGD ++S+I++L+K+ ++L++EN +L+++ E   +   
Sbjct  121  NLEELQRLEKLLESGLSRVSEKKGDCVMSQISSLEKRGSELVDENKRLREKLETFERSKM  180

Query  712  ---GPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                    +ES T     + D        SDTSLKLGLP
Sbjct  181  LAFKEAVETESATTNVSSY-DSGAPIEDESDTSLKLGLP  218



>gb|EPS73619.1| hypothetical protein M569_01137 [Genlisea aurea]
Length=223

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 153/229 (67%), Gaps = 24/229 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN+TARQVTFSKRRRGLFKKA+EL+ LCD D+ LIVFS++GKL  Y++S
Sbjct  1    MAREKIQIRKIDNVTARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSSSGKLFEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +H + ++ ++ QPS  LQ  E   Y+ L+KE  E++ +LR++ GE+L EL
Sbjct  61   SMKEILERHDLHAKNLDKMD-QPSLELQLVEDSNYSMLSKEVAERTNQLRRMRGEELNEL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GLSR+M KKG+ ++ EI  L++K  +LMEEN +LK+R         
Sbjct  120  SIQELQQLEKSIESGLSRVMEKKGERIMEEIKRLQEKGKQLMEENVRLKKRVVDMGRRSM  179

Query  691  --------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
                      + +      SSESV N     P   QD  +SSDTSLKLG
Sbjct  180  MMNDATMADSLNLAYDEGQSSESV-NASSGPP---QD-CESSDTSLKLG  223



>ref|XP_010439014.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Camelina sativa]
Length=221

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 149/221 (67%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M +++ R+++H   +  +   PS  LQ+ E+   + L+KE  +K+++LR+L GEDL  L
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIG-----  702
             + EL +LEK++E GLSR+  KKG+ ++S+I++L+K+ + L++EN +L+++ E       
Sbjct  121  NLEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSDLVDENKRLREKLETFERSKM  180

Query  703  VQGGPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
            V       +ES T     +     L+D    SDTSLKLGLP
Sbjct  181  VAFKEAVETESATTNMSSYDSGAPLEDE---SDTSLKLGLP  218



>ref|XP_010060098.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Eucalyptus grandis]
Length=232

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 152/235 (65%), Gaps = 24/235 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA ELS LCD ++ +++FSATGKL  YS+S
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQ----RESITYAG---LAKEFTEKSRELRQLNG  519
            +M++ + R+++H   +E ++ QPS  LQ    R  + ++    L+KE  EKS  LRQL G
Sbjct  61   SMKDTLERYTLHHNNLENMD-QPSLELQVLSLRSELEHSNNMRLSKEVAEKSHRLRQLRG  119

Query  520  EDLQELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI  699
            EDLQ L + EL +LEKM+E GL+R++  K + + +EI  L+ K A+L+EEN  LKQ    
Sbjct  120  EDLQGLNIEELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTMTT  179

Query  700  GVQG----------GPP---YSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
              +G            P    SSES TN C C     L+D    SDTSLKLGLPF
Sbjct  180  LTKGKRHIVTEPDVALPEEGVSSESATNVCSCNSGPPLEDD--GSDTSLKLGLPF  232



>ref|XP_009345714.1| PREDICTED: MADS-box protein JOINTLESS isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345715.1| PREDICTED: MADS-box protein JOINTLESS isoform X1 [Pyrus x bretschneideri]
Length=231

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 149/235 (63%), Gaps = 27/235 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD DI LI+FS+TGKL  Y+++
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASA  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH++H + ++ +E QPS  LQ  E+  Y+ L+KE   KS +LRQ+ GE++Q L
Sbjct  61   SMKEILERHNLHSKNLDKLE-QPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GL  ++ KK + ++ EIN L++       +  +  +R         
Sbjct  120  SLEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNMNVQAMQLTEENERLRQQVVEKS  179

Query  691  ---------SE--IGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                     SE  I  +G    SSESVTN  C      QD Y SS TSLKLGLP+
Sbjct  180  NGRRLVHVDSENLITEEG---QSSESVTN-LCKSNSGPQD-YDSSVTSLKLGLPY  229



>gb|AIK35208.1| SVP1 protein [Camellia sinensis]
Length=232

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 160/234 (68%), Gaps = 23/234 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FSATGKL  Y++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFDYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESI-TYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ ++++H    E V+ QPS  LQ E+   +A L+KE +EK+ +LRQ+ G+DLQ L
Sbjct  61   SMKDILRKYNVHANNSEKVD-QPSLELQLENTNNHARLSKEVSEKTNQLRQMRGDDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LE+M+E GLSR+++ KG+ +++EI  L+ K A+L+EEN QLK++         
Sbjct  120  NIEELQQLERMLESGLSRVLKTKGERIMNEIATLQSKGAQLIEENKQLKRKMTMISKGKW  179

Query  691  ----SEIGVQGG-----PPYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                + +G +          S ES+TNGC C      +D    SDTSLKLGLP 
Sbjct  180  GVGVANVGAESDNLVPEEGQSPESITNGCSCNSAPPPEDD--CSDTSLKLGLPI  231



>ref|XP_006580977.1| PREDICTED: uncharacterized protein LOC100776749 isoform X2 [Glycine 
max]
Length=220

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 149/223 (67%), Gaps = 10/223 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M RT+I+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++GLIVFS+TGKL  YS+S
Sbjct  1    MTRTRIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++T++S H   +  ++ +PS  LQ E+   A L+KE  ++++EL  L G+DLQ LG
Sbjct  61   SMNDIVTKYSTHSHGINKLD-KPSLELQLEASNSAKLSKEIADRTQELSWLKGDDLQGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------SEIG  702
            + EL +LEK +E GL R+   K + ++S+I+ L+KK A+  +E    K +      S+ G
Sbjct  120  LNELQQLEKTLEIGLDRVTDIKENQIMSQISELQKKLAEKEKEAMLCKAKIPFMVDSDKG  179

Query  703  VQGGPPYSSESVTN-GCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
            +      S +S  N   C+    L+D   SSD SL LGLPF +
Sbjct  180  IMQEEGVSLDSTNNISSCISDPPLEDG--SSDISLTLGLPFSN  220



>gb|AFM77899.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 152/221 (69%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q E+   + L+KE  +K+++LRQ+ GEDL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++  + ++    
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPDK--LQDHYKSSDTSLKLGLP  819
             +      +ES T     +     ++D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSAAPIEDDF--SDTSLKLGLP  218



>emb|CDY03445.1| BnaC01g16370D [Brassica napus]
Length=221

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 152/221 (69%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q E+   + L+KE  +K+++LRQ+ GEDL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGEDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++  + ++    
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     ++D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSGAPIEDDF--SDTSLKLGLP  218



>ref|XP_010646795.1| PREDICTED: LOW QUALITY PROTEIN: MADS-box protein SVP [Vitis vinifera]
Length=253

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 153/225 (68%), Gaps = 17/225 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ +HS+  + +E +E QPS  LQ  E+  ++ L+KE  +KS +LRQ+ GE+LQ L
Sbjct  61   SMKEILEKHSLQSKNLEKLE-QPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + +L +LEK +E GLSR+++KKG+ ++ EI  L+ K  +LMEEN +L+Q        R 
Sbjct  120  NIEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRR  179

Query  694  EIGVQGGPPY-----SSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
            ++       +     SSESVTN         QD Y+SSDTSL  G
Sbjct  180  QVAGDSENMFHEEGQSSESVTN-VSNSNGPPQD-YESSDTSLNWG  222



>ref|XP_004515126.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cicer arietinum]
 ref|XP_004515127.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cicer arietinum]
 ref|XP_004515128.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Cicer arietinum]
Length=227

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 148/230 (64%), Gaps = 19/230 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M   KI+IKKIDN TARQVTFSKRRRGLFKK +ELS LCD D+ LI+FS+TGKL  YSN 
Sbjct  1    MASEKIKIKKIDNATARQVTFSKRRRGLFKKGEELSVLCDADVALIIFSSTGKLFEYSNL  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M E++ RH +H + +  +E +PS  LQ  E+I  + L+KE  EKS +LRQ+ GEDL  L
Sbjct  61   SMREILERHHLHSKNLAELE-EPSLELQLVENINCSTLSKEIAEKSHQLRQMRGEDLHGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LE+ +E GL R++  K + ++ EI  L++K  +LMEEN +L  R E  +  G 
Sbjct  120  NVEELHQLERSLEIGLGRVLETKEEKIMMEIKHLQRKGMQLMEENDRL-MRLEANMNNGK  178

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
             +              SSESVTN  C      QD Y SSDTSLKLGLP+ 
Sbjct  179  MFGGVESENVVNEEGQSSESVTN-VCNSTGPPQD-YVSSDTSLKLGLPYA  226



>gb|AGW23342.1| MADS box protein MADS40 [Gossypium hirsutum]
Length=225

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 150/226 (66%), Gaps = 15/226 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTF+KRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNSTARQVTFAKRRRGLFKKAEELAILCDADVALIIFSSTGKLFDYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +  + +E +E QP   L+  E    + L  E  EKS +LRQ+ GE+L  L
Sbjct  61   SMKEILERHHLRSKNLEKLE-QPCLGLKLVEHSNQSMLTMEIAEKSHQLRQMRGEELHGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GLSR+M KKG  ++ EI  L++K  +LMEEN +LKQ+         
Sbjct  120  NIEELQQLEKSLEIGLSRVMEKKGQRIMREIKDLQRKGMQLMEENERLKQQIINGPRQVT  179

Query  691  --SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
              S+  + G    SSESVTN C    +     Y+SS TSLKLGLP+
Sbjct  180  GDSDNIIFGEEGQSSESVTNVCT--SNGNPHDYESSVTSLKLGLPY  223



>gb|AAW66885.1| MADS box transcription factor [Elaeis guineensis]
Length=225

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 149/229 (65%), Gaps = 18/229 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELAILCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+E++ +HS+H + ++ VE  PS  L  E+  Y  L K+  E S +LRQ+ GE+LQ L 
Sbjct  61   SMKEILEKHSLHSKNLQKVEP-PSLDLNLENSNYTRLDKQVAEASLQLRQMRGEELQGLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQL-KQRSEIGVQG--  711
            M EL +LEK +E GLS ++ +KG  ++ +IN L++K   LMEEN +L KQ  E+   G  
Sbjct  120  MQELQQLEKNLETGLSCVLERKGQQIMEQINHLQQKGMHLMEENERLRKQVVEMARAGRR  179

Query  712  ----------GPPYSSESVTNGCCL-FPDKLQDHYKSSDTSLKLGLPFP  825
                          SSESVTN   L  P    D   SSDTSLKLG+  P
Sbjct  180  VLTDSENVMYEDGQSSESVTNASQLVVPPNYDD---SSDTSLKLGVAGP  225



>ref|XP_010472243.1| PREDICTED: MADS-box protein SVP-like [Camelina sativa]
Length=238

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 156/241 (65%), Gaps = 32/241 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + NS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----SEIG-  702
             + EL +LEK +E GL+R++  K D +++EI+ L++K  +LM+EN +L+Q+    +E+  
Sbjct  120  NIEELQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQGTQLTEVNE  179

Query  703  -----------------VQGGPPY----SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                             V+    Y    SSES+TN     P       +SSDTSL+LGL 
Sbjct  180  RLGMQIYNNVHESGVDEVENAAVYEEGHSSESITNAGNGAPVD----SESSDTSLRLGLA  235

Query  820  F  822
            +
Sbjct  236  Y  236



>ref|XP_003613086.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES96044.1| MADS-box transcription factor [Medicago truncatula]
Length=227

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 151/230 (66%), Gaps = 19/230 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKI+N TARQVTFSKRRRGL KKA+ELS LCD D+ LI+FS+TGKL  YSN 
Sbjct  1    MAREKIQIKKIENSTARQVTFSKRRRGLIKKAEELSVLCDADVALIIFSSTGKLFEYSNL  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M E++ RH +H + +  +E +PS  LQ  E+   + L+KE  +KS +LRQ+ GEDLQ L
Sbjct  61   SMREILERHHLHSKNLAKLE-EPSLELQLVENSNCSRLSKEVAQKSHQLRQMRGEDLQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP  717
             + EL +LEK +E GL R++  KG+ ++ EIN L+ K  +LMEEN +LK R   G+  G 
Sbjct  120  SLEELQQLEKSLEIGLGRVIETKGEKIMMEINELQTKGRQLMEENNRLK-RHVSGMFNGK  178

Query  718  PY--------------SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
             +              SSESVTN         QD Y+SSDTSLKLGLP+ 
Sbjct  179  MFGGVESENMVTEEGQSSESVTN-VYNSTGPPQD-YESSDTSLKLGLPYA  226



>gb|AFC96914.1| SVP-like MADS-box protein, partial [Vitis vinifera]
Length=240

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 153/225 (68%), Gaps = 17/225 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  +S+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ +HS+  + +E +E QPS  LQ  E+  ++ L+KE  +KS +LRQ+ GE+LQ L
Sbjct  61   SMKEILEKHSLQSKNLEKLE-QPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQ--------RS  693
             + +L +LEK +E GLSR+++KKG+ ++ EI  L+ K  +LMEEN +L+Q        R 
Sbjct  120  NIEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRR  179

Query  694  EIGVQGGPPY-----SSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
            ++       +     SSESVTN         QD Y+SSDTSL  G
Sbjct  180  QVAGDSENMFHEEGQSSESVTN-VSNSNGPPQD-YESSDTSLNWG  222



>gb|AAK27151.1| MADS box transcription factor [Ipomoea batatas]
 dbj|BAC15562.1| IbMADS4 [Ipomoea batatas]
Length=229

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 153/229 (67%), Gaps = 16/229 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+EL+ LCD D+ LIVFSATGKL  +++S
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSATGKLFEFASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            NM++++ ++ +H   ++    QPS  LQ E+  +  L+KE  +K+RELRQ+ GE+LQ L 
Sbjct  61   NMKDILGKYELHSSNLDQA-TQPSRELQLENSLHVRLSKEVADKTRELRQMKGEELQGLS  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL KLEK +E GL+R++  KG+ +++EI  L++K A+LM+EN QLK++          
Sbjct  120  LEELQKLEKRLENGLTRVLETKGERVVTEIATLQRKGAELMKENKQLKEKMARVNGEKFP  179

Query  691  --SEIGVQGGPP---YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
              +++   G  P    SSES+T   C            SDTSLKLGLP 
Sbjct  180  VIADVEAAGLIPEEGQSSESITTNVCSCNSGPPPEDDCSDTSLKLGLPI  228



>ref|XP_004490446.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cicer arietinum]
 ref|XP_004490447.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cicer arietinum]
 ref|XP_004490448.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Cicer arietinum]
Length=219

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 147/229 (64%), Gaps = 24/229 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRG+FKKA+ELS LCD ++GLI+FSATGKL  Y +S
Sbjct  1    MARQKIKIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDAEVGLIIFSATGKLYEYGSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            NM+++ITR++ H + +    ++P    Q E+++ A L KE  +K+++LR + GED + + 
Sbjct  61   NMKDIITRYNQHFQHM-SKSNKPLQEFQGENLS-AELQKEVADKTQQLRGMKGEDFEGIN  118

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            +  L +LEK +E GL R+M  K   +++EI+ L+ K  KL E+N  LKQ+          
Sbjct  119  LKGLQELEKTLETGLKRVMEMKEKRIVNEISTLQIKGIKLEEQNKHLKQKMAMLCNRKNL  178

Query  691  ----SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFP  825
                S+I +Q     SSES+ N      D       SSDTSLKLGLP+P
Sbjct  179  ILGDSDITMQ--EIVSSESMNNSGLSLED------DSSDTSLKLGLPYP  219



>ref|XP_009138187.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Brassica rapa]
Length=223

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 150/222 (68%), Gaps = 11/222 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q ++   + L+KE  +K+++LRQ+ G DL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-------  699
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++ ++       
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQYQLVTLEMAK  180

Query  700  GVQGGPPYSSESVTNGCCLFPDK--LQDHYKSSDTSLKLGLP  819
             +       +ES T     +     ++D +  SDTSLKLGLP
Sbjct  181  TMALKEAVETESATTNVSSYDSAAPIEDDF--SDTSLKLGLP  220



>ref|XP_009391344.1| PREDICTED: MADS-box transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 145/228 (64%), Gaps = 18/228 (8%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            MVR KI+IKKIDN  ARQVTFSKRRRGLFKKA ELS LCD D+ LIVFS+TGKL  + NS
Sbjct  1    MVREKIQIKKIDNTAARQVTFSKRRRGLFKKAAELSVLCDADVALIVFSSTGKLFEFCNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M+++I +HS H + +E    QP   L  ++  YA L K+  E S +LRQ+ GE L++L 
Sbjct  61   SMKKIIDKHSTHSKNLE-KHDQPFLDLNLDNNNYASLKKQVAEASLQLRQMRGEALEKLT  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL +LEK +E GL R+M +KG     +IN+L++K AKL EEN +L++R          
Sbjct  120  VEELQQLEKTLEAGLGRVMDRKGAQFTQQINSLQQKAAKLAEENVRLRRRVLEMPNMGKQ  179

Query  691  ---SEIGVQGGPPYSSESVTNGC-CLFPDKLQDHYKSSDTSLKLGLPF  822
                +  V      SSESVTN      P +  D   SS TSLKLGLP+
Sbjct  180  VMADKDNVVNEDGQSSESVTNASHSGGPQECDD---SSVTSLKLGLPY  224



>ref|NP_179840.2| MADS-box protein SVP [Arabidopsis thaliana]
 sp|Q9FVC1.1|SVP_ARATH RecName: Full=MADS-box protein SVP; AltName: Full=Protein SHORT 
VEGETATIVE PHASE [Arabidopsis thaliana]
 gb|AAG24508.1|AF211171_1 short vegetative phase protein [Arabidopsis thaliana]
 gb|ABU95408.1| short vegetative phase [Arabidopsis thaliana]
 gb|ACF09414.1| At2g22540 [Arabidopsis thaliana]
 gb|AEC07320.1| MADS-box protein SVP [Arabidopsis thaliana]
 gb|AFU85626.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85627.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85628.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85629.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85630.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85631.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85633.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85634.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85635.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85637.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85638.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85639.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85640.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85641.1| short vegetative phase [Arabidopsis thaliana]
Length=240

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 157/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K D ++SEI+ L+KK  +LM+EN +L+Q+         
Sbjct  120  DIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  EIGVQ--------GGPP----------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
             +G+Q        GG             SSES+TN        +    +SSDTSL+LGLP
Sbjct  180  RLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGLP  237

Query  820  F  822
            +
Sbjct  238  Y  238



>ref|XP_010520749.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Tarenaya hassleriana]
Length=229

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 147/231 (64%), Gaps = 21/231 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA+ELS LCD ++ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  361  -NMEEVITRHSMHIEKVECVEHQPSP-SLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
              M +++ R+++H   +   +  P P  +Q E+     L+KE  +K+++LRQL GEDLQ 
Sbjct  61   RRMRDMLARYNLHASNLN--KFNPPPLDIQLENSNLVRLSKEVEDKTKQLRQLRGEDLQG  118

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR--------  690
            L + +L +LEK+VE GL R++ KKG+ ++ EI++L+K+ A L EEN++LK+R        
Sbjct  119  LSLDDLQRLEKLVESGLGRVLEKKGESIMGEISSLEKRGAALAEENSKLKERLMTLERGK  178

Query  691  -------SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
                     +  + G    S   TN        L D +  SDTSLKL LPF
Sbjct  179  TTAFGEGEIVATRDGISLESALTTNLSSSASGSLPDDF--SDTSLKLALPF  227



>ref|XP_006466301.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466302.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Citrus 
sinensis]
 ref|XP_006466303.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X3 [Citrus 
sinensis]
Length=217

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 144/231 (62%), Gaps = 33/231 (14%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRG+FKKA+ELS LCD D+ LI+FSATGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQ-RESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ +H +H + +E V+ QPS  LQ  E+  Y+ L KE  EKS  LRQ+ GE++  L
Sbjct  61   SMKEILEKHRVHSKNLERVD-QPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGL  119

Query  538  GMAELIKLEKMVEGGLSRI--------------MRKKGDILLSEInalkkkeaklmeena  675
             + EL KLE+ +E GL R+              ++++G +L+ E              N 
Sbjct  120  SLEELQKLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEE--------------NE  165

Query  676  QLKQR-SEI-GVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            +L+Q+ +E+    G    SSESV N  C   +      +SSDTSLKLGLP+
Sbjct  166  RLRQQVAEVSNAYGEEGQSSESVNN-ICNSSNAPPPESESSDTSLKLGLPY  215



>gb|ABJ96361.2| dam1 [Prunus persica]
Length=242

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = +1

Query  175  VKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYS  354
            +KM R KI+IKKIDNL ARQVTFSKRRRG+FKKA ELS LC+ ++ +++FSATGKL  YS
Sbjct  1    MKMTREKIKIKKIDNLPARQVTFSKRRRGIFKKAAELSVLCESEVAVVIFSATGKLFDYS  60

Query  355  NSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +S+M++VI R+  HI   E  + +PS  LQ E   +  L+KE  EKSR+LRQ+ GEDL+E
Sbjct  61   SSSMKDVIERYQEHINGAEKFD-EPSIELQPEKENHIRLSKELEEKSRQLRQMKGEDLEE  119

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS  693
            L   EL KLE++V+  L R++  K ++++SEI ALK+K A+L+E N QL+QR+
Sbjct  120  LNFDELQKLEQLVDASLGRVIETKDELIMSEIMALKRKRAELVEANKQLRQRA  172



>gb|AGW23356.1| MADS box protein MADS54 [Gossypium hirsutum]
Length=219

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 153/227 (67%), Gaps = 24/227 (11%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDNLTARQVTFSKRRRGLFKKA+ELS LCD +  LI+FSATGKL  ++ S
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLFKKAEELSVLCDAEFALIIFSATGKLFEFATS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++++ R+++H  K++    QP+  L+ E+     L+KE  +K+ ++RQ+ GEDLQ L 
Sbjct  61   SMKDILGRYNLHSNKLD----QPTLELRLENTNEISLSKEVADKTHQMRQMRGEDLQGLN  116

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL +LEK++E GL+R++  KG+ +++EI++L+ + A+L EEN  LK++          
Sbjct  117  IDELQQLEKLLESGLTRVLETKGERIMNEISSLEIEGAQLQEENKLLKEKLVSLCKGKRL  176

Query  691  ----SEIGVQGGPPYSSESVTN--GCCLFPDKLQDHYKSSDTSLKLG  813
                SE+  Q     SS+SV +   C   P  L+D   SSDTSLKLG
Sbjct  177  VLVDSEVATQ-EEGMSSQSVDDVYSCSSGP-SLEDD--SSDTSLKLG  219



>gb|AFM77900.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q E+   + L+KE  +K+++LRQ+ G DL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++  + ++    
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     ++D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSGAPIEDDF--SDTSLKLGLP  218



>ref|XP_010648095.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Vitis 
vinifera]
 ref|XP_010648096.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Vitis 
vinifera]
 emb|CBI35558.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 151/220 (69%), Gaps = 6/220 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSA GKL  YS+S
Sbjct  1    MPRQKIQIKKIDNTAARQVTFSKRRRGLFKKALELSTLCDAEIELIVFSAAGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI RHS H +  E  E  PS  LQ E+ T A L+KE  ++++ LRQ+ GE+LQ L 
Sbjct  61   SVNQVIERHSQHPQTPEKPE-PPSLELQLENRTCAALSKEIAQQTQRLRQMRGEELQGLK  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP-  717
            + ELI+LEK++E GL  ++ +K + + +EI+ L++K   L  EN +L++  E   +  P 
Sbjct  120  IEELIELEKLLEAGLCSVVEEKAERIQTEISDLQRKGDLLRGENERLRKWMENISEAQPL  179

Query  718  ---PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                +SSES+TN  C   D  Q H+ +SDTSLKLGLPF +
Sbjct  180  LQQGHSSESITNNICSLSDPNQGHH-NSDTSLKLGLPFSN  218



>ref|XP_011023054.1| PREDICTED: MADS-box protein JOINTLESS-like [Populus euphratica]
Length=237

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 150/226 (66%), Gaps = 9/226 (4%)
 Frame = +1

Query  172  VVKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHY  351
            +VKM R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I L VFSATGKL  Y
Sbjct  14   MVKMTRKKIQIKKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALTVFSATGKLFEY  73

Query  352  SNSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            SN++M +VI R ++H +  + + HQ S   Q +   +A L KE  EK+RELR + GEDLQ
Sbjct  74   SNTSMGQVIERRNLHPKNFDAL-HQQSLEQQLDGGVHAMLIKEIAEKNRELRHMRGEDLQ  132

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR--SEIGV  705
             L + EL KLEK++EG L R++ +K +  + EINALK K  +L EEN +LKQ+  +    
Sbjct  133  GLNVEELKKLEKLIEGSLRRLVEEKEEKSIKEINALKTKGKQLAEENQRLKQQVMNLSAA  192

Query  706  QGG---PPYSSES-VTNGCCL-FPDKLQDHYKSSDTSLKLGLPFPD  828
            QG    P  S +S VTN   +   D  QD+  SS   L LGLPFPD
Sbjct  193  QGHLLEPGESPDSLVTNISSMSSADPRQDN-DSSCAFLTLGLPFPD  237



>emb|CAX51212.1| MPF1-like-B [Withania frutescens]
Length=194

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 147/194 (76%), Gaps = 9/194 (5%)
 Frame = +1

Query  223  TARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNSNMEEVITRHSMHIE  402
            TARQVTFSKRRRGLFKKAQELSTLCD DIGLIVFSATGKL  YS+S+M ++I +H M  E
Sbjct  1    TARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSSSSMMQLIEKHQMQSE  60

Query  403  --KVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELGMAELIKLEKMVE  576
              K++C E   S +LQ E  TYA L++E  EK+RELRQL+G++LQELG+ EL+KLEK+VE
Sbjct  61   RDKMDCPEQLQSFNLQSEKKTYAMLSRELVEKNRELRQLHGKELQELGLEELMKLEKLVE  120

Query  577  GGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS------EIGVQGGPPYSSESV  738
            GG+SR+++ KGD  + EI++LKKKEA+L EEN+QLKQ++      E+       +S++S+
Sbjct  121  GGISRVLKIKGDKYMREISSLKKKEAQLQEENSQLKQQTKARLDEEVQNVIEQGHSADSI  180

Query  739  TNGCCLFPDKLQDH  780
            TN   L  +  QDH
Sbjct  181  TNHRSLV-NSHQDH  193



>ref|XP_010312646.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Solanum 
lycopersicum]
Length=197

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  YS+S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M++++ R  +H + +E ++ QPS  LQ  E+  Y+ L+KE +EKS  LRQ+ GE+LQ L
Sbjct  61   SMKQILERRDLHSKNLEKLD-QPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEI  630
             + EL +LE+ +E GLSR++ +KGD ++ EI
Sbjct  120  NIEELQQLERSLETGLSRVIERKGDKIMREI  150



>gb|AIU94278.1| DAM6 for dormancy associated MADS-box transcription factor [Prunus 
pseudocerasus]
Length=240

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 150/241 (62%), Gaps = 26/241 (11%)
 Frame = +1

Query  172  VVKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHY  351
            +VKM+R KI+IKKID L ARQVTFSKRRRGLFKKA ELS LC+ ++ +++FSATGKL  Y
Sbjct  1    MVKMMREKIKIKKIDYLPARQVTFSKRRRGLFKKAAELSVLCESEVAVVIFSATGKLFDY  60

Query  352  SNSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            S+S++E+VI R+  H   V+    Q    LQ E+  +  L+KE  EKSR+LRQ+ GEDL+
Sbjct  61   SSSSIEDVIERYKAHTNGVQKSNKQ-FLELQLENENHIKLSKELEEKSRQLRQMKGEDLE  119

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR-------  690
             L + EL+KLE++VEG L R++  K ++++SEI AL+KK A+L+E N QL+QR       
Sbjct  120  GLNLDELLKLEQLVEGSLGRVIETKEELIMSEIIALEKKGAELVETNNQLRQRMAMLSGG  179

Query  691  -------------SEIGVQGGPPYSSESVT----NGC-CLFPDKLQDHYKSSDTSLKLGL  816
                         + IG  G    SSES T      C       L+D       SLKLGL
Sbjct  180  NTGPALVEPETLNTNIGGGGEDGMSSESATMATSTSCNSALSLSLEDDCSDVTLSLKLGL  239

Query  817  P  819
            P
Sbjct  240  P  240



>ref|XP_006426275.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 ref|XP_006426276.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 gb|ESR39515.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 gb|ESR39516.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
Length=217

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 144/231 (62%), Gaps = 33/231 (14%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRG+FKKA+ELS LCD D+ LI+FSATGKL  YS+S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQ-RESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ +H +H + +E V+ QPS  LQ  E+  Y+ L KE  EKS  LRQ+ GE++  L
Sbjct  61   SMKEILEKHRVHSKNLERVD-QPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGL  119

Query  538  GMAELIKLEKMVEGGLSRI--------------MRKKGDILLSEInalkkkeaklmeena  675
             + EL +LE+ +E GL R+              ++++G +L+ E              N 
Sbjct  120  SLEELQRLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEE--------------NE  165

Query  676  QLKQR-SEI-GVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPF  822
            +L+Q+ +E+    G    SSESV N  C   +      +SSDTSLKLGLP+
Sbjct  166  RLRQQVAEVSNAYGEEGQSSESVNN-ICNSSNAPPPESESSDTSLKLGLPY  215



>gb|AFM77909.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 155/242 (64%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+  +A L+KE  EKS  LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K + ++SEI+ L++K  KLM+EN +L+Q          
Sbjct  120  NIEELQQLEKALESGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENE  179

Query  694  EIGVQ---------GG----------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
             +G Q         GG            +SSES+TN        +    +SSDTSL+LGL
Sbjct  180  RLGKQIYNNMHERYGGVESEKTAVYEEGHSSESITNAGNSTGAPVDS--ESSDTSLRLGL  237

Query  817  PF  822
            P+
Sbjct  238  PY  239



>ref|XP_006282463.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
 gb|EOA15361.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
Length=231

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 148/219 (68%), Gaps = 11/219 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDN+TARQVTFSKRRRG+FKKA ELS LCD D+ L++FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALVIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
             M +++ ++++H   +  +   PS  LQ+ E+   + L+KE  +K+++LR+L GEDL  L
Sbjct  61   RMRDILGKYNLHASNINKMMDPPSTHLQQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI-----G  702
             + EL +LEKM+E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++ E       
Sbjct  121  NLEELQRLEKMLESGLSRVTEKKGECVMSQISSLEKRGSELVDENKRLREKLETFERAKM  180

Query  703  VQGGPPYSSESVTNGCCLFPD--KLQDHYKSSDTSLKLG  813
            +       +ES T     +     L+D    SDTSLKLG
Sbjct  181  MASKEAVETESATTNLSSYDSGAPLEDE---SDTSLKLG  216



>ref|XP_003631742.2| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Vitis 
vinifera]
 ref|XP_010648130.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Vitis 
vinifera]
 ref|XP_010648131.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Vitis 
vinifera]
 emb|CBI34005.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 151/220 (69%), Gaps = 7/220 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKAQELSTLCD +I LIVFSA GKL  YS+S
Sbjct  1    MARQKIQIKKIDNTAARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSAAGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI RH+ H +  E  E  PS  LQ E+ T A L+KE  ++++ LRQ+ GE+LQ L 
Sbjct  61   SVSQVIERHNQHPQTPEKPEP-PSLELQLENSTCAALSKEIAQQTQRLRQMKGEELQGLK  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP-  717
            + ELI+LE+++E GL  ++ +K + + +EI+ L++K   L EEN +L++  E  +   P 
Sbjct  120  IEELIELEELLEAGLCSVVEEKAERIRTEISDLQRKGDLLREENERLRKEVE-NISEAPL  178

Query  718  ---PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                +SSES+T   C   D  Q  + +SDTSLKLGLPF +
Sbjct  179  LQQGHSSESITTNICSLSDPNQGLH-NSDTSLKLGLPFSN  217



>ref|XP_009138200.1| PREDICTED: MADS-box protein AGL24 isoform X4 [Brassica rapa]
 ref|XP_009138207.1| PREDICTED: MADS-box protein AGL24 isoform X4 [Brassica rapa]
 gb|AFM77898.1| MADS-box protein AGL24 [Brassica napus]
 gb|AFM77903.1| MADS-box protein AGL24 [Brassica juncea]
Length=221

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q ++   + L+KE  +K+++LRQ+ G DL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++  + ++    
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPDK--LQDHYKSSDTSLKLGLP  819
             +      +ES T     +     ++D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSAAPIEDDF--SDTSLKLGLP  218



>gb|KFK32803.1| mads-box protein svp [Arabis alpina]
Length=241

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 153/244 (63%), Gaps = 35/244 (14%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + NS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+  +A L++E  +KS  LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENTDHARLSREIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL KLEK +E GL+R++  K D ++ EI+ L++K  +LM+EN +L+Q+         
Sbjct  120  NVEELQKLEKSLETGLTRVIETKSDKIMKEISELQRKGMQLMDENKRLRQQGSQLTEENE  179

Query  694  EIGVQGGPPY-------------------SSESVTN--GCCLFPDKLQDHYKSSDTSLKL  810
             +G+Q                        SSES+TN       P       +SSDTSL+L
Sbjct  180  RLGMQINNNVQERHGVAESVNVVVCEEGQSSESITNVGNSTGAP----VDSESSDTSLRL  235

Query  811  GLPF  822
            GLP+
Sbjct  236  GLPY  239



>ref|XP_010648099.1| PREDICTED: MADS-box protein AGL24-like isoform X4 [Vitis vinifera]
Length=237

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 151/220 (69%), Gaps = 6/220 (3%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN  ARQVTFSKRRRGLFKKA ELSTLCD +I LIVFSA GKL  YS+S
Sbjct  20   MPRQKIQIKKIDNTAARQVTFSKRRRGLFKKALELSTLCDAEIELIVFSAAGKLFEYSSS  79

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI RHS H +  E  E  PS  LQ E+ T A L+KE  ++++ LRQ+ GE+LQ L 
Sbjct  80   SVNQVIERHSQHPQTPEKPE-PPSLELQLENRTCAALSKEIAQQTQRLRQMRGEELQGLK  138

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGP-  717
            + ELI+LEK++E GL  ++ +K + + +EI+ L++K   L  EN +L++  E   +  P 
Sbjct  139  IEELIELEKLLEAGLCSVVEEKAERIQTEISDLQRKGDLLRGENERLRKWMENISEAQPL  198

Query  718  ---PYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                +SSES+TN  C   D  Q H+ +SDTSLKLGLPF +
Sbjct  199  LQQGHSSESITNNICSLSDPNQGHH-NSDTSLKLGLPFSN  237



>ref|XP_008219269.1| PREDICTED: MADS-box protein AGL24-like [Prunus mume]
Length=235

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 146/236 (62%), Gaps = 22/236 (9%)
 Frame = +1

Query  175  VKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYS  354
            +KM+R KI+IKKIDNL ARQVTFSKRRRG+FKKA ELS LC+ ++ +++FSATGKL  YS
Sbjct  1    MKMMREKIKIKKIDNLPARQVTFSKRRRGIFKKAAELSVLCESEVAVVIFSATGKLFDYS  60

Query  355  NSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQE  534
            +S+M++VI R+  HI   E   ++PS  LQ E   +  L+KE  EKSR+LRQ+ GEDL+E
Sbjct  61   SSSMKDVIQRYQAHINGGEKF-NEPSIELQPEYENHIRLSKELKEKSRQLRQMKGEDLEE  119

Query  535  LGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG  714
            L   EL KLE++V+  L R++  K + ++SEI AL++K A+L++ N QL+QR       G
Sbjct  120  LNFDELQKLEQLVDASLGRVIETKDERIMSEIMALERKRAELVKANKQLRQRMLFRGNIG  179

Query  715  PP-YSSESVTNG-------------------CCLFPD-KLQDHYKSSDTSLKLGLP  819
            P     E + N                    C   P   L+D       SLKLGLP
Sbjct  180  PELMKPERLNNNFGGGGEEEGMSSESATSTTCNSAPSLSLEDDSDDVTLSLKLGLP  235



>gb|AAQ55452.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
Length=241

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 155/242 (64%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+  +A L+KE  EKS +LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENSDHALLSKEIAEKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K + ++SEI+ L++K  KLM+EN +L+Q          
Sbjct  120  NIEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENE  179

Query  694  EIGVQ---------GG----------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
             +G Q         GG             SSES+TN        +    +SSDTSL+LGL
Sbjct  180  RLGKQIYNNMHERYGGVESEKTAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGL  237

Query  817  PF  822
            P+
Sbjct  238  PY  239



>ref|NP_001239872.1| uncharacterized protein LOC100776749 [Glycine max]
 ref|XP_006580976.1| PREDICTED: uncharacterized protein LOC100776749 isoform X1 [Glycine 
max]
 gb|ACU18174.1| unknown [Glycine max]
 gb|KHN09002.1| MADS-box protein SVP [Glycine soja]
Length=234

 Score =   166 bits (420),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 150/237 (63%), Gaps = 24/237 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M RT+I+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++GLIVFS+TGKL  YS+S
Sbjct  1    MTRTRIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++T++S H   +  ++ +PS  LQ E+   A L+KE  ++++EL  L G+DLQ LG
Sbjct  61   SMNDIVTKYSTHSHGINKLD-KPSLELQLEASNSAKLSKEIADRTQELSWLKGDDLQGLG  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + EL +LEK +E GL R+   K + ++S+I+ L+KK   L EEN  L ++          
Sbjct  120  LNELQQLEKTLEIGLDRVTDIKENQIMSQISELQKKGILLEEENKHLTKKLAEKEKEAML  179

Query  691  ----------SEIGVQGGPPYSSESVTN-GCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                      S+ G+      S +S  N   C+    L+D   SSD SL LGLPF +
Sbjct  180  CKAKIPFMVDSDKGIMQEEGVSLDSTNNISSCISDPPLEDG--SSDISLTLGLPFSN  234



>gb|AFM77901.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +++ R+++H   +  +   PSP  Q ++   + L+KE  +K+++LRQ+ G DL+ L 
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++  + ++    
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL-VTLEMAKT  179

Query  721  YS------SESVTNGCCLFPD--KLQDHYKSSDTSLKLGLP  819
             +      +ES T     +     ++D +  SDTSLKLGLP
Sbjct  180  MALKEAVETESATTNVSSYDSGAPIEDDF--SDTSLKLGLP  218



>gb|ABK92958.1| unknown [Populus trichocarpa]
Length=215

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 143/217 (66%), Gaps = 8/217 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN +ARQV+FSKRRRGLFKKA ELS LCD +I L+VFSATGK   YSNS
Sbjct  1    MARKKIQIKKIDNTSARQVSFSKRRRGLFKKAFELSILCDAEIALMVFSATGKFFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +VI R ++H + ++    QPS  LQ +S  +A L KE  EK+RELR+  GEDLQ L 
Sbjct  61   SIGQVIERRNLHPKNLDTFS-QPSVELQLDSAVHAMLNKEIAEKTRELRRTRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
            M EL KLEK++E  L R++  KG+ +L E++ALK KE +L+EEN +LKQR  + +  G  
Sbjct  120  MEELEKLEKLIEKSLCRVIETKGEKILKEVDALKSKEHQLIEENQRLKQRL-MSLSKGQG  178

Query  721  Y------SSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
            +      SS+S+ N         +  Y +  + L LG
Sbjct  179  HLLEQGQSSDSMVNNISSNSANPRQDYDNYSSFLTLG  215



>gb|AFM77906.1| MADS-box protein SVP [Brassica juncea]
Length=241

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 154/242 (64%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS+TGKL  + NS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+   + L+KE  +KS +LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENSDNSRLSKEIADKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K + ++SEI+ L++K  KLM+EN +L+Q          
Sbjct  120  NIEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENE  179

Query  694  EIGVQ---------GG----------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
             +G Q         GG             SSES+TN        +    +SSDTSL+LGL
Sbjct  180  RLGKQIYNNMHERYGGVESEKTAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGL  237

Query  817  PF  822
            P+
Sbjct  238  PY  239



>ref|XP_010417014.1| PREDICTED: MADS-box protein SVP isoform X2 [Camelina sativa]
Length=240

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 156/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + +L +LEK +E GL+R++  K D +++EI+ L++K  +LM+EN +L+Q+         
Sbjct  120  NIEDLQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQGTQLTEENE  179

Query  694  -----------EIGV---QGGPPY----SSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                       E GV   +    Y    SSES+TN      +      +SSDTSL+LGLP
Sbjct  180  RLGMQMYNNVHESGVDEMENAAVYEEGHSSESITNAGN--SNGAPVDSESSDTSLRLGLP  237

Query  820  F  822
            +
Sbjct  238  Y  238



>gb|AFU85632.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85636.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85642.1| short vegetative phase [Arabidopsis thaliana]
Length=240

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 156/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKK +ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKVEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K D ++SEI+ L+KK  +LM+EN +L+Q+         
Sbjct  120  DIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  EIGVQ--------GGPP----------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
             +G+Q        GG             SSES+TN        +    +SSDTSL+LGLP
Sbjct  180  RLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGLP  237

Query  820  F  822
            +
Sbjct  238  Y  238



>gb|AGW23370.1| MADS box protein MADS68 [Gossypium hirsutum]
Length=220

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 147/223 (66%), Gaps = 15/223 (7%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTF+KRRRGLFKKA+EL+ LCD D+ LI+FS+TGKL  Y++S
Sbjct  1    MAREKIQIKKIDNSTARQVTFAKRRRGLFKKAEELAILCDADVALIIFSSTGKLFDYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQ-RESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+E++ RH +  + +E +E QP   LQ  E    + L  E  EKS +LRQ+ GE+L  L
Sbjct  61   SMKEILERHHLRSKNLEKLE-QPCLGLQLLEHSNQSMLTMEIAEKSHQLRQMRGEELHGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + EL +LEK +E GLSR+M KKG  ++ EI  L++K  +LMEEN +LKQ+         
Sbjct  120  NIEELQQLEKSLEIGLSRVMEKKGQRIMREIKDLQRKGMQLMEENERLKQQIINGPRQVT  179

Query  691  --SEIGVQGGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
              S+  + G    SSESVTN C    +     Y+SS TSLKLG
Sbjct  180  GDSDNIIFGEEGQSSESVTNVCT--SNGNPHDYESSVTSLKLG  220



>ref|XP_004152597.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
 ref|XP_004163451.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
Length=230

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 148/234 (63%), Gaps = 22/234 (9%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDNLTARQVTFSKRRRGL KKA+ELS LCD ++ L+VFSATGK   YSNS
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLIKKAEELSVLCDAEVALLVFSATGKFFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++++VI R+++H   +  +E+ PS  LQ E   +  L KE  + +++LRQ+ GEDLQ L 
Sbjct  61   SIKDVIARYNLHSSNLGKLEY-PSIGLQVEDSNHVQLNKEVEDMNQQLRQMRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR----------  690
            + +L +LE+ +E GL+R++  K   ++ EI+ L+ K A+LMEEN  LKQ+          
Sbjct  120  LEDLKQLERKLEVGLTRVLHTKEKKIMREIDELELKGARLMEENKMLKQQMLRLSNERLM  179

Query  691  ------SEIGVQGGPPYSSESVTN--GCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                  S++ V      SSES  N   C   P    D   SSDTSLKLG P P+
Sbjct  180  AVLVDSSDVRVAAEEGLSSESAANVYSCNSGPPADDD---SSDTSLKLGPPCPN  230



>gb|AIY25021.1| short vegetative phase 2 [Dimocarpus longan]
Length=205

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KIEIKKIDN TARQVTFSKRRRGLFKKAQELSTLCD +I L+VFSATGKL  YS+S
Sbjct  1    MTRQKIEIKKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALMVFSATGKLFEYSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M++VI ++  +++ +   + QPS  LQ E  TYA L+ E  EK+RELRQ+ GE+LQ L 
Sbjct  61   SMKQVIEKYKTNMQNLHKFD-QPSLELQLECNTYAMLSGEIAEKTRELRQMRGEELQGLS  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEI  630
            + EL +LEK +EGGL  +   K + ++ EI
Sbjct  120  LEELKQLEKSLEGGLRCVAETKVERIMKEI  149



>ref|XP_006294892.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
 gb|EOA27790.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
Length=240

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 154/241 (64%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+L  L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELHGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K D +++EI+ L++K  +LM+EN +L+Q+         
Sbjct  120  NIEELQQLEKALEAGLTRVIETKSDKIMNEISELQRKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  -----------EIGVQGGPP-------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
                       E GV            +SSES+TN      +      +SSDTSL+LGLP
Sbjct  180  RLGMQIYNNVHESGVDESENVAVYEEGHSSESITNAGN--SNGAPVDSESSDTSLRLGLP  237

Query  820  F  822
            +
Sbjct  238  Y  238



>ref|XP_010417013.1| PREDICTED: MADS-box protein SVP isoform X1 [Camelina sativa]
Length=242

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 156/243 (64%), Gaps = 32/243 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR---------  690
             + +L +LEK +E GL+R++  K D +++EI+ L++K  +LM+EN +L+Q+         
Sbjct  120  NIEDLQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQVNGTQLTEE  179

Query  691  ------------SEIGV---QGGPPY----SSESVTNGCCLFPDKLQDHYKSSDTSLKLG  813
                         E GV   +    Y    SSES+TN      +      +SSDTSL+LG
Sbjct  180  NERLGMQMYNNVHESGVDEMENAAVYEEGHSSESITNAGN--SNGAPVDSESSDTSLRLG  237

Query  814  LPF  822
            LP+
Sbjct  238  LPY  240



>gb|AFM77908.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 155/242 (64%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LIVFS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+   + L+KE  +KS +LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENSDNSRLSKEIADKSHQLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K + ++SEI+ L++K  KLM+EN +L+Q          
Sbjct  120  NIEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENE  179

Query  694  EIGVQ---------GG----------PPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
             +G Q         GG            +SSES+TN        +    +SSDTSL+LGL
Sbjct  180  RLGKQIYNNMHERYGGVESEKTAVYEEGHSSESITNAGNSTGAPVDS--ESSDTSLRLGL  237

Query  817  PF  822
            P+
Sbjct  238  PY  239



>gb|AFM77910.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 155/242 (64%), Gaps = 31/242 (13%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M EV+ RH++  + +E ++ QPS  LQ  E+  +A L+KE  EKS  LRQ+ GE+LQ L
Sbjct  61   SMREVLERHNLQSKNLEKLD-QPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K + ++SEI+ L++K  +LM+EN +L+Q+         
Sbjct  120  NIEELQQLEKALESGLTRVIETKSEKIMSEISYLQRKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  EIGVQ----------GGPP---------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGL  816
             +G Q          GG           +SSES+TN        +    +SSD SL+LGL
Sbjct  180  RLGQQIYNNVHERYGGGESENIAVYEEGHSSESITNAGNSTGAPVDS--ESSDISLRLGL  237

Query  817  PF  822
            P+
Sbjct  238  PY  239



>gb|KDP41475.1| hypothetical protein JCGZ_15882 [Jatropha curcas]
Length=227

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 156/232 (67%), Gaps = 23/232 (10%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN+TARQVTFSKRRRGLFKKA+ELS LCD ++ LI FSATGKL  Y+++
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVALISFSATGKLFEYAST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSREL----RQLNGEDL  528
            +M+++I R+  +   ++  + QPS  LQ E+  +  L+KE  EK+ +L    RQ++GEDL
Sbjct  61   SMKDIIARYDRYSNNIKKGD-QPSLELQLENNNHIRLSKELAEKTHQLSLHNRQMSGEDL  119

Query  529  QELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR------  690
            Q L + EL +LEKM+E GLSR++  KG+ +++EI+A +KK  +L+EEN QLKQ+      
Sbjct  120  QGLNIEELQQLEKMLESGLSRVLETKGERIMNEISAFEKKREQLLEENKQLKQKMMSLCK  179

Query  691  ------SEIGVQGGPPYSSESVTN--GCCLFPDKLQDHYKSSDTSLKLGLPF  822
                  S I  Q     SSESVTN   C   P    D   SSDTSLKLGLPF
Sbjct  180  GKRLVESNIHPQ-EEGLSSESVTNICSCSSGPPPEDD---SSDTSLKLGLPF  227



>dbj|BAE98676.1| short vegegative phase protein [Arabidopsis thaliana]
Length=240

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 156/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD D+ LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K D ++SEI+ L+KK  +LM+EN +L+Q+         
Sbjct  120  DIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  EIGVQ--------GGPP----------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
             +G+Q        GG             SSES+TN        +    +SSDTSL+LGL 
Sbjct  180  RLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGLT  237

Query  820  F  822
            +
Sbjct  238  Y  238



>ref|XP_004299728.1| PREDICTED: MADS-box protein SVP-like [Fragaria vesca subsp. vesca]
Length=235

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 128/173 (74%), Gaps = 4/173 (2%)
 Frame = +1

Query  172  VVKMVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHY  351
            + K  R KI+I+KIDNL ARQVTFSKRRRGL KKA ELS LCD +  +I+FSATGKL   
Sbjct  1    MTKPARNKIKIRKIDNLPARQVTFSKRRRGLLKKAGELSVLCDCEYAVIIFSATGKLFES  60

Query  352  SNSNMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQ  531
            S+S+ ++VI R+  HIE VE +E QPS  LQ + I    L+K+  EKSR LRQ+NGEDL+
Sbjct  61   SSSSTKDVIARYKAHIENVEKLE-QPSIELQPDRIK---LSKDLAEKSRVLRQMNGEDLE  116

Query  532  ELGMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQR  690
             L + EL KLEK +EGGLSR+++ K + ++SEI AL+ K A+L++ N QL+QR
Sbjct  117  GLNIDELQKLEKQIEGGLSRVLQTKEEKIMSEILALEAKGAQLLQANNQLRQR  169



>ref|XP_011023057.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Populus 
euphratica]
Length=221

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 147/222 (66%), Gaps = 11/222 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KIEIKKID+  ARQVTFSKRRRGLFKKA ELSTLCD +I L+VFSA+GKL  YSNS
Sbjct  1    MTRRKIEIKKIDDAIARQVTFSKRRRGLFKKAYELSTLCDAEIALMVFSASGKLFEYSNS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            ++ +V+ R ++H++ ++    QPS  LQ +   YA L KE  EK+RELR + GEDLQ L 
Sbjct  61   SVGQVLERRNLHLKNIDMF-GQPSLELQPDGAVYATLNKEIAEKTRELRHVRGEDLQGLN  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGG--  714
            + EL KLEK+++  L R++ +K   +++EIN LK +  +L+EEN +LKQ+  + +  G  
Sbjct  120  LEELHKLEKLIKTSLCRVVEEKEGKIMNEINTLKNEGEQLVEENRRLKQQV-MNLSAGQR  178

Query  715  ----PPYSSES-VTNGCCL-FPDKLQDHYKSSDTSLKLGLPF  822
                P  SS+S VTN   +   D  QD   S    L LGLPF
Sbjct  179  HLLEPDKSSDSLVTNTRSMSSADPCQD-CDSPCAFLTLGLPF  219



>gb|KDP29972.1| hypothetical protein JCGZ_18739 [Jatropha curcas]
Length=219

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 146/222 (66%), Gaps = 9/222 (4%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+IKKIDN TARQVTFSKRRRGLFKKA ELSTLCD +I LIVFS TGKL  Y++S
Sbjct  1    MTRQKIQIKKIDNNTARQVTFSKRRRGLFKKAYELSTLCDAEIALIVFSGTGKLSEYASS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +M +VI R ++  +K      Q S   Q E  T+  L+KE  E++ ELR + GE+LQ L 
Sbjct  61   SMNQVIGRRNLQ-QKNSGKLDQSSLEQQLEDGTFTALSKEVAERTLELRHMRGEELQRLS  119

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQ----  708
            + +L +LEK +E GL R++  K  ++ +EINALK KEA+L+EEN +LKQ+  + V     
Sbjct  120  IEQLQELEKSLERGLKRVLETKSHVITNEINALKSKEAQLIEENERLKQQI-MNVPMVRL  178

Query  709  --GGPPYSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLPFPD  828
                P +SS+S+        D L   Y+ + T L+LGLPFPD
Sbjct  179  HLSEPGHSSDSMITNTSSSAD-LSLDYEGNYTFLRLGLPFPD  219



>ref|XP_009138166.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
 ref|XP_009138171.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
 ref|XP_009138179.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
Length=224

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 151/223 (68%), Gaps = 12/223 (5%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI IKKIDNLTARQVTFSKRRRG+ KKA ELS LCD D+ LI+FSATGKL  +S+S
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M +++ R+++H   +  +   PSP  Q+ ++   + L+KE  +K+++LRQ+ G DL+ L
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGL  120

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEI------  699
             + EL +LEK +E GLSR+  KKG+ ++S+I++L+K+ ++L++EN +L+++ ++      
Sbjct  121  NLEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQYQLVTLEMA  180

Query  700  -GVQGGPPYSSESVTNGCCLFPDK--LQDHYKSSDTSLKLGLP  819
              +       +ES T     +     ++D +  SDTSLKLGLP
Sbjct  181  KTMALKEAVETESATTNVSSYDSAAPIEDDF--SDTSLKLGLP  221



>dbj|BAD43004.1| short vegegative phase protein (SVP) [Arabidopsis thaliana]
Length=240

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 156/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R KI+I+KIDN TARQVTFSKRRRGLFKKA+ELS LCD  + LI+FS+TGKL  + +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDAGVALIIFSSTGKLFEFCSS  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQR-ESITYAGLAKEFTEKSRELRQLNGEDLQEL  537
            +M+EV+ RH++  + +E ++ QPS  LQ  E+  +A ++KE  +KS  LRQ+ GE+LQ L
Sbjct  61   SMKEVLERHNLQSKNLEKLD-QPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGL  119

Query  538  GMAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRS--------  693
             + EL +LEK +E GL+R++  K D ++SEI+ L+KK  +LM+EN +L+Q+         
Sbjct  120  DIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENE  179

Query  694  EIGVQ--------GGPP----------YSSESVTNGCCLFPDKLQDHYKSSDTSLKLGLP  819
             +G+Q        GG             SSES+TN        +    +SSDTSL+LGLP
Sbjct  180  RLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDS--ESSDTSLRLGLP  237

Query  820  F  822
            +
Sbjct  238  Y  238



>gb|AGA01527.1| SVP-like protein [Gossypium hirsutum]
Length=220

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 140/221 (63%), Gaps = 3/221 (1%)
 Frame = +1

Query  181  MVRTKIEIKKIDNLTARQVTFSKRRRGLFKKAQELSTLCDVDIGLIVFSATGKLCHYSNS  360
            M R +I+IKKIDN+ ARQVTFSKRRRGLFKKA ELS LCD +I LIVFSATGKL  Y ++
Sbjct  1    MTRKRIQIKKIDNVAARQVTFSKRRRGLFKKAHELSVLCDAEIALIVFSATGKLFDYFST  60

Query  361  NMEEVITRHSMHIEKVECVEHQPSPSLQRESITYAGLAKEFTEKSRELRQLNGEDLQELG  540
            +ME +  R+    + ++     P   LQ ES T A L+KE  EK+ +LRQL GE+LQ LG
Sbjct  61   SMEVIERRNQQSGKGIDRSVTSPCHGLQVESRTCAMLSKEMAEKTHQLRQLKGEELQGLG  120

Query  541  MAELIKLEKMVEGGLSRIMRKKGDILLSEInalkkkeaklmeenaQLKQRSEIGVQGGPP  720
               L  LEK+VEGGL R+   K +    EI+ LK KEA+L+EEN QLKQ+ E        
Sbjct  121  YEGLKHLEKLVEGGLRRVTETKDERFFKEISTLKMKEAELVEENQQLKQQMENLPHMVHV  180

Query  721  YSSESVTN-GCCLFPDKLQDHYKSSDTSLKLGLPFPD*GLK  840
              SES+ + G    P   Q +  S D SL LGL FP+  LK
Sbjct  181  QPSESIAHVGSSENPT--QPYNNSHDISLTLGLAFPNSPLK  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1957071984678