BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14812_g1_i1 len=1664 path=[3905:0-251 2516:252-1663]

Length=1664
                                                                      Score     E

ref|XP_011098929.1|  PREDICTED: probable protein S-acyltransferase 7    588   0.0      
ref|XP_004231755.1|  PREDICTED: probable protein S-acyltransferase 7    585   0.0      
ref|XP_006338722.1|  PREDICTED: probable protein S-acyltransferas...    585   0.0      
ref|XP_007215386.1|  hypothetical protein PRUPE_ppa005757mg             573   0.0      
ref|XP_008231065.1|  PREDICTED: probable protein S-acyltransferase 7    573   0.0      
ref|XP_009628445.1|  PREDICTED: probable protein S-acyltransferase 7    571   0.0      
ref|XP_009346802.1|  PREDICTED: probable protein S-acyltransferase 7    568   0.0      
ref|XP_002273157.1|  PREDICTED: probable protein S-acyltransferas...    566   0.0      Vitis vinifera
ref|XP_009344211.1|  PREDICTED: probable protein S-acyltransferase 7    566   0.0      
gb|KDP41813.1|  hypothetical protein JCGZ_26831                         563   0.0      
ref|XP_004304544.1|  PREDICTED: probable S-acyltransferase At3g26...    562   0.0      
ref|XP_008341259.1|  PREDICTED: probable protein S-acyltransferase 7    562   0.0      
ref|XP_002512891.1|  zinc finger protein, putative                      561   0.0      Ricinus communis
ref|XP_009378011.1|  PREDICTED: probable protein S-acyltransferase 7    561   0.0      
ref|XP_009761768.1|  PREDICTED: probable protein S-acyltransferase 7    560   0.0      
ref|XP_003548022.1|  PREDICTED: probable protein S-acyltransferas...    557   0.0      
ref|XP_010660719.1|  PREDICTED: probable protein S-acyltransferas...    553   0.0      
gb|KHN13374.1|  Putative S-acyltransferase                              555   0.0      
emb|CDP16720.1|  unnamed protein product                                555   0.0      
ref|XP_008357698.1|  PREDICTED: probable protein S-acyltransferase 7    554   0.0      
ref|XP_007151749.1|  hypothetical protein PHAVU_004G071400g             552   0.0      
ref|XP_003518123.1|  PREDICTED: probable protein S-acyltransferas...    545   0.0      
ref|XP_006447007.1|  hypothetical protein CICLE_v10015257mg             545   0.0      
gb|KDO63858.1|  hypothetical protein CISIN_1g013443mg                   545   0.0      
ref|XP_007031947.1|  DHHC-type zinc finger family protein               542   0.0      
ref|XP_011045758.1|  PREDICTED: probable protein S-acyltransferas...    542   0.0      
gb|KHG22830.1|  hypothetical protein F383_02837                         538   0.0      
ref|XP_004492998.1|  PREDICTED: probable S-acyltransferase At3g26...    536   0.0      
emb|CBI21313.3|  unnamed protein product                                537   0.0      
ref|XP_002298649.1|  zinc finger family protein                         533   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010028971.1|  PREDICTED: probable protein S-acyltransferase 7    533   0.0      
ref|XP_006599011.1|  PREDICTED: probable protein S-acyltransferas...    530   0.0      
ref|XP_004148004.1|  PREDICTED: probable S-acyltransferase At3g26...    532   0.0      
ref|XP_006395501.1|  hypothetical protein EUTSA_v10004226mg             531   0.0      
ref|XP_008347994.1|  PREDICTED: probable protein S-acyltransferase 7    531   0.0      
ref|XP_008450142.1|  PREDICTED: probable protein S-acyltransferase 7    530   0.0      
gb|EYU31851.1|  hypothetical protein MIMGU_mgv1a006331mg                530   0.0      
gb|KEH25651.1|  DHHC type zinc finger protein                           528   1e-180   
emb|CAN71475.1|  hypothetical protein VITISV_038617                     533   1e-180   Vitis vinifera
ref|XP_010514369.1|  PREDICTED: probable protein S-acyltransferase 7    528   3e-180   
ref|XP_004168841.1|  PREDICTED: LOW QUALITY PROTEIN: probable S-a...    528   4e-180   
ref|XP_010679975.1|  PREDICTED: probable protein S-acyltransferase 7    526   1e-179   
ref|XP_010502648.1|  PREDICTED: probable protein S-acyltransferase 7    525   2e-179   
ref|XP_010425430.1|  PREDICTED: probable protein S-acyltransferase 7    525   2e-179   
ref|XP_004515995.1|  PREDICTED: probable S-acyltransferase At3g26...    524   6e-179   
gb|KHG28749.1|  hypothetical protein F383_11399                         524   1e-178   
ref|XP_010528151.1|  PREDICTED: probable protein S-acyltransferase 7    523   1e-178   
ref|XP_006291141.1|  hypothetical protein CARUB_v10017257mg             522   3e-178   
gb|KFK33610.1|  hypothetical protein AALP_AA5G036400                    520   5e-177   
ref|XP_003549008.1|  PREDICTED: probable protein S-acyltransferas...    519   6e-177   
ref|NP_850638.1|  putative S-acyltransferase                            519   9e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161696.1|  hypothetical protein PHAVU_001G090700g             517   3e-176   
ref|XP_010556303.1|  PREDICTED: probable protein S-acyltransferase 7    516   7e-176   
ref|XP_004492999.1|  PREDICTED: probable S-acyltransferase At3g26...    514   2e-175   
ref|XP_006604174.1|  PREDICTED: probable protein S-acyltransferas...    509   3e-174   
emb|CDY34198.1|  BnaA02g28420D                                          512   3e-174   
ref|XP_002877006.1|  zinc finger family protein                         512   4e-174   
emb|CDY52410.1|  BnaC07g49090D                                          510   1e-173   
ref|XP_003553969.1|  PREDICTED: probable protein S-acyltransferas...    510   2e-173   
emb|CDY13668.1|  BnaA06g32550D                                          509   4e-173   
ref|XP_009152005.1|  PREDICTED: probable protein S-acyltransferase 7    509   5e-173   
ref|XP_010250598.1|  PREDICTED: probable protein S-acyltransferas...    508   8e-173   
ref|XP_009129462.1|  PREDICTED: probable protein S-acyltransferase 7    508   2e-172   
ref|XP_010250597.1|  PREDICTED: probable protein S-acyltransferas...    507   4e-172   
ref|XP_004515996.1|  PREDICTED: probable S-acyltransferase At3g26...    503   1e-170   
ref|XP_009111543.1|  PREDICTED: probable protein S-acyltransferas...    502   2e-170   
ref|XP_009111542.1|  PREDICTED: probable protein S-acyltransferas...    503   2e-170   
emb|CDY28510.1|  BnaC02g36500D                                          499   3e-169   
emb|CDY12251.1|  BnaA09g24510D                                          499   4e-169   
gb|KHN28546.1|  Putative S-acyltransferase                              498   5e-169   
emb|CDY00176.1|  BnaC09g01250D                                          498   7e-169   
ref|XP_010249127.1|  PREDICTED: probable protein S-acyltransferas...    493   4e-167   
ref|XP_010249126.1|  PREDICTED: probable protein S-acyltransferas...    493   1e-166   
emb|CAN81512.1|  hypothetical protein VITISV_001671                     493   7e-166   Vitis vinifera
ref|XP_007038080.1|  DHHC-type zinc finger family protein isoform 2     488   9e-166   
gb|EPS65996.1|  hypothetical protein M569_08778                         484   2e-163   
ref|XP_002284252.1|  PREDICTED: probable protein S-acyltransferase 7    481   4e-162   Vitis vinifera
ref|XP_010926776.1|  PREDICTED: probable protein S-acyltransferas...    479   8e-162   
ref|XP_007038079.1|  DHHC-type zinc finger family protein isoform 1     480   2e-161   
ref|XP_010926775.1|  PREDICTED: probable protein S-acyltransferas...    480   3e-161   
ref|XP_009597116.1|  PREDICTED: probable protein S-acyltransferase 7    476   3e-160   
ref|XP_006366904.1|  PREDICTED: probable protein S-acyltransferas...    476   6e-160   
ref|XP_009773376.1|  PREDICTED: probable protein S-acyltransferase 7    474   2e-159   
ref|XP_010929605.1|  PREDICTED: probable protein S-acyltransferase 7    474   3e-159   
ref|XP_009614913.1|  PREDICTED: probable protein S-acyltransferase 7    472   1e-158   
gb|KHG10229.1|  hypothetical protein F383_12963                         472   2e-158   
ref|XP_009768845.1|  PREDICTED: probable protein S-acyltransferase 7    471   4e-158   
ref|XP_010318318.1|  PREDICTED: probable protein S-acyltransferas...    468   7e-158   
ref|XP_003624454.1|  Palmitoyltransferase ZDHHC9                        470   8e-158   
ref|XP_004235323.1|  PREDICTED: probable protein S-acyltransferas...    469   2e-157   
emb|CBI15716.3|  unnamed protein product                                468   4e-157   
ref|XP_011045759.1|  PREDICTED: probable protein S-acyltransferas...    466   9e-157   
ref|XP_010093936.1|  putative S-acyltransferase                         467   4e-156   
ref|XP_008790730.1|  PREDICTED: probable protein S-acyltransferas...    464   2e-155   
ref|XP_010943750.1|  PREDICTED: probable protein S-acyltransferas...    462   3e-155   
ref|XP_008790729.1|  PREDICTED: probable protein S-acyltransferas...    464   3e-155   
ref|XP_006347348.1|  PREDICTED: probable protein S-acyltransferas...    463   3e-155   
ref|XP_010943753.1|  PREDICTED: probable protein S-acyltransferas...    461   5e-155   
ref|XP_010943749.1|  PREDICTED: probable protein S-acyltransferas...    460   9e-155   
ref|XP_010943748.1|  PREDICTED: probable protein S-acyltransferas...    462   2e-154   
ref|XP_009385498.1|  PREDICTED: probable protein S-acyltransferase 7    461   4e-154   
ref|XP_008791097.1|  PREDICTED: probable protein S-acyltransferase 7    459   2e-153   
ref|XP_004241453.1|  PREDICTED: probable protein S-acyltransferase 7    458   5e-153   
ref|XP_004297510.1|  PREDICTED: probable S-acyltransferase At3g26...    457   7e-153   
ref|XP_006373200.1|  hypothetical protein POPTR_0017s09590g             443   2e-149   
ref|XP_009396773.1|  PREDICTED: probable protein S-acyltransferase 7    451   2e-148   
ref|XP_009383864.1|  PREDICTED: probable protein S-acyltransferas...    442   1e-147   
ref|XP_006844579.1|  hypothetical protein AMTR_s00016p00200180          443   2e-147   
gb|ABK25142.1|  unknown                                                 444   2e-147   Picea sitchensis
ref|XP_008239524.1|  PREDICTED: probable protein S-acyltransferase 7    443   4e-147   
ref|XP_007209138.1|  hypothetical protein PRUPE_ppa005782mg             442   6e-147   
ref|XP_009411802.1|  PREDICTED: probable protein S-acyltransferase 7    442   1e-146   
gb|ACJ85439.1|  unknown                                                 434   2e-146   Medicago truncatula
ref|XP_009347836.1|  PREDICTED: probable protein S-acyltransferase 7    441   2e-146   
ref|XP_009383862.1|  PREDICTED: probable protein S-acyltransferas...    441   2e-146   
ref|XP_010450570.1|  PREDICTED: probable protein S-acyltransferase 6    439   3e-146   
ref|XP_010436045.1|  PREDICTED: probable protein S-acyltransferase 6    439   5e-146   
ref|XP_010441268.1|  PREDICTED: probable protein S-acyltransferase 6    439   5e-146   
ref|XP_006405397.1|  hypothetical protein EUTSA_v10027785mg             439   5e-146   
emb|CDY46404.1|  BnaC04g33230D                                          439   6e-146   
ref|XP_006283837.1|  hypothetical protein CARUB_v10004938mg             438   8e-146   
ref|XP_009342210.1|  PREDICTED: probable protein S-acyltransferase 7    439   1e-145   
ref|XP_002870656.1|  zinc finger family protein                         437   3e-145   
ref|NP_001078687.1|  DHHC-type zinc finger family protein               436   4e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125172.1|  PREDICTED: probable protein S-acyltransferase 6    432   7e-145   
ref|NP_198922.1|  DHHC-type zinc finger family protein                  435   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140064.1|  PREDICTED: probable protein S-acyltransferase 6    434   2e-144   
emb|CDX67485.1|  BnaA07g15250D                                          432   2e-144   
gb|KDP22570.1|  hypothetical protein JCGZ_26401                         435   8e-144   
ref|XP_011023929.1|  PREDICTED: probable protein S-acyltransferas...    435   1e-143   
ref|XP_002321733.1|  hypothetical protein POPTR_0015s11400g             434   2e-143   Populus trichocarpa [western balsam poplar]
ref|XP_008392726.1|  PREDICTED: probable protein S-acyltransferase 7    431   2e-142   
emb|CDY11734.1|  BnaC06g13420D                                          431   2e-142   
ref|XP_004957301.1|  PREDICTED: probable S-acyltransferase At3g26...    429   1e-141   
gb|KFK33034.1|  hypothetical protein AALP_AA6G322100                    427   1e-141   
ref|XP_006645261.1|  PREDICTED: probable protein S-acyltransferas...    427   1e-141   
gb|EEC84857.1|  hypothetical protein OsI_31977                          428   2e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_009337538.1|  PREDICTED: probable protein S-acyltransferase 7    429   2e-141   
ref|XP_003564978.1|  PREDICTED: probable protein S-acyltransferase 7    427   2e-141   
ref|NP_001063622.1|  Os09g0508300                                       428   2e-141   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03564.1|  predicted protein                                      426   5e-141   
ref|XP_002462643.1|  hypothetical protein SORBIDRAFT_02g029440          427   6e-141   Sorghum bicolor [broomcorn]
emb|CDM85836.1|  unnamed protein product                                424   2e-140   
ref|NP_001130802.1|  palmitoyltransferase ZDHHC9                        424   2e-140   Zea mays [maize]
gb|EEC72069.1|  hypothetical protein OsI_05001                          424   2e-140   Oryza sativa Indica Group [Indian rice]
gb|EMT02705.1|  Putative S-acyltransferase                              424   4e-140   
ref|XP_004971123.1|  PREDICTED: probable S-acyltransferase At3g26...    424   4e-140   
ref|XP_006660819.1|  PREDICTED: probable protein S-acyltransferas...    424   6e-140   
gb|ACU18488.1|  unknown                                                 418   7e-140   Glycine max [soybeans]
ref|XP_011023928.1|  PREDICTED: probable protein S-acyltransferas...    425   1e-139   
tpg|DAA40497.1|  TPA: hypothetical protein ZEAMMB73_230015              420   1e-139   
ref|NP_001045255.1|  Os01g0925300                                       422   2e-139   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ14683.1|  hypothetical protein OsJ_04607                          422   3e-139   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB89658.1|  P0482D04.5                                             422   3e-139   Oryza sativa Japonica Group [Japonica rice]
emb|CDP14989.1|  unnamed protein product                                422   5e-139   
ref|XP_008674635.1|  PREDICTED: probable protein S-acyltransferas...    419   1e-138   
ref|XP_008674634.1|  PREDICTED: probable protein S-acyltransferas...    419   3e-138   
tpg|DAA40499.1|  TPA: hypothetical protein ZEAMMB73_230015              419   6e-138   
ref|XP_008668041.1|  PREDICTED: palmitoyltransferase ZDHHC9 isofo...    419   6e-138   
ref|XP_002511124.1|  Palmitoyltransferase ZDHHC9, putative              420   7e-138   Ricinus communis
ref|NP_001062355.1|  Os08g0535400                                       417   2e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674633.1|  PREDICTED: probable protein S-acyltransferas...    417   2e-137   
ref|NP_001149898.1|  palmitoyltransferase ZDHHC9                        418   2e-137   Zea mays [maize]
gb|EEE69067.1|  hypothetical protein OsJ_28081                          417   4e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659633.1|  PREDICTED: probable protein S-acyltransferas...    416   4e-137   
gb|EEC83946.1|  hypothetical protein OsI_30037                          417   1e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001151207.1|  palmitoyltransferase ZDHHC9                        415   3e-136   Zea mays [maize]
ref|XP_004974018.1|  PREDICTED: probable S-acyltransferase At3g26...    414   8e-136   
ref|XP_002444687.1|  hypothetical protein SORBIDRAFT_07g026030          413   1e-135   Sorghum bicolor [broomcorn]
dbj|BAJ85153.1|  predicted protein                                      413   2e-135   
ref|XP_002318154.2|  hypothetical protein POPTR_0012s10510g             413   3e-135   Populus trichocarpa [western balsam poplar]
gb|KDO64487.1|  hypothetical protein CISIN_1g013191mg                   410   3e-135   
ref|XP_006436902.1|  hypothetical protein CICLE_v10031377mg             413   6e-135   
ref|XP_003578399.1|  PREDICTED: probable protein S-acyltransferase 7    412   7e-135   
ref|NP_001149872.1|  LOC100283500                                       410   1e-134   Zea mays [maize]
gb|ACL53585.1|  unknown                                                 410   2e-134   Zea mays [maize]
ref|XP_003574837.1|  PREDICTED: probable protein S-acyltransferase 6    410   3e-134   
ref|XP_006493254.1|  PREDICTED: probable protein S-acyltransferas...    410   3e-134   
gb|EMT31641.1|  Putative S-acyltransferase                              404   9e-132   
dbj|BAK07653.1|  predicted protein                                      402   2e-131   
ref|XP_004501727.1|  PREDICTED: probable S-acyltransferase At3g26...    399   1e-129   
ref|XP_010519475.1|  PREDICTED: probable protein S-acyltransferase 5    399   2e-129   
ref|NP_001141947.1|  uncharacterized protein LOC100274096               397   4e-129   Zea mays [maize]
gb|AFK39395.1|  unknown                                                 395   1e-128   
ref|XP_009150177.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    396   1e-128   
ref|NP_001288988.1|  probable protein S-acyltransferase 5               395   1e-128   
emb|CDY37914.1|  BnaA06g19030D                                          395   2e-128   
emb|CAB87904.1|  putative protein                                       396   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503518.1|  PREDICTED: probable protein S-acyltransferase 5    396   2e-128   
gb|ABK25091.1|  unknown                                                 392   1e-127   Picea sitchensis
ref|XP_003528095.1|  PREDICTED: probable protein S-acyltransferas...    392   2e-127   
gb|KHN23960.1|  Putative S-acyltransferase                              392   2e-127   
emb|CDX87017.1|  BnaC03g52870D                                          392   2e-127   
ref|XP_010515201.1|  PREDICTED: probable protein S-acyltransferase 5    393   4e-127   
emb|CDY05871.1|  BnaC08g20480D                                          391   9e-127   
ref|XP_011083425.1|  PREDICTED: probable protein S-acyltransferase 7    388   1e-126   
ref|XP_010426373.1|  PREDICTED: probable protein S-acyltransferase 5    391   2e-126   
ref|XP_002875924.1|  zinc finger family protein                         391   2e-126   
ref|XP_006291034.1|  hypothetical protein CARUB_v10017146mg             390   4e-126   
ref|XP_006404219.1|  hypothetical protein EUTSA_v10010352mg             388   2e-125   
ref|XP_010550747.1|  PREDICTED: probable protein S-acyltransferas...    386   4e-125   
ref|NP_190445.2|  putative S-acyltransferase                            387   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149794.1|  PREDICTED: probable protein S-acyltransferase 5    386   8e-125   
gb|KFK34176.1|  hypothetical protein AALP_AA5G110400                    385   3e-124   
gb|AES73022.2|  DHHC type zinc finger protein                           382   2e-123   
ref|XP_001759162.1|  predicted protein                                  373   6e-120   
dbj|BAB01189.1|  unnamed protein product                                369   8e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757201.1|  predicted protein                                  369   2e-118   
ref|XP_003574851.1|  PREDICTED: probable protein S-acyltransferase 7    366   2e-117   
ref|XP_010910250.1|  PREDICTED: probable protein S-acyltransferas...    365   3e-117   
ref|XP_003524474.1|  PREDICTED: probable protein S-acyltransferas...    366   3e-117   
ref|XP_008812135.1|  PREDICTED: probable protein S-acyltransferase 7    363   2e-116   
ref|XP_007159990.1|  hypothetical protein PHAVU_002G283700g             362   7e-116   
ref|NP_001142294.1|  uncharacterized protein LOC100274463               361   2e-115   Zea mays [maize]
gb|EMT31104.1|  Putative S-acyltransferase                              365   4e-115   
ref|XP_008778432.1|  PREDICTED: probable protein S-acyltransferase 7    359   7e-115   
ref|XP_006359052.1|  PREDICTED: protein S-acyltransferase 8-like        359   9e-115   
ref|XP_003532462.1|  PREDICTED: probable protein S-acyltransferas...    359   1e-114   
gb|EAZ07812.1|  hypothetical protein OsI_30070                          358   1e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_002987463.1|  hypothetical protein SELMODRAFT_235280             358   2e-114   
ref|NP_001062374.1|  Os08g0539100                                       358   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980068.1|  hypothetical protein SELMODRAFT_153626             357   5e-114   
ref|XP_010665161.1|  PREDICTED: protein S-acyltransferase 8-like        357   9e-114   
gb|EAZ43494.1|  hypothetical protein OsJ_28110                          358   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001776677.1|  predicted protein                                  357   1e-113   
ref|XP_010037361.1|  PREDICTED: probable protein S-acyltransferase 7    356   2e-113   
ref|XP_002444667.1|  hypothetical protein SORBIDRAFT_07g025730          355   3e-113   Sorghum bicolor [broomcorn]
ref|XP_010250452.1|  PREDICTED: probable protein S-acyltransferase 7    355   3e-113   
ref|XP_010320113.1|  PREDICTED: protein S-acyltransferase 8             354   7e-113   
ref|XP_004974049.1|  PREDICTED: probable S-acyltransferase At3g26...    354   8e-113   
ref|XP_010912021.1|  PREDICTED: protein S-acyltransferase 8-like        350   2e-111   
gb|KDO64488.1|  hypothetical protein CISIN_1g013191mg                   345   2e-111   
ref|XP_002524314.1|  zinc finger protein, putative                      350   2e-111   Ricinus communis
ref|XP_009803969.1|  PREDICTED: protein S-acyltransferase 8             350   4e-111   
ref|XP_008463061.1|  PREDICTED: protein S-acyltransferase 8-like        349   8e-111   
ref|XP_004162173.1|  PREDICTED: probable S-acyltransferase At4g24...    348   9e-111   
ref|XP_009404189.1|  PREDICTED: probable protein S-acyltransferase 7    348   1e-110   
ref|XP_004138367.1|  PREDICTED: probable S-acyltransferase At4g24...    348   2e-110   
ref|XP_002459011.1|  hypothetical protein SORBIDRAFT_03g044420          347   2e-110   Sorghum bicolor [broomcorn]
ref|XP_006659644.1|  PREDICTED: probable protein S-acyltransferas...    348   2e-110   
gb|ABK24698.1|  unknown                                                 348   2e-110   Picea sitchensis
ref|XP_011073108.1|  PREDICTED: probable protein S-acyltransferas...    343   3e-110   
gb|KDP36577.1|  hypothetical protein JCGZ_08344                         347   3e-110   
ref|XP_011044264.1|  PREDICTED: protein S-acyltransferase 8-like        347   4e-110   
ref|XP_002307509.1|  zinc finger family protein                         346   9e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010063838.1|  PREDICTED: protein S-acyltransferase 8             345   2e-109   
ref|XP_011004340.1|  PREDICTED: probable protein S-acyltransferas...    344   2e-109   
gb|EYU17491.1|  hypothetical protein MIMGU_mgv1a007166mg                345   2e-109   
ref|XP_008785854.1|  PREDICTED: protein S-acyltransferase 8-like ...    343   2e-109   
ref|XP_010277271.1|  PREDICTED: protein S-acyltransferase 8-like        345   2e-109   
ref|XP_009628288.1|  PREDICTED: protein S-acyltransferase 8-like        345   4e-109   
ref|XP_002299362.2|  hypothetical protein POPTR_0001s12750g             344   6e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011101211.1|  PREDICTED: protein S-acyltransferase 8             343   7e-109   
ref|XP_011004339.1|  PREDICTED: probable protein S-acyltransferas...    344   8e-109   
ref|XP_011042885.1|  PREDICTED: protein S-acyltransferase 8-like        343   9e-109   
ref|XP_009612423.1|  PREDICTED: probable protein S-acyltransferase 7    342   1e-108   
ref|XP_002300909.1|  hypothetical protein POPTR_0002s06610g             343   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_009773560.1|  PREDICTED: probable protein S-acyltransferase 7    342   1e-108   
ref|XP_007043729.1|  DHHC-type zinc finger family protein               343   2e-108   
ref|XP_008785852.1|  PREDICTED: protein S-acyltransferase 8-like ...    342   2e-108   
gb|KHN00745.1|  Putative S-acyltransferase                              340   2e-108   
ref|XP_006599479.1|  PREDICTED: protein S-acyltransferase 8-like ...    340   2e-108   
gb|KEH25934.1|  DHHC type zinc finger protein                           342   2e-108   
ref|XP_010103348.1|  putative S-acyltransferase                         340   3e-108   
ref|XP_010044898.1|  PREDICTED: probable protein S-acyltransferase 6    342   3e-108   
gb|KEH25935.1|  DHHC type zinc finger protein                           342   3e-108   
ref|XP_006402194.1|  hypothetical protein EUTSA_v10013681mg             341   5e-108   
ref|XP_007019572.1|  DHHC-type zinc finger family protein               341   7e-108   
ref|XP_007151980.1|  hypothetical protein PHAVU_004G091700g             339   1e-107   
ref|XP_008441500.1|  PREDICTED: protein S-acyltransferase 8-like        341   1e-107   
ref|XP_009134039.1|  PREDICTED: probable protein S-acyltransferase 9    340   2e-107   
ref|XP_003518555.1|  PREDICTED: protein S-acyltransferase 8-like ...    340   3e-107   
gb|KHN41298.1|  Putative S-acyltransferase                              340   3e-107   
ref|XP_003548096.1|  PREDICTED: protein S-acyltransferase 8-like ...    340   3e-107   
emb|CDP11427.1|  unnamed protein product                                339   4e-107   
emb|CBI29283.3|  unnamed protein product                                340   4e-107   
ref|XP_002969767.1|  hypothetical protein SELMODRAFT_92351              338   4e-107   
ref|XP_006599478.1|  PREDICTED: protein S-acyltransferase 8-like ...    340   4e-107   
ref|XP_008793921.1|  PREDICTED: protein S-acyltransferase 8-like        339   4e-107   
ref|XP_010657521.1|  PREDICTED: probable protein S-acyltransferase 7    339   5e-107   
ref|XP_002985545.1|  hypothetical protein SELMODRAFT_13217              335   8e-107   
ref|XP_007151981.1|  hypothetical protein PHAVU_004G091700g             338   1e-106   
ref|XP_008348772.1|  PREDICTED: protein S-acyltransferase 8-like        332   2e-106   
gb|KFK26635.1|  hypothetical protein AALP_AA8G274100                    337   2e-106   
ref|XP_009411923.1|  PREDICTED: protein S-acyltransferase 8-like        337   2e-106   
ref|XP_010942391.1|  PREDICTED: probable protein S-acyltransferase 7    338   2e-106   
ref|XP_004140962.1|  PREDICTED: probable S-acyltransferase At4g24...    337   3e-106   
emb|CAN74600.1|  hypothetical protein VITISV_021495                     339   3e-106   
ref|XP_006281747.1|  hypothetical protein CARUB_v10027904mg             337   3e-106   
ref|XP_003592069.1|  Palmitoyltransferase SWF1                          336   6e-106   
ref|XP_006844684.1|  hypothetical protein AMTR_s00016p00244610          336   6e-106   
ref|XP_009393417.1|  PREDICTED: protein S-acyltransferase 8-like        336   7e-106   
ref|XP_006473090.1|  PREDICTED: protein S-acyltransferase 8-like        336   7e-106   
ref|XP_002993288.1|  hypothetical protein SELMODRAFT_136897             335   7e-106   
ref|XP_002303739.1|  hypothetical protein POPTR_0003s15900g             335   9e-106   
ref|XP_006434505.1|  hypothetical protein CICLE_v10001285mg             335   1e-105   
ref|XP_004489729.1|  PREDICTED: probable S-acyltransferase At5g50...    333   1e-105   
ref|XP_004301043.1|  PREDICTED: probable S-acyltransferase At3g26...    336   1e-105   
ref|XP_006847124.1|  hypothetical protein AMTR_s00017p00230690          335   2e-105   
gb|KDO83788.1|  hypothetical protein CISIN_1g014261mg                   335   2e-105   
emb|CDX83171.1|  BnaA03g23350D                                          335   3e-105   
ref|XP_009376562.1|  PREDICTED: protein S-acyltransferase 8-like        335   4e-105   
ref|XP_008369598.1|  PREDICTED: probable protein S-acyltransferase 7    335   5e-105   
ref|XP_009383391.1|  PREDICTED: probable protein S-acyltransferase 6    334   5e-105   
ref|XP_011020914.1|  PREDICTED: probable protein S-acyltransferase 7    334   8e-105   
ref|XP_010681146.1|  PREDICTED: protein S-acyltransferase 8-like ...    332   1e-104   
gb|AEF58502.1|  S-acyltransferase PAT9_3                                333   1e-104   
gb|KHN17027.1|  Putative S-acyltransferase                              331   2e-104   
ref|XP_002512693.1|  zinc finger protein, putative                      333   2e-104   
ref|XP_007143565.1|  hypothetical protein PHAVU_007G082300g             333   2e-104   
ref|XP_004290492.1|  PREDICTED: probable S-acyltransferase At4g24...    333   2e-104   
ref|XP_010681139.1|  PREDICTED: protein S-acyltransferase 8-like ...    332   2e-104   
ref|XP_004489727.1|  PREDICTED: probable S-acyltransferase At5g50...    332   3e-104   
ref|NP_001190503.1|  putative S-acyltransferase                         332   3e-104   
ref|XP_010680305.1|  PREDICTED: protein S-acyltransferase 8-like        331   5e-104   
ref|XP_007199850.1|  hypothetical protein PRUPE_ppa005660mg             332   7e-104   
ref|XP_010313124.1|  PREDICTED: probable protein S-acyltransferase 7    330   7e-104   
ref|XP_006588475.1|  PREDICTED: uncharacterized protein LOC100805...    331   1e-103   
ref|XP_009353491.1|  PREDICTED: probable protein S-acyltransferase 7    331   1e-103   
ref|XP_004961959.1|  PREDICTED: probable S-acyltransferase At4g24...    330   1e-103   
ref|XP_003556158.2|  PREDICTED: protein S-acyltransferase 8-like        330   1e-103   
ref|XP_006487582.1|  PREDICTED: probable protein S-acyltransferas...    328   1e-103   
ref|XP_002278286.1|  PREDICTED: protein S-acyltransferase 8 isofo...    330   2e-103   
ref|XP_010250344.1|  PREDICTED: protein S-acyltransferase 8-like ...    327   2e-103   
ref|XP_009413500.1|  PREDICTED: probable protein S-acyltransferase 6    330   2e-103   
ref|NP_001149971.1|  LOC100283598                                       330   2e-103   
ref|XP_010520765.1|  PREDICTED: protein S-acyltransferase 8-like ...    329   4e-103   
gb|KHN46400.1|  Putative S-acyltransferase                              328   4e-103   
gb|AFK45958.1|  unknown                                                 329   4e-103   
ref|XP_008390231.1|  PREDICTED: probable protein S-acyltransferase 6    330   4e-103   
emb|CDY21437.1|  BnaC03g27600D                                          330   4e-103   
ref|XP_004496446.1|  PREDICTED: probable S-acyltransferase At4g24...    328   5e-103   
gb|EPS73403.1|  hypothetical protein M569_01348                         328   6e-103   
ref|XP_006828800.1|  hypothetical protein AMTR_s00001p00123260          328   6e-103   
ref|NP_001242156.1|  uncharacterized protein LOC100805189               328   8e-103   
ref|XP_009109242.1|  PREDICTED: protein S-acyltransferase 8-like        327   9e-103   
gb|ACF79009.1|  unknown                                                 328   1e-102   
ref|XP_010250335.1|  PREDICTED: protein S-acyltransferase 8-like ...    327   2e-102   
gb|KDP23240.1|  hypothetical protein JCGZ_23073                         327   2e-102   
ref|XP_011075729.1|  PREDICTED: probable protein S-acyltransferase 7    327   3e-102   
ref|XP_010482306.1|  PREDICTED: probable protein S-acyltransferase 9    326   3e-102   
ref|XP_010441416.1|  PREDICTED: probable protein S-acyltransferase 9    326   3e-102   
ref|NP_194194.2|  DHHC-type zinc finger family protein                  326   4e-102   
ref|XP_010442482.1|  PREDICTED: probable protein S-acyltransferase 9    326   7e-102   
ref|XP_006487580.1|  PREDICTED: probable protein S-acyltransferas...    326   7e-102   
ref|XP_002439863.1|  hypothetical protein SORBIDRAFT_09g021530          326   8e-102   
ref|XP_006420833.1|  hypothetical protein CICLE_v10005034mg             325   8e-102   
ref|XP_008222281.1|  PREDICTED: probable protein S-acyltransferase 6    326   8e-102   
gb|KDO39204.1|  hypothetical protein CISIN_1g014495mg                   325   8e-102   
ref|XP_007227706.1|  hypothetical protein PRUPE_ppa006040mg             326   9e-102   
ref|XP_010433743.1|  PREDICTED: protein S-acyltransferase 8-like        325   1e-101   
emb|CDY08941.1|  BnaC08g11710D                                          324   1e-101   
emb|CDY34297.1|  BnaA01g14000D                                          324   1e-101   
ref|XP_010036411.1|  PREDICTED: probable protein S-acyltransferase 4    325   2e-101   
ref|XP_010448541.1|  PREDICTED: protein S-acyltransferase 8             324   2e-101   
ref|XP_010439003.1|  PREDICTED: protein S-acyltransferase 8-like        324   2e-101   
ref|XP_002869709.1|  zinc ion binding protein                           323   4e-101   
gb|ACN31955.1|  unknown                                                 318   5e-101   
ref|XP_009359851.1|  PREDICTED: probable protein S-acyltransferase 6    324   5e-101   
ref|XP_006481987.1|  PREDICTED: probable protein S-acyltransferas...    325   5e-101   
ref|XP_006282635.1|  hypothetical protein CARUB_v10004950mg             323   6e-101   
ref|XP_006430445.1|  hypothetical protein CICLE_v10011689mg             324   6e-101   
tpg|DAA56053.1|  TPA: hypothetical protein ZEAMMB73_443551              318   1e-100   
ref|XP_008381852.1|  PREDICTED: LOW QUALITY PROTEIN: protein S-ac...    322   2e-100   
ref|XP_008811959.1|  PREDICTED: probable protein S-acyltransferase 1    322   3e-100   
ref|XP_010904714.1|  PREDICTED: probable protein S-acyltransferase 4    322   3e-100   
gb|EYU26047.1|  hypothetical protein MIMGU_mgv1a007309mg                321   5e-100   
ref|XP_006654456.1|  PREDICTED: protein S-acyltransferase 8-like        321   5e-100   
ref|XP_009138303.1|  PREDICTED: protein S-acyltransferase 8             320   7e-100   
emb|CDY03433.1|  BnaC01g16490D                                          318   3e-99    
ref|NP_001055649.1|  Os05g0436900                                       319   4e-99    
ref|XP_003568378.1|  PREDICTED: protein S-acyltransferase 8             319   4e-99    
ref|XP_010249346.1|  PREDICTED: probable protein S-acyltransferase 7    318   4e-99    
ref|XP_004980573.1|  PREDICTED: probable S-acyltransferase At3g26...    319   7e-99    
ref|XP_010516297.1|  PREDICTED: probable protein S-acyltransferase 4    319   2e-98    
ref|XP_010927408.1|  PREDICTED: protein S-acyltransferase 8-like ...    316   2e-98    
ref|XP_010525441.1|  PREDICTED: probable protein S-acyltransferase 4    318   2e-98    
ref|XP_010504604.1|  PREDICTED: probable protein S-acyltransferas...    318   2e-98    
ref|XP_009405119.1|  PREDICTED: probable protein S-acyltransferase 1    317   4e-98    
ref|XP_010427545.1|  PREDICTED: probable protein S-acyltransferas...    318   5e-98    
ref|XP_009116394.1|  PREDICTED: probable protein S-acyltransferase 4    317   1e-97    
ref|XP_006291036.1|  hypothetical protein CARUB_v10017149mg             316   2e-97    
ref|XP_010504605.1|  PREDICTED: probable protein S-acyltransferas...    313   3e-97    
dbj|BAE98351.1|  hypothetical protein                                   309   4e-97    
ref|XP_006373664.1|  hypothetical protein POPTR_0016s02580g             315   4e-97    
ref|XP_006645080.1|  PREDICTED: protein S-acyltransferase 8-like        313   4e-97    
ref|XP_010427544.1|  PREDICTED: probable protein S-acyltransferas...    312   5e-97    
ref|NP_001044919.1|  Os01g0868200                                       313   5e-97    
ref|XP_004289442.1|  PREDICTED: probable S-acyltransferase At3g56...    313   6e-97    
ref|XP_002532773.1|  zinc finger protein, putative                      310   7e-97    
ref|NP_199813.2|  putative S-acyltransferase                            312   8e-97    
emb|CDX72095.1|  BnaC08g27790D                                          314   1e-96    
gb|EYU43025.1|  hypothetical protein MIMGU_mgv1a013406mg                305   1e-96    
ref|XP_008671888.1|  PREDICTED: probable protein S-acyltransferase 6    313   1e-96    
ref|XP_002323199.2|  hypothetical protein POPTR_0016s02580g             315   1e-96    
ref|XP_010922123.1|  PREDICTED: probable protein S-acyltransferase 1    312   2e-96    
ref|XP_007028179.1|  DHHC-type zinc finger family protein, putati...    313   2e-96    
ref|XP_011079430.1|  PREDICTED: probable protein S-acyltransferase 4    311   2e-96    
ref|XP_006402931.1|  hypothetical protein EUTSA_v10005938mg             313   3e-96    
ref|XP_011041324.1|  PREDICTED: probable protein S-acyltransferase 4    314   3e-96    
ref|NP_191252.1|  putative S-acyltransferase                            313   3e-96    
gb|AAM20704.1|  putative protein                                        313   3e-96    
emb|CDY51264.1|  BnaCnng20430D                                          313   4e-96    
emb|CAN60133.1|  hypothetical protein VITISV_000885                     324   4e-96    
ref|XP_004489728.1|  PREDICTED: probable S-acyltransferase At5g50...    310   5e-96    
ref|XP_010927405.1|  PREDICTED: protein S-acyltransferase 8-like ...    310   6e-96    
emb|CDP14342.1|  unnamed protein product                                311   6e-96    
ref|XP_009384346.1|  PREDICTED: probable protein S-acyltransferase 4    311   7e-96    
emb|CDX67662.1|  BnaA07g17020D                                          312   7e-96    
ref|XP_009104030.1|  PREDICTED: probable protein S-acyltransferas...    309   9e-96    
ref|XP_002864027.1|  zinc finger family protein                         309   1e-95    
ref|XP_009104028.1|  PREDICTED: probable protein S-acyltransferas...    311   1e-95    
ref|XP_002876388.1|  hypothetical protein ARALYDRAFT_486136             311   2e-95    
ref|XP_011025558.1|  PREDICTED: protein S-acyltransferase 8-like        306   2e-95    
ref|XP_010251763.1|  PREDICTED: probable protein S-acyltransferase 4    308   3e-95    
gb|EYU20840.1|  hypothetical protein MIMGU_mgv1a022244mg                307   3e-95    
ref|XP_011070038.1|  PREDICTED: probable protein S-acyltransferase 4    308   4e-95    
gb|EMT21298.1|  Putative S-acyltransferase                              310   7e-95    
ref|XP_006434506.1|  hypothetical protein CICLE_v10001285mg             303   9e-95    
ref|XP_008786791.1|  PREDICTED: probable protein S-acyltransferase 4    308   1e-94    
ref|XP_008679461.1|  PREDICTED: probable protein S-acyltransferase 6    308   1e-94    
ref|XP_007203017.1|  hypothetical protein PRUPE_ppa017899mg             307   2e-94    
gb|KDO57373.1|  hypothetical protein CISIN_1g018132mg                   305   2e-94    
ref|XP_004309653.1|  PREDICTED: probable S-acyltransferase At5g05...    305   2e-94    
gb|EPS66795.1|  hypothetical protein M569_07980                         307   2e-94    
ref|XP_002308847.2|  hypothetical protein POPTR_0006s02820g             306   2e-94    
gb|AAT58886.1|  unknown protein contains, zinc finger DHHC domain       318   4e-94    
ref|XP_004249100.1|  PREDICTED: probable protein S-acyltransferase 1    307   5e-94    
emb|CDY27178.1|  BnaA09g36240D                                          318   5e-94    
ref|XP_010673207.1|  PREDICTED: probable protein S-acyltransferase 4    305   5e-94    
ref|XP_009777440.1|  PREDICTED: probable protein S-acyltransferase 1    307   6e-94    
gb|KHN31279.1|  Putative S-acyltransferase                              297   7e-94    
ref|XP_008240605.1|  PREDICTED: probable protein S-acyltransferas...    305   7e-94    
ref|XP_009592264.1|  PREDICTED: probable protein S-acyltransferase 1    307   8e-94    
ref|XP_006364757.1|  PREDICTED: probable protein S-acyltransferas...    307   8e-94    
dbj|BAG99648.1|  unnamed protein product                                302   1e-93    
emb|CBX25421.1|  hypothetical_protein                                   306   1e-93    
ref|XP_008465237.1|  PREDICTED: probable protein S-acyltransferase 1    304   1e-93    
ref|XP_004144683.1|  PREDICTED: probable S-acyltransferase At5g05...    304   2e-93    
ref|XP_008240604.1|  PREDICTED: probable protein S-acyltransferas...    305   2e-93    
ref|XP_002523676.1|  zinc finger protein, putative                      306   2e-93    
gb|EAY73514.1|  hypothetical protein OsI_01396                          301   3e-93    
ref|XP_002283906.1|  PREDICTED: probable protein S-acyltransferase 4    304   3e-93    
ref|XP_004970714.1|  PREDICTED: probable S-acyltransferase At4g24...    301   3e-93    
gb|EMT33434.1|  Putative S-acyltransferase                              303   4e-93    
ref|XP_008244867.1|  PREDICTED: probable protein S-acyltransferas...    301   4e-93    
ref|XP_006464542.1|  PREDICTED: protein S-acyltransferase 8-like        300   6e-93    
ref|XP_006427889.1|  hypothetical protein CICLE_v10027028mg             300   6e-93    
emb|CDM82986.1|  unnamed protein product                                302   6e-93    
gb|EAY82169.1|  hypothetical protein OsI_37369                          303   1e-92    
ref|XP_004493294.1|  PREDICTED: probable S-acyltransferase At3g56...    303   1e-92    
gb|KDP21990.1|  hypothetical protein JCGZ_02880                         304   2e-92    
ref|XP_007204900.1|  hypothetical protein PRUPE_ppa006532mg             301   2e-92    
ref|XP_006662708.1|  PREDICTED: probable protein S-acyltransferas...    302   2e-92    
gb|KDO57156.1|  hypothetical protein CISIN_1g018898mg                   298   2e-92    
ref|XP_010111327.1|  putative S-acyltransferase                         301   2e-92    
tpg|DAA59190.1|  TPA: hypothetical protein ZEAMMB73_754615              304   3e-92    
ref|NP_001042744.1|  Os01g0279000                                       300   3e-92    
ref|XP_008675588.1|  PREDICTED: probable protein S-acyltransferas...    307   3e-92    
gb|KDP35293.1|  hypothetical protein JCGZ_09452                         298   3e-92    
ref|XP_008244866.1|  PREDICTED: probable protein S-acyltransferas...    301   3e-92    
ref|XP_006604301.1|  PREDICTED: probable protein S-acyltransferas...    301   4e-92    
ref|XP_009599608.1|  PREDICTED: protein S-acyltransferase 8-like        299   4e-92    
gb|KHN34577.1|  Putative S-acyltransferase                              301   4e-92    
gb|EEE51596.1|  hypothetical protein OsJ_32848                          301   5e-92    
emb|CBI32862.3|  unnamed protein product                                300   1e-91    
emb|CAN79042.1|  hypothetical protein VITISV_043755                     305   1e-91    
ref|XP_009336518.1|  PREDICTED: probable protein S-acyltransferase 4    299   2e-91    
tpg|DAA48250.1|  TPA: hypothetical protein ZEAMMB73_448859              293   2e-91    
ref|XP_009781054.1|  PREDICTED: protein S-acyltransferase 8-like        297   2e-91    
ref|XP_002450881.1|  hypothetical protein SORBIDRAFT_05g020320          299   3e-91    
ref|XP_004493300.1|  PREDICTED: probable S-acyltransferase At2g40...    298   3e-91    
ref|XP_008392511.1|  PREDICTED: probable protein S-acyltransferase 4    299   3e-91    
ref|XP_011040691.1|  PREDICTED: probable protein S-acyltransferase 1    297   3e-91    
ref|XP_007161918.1|  hypothetical protein PHAVU_001G108600g             298   3e-91    
gb|KGN54915.1|  hypothetical protein Csa_4G595980                       298   4e-91    
ref|XP_009347201.1|  PREDICTED: probable protein S-acyltransferase 4    298   5e-91    
ref|XP_008675589.1|  PREDICTED: probable protein S-acyltransferas...    303   6e-91    
ref|XP_003578979.1|  PREDICTED: probable protein S-acyltransferase 1    299   6e-91    
ref|XP_006357344.1|  PREDICTED: protein S-acyltransferase 8-like        296   6e-91    
ref|XP_011021974.1|  PREDICTED: protein S-acyltransferase 8-like ...    295   6e-91    
ref|XP_011021973.1|  PREDICTED: protein S-acyltransferase 8-like ...    295   6e-91    
ref|XP_008366551.1|  PREDICTED: probable protein S-acyltransferase 1    298   8e-91    
ref|XP_009377643.1|  PREDICTED: probable protein S-acyltransferase 1    298   9e-91    
gb|AES81075.2|  DHHC-type zinc finger protein                           298   9e-91    
ref|XP_002278657.2|  PREDICTED: probable protein S-acyltransferase 1    296   9e-91    
ref|XP_009335282.1|  PREDICTED: probable protein S-acyltransferase 1    298   9e-91    
emb|CBI32863.3|  unnamed protein product                                295   1e-90    
ref|XP_009776186.1|  PREDICTED: protein S-acyltransferase 8-like ...    293   1e-90    
ref|XP_004517196.1|  PREDICTED: probable S-acyltransferase At5g50...    293   1e-90    
ref|XP_002442702.1|  hypothetical protein SORBIDRAFT_08g001470          299   1e-90    
emb|CAN79043.1|  hypothetical protein VITISV_043756                     296   2e-90    
ref|XP_003553374.1|  PREDICTED: probable protein S-acyltransferas...    296   2e-90    
ref|XP_009629928.1|  PREDICTED: protein S-acyltransferase 8-like ...    293   2e-90    
ref|XP_003520466.1|  PREDICTED: probable protein S-acyltransferas...    296   2e-90    
ref|XP_006604302.1|  PREDICTED: probable protein S-acyltransferas...    292   3e-90    
ref|XP_011021975.1|  PREDICTED: protein S-acyltransferase 8-like ...    293   3e-90    
gb|EEC67608.1|  hypothetical protein OsI_34983                          296   3e-90    
ref|XP_009373028.1|  PREDICTED: probable protein S-acyltransferase 4    295   5e-90    
gb|EEE54331.1|  hypothetical protein OsJ_01304                          308   6e-90    



>ref|XP_011098929.1| PREDICTED: probable protein S-acyltransferase 7 [Sesamum indicum]
Length=437

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/340 (87%), Positives = 318/340 (94%), Gaps = 5/340 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             LVLLLLTSGRDPGI+PRNAHPPEP+ +DG++EG  QTPQLRLPRIKEVEVNGITVK+KYC
Sbjct  92    LVLLLLTSGRDPGIIPRNAHPPEPEGYDGSVEGA-QTPQLRLPRIKEVEVNGITVKIKYC  150

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF
Sbjct  151   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  210

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYI+RIMD E+T+IW+AMIKTPAS+VLI YTFI+VWFVGGLTAFHLYLISTNQTTYEN
Sbjct  211   CWVYIKRIMDTEQTSIWRAMIKTPASIVLIVYTFIAVWFVGGLTAFHLYLISTNQTTYEN  270

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRYRYDRRANPYNKGV+ENF EIFC   PPSKN+FRAKVP +PAL AR  AGGFVSPNMG
Sbjct  271   FRYRYDRRANPYNKGVLENFKEIFCGPTPPSKNNFRAKVPIEPALPARSVAGGFVSPNMG  330

Query  976   KAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             KAVEDIEMGRKAVWGDVG+  +H EGQLSDNDG+N K+ GGLGEMSPEIRTTVDEGDRA 
Sbjct  331   KAVEDIEMGRKAVWGDVGSVLDHPEGQLSDNDGLNGKD-GGLGEMSPEIRTTVDEGDRAG  389

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             + HPRRSSWGRKSGSWEMSPEVLALASR+GE NR GGSSS
Sbjct  390   I-HPRRSSWGRKSGSWEMSPEVLALASRMGEPNRTGGSSS  428



>ref|XP_004231755.1| PREDICTED: probable protein S-acyltransferase 7 [Solanum lycopersicum]
Length=432

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/338 (86%), Positives = 314/338 (93%), Gaps = 4/338 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             VLVLLLLTSGRDPGI+PRNAHPPEP+ +DG +EGGGQTPQLRLPRIKEVEVNGITVK+KY
Sbjct  91    VLVLLLLTSGRDPGIIPRNAHPPEPEGYDGTVEGGGQTPQLRLPRIKEVEVNGITVKIKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIM  ++TTIWKAMIKTPAS+VLIAYTFISVWFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIKRIMVLDDTTIWKAMIKTPASIVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD RANPYN+GV++NF EIFCTSIPPSKN+FRAKVPR+P +A R   GGFVSPNM
Sbjct  271   NFRYRYDWRANPYNRGVMQNFKEIFCTSIPPSKNNFRAKVPREPKVATRSAGGGFVSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKAVEDIEMGRKAVW +VG    EGQLSDNDG+N+K+ G LG+MSPEIR+TVDE DRA +
Sbjct  331   GKAVEDIEMGRKAVWSEVG--DNEGQLSDNDGLNIKD-GMLGQMSPEIRSTVDESDRAGI  387

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
              HPR SSWGRKSGSWEMSPEVLALASRVGE NR GGSS
Sbjct  388   -HPRGSSWGRKSGSWEMSPEVLALASRVGEANRTGGSS  424



>ref|XP_006338722.1| PREDICTED: probable protein S-acyltransferase 7-like [Solanum 
tuberosum]
Length=435

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/338 (86%), Positives = 313/338 (93%), Gaps = 4/338 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             VLVLLLLTSGRDPGI+PRNAHPPEP+ +DG +EGGGQTPQLRLPRIKEVEVNGITVK+KY
Sbjct  95    VLVLLLLTSGRDPGIIPRNAHPPEPEGYDGTVEGGGQTPQLRLPRIKEVEVNGITVKIKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIM  ++TTIWKAMIKTPAS+VLIAYTFISVWFVGGLTAFHLYLISTNQTTYE
Sbjct  215   FCWVYIKRIMVLDDTTIWKAMIKTPASIVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD RANPYN+GV++NF EIFCTSIPPSKN+FRAKVPR+P +  R   GGFVSPNM
Sbjct  275   NFRYRYDWRANPYNRGVIQNFKEIFCTSIPPSKNNFRAKVPREPKVPTRSAGGGFVSPNM  334

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKAVEDIEMGRKAVW +VG    EGQLSDNDG+N+K+ G LG+MSPEIRTTVDE DRA +
Sbjct  335   GKAVEDIEMGRKAVWSEVG--DNEGQLSDNDGLNIKD-GMLGQMSPEIRTTVDESDRAGI  391

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
              HPR SSWGRKSGSWEMSPEVLALASRVGE NR GGSS
Sbjct  392   -HPRGSSWGRKSGSWEMSPEVLALASRVGEANRTGGSS  428



>ref|XP_007215386.1| hypothetical protein PRUPE_ppa005757mg [Prunus persica]
 gb|EMJ16585.1| hypothetical protein PRUPE_ppa005757mg [Prunus persica]
Length=445

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 315/345 (91%), Gaps = 6/345 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRN HPPEP+ FDGN+EGG GQTPQLRLPRIKEVEVNGI VK+KY
Sbjct  96    LVLLLLTSGRDPGIIPRNTHPPEPEGFDGNVEGGAGQTPQLRLPRIKEVEVNGIPVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM  E+TTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMGTEDTTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVVENF EIFCT+IP SKN+FRAKVPR+P L  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVENFKEIFCTTIPQSKNNFRAKVPREPVLPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAVEDIEMGRK VWGD+  G +H EGQL++ND +N+K+ G LGE+SP+IRTTVDE  DR
Sbjct  336   GKAVEDIEMGRKTVWGDMNAGGDHYEGQLNNNDRLNLKD-GELGEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             A + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR GGSSSGGL
Sbjct  395   AGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRTGGSSSGGL  438



>ref|XP_008231065.1| PREDICTED: probable protein S-acyltransferase 7 [Prunus mume]
Length=445

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 315/345 (91%), Gaps = 6/345 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRN HPPEP+ FDGN+EGG GQTPQLRLPRIKEVEVNGI VK+KY
Sbjct  96    LVLLLLTSGRDPGIIPRNTHPPEPEGFDGNVEGGAGQTPQLRLPRIKEVEVNGIPVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM  E+TTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMGTEDTTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVVENF EIFCT+IP SKN+FRAKVPR+P L  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVENFKEIFCTTIPQSKNNFRAKVPREPGLPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAVEDIEMGRK VWGD+  G +H EGQL++ND +N+K+ G LGE+SP+IRTTVDE  DR
Sbjct  336   GKAVEDIEMGRKTVWGDMNAGGDHYEGQLNNNDRLNLKD-GELGEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             A + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR GGSSSGGL
Sbjct  395   AGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRTGGSSSGGL  438



>ref|XP_009628445.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/336 (85%), Positives = 307/336 (91%), Gaps = 3/336 (1%)
 Frame = +1

Query  262   LLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDT  441
             LLLLTSGRDPGI+PRNAHPPEP+ +DG  EGGGQTPQLRLPRIKEV VNGITVK+KYCDT
Sbjct  98    LLLLTSGRDPGIIPRNAHPPEPEGYDGTAEGGGQTPQLRLPRIKEVAVNGITVKIKYCDT  157

Query  442   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW  621
             CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW
Sbjct  158   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW  217

Query  622   VYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFR  801
             VYI+RIM  E+TTIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTTYENFR
Sbjct  218   VYIKRIMVLEDTTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTTYENFR  277

Query  802   YRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKA  981
             YRYD RANPYNKGV++NF EIFCT+IPPSKN+FRAKVPR+P + +R   GGFVSPNMGKA
Sbjct  278   YRYDWRANPYNKGVIQNFKEIFCTTIPPSKNNFRAKVPREPKMPSRSAGGGFVSPNMGKA  337

Query  982   VEDIEMGRKAVWGDVGAE-HQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHH  1158
             VEDIEMGRKAVW +VG     +GQ SDN+G+N+K+ G LG+MSPEIRTTVDE DRA + H
Sbjct  338   VEDIEMGRKAVWSEVGGGVDNDGQFSDNNGLNVKD-GVLGQMSPEIRTTVDEADRAGI-H  395

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
             PR SSWGRKSGSWEMSPEVLALASRVGE NR GGSS
Sbjct  396   PRGSSWGRKSGSWEMSPEVLALASRVGEPNRTGGSS  431



>ref|XP_009346802.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=449

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/345 (84%), Positives = 314/345 (91%), Gaps = 6/345 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRN HPPEP+ FDGNIEGG GQTPQLRLPRIKEVEVNGI+VK+KY
Sbjct  96    LVLLLLTSGRDPGIIPRNTHPPEPEGFDGNIEGGAGQTPQLRLPRIKEVEVNGISVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF+TTLLCIYVFG
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFNTTLLCIYVFG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMGAEETTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV+NF EIFCT+IP SKN FR KVPR+PAL  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVDNFKEIFCTAIPKSKNHFRDKVPREPALPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAVEDIEMGRK VWGD+  G ++ EGQ + ND +N+K+ G L E+SP+IRTTVDE  DR
Sbjct  336   GKAVEDIEMGRKTVWGDMSAGGDNYEGQHNGNDRLNVKD-GELSEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             A M HPRR+SWGRKSGSWEMSPEVLALA+RVGE NR GGSSSGGL
Sbjct  395   AGM-HPRRASWGRKSGSWEMSPEVLALAARVGEPNRTGGSSSGGL  438



>ref|XP_002273157.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Vitis 
vinifera]
Length=452

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/339 (84%), Positives = 311/339 (92%), Gaps = 5/339 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ +DG+ EG GGQTPQLRLPRIKEVEVNG+TVK+K
Sbjct  95    VLVLLLLTSGRDPGIIPRNAHPPEPEGYDGSAEGVGGQTPQLRLPRIKEVEVNGVTVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  155   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI+RIMD+EETTIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTTY
Sbjct  215   GFCWVYIKRIMDSEETTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYNKGVV+NF EIFCTSI PSKN+FRAKVP++P L  R   GGF+SPN
Sbjct  275   ENFRYRYDRRANPYNKGVVQNFKEIFCTSISPSKNNFRAKVPKEPGLPGRSVGGGFISPN  334

Query  970   MGKAVEDIEMGRK-AVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV-DEG  1137
             MGKAVEDIEMGRK A WGDVGA  +H EGQ+ +ND +N+K+ GGLGE+SP++RTT+ D G
Sbjct  335   MGKAVEDIEMGRKAAAWGDVGAGPDHCEGQIYNNDSLNIKDNGGLGEISPDVRTTIEDMG  394

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             +     HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  395   ELGGGVHPRRSSWGRKSGSWEMSPEVLALAARVGEPNRV  433



>ref|XP_009344211.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=445

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/345 (83%), Positives = 314/345 (91%), Gaps = 6/345 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRN HPPEP+ FDGN+E G GQTPQLRLPRIKEVEVNGI+VK+KY
Sbjct  96    LILLLLTSGRDPGIIPRNTHPPEPEGFDGNVESGAGQTPQLRLPRIKEVEVNGISVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM+AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMEAEETTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV+NF EIFCT+IP SKN+FR KVPR+P L  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVDNFKEIFCTTIPKSKNNFRDKVPREPVLPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAV+DIEMGRK VWGD+  G ++ +GQ + ND VN+K+ G L E+SP+IRTTVDE  DR
Sbjct  336   GKAVDDIEMGRKTVWGDMNAGGDNYDGQHNGNDRVNVKD-GELSEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             A M HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRMGGSSSGGL
Sbjct  395   AGM-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRMGGSSSGGL  438



>gb|KDP41813.1| hypothetical protein JCGZ_26831 [Jatropha curcas]
Length=443

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/345 (82%), Positives = 312/345 (90%), Gaps = 5/345 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ FDGN + G GQTPQLRLPR KEVEVNG  VK+K
Sbjct  94    VLVLLLLTSGRDPGIIPRNAHPPEPEGFDGNADVGAGQTPQLRLPRFKEVEVNGAVVKIK  153

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  154   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  213

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM +E T+IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  214   AFCWVYIRRIMGSENTSIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTY  273

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR NPYNKG++ENF EIFC+SIP SKN+FRAKVPR+PAL  R   GGF+SPN
Sbjct  274   ENFRYRYDRRTNPYNKGMIENFKEIFCSSIPQSKNNFRAKVPREPALPTRPIGGGFMSPN  333

Query  970   MGKAVEDIEMGRKAVWGDVG--AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             MGKAV+DIEMGRK VWGD+G  A+H EGQ+++N  +N+K+ G LGE+SP+IRT V+EGDR
Sbjct  334   MGKAVDDIEMGRKTVWGDMGTMADHGEGQVTNNGRLNIKD-GELGEVSPDIRTAVEEGDR  392

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             + + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR GGSSSG L
Sbjct  393   SGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRAGGSSSGNL  436



>ref|XP_004304544.1| PREDICTED: probable S-acyltransferase At3g26935-like [Fragaria 
vesca subsp. vesca]
Length=443

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/346 (83%), Positives = 312/346 (90%), Gaps = 6/346 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRN HPPEP+ FDG+ E G GQTPQLRLPRIKEVEVNGI VK+KY
Sbjct  94    LMLLLLTSGRDPGIIPRNTHPPEPEGFDGSTESGAGQTPQLRLPRIKEVEVNGIPVKIKY  153

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  154   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  213

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM +E+TTIW+AMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  214   FCWVYVRRIMGSEDTTIWRAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  273

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGV +NF EIFCTSIP SKNDFR KVPR+P L  R   GGF+SPNM
Sbjct  274   NFRYRYDRRANPYNKGVADNFKEIFCTSIPESKNDFREKVPREPVLPPRPGGGGFMSPNM  333

Query  973   GKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAV+DIEMGRK VWGD+GA  +H EGQL++N+  N+KE G LGE+SP+IRTTVDE  DR
Sbjct  334   GKAVDDIEMGRKTVWGDMGAGGDHFEGQLNNNERQNVKE-GELGEVSPDIRTTVDETVDR  392

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             A + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRMGGSSS GL 
Sbjct  393   AGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRMGGSSSSGLT  437



>ref|XP_008341259.1| PREDICTED: probable protein S-acyltransferase 7 [Malus domestica]
Length=445

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/345 (83%), Positives = 313/345 (91%), Gaps = 6/345 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRN HPPEP+ FDGNIEGG GQTPQLRLPRIKEVEVNGI+ K+KY
Sbjct  96    LILLLLTSGRDPGIIPRNTHPPEPEGFDGNIEGGAGQTPQLRLPRIKEVEVNGISXKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM AEETTIWKA+IKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMGAEETTIWKALIKTPASIVLILYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGV++NF EIFCT+IP SKN+FR KVPR+PAL  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVIDNFKEIFCTTIPKSKNNFRDKVPREPALPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAV+DIEMGRK VWGD+  G ++ +GQ + ND VN+K+ G L E+SP+IRTTVDE  DR
Sbjct  336   GKAVDDIEMGRKTVWGDMNAGGDNYDGQHNGNDRVNVKD-GELSEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             A + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRMG SSSGGL
Sbjct  395   AGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRMGSSSSGGL  438



>ref|XP_002512891.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49394.1| zinc finger protein, putative [Ricinus communis]
Length=443

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 310/342 (91%), Gaps = 5/342 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ FDG  + G GQTPQLRLPRIKEVEVNG  VK+K
Sbjct  94    VLVLLLLTSGRDPGIIPRNAHPPEPEGFDGTADVGAGQTPQLRLPRIKEVEVNGAVVKIK  153

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  154   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  213

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM +E T+IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  214   AFCWVYIRRIMGSENTSIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTY  273

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR NPY KGVVENF EIFC+SIP SKN+FRAKVPR+PAL  R   GGF+SPN
Sbjct  274   ENFRYRYDRRVNPYYKGVVENFKEIFCSSIPLSKNNFRAKVPREPALPTRPIGGGFMSPN  333

Query  970   MGKAVEDIEMGRKAVWGDVG--AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             MGKAV+DIEMGRK VWGD+G  A+H +GQL++ND +N+K+ G LGE+SPEIRT V+EGDR
Sbjct  334   MGKAVDDIEMGRKTVWGDMGVIADHGDGQLANNDRLNIKD-GELGEVSPEIRTAVEEGDR  392

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
               + HPRRSSWGRKSGSWEMSPEVLA+A+RVGE NR+GGSSS
Sbjct  393   NGI-HPRRSSWGRKSGSWEMSPEVLAMAARVGEPNRVGGSSS  433



>ref|XP_009378011.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=437

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/344 (83%), Positives = 312/344 (91%), Gaps = 6/344 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRN HPPEP+ FDGN+E G GQTPQLRLPRIKEVEVNGI+VK+KY
Sbjct  96    LILLLLTSGRDPGIIPRNTHPPEPEGFDGNVESGAGQTPQLRLPRIKEVEVNGISVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM+AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMEAEETTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV+NF EIFCT+IP SKN+FR KVPR+P L  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVDNFKEIFCTTIPKSKNNFRDKVPREPVLPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAV+DIEMGRK VWGD+  G ++ +GQ + ND VN+K+ G L E+SP+IRTTVDE  DR
Sbjct  336   GKAVDDIEMGRKTVWGDMNAGGDNYDGQHNGNDRVNVKD-GELSEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
             A M HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRMGGSS GG
Sbjct  395   AGM-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRMGGSSIGG  437



>ref|XP_009761768.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana sylvestris]
Length=445

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/331 (84%), Positives = 301/331 (91%), Gaps = 3/331 (1%)
 Frame = +1

Query  262   LLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDT  441
             LLLLTSGRDPGI+PRNAHPPEP+ ++G +EGGGQTPQLRLPRIKEV VNGITVK+KYCDT
Sbjct  98    LLLLTSGRDPGIIPRNAHPPEPEGYEGTVEGGGQTPQLRLPRIKEVLVNGITVKIKYCDT  157

Query  442   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW  621
             CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW
Sbjct  158   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW  217

Query  622   VYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFR  801
             VYI+RIM  E+ TIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTTYENFR
Sbjct  218   VYIKRIMVLEDKTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTTYENFR  277

Query  802   YRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKA  981
             YRYD RANPYNKGV++NF EIFCT+IPPSKN+FRA+VPR+P + +R   GGFVSPNMGK 
Sbjct  278   YRYDWRANPYNKGVIQNFKEIFCTTIPPSKNNFRAQVPREPKMPSRSAGGGFVSPNMGKV  337

Query  982   VEDIEMGRKAVWGDV-GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHH  1158
             VEDIEMGRKAVW +V G    EGQ SDN+G+N+K+ G LG+MSPEIRTTVDE DRA   H
Sbjct  338   VEDIEMGRKAVWSEVGGGVDNEGQFSDNNGLNVKD-GVLGQMSPEIRTTVDEADRAGT-H  395

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             PR SSWGRKSGSWEMSPEVLALASRVGE NR
Sbjct  396   PRGSSWGRKSGSWEMSPEVLALASRVGEPNR  426



>ref|XP_003548022.1| PREDICTED: probable protein S-acyltransferase 7-like [Glycine 
max]
Length=438

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 305/342 (89%), Gaps = 6/342 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G GQTPQLRLPRIKEVEVNGITVKVK
Sbjct  91    VLVLLLLTSGRDPGIIPRNAHPPEPEGFEGSLDVGAGQTPQLRLPRIKEVEVNGITVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM+AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRRIMEAEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYN GV  NF+EIFCTSIP SKN+FRAKVP +P L AR   GGF+SP+
Sbjct  271   ENFRYRYDRRANPYNTGVFNNFLEIFCTSIPQSKNNFRAKVPMEPVLPARSVGGGFMSPS  330

Query  970   MGKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             MGKAV+DIEMGRK VW D+G   +  EGQL  ND V +K+ G  GE+SPEIRTTVDE   
Sbjct  331   MGKAVDDIEMGRKTVWADMGTALDPSEGQL--NDRVAVKD-GEFGELSPEIRTTVDETSH  387

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
              A  HPRRSSWGRKSGSWEMSPEVLALA++VGE NRMGG SS
Sbjct  388   RAGMHPRRSSWGRKSGSWEMSPEVLALAAKVGESNRMGGGSS  429



>ref|XP_010660719.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=385

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 304/332 (92%), Gaps = 5/332 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ +DG+ EG GGQTPQLRLPRIKEVEVNG+TVK+KYCDTCML
Sbjct  35    TSGRDPGIIPRNAHPPEPEGYDGSAEGVGGQTPQLRLPRIKEVEVNGVTVKIKYCDTCML  94

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI
Sbjct  95    YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  154

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD+EETTIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  155   KRIMDSEETTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  214

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVV+NF EIFCTSI PSKN+FRAKVP++P L  R   GGF+SPNMGKAVED
Sbjct  215   DRRANPYNKGVVQNFKEIFCTSISPSKNNFRAKVPKEPGLPGRSVGGGFISPNMGKAVED  274

Query  991   IEMGRK-AVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV-DEGDRAAMHH  1158
             IEMGRK A WGDVGA  +H EGQ+ +ND +N+K+ GGLGE+SP++RTT+ D G+     H
Sbjct  275   IEMGRKAAAWGDVGAGPDHCEGQIYNNDSLNIKDNGGLGEISPDVRTTIEDMGELGGGVH  334

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             PRRSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  335   PRRSSWGRKSGSWEMSPEVLALAARVGEPNRV  366



>gb|KHN13374.1| Putative S-acyltransferase [Glycine soja]
Length=438

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/342 (82%), Positives = 304/342 (89%), Gaps = 6/342 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G GQTPQLRLPRIKEVEVNGITVKVK
Sbjct  91    VLVLLLLTSGRDPGIIPRNAHPPEPEGFEGSLDVGAGQTPQLRLPRIKEVEVNGITVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM+AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRRIMEAEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYN GV  NF+EIFCTSIP SKN+FRAKVP +P L AR    GF+SP+
Sbjct  271   ENFRYRYDRRANPYNTGVFNNFLEIFCTSIPQSKNNFRAKVPMEPVLPARSVGAGFMSPS  330

Query  970   MGKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             MGKAV+DIEMGRK VW D+G   +  EGQL  ND V +K+ G  GE+SPEIRTTVDE   
Sbjct  331   MGKAVDDIEMGRKTVWADMGTALDPSEGQL--NDRVAVKD-GEFGELSPEIRTTVDETSH  387

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
              A  HPRRSSWGRKSGSWEMSPEVLALA++VGE NRMGG SS
Sbjct  388   RAGMHPRRSSWGRKSGSWEMSPEVLALAAKVGESNRMGGGSS  429



>emb|CDP16720.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/334 (86%), Positives = 308/334 (92%), Gaps = 4/334 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             VLVLLLLTSGRDPGI+PRN HPPEP+ +DG  EGGGQTPQLRLPRIKEVEVNGITVK+KY
Sbjct  95    VLVLLLLTSGRDPGIIPRNTHPPEPEGYDGGAEGGGQTPQLRLPRIKEVEVNGITVKIKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTT+LCIYVFG
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTILCIYVFG  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI RIM++EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  215   FCWVYITRIMNSEETTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKG+V+NF EIFC+ IPPSKNDFRAKVPR+P L AR   GGFVSPNM
Sbjct  275   NFRYRYDRRANPYNKGMVQNFKEIFCSPIPPSKNDFRAKVPREPTLPARSVGGGFVSPNM  334

Query  973   GKAVEDIEMGRKAVWGDVG--AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
             GKAV+DIEMGRKAVWGDVG   ++ EG  SDNDG+N+K+GG  G MSP IRTTVDEGDRA
Sbjct  335   GKAVDDIEMGRKAVWGDVGPLTDNPEGHFSDNDGLNIKDGGFDG-MSPGIRTTVDEGDRA  393

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
              + HPRRSSWGRKSGSWEMSPEVLALASR+GE N
Sbjct  394   GV-HPRRSSWGRKSGSWEMSPEVLALASRMGEPN  426



>ref|XP_008357698.1| PREDICTED: probable protein S-acyltransferase 7 [Malus domestica]
Length=445

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/337 (84%), Positives = 306/337 (91%), Gaps = 6/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRN HPPEP+ FDGNIEGG GQTPQLRLPRIKEVEVNGI+VK+KY
Sbjct  96    LVLLLLTSGRDPGIIPRNTHPPEPEGFDGNIEGGAGQTPQLRLPRIKEVEVNGISVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF+TTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFNTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+RRIM AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYVRRIMGAEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV+NF EIFCT+IP SKN FR KVPR+PAL  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPYNKGVVDNFKEIFCTAIPESKNHFRDKVPREPALPPRSGGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DR  1143
             GKAVEDIEMGRK VWGD+  G ++ EGQ + ND VN+K+ G L E+SP+IRTTVDE  DR
Sbjct  336   GKAVEDIEMGRKTVWGDMSAGGDNYEGQHNGNDRVNVKD-GELSEVSPDIRTTVDETVDR  394

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             A M HPRR+SWGRKSGSWEMSPEVLALA+RVGE NRM
Sbjct  395   AGM-HPRRASWGRKSGSWEMSPEVLALAARVGEPNRM  430



>ref|XP_007151749.1| hypothetical protein PHAVU_004G071400g [Phaseolus vulgaris]
 gb|ESW23743.1| hypothetical protein PHAVU_004G071400g [Phaseolus vulgaris]
Length=438

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/342 (82%), Positives = 305/342 (89%), Gaps = 6/342 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G GQTPQLRLPRIKEVEVNG+TVKVK
Sbjct  91    VLVLLLLTSGRDPGIIPRNAHPPEPEGFEGSLDVGAGQTPQLRLPRIKEVEVNGMTVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM++EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRRIMESEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYN+GV+ NF+EIFCTSIP SKN+FR KVP +P L AR   GGF+SP+
Sbjct  271   ENFRYRYDRRANPYNRGVINNFLEIFCTSIPQSKNNFREKVPLEPVLPARSVGGGFMSPS  330

Query  970   MGKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             MGKAV+DIEMGRK VW D+G   +  EGQL  ND + +K+ G  GE+SPEIRTTVDE   
Sbjct  331   MGKAVDDIEMGRKTVWADMGTALDPSEGQL--NDRLAIKD-GEFGELSPEIRTTVDETSD  387

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
                 HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRMGG SS
Sbjct  388   RGGIHPRRSSWGRKSGSWEMSPEVLALAARVGESNRMGGGSS  429



>ref|XP_003518123.1| PREDICTED: probable protein S-acyltransferase 7-like [Glycine 
max]
Length=427

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/339 (82%), Positives = 302/339 (89%), Gaps = 7/339 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G GQTPQLRLPRIKEVEVNGITVKVK
Sbjct  91    VLVLLLLTSGRDPGIIPRNAHPPEPEGFEGSLDVGAGQTPQLRLPRIKEVEVNGITVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM+AEETTIWKAMIKTPAS+ LI YTF+S+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRRIMEAEETTIWKAMIKTPASIGLIIYTFVSMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYNKGV  NF+EIFCTSIP SKN+FRAKVP +P L AR   GGF+SP+
Sbjct  271   ENFRYRYDRRANPYNKGVFNNFLEIFCTSIPQSKNNFRAKVPMEPVLPARSVGGGFMSPS  330

Query  970   MGKAVEDIEMGRKAVWGDVGA---EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             MGKAV+DIEMGRK VW D+G+   +  EGQL  N+ V +K+ G  GE+SPEIRTTVDE  
Sbjct  331   MGKAVDDIEMGRKTVWADMGSTALDPSEGQL--NERVAVKD-GEFGELSPEIRTTVDETS  387

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG  1257
               A  HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+ 
Sbjct  388   DRAGIHPRRSSWGRKSGSWEMSPEVLALAARVGESNRIA  426



>ref|XP_006447007.1| hypothetical protein CICLE_v10015257mg [Citrus clementina]
 ref|XP_006468838.1| PREDICTED: probable protein S-acyltransferase 7-like [Citrus 
sinensis]
 gb|ESR60247.1| hypothetical protein CICLE_v10015257mg [Citrus clementina]
Length=443

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 302/339 (89%), Gaps = 6/339 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDGN + G GQTPQLRLPRIKEVEVNGITVK+KYCDTCML
Sbjct  100   TSGRDPGIIPRNAHPPEPEGFDGNADVGAGQTPQLRLPRIKEVEVNGITVKIKYCDTCML  159

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  160   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  219

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIMDAE TTIWKAMIKTPAS+VLI YTFI++WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  220   RRIMDAEYTTIWKAMIKTPASIVLIIYTFIAMWFVGGLTAFHLYLISTNQTTYENFRYRY  279

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVV+NF EIFC+SIPPSKN+FRA VPR+PAL  R   GGF+SPNMGKA +D
Sbjct  280   DRRANPYNKGVVDNFKEIFCSSIPPSKNNFRAMVPREPALPTRSVGGGFMSPNMGKAGDD  339

Query  991   IEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             IEMGRK VWGDV  G +  EGQL +ND +N+K+ G L E+SP+IRTTV+EGDR  + HPR
Sbjct  340   IEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKD-GELAELSPDIRTTVEEGDRVGI-HPR  397

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             RSSWGRKSGSW+MSPE+ ALA+R+ E NR GGS +   N
Sbjct  398   RSSWGRKSGSWDMSPELTALAARI-ESNRAGGSGTSSSN  435



>gb|KDO63858.1| hypothetical protein CISIN_1g013443mg [Citrus sinensis]
Length=443

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 302/339 (89%), Gaps = 6/339 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDGN + G GQTPQLRLPRIKEVEVNGITVK+KYCDTCML
Sbjct  100   TSGRDPGIIPRNAHPPEPEGFDGNADVGAGQTPQLRLPRIKEVEVNGITVKIKYCDTCML  159

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  160   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  219

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIMDAE TTIWKAMIKTPAS+VLI YTFI++WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  220   RRIMDAEYTTIWKAMIKTPASIVLIIYTFIAMWFVGGLTAFHLYLISTNQTTYENFRYRY  279

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVV+NF EIFC+SIPPSKN+FRA VPR+PAL  R   GGF+SPNMGKA +D
Sbjct  280   DRRANPYNKGVVDNFKEIFCSSIPPSKNNFRAMVPREPALPTRSVGGGFMSPNMGKAGDD  339

Query  991   IEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             IEMGRK VWGDV  G +  EGQL +ND +N+K+ G L E+SP+IRTTV+EGDR  + HPR
Sbjct  340   IEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKD-GELAELSPDIRTTVEEGDRVGI-HPR  397

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             RSSWGRKSGSW+MSPE+ ALA+R+ E NR GGS +   N
Sbjct  398   RSSWGRKSGSWDMSPELTALAARI-ESNRAGGSGTSSSN  435



>ref|XP_007031947.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY02873.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=442

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/336 (84%), Positives = 306/336 (91%), Gaps = 9/336 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FDGN + G GQTPQLRLPR+KEVEVNG++VK+KY
Sbjct  95    LVLLLLTSGRDPGIIPRNAHPPEPEGFDGNTDVGAGQTPQLRLPRMKEVEVNGVSVKIKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRIM +EETTIW+AMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  215   FCWVYIRRIMASEETTIWRAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVVENF EIFC+SIP SKN+FR KV R+PAL  R   GGF+SPNM
Sbjct  275   NFRYRYDRRANPYNKGVVENFKEIFCSSIPLSKNNFREKVMREPALPTR--PGGFMSPNM  332

Query  973   GKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV-DEGDR  1143
             GKAV+DIEMGRK VWGD+GA  +H EGQL+  D VN+KE G LGE+SP+IRTTV D GDR
Sbjct  333   GKAVDDIEMGRKTVWGDMGAGTDHCEGQLT-RDRVNVKE-GELGELSPDIRTTVEDTGDR  390

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             + + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR
Sbjct  391   SGI-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNR  425



>ref|XP_011045758.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Populus 
euphratica]
Length=444

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/343 (80%), Positives = 305/343 (89%), Gaps = 5/343 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FDG+ + G GQTPQLRLPR+KEVE NG+TVKVKY
Sbjct  95    LVLLLLTSGRDPGIIPRNAHPPEPEGFDGSADVGSGQTPQLRLPRVKEVEFNGMTVKVKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV STTLLCIYVF 
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVLSTTLLCIYVFA  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM +E  + WKAM+KTP+S+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  215   FCWVYIRKIMGSENISTWKAMMKTPSSIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANP+ KG+VENF EIFC+SIPPSKN+FRAKVPR+PAL  R   GGF+SPNM
Sbjct  275   NFRYRYDRRANPFYKGLVENFKEIFCSSIPPSKNNFRAKVPREPALPTRTLGGGFMSPNM  334

Query  973   GKAVEDIEMGRKAVWGDVGA-EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRA  1146
             GKA  DIEMGRK VWGD+ A    EGQ ++ND +N+K+ G LGE+SP+IRTTVDE GDR 
Sbjct  335   GKAGGDIEMGRKTVWGDMSAMADSEGQPANNDRLNIKD-GELGELSPDIRTTVDEVGDRG  393

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
              + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+GG SS G
Sbjct  394   GL-HPRRSSWGRKSGSWEMSPEVLALAARVGESNRVGGGSSVG  435



>gb|KHG22830.1| hypothetical protein F383_02837 [Gossypium arboreum]
Length=442

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 305/336 (91%), Gaps = 9/336 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDGN++ G GQTPQLRLPRIKEVEVNGITVK+KYCDTCML
Sbjct  101   TSGRDPGIIPRNAHPPEPESFDGNVDVGAGQTPQLRLPRIKEVEVNGITVKIKYCDTCML  160

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  161   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  220

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIM +EETTIW+AMIKTPAS+VLI YTFI++WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  221   RRIMASEETTIWRAMIKTPASIVLIVYTFIAMWFVGGLTAFHLYLISTNQTTYENFRYRY  280

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVV+NF EIF +SIP SKN+FR KVPR+P L  R   GGF+SPNMGKAV+D
Sbjct  281   DRRANPYNKGVVDNFKEIFFSSIPLSKNNFREKVPREPVLPTR--PGGFMSPNMGKAVDD  338

Query  991   IEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRAAMHHP  1161
             IEMGRK VWGD+GA  +H EGQL  +D VN+KE G LG++SP+IR+TVD+ GDR+ + HP
Sbjct  339   IEMGRKTVWGDIGAGTDHCEGQLI-SDRVNVKE-GELGDLSPDIRSTVDDIGDRSGI-HP  395

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             RRSSWGRKSG WEMSPEVLALA+RVGE NR+GG SS
Sbjct  396   RRSSWGRKSGRWEMSPEVLALAARVGEPNRVGGGSS  431



>ref|XP_004492998.1| PREDICTED: probable S-acyltransferase At3g26935-like isoform 
X1 [Cicer arietinum]
Length=434

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/342 (80%), Positives = 300/342 (88%), Gaps = 9/342 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FD N + G GQTPQLRLPRIKEVEVNG+ VKVKY
Sbjct  92    LVLLLLTSGRDPGIIPRNAHPPEPEGFDSNADVGSGQTPQLRLPRIKEVEVNGVAVKVKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTT+LC+YVF 
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTVLCVYVFA  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  212   FCWVYIRRIMGSEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV NF EIFC SIP SKNDFRA VP +PAL AR   GGF++  +
Sbjct  272   NFRYRYDRRANPYNKGVVNNFKEIFCISIPSSKNDFRAMVPNEPALPARSVGGGFMNQTL  331

Query  973   GKAVEDIEMGRKAVWG-DVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DRA  1146
             GK  +DIEMGRKAVW  + G +  + QL +ND V++K+    GE+SPEIRTTVD+  DRA
Sbjct  332   GKPTDDIEMGRKAVWEMNAGMDDSDNQL-NNDRVSIKD----GELSPEIRTTVDDTVDRA  386

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG-GSSS  1269
              MHHPRRSSWGRKSGSWEMSPEVLALA+RVGE NR G G+SS
Sbjct  387   GMHHPRRSSWGRKSGSWEMSPEVLALAARVGEANRAGEGNSS  428



>emb|CBI21313.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 296/338 (88%), Gaps = 23/338 (7%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ +DG+ EG GGQTPQLRLPRIKEVEVNG+TVK+K
Sbjct  95    VLVLLLLTSGRDPGIIPRNAHPPEPEGYDGSAEGVGGQTPQLRLPRIKEVEVNGVTVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  155   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI+RIMD+EETTIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTTY
Sbjct  215   GFCWVYIKRIMDSEETTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYNKGVV+NF EIFCTSI PSKN+FRAKVP++P L  R   GGF+SPN
Sbjct  275   ENFRYRYDRRANPYNKGVVQNFKEIFCTSISPSKNNFRAKVPKEPGLPGRSVGGGFISPN  334

Query  970   MGKAVEDIEMGRK-AVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             MGKAVEDIEMGRK A WGDVGA  +H EGQ+ +ND +N+K+ GG                
Sbjct  335   MGKAVEDIEMGRKAAAWGDVGAGPDHCEGQIYNNDSLNIKDNGG----------------  378

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
                  HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  379   ---GVHPRRSSWGRKSGSWEMSPEVLALAARVGEPNRV  413



>ref|XP_002298649.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE83454.1| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/334 (81%), Positives = 298/334 (89%), Gaps = 5/334 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FDG+ + G GQTPQLRLPR+KEVE NG+TVKVKY
Sbjct  96    LVLLLLTSGRDPGIIPRNAHPPEPEGFDGSADVGSGQTPQLRLPRVKEVEFNGMTVKVKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV STTLLCIYVF 
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVLSTTLLCIYVFA  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM +E  + WKAMIKTP+S+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  216   FCWVYIRKIMGSENISTWKAMIKTPSSIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANP+ KG+VENF EIFC+SI PSKN+FRAKVPR+PAL  R   GGF+SPNM
Sbjct  276   NFRYRYDRRANPFYKGLVENFKEIFCSSISPSKNNFRAKVPREPALPTRTLGGGFMSPNM  335

Query  973   GKAVEDIEMGRKAVWGDVGAEHQ-EGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRA  1146
             GKAV DIEMGRK VWGD+ A    EGQ ++ND +N+K+ G LGE+SP+IRTTVDE GDR 
Sbjct  336   GKAVGDIEMGRKTVWGDMSAMADGEGQPANNDRLNIKD-GELGELSPDIRTTVDEVGDRG  394

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
              + HPRRSSWGRKSGSWEMSPEVLALA+RVGE N
Sbjct  395   GL-HPRRSSWGRKSGSWEMSPEVLALAARVGESN  427



>ref|XP_010028971.1| PREDICTED: probable protein S-acyltransferase 7 [Eucalyptus grandis]
 gb|KCW55800.1| hypothetical protein EUGRSUZ_I01621 [Eucalyptus grandis]
Length=440

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/343 (79%), Positives = 299/343 (87%), Gaps = 6/343 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGR PGI+PRNAHPPEP+ FDG+ + G GQTPQLRLPRIKEV+VNGITVK+KY
Sbjct  92    LILLLLTSGRAPGIIPRNAHPPEPEGFDGSTDTGAGQTPQLRLPRIKEVDVNGITVKIKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI+VF 
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIFVFA  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRI  +E T IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  212   FCWVYIRRIAGSEHTNIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYN+GVVENF EIF T IP SKN+FRAK PR+P L  R   GGF+SPNM
Sbjct  272   NFRYRYDRRANPYNRGVVENFKEIFFTGIPVSKNNFRAKFPREPVLPTRSVGGGFMSPNM  331

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV-DEGDR  1143
             GK VEDIEMGRKAVWGD+  G +  EGQL+  D +N+K+ G LGEMSPE+R  V D G+R
Sbjct  332   GKPVEDIEMGRKAVWGDMNSGLDLGEGQLNSTDRLNLKD-GELGEMSPEMRANVEDTGER  390

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             A + HPRRSSWGRKSGSW+MSPE+LAL++RVGE NR   SSS 
Sbjct  391   AGI-HPRRSSWGRKSGSWDMSPEILALSARVGESNRATSSSSA  432



>ref|XP_006599011.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Glycine 
max]
Length=386

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 298/342 (87%), Gaps = 8/342 (2%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKV  426
              VLVLLLLTSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPR KEVEVNGI +KV
Sbjct  42    DVLVLLLLTSGRDPGIIPRNAHPPEPEGLDSNLDVGAGQTPQLRLPRFKEVEVNGIPIKV  101

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV
Sbjct  102   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  161

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F FCWVYI RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTT
Sbjct  162   FAFCWVYIVRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTT  221

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSP  966
             YENFRYRYDRRANPYNKGV+ NF EIFC SI PSKN+FRA VPR+PAL  R   GGF++ 
Sbjct  222   YENFRYRYDRRANPYNKGVLNNFKEIFCISISPSKNNFRAMVPREPALPTRSVGGGFMNQ  281

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQE-GQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             N+GKA EDIEMGRK VW D+GA   + G   ++D V +K+    GE+SPEIRTTVD+ DR
Sbjct  282   NIGKAGEDIEMGRKTVW-DMGAGMDDNGAPINDDRVTIKD----GELSPEIRTTVDDSDR  336

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             A M HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+GG SS
Sbjct  337   AGM-HPRRSSWGRKSGSWEMSPEVLALAARVGEPNRVGGGSS  377



>ref|XP_004148004.1| PREDICTED: probable S-acyltransferase At3g26935-like [Cucumis 
sativus]
 gb|KGN58152.1| hypothetical protein Csa_3G560760 [Cucumis sativus]
Length=450

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/346 (78%), Positives = 304/346 (88%), Gaps = 7/346 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             +LVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G  QTPQLRLPRIKEVEVNGITVK+K
Sbjct  95    ILVLLLLTSGRDPGIIPRNAHPPEPEPFEGSVDTGSAQTPQLRLPRIKEVEVNGITVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  155   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM AEET+IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  215   SFCWVYIRRIMSAEETSIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYNKGV++NF EIFC+SIP SKN+FRA VP++P L   R   GGF+SP
Sbjct  275   ENFRYRYDRRANPYNKGVLDNFKEIFCSSIPASKNNFRATVPKEPVLPPTRLGTGGFMSP  334

Query  967   NMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSD-NDGVNMKEGGGLGEMSPEIRTTVDEG  1137
             N+GK VEDIEMGRK VWGD+  GA+  +GQ    ++ +N+KE G LGE+SP+IR  V+EG
Sbjct  335   NVGKGVEDIEMGRKTVWGDINSGADPFDGQQPQISERLNIKE-GELGEVSPDIRAAVEEG  393

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
                   HPR SSWGRKSGSW+MSPEV+ALA+R GE NR+GGSSS G
Sbjct  394   SERGGLHPRLSSWGRKSGSWDMSPEVVALAARGGE-NRVGGSSSSG  438



>ref|XP_006395501.1| hypothetical protein EUTSA_v10004226mg [Eutrema salsugineum]
 gb|ESQ32787.1| hypothetical protein EUTSA_v10004226mg [Eutrema salsugineum]
Length=443

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/337 (80%), Positives = 301/337 (89%), Gaps = 7/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVEVNGI  KVKY
Sbjct  91    LVLLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVEVNGIIFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I +AE TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITEAEHTTIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA +DIEMGRKAVW D+G   +EH +G+  +N+ +++K+ G LGE+SP+IRTTVDE  D
Sbjct  331   GKANDDIEMGRKAVWADMGPAMSEHGDGKHGNNERLHVKD-GELGELSPDIRTTVDEQSD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R AM HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPAM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>ref|XP_008347994.1| PREDICTED: probable protein S-acyltransferase 7 [Malus domestica]
Length=455

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/349 (79%), Positives = 302/349 (87%), Gaps = 8/349 (2%)
 Frame = +1

Query  220   SSLAN*ESRTQVLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKE  396
             SSL+N  S T  L   +L   R   ++ R  HPPEP+ FDGNIEGG GQTPQLRLPRIKE
Sbjct  96    SSLSN--SHTSYLCKGILYFARKSAMLCRKEHPPEPEGFDGNIEGGAGQTPQLRLPRIKE  153

Query  397   VEVNGITVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV  576
             VEVNGI+VK+KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV
Sbjct  154   VEVNGISVKIKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV  213

Query  577   FSTTLLCIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFH  756
             F+TTLLCIYVF FCWVY+RRIM AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFH
Sbjct  214   FNTTLLCIYVFAFCWVYVRRIMGAEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFH  273

Query  757   LYLISTNQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAA  936
             LYLISTNQTTYENFRYRYDRRANPYNKGVV+NF EIFCT+IP SKN FR KVPR+PAL  
Sbjct  274   LYLISTNQTTYENFRYRYDRRANPYNKGVVDNFKEIFCTAIPESKNHFRDKVPREPALPP  333

Query  937   RHTAGGFVSPNMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSP  1110
             R   GGF+SPNMGKAVEDIEMGRK VWGD+  G ++ EGQ + ND VN+K+ G L E+SP
Sbjct  334   RSGGGGFMSPNMGKAVEDIEMGRKTVWGDMSAGGDNYEGQHNGNDRVNVKD-GELSEVSP  392

Query  1111  EIRTTVDEG-DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             +IRTTVDE  DRA M HPRR+SWGRKSGSWEMSPEVLALA+RVGE NRM
Sbjct  393   DIRTTVDETVDRAGM-HPRRASWGRKSGSWEMSPEVLALAARVGEPNRM  440



>ref|XP_008450142.1| PREDICTED: probable protein S-acyltransferase 7 [Cucumis melo]
Length=450

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/346 (78%), Positives = 305/346 (88%), Gaps = 7/346 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             +LVLLLLTSGRDPGI+PRNAHPPEP+ ++G+++ G  QTPQLRLPRIKEVEVNGITVK+K
Sbjct  95    ILVLLLLTSGRDPGIIPRNAHPPEPEPYEGSVDTGSAQTPQLRLPRIKEVEVNGITVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  155   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM AEET+IW+AMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  215   SFCWVYIRRIMSAEETSIWRAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYNKGV++NF EIFC+SIP SKN+FRA VP++P L   R   GGF+SP
Sbjct  275   ENFRYRYDRRANPYNKGVMDNFKEIFCSSIPASKNNFRATVPKEPVLPPTRLGTGGFMSP  334

Query  967   NMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSD-NDGVNMKEGGGLGEMSPEIRTTVDEG  1137
             N+GK VEDIEMGRK VWGD+  GA+  +GQ    ++ +N+KE G LGE+SP+IR  V+EG
Sbjct  335   NVGKGVEDIEMGRKTVWGDINSGADPFDGQQPQISERLNIKE-GELGEVSPDIRAAVEEG  393

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
             +     HPR SSWGRKSGSW+MSPEV+ALA+R GE NR+GGSSS G
Sbjct  394   NERGGLHPRLSSWGRKSGSWDMSPEVVALAARGGE-NRVGGSSSSG  438



>gb|EYU31851.1| hypothetical protein MIMGU_mgv1a006331mg [Erythranthe guttata]
Length=448

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/346 (82%), Positives = 305/346 (88%), Gaps = 10/346 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LLLLTSGRDPGI+PRNAHPPEP+ +DG+ EG  QTPQLRLPRIKEVEVNG TVK+KYC
Sbjct  96    LILLLLTSGRDPGIIPRNAHPPEPEGYDGSAEGA-QTPQLRLPRIKEVEVNGTTVKIKYC  154

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF+TTLLC+YVFGF
Sbjct  155   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFTTTLLCVYVFGF  214

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYI+RIMD E+ +IWKAMIKTPAS+VLI YTFI+VWFVGGLTAFHLYLISTNQTTYEN
Sbjct  215   CWVYIKRIMDTEDISIWKAMIKTPASIVLIVYTFIAVWFVGGLTAFHLYLISTNQTTYEN  274

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRYRYDRRANPYNKGVV+NF EIF     PSKN FRAKV R+P L  R  AGGFVSPNMG
Sbjct  275   FRYRYDRRANPYNKGVVDNFKEIFYGPTAPSKNKFRAKVAREPVLPTRSVAGGFVSPNMG  334

Query  976   KAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGV-----NMKEGGGLGEMSPEIRTTVDE  1134
             K VEDIEMGRKAVWGDVGA  ++ EGQLSDNDG+     N  +  GLGE SPEIRTTVDE
Sbjct  335   KGVEDIEMGRKAVWGDVGAVLDNTEGQLSDNDGLNNNNNNHNKDSGLGETSPEIRTTVDE  394

Query  1135  GDRAAMHHPrrsswgrksgswEMSPEVLALASRV-GEGNRMGGSSS  1269
             GDRA + HPRRSSWGRKSGSWEMSPEVLALASR+ GE NR  GSSS
Sbjct  395   GDRAGI-HPRRSSWGRKSGSWEMSPEVLALASRMGGEPNRTAGSSS  439



>gb|KEH25651.1| DHHC type zinc finger protein [Medicago truncatula]
Length=439

 Score =   528 bits (1361),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/343 (79%), Positives = 297/343 (87%), Gaps = 7/343 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             V+ LL  TS RDPGI+PRNAHPPEP+  +G +E G GQTPQLRLPRIKEVEVNGI+VKVK
Sbjct  91    VIGLLFSTSARDPGIIPRNAHPPEPEGVEGGLEVGSGQTPQLRLPRIKEVEVNGISVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFS TLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM AEETTIWKAMIK+PAS+VLI YTFI +WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRRIMKAEETTIWKAMIKSPASIVLIIYTFICMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRRANPYNKGV +NF EIF TSIPPSKN+FRAKVP +P L AR   GGF+SP+
Sbjct  271   ENFRYRYDRRANPYNKGVFDNFKEIFFTSIPPSKNNFRAKVPVEPVLPARSVGGGFMSPS  330

Query  970   MGKAVEDIEMGRKAVW-GDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             MGKAV+DIEMGRK VW GD+G+  +H EGQL++   +   + G   E+SPEIRTTVDE  
Sbjct  331   MGKAVDDIEMGRKTVWAGDMGSSIDHCEGQLNNRGAI---KDGEFDELSPEIRTTVDETS  387

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
                  HPRRSSWGRKSGSW+MSPEVLALA+RVGE NR+GGSSS
Sbjct  388   DRVGIHPRRSSWGRKSGSWDMSPEVLALAARVGEPNRVGGSSS  430



>emb|CAN71475.1| hypothetical protein VITISV_038617 [Vitis vinifera]
Length=568

 Score =   533 bits (1373),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/340 (80%), Positives = 300/340 (88%), Gaps = 6/340 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLLLTSGRDPGI+PRNAHPPEP+ +DG+ EG GGQTPQLRLPRIKEVEVNG+TVK+K
Sbjct  210   VLVLLLLTSGRDPGIIPRNAHPPEPEGYDGSAEGVGGQTPQLRLPRIKEVEVNGVTVKIK  269

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLL-CIYV  606
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRN   +   + S  L   IYV
Sbjct  270   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNLSIYSSCLSSRRLFFVIYV  329

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             FGFCWVYI+RIMD+EETTIWKAMIKTPAS+VLI YTFISVWFVGGLTAFHLYLISTNQTT
Sbjct  330   FGFCWVYIKRIMDSEETTIWKAMIKTPASIVLIVYTFISVWFVGGLTAFHLYLISTNQTT  389

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSP  966
             YENFRYRYDRRANPYNKGVV+NF EIFCTSI PSKN+FRAKVP++P L  R   GGF+SP
Sbjct  390   YENFRYRYDRRANPYNKGVVQNFKEIFCTSISPSKNNFRAKVPKEPGLPGRSVGGGFISP  449

Query  967   NMGKAVEDIEMGRK-AVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV-DE  1134
             NMGKAVEDIEMGRK A WGDVGA  +H EGQ+ +ND +N+K+ GGLGE+SP++RTT+ D 
Sbjct  450   NMGKAVEDIEMGRKAAAWGDVGAGPDHCEGQIYNNDSLNIKDNGGLGEISPDVRTTIEDM  509

Query  1135  GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             G+     HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  510   GELGGGVHPRRSSWGRKSGSWEMSPEVLALAARVGEPNRV  549



>ref|XP_010514369.1| PREDICTED: probable protein S-acyltransferase 7 [Camelina sativa]
Length=443

 Score =   528 bits (1359),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 264/337 (78%), Positives = 299/337 (89%), Gaps = 7/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVE+NG+T KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVELNGVTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I D+E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITDSEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC+SIPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSSIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA +DIEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SPEIRTTVDE  D
Sbjct  331   GKANDDIEMGRKAVWADMGPTMSDHDDGKHGNNERLHVKD-GELGELSPEIRTTVDEQSD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R  M HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPGM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>ref|XP_004168841.1| PREDICTED: LOW QUALITY PROTEIN: probable S-acyltransferase At3g26935-like 
[Cucumis sativus]
Length=450

 Score =   528 bits (1359),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 269/346 (78%), Positives = 302/346 (87%), Gaps = 7/346 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             +LVLLLLTSGRDPGI+PRNAHPPEP+ F+G+++ G  QTPQLRLPRIKEVEVNGITVK+K
Sbjct  95    ILVLLLLTSGRDPGIIPRNAHPPEPEPFEGSVDTGSAQTPQLRLPRIKEVEVNGITVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF
Sbjct  155   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIRRIM AEET+IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  215   SFCWVYIRRIMSAEETSIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             E FRYRYDRRANPYNKGV++NF EIFC+SIP SKN+FRA VP++P L   R   GGF+SP
Sbjct  275   EXFRYRYDRRANPYNKGVLDNFKEIFCSSIPASKNNFRATVPKEPVLPPTRLGTGGFMSP  334

Query  967   NMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSD-NDGVNMKEGGGLGEMSPEIRTTVDEG  1137
             N+GK VEDIEMGRK VWGD+  GA+  +GQ    ++ +N+KE G LGE+SP+IR  V+EG
Sbjct  335   NVGKGVEDIEMGRKTVWGDINSGADPFDGQQPQISERLNIKE-GELGEVSPDIRAAVEEG  393

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
                   HPR SSWGRKSGSW+M PEV+ALA+R GE NR+GGSSS G
Sbjct  394   SERGGLHPRLSSWGRKSGSWDMPPEVVALAARGGE-NRVGGSSSSG  438



>ref|XP_010679975.1| PREDICTED: probable protein S-acyltransferase 7 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   526 bits (1354),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 266/333 (80%), Positives = 294/333 (88%), Gaps = 7/333 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDG+ E GGGQTPQLRLPRIKEVEVNG+ VK+KYCDTCML
Sbjct  99    TSGRDPGIIPRNAHPPEPEGFDGSTETGGGQTPQLRLPRIKEVEVNGVPVKIKYCDTCML  158

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFV +TT+LCIYVF FCW+YI
Sbjct  159   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVSTTTILCIYVFSFCWIYI  218

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMDAE+T+IWKAMIKTPASMVLI YTFI+VWFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  219   KRIMDAEDTSIWKAMIKTPASMVLIIYTFIAVWFVGGLTAFHLYLISTNQTTYENFRYRY  278

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVVENF EIFCTSIPPSKNDFRA+VPR+P  +AR    GFVSP+MGK  +D
Sbjct  279   DRRANPYNKGVVENFKEIFCTSIPPSKNDFRAEVPREPLPSARPMGAGFVSPSMGKGTDD  338

Query  991   IEMGRKAVWG---DVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRAAMHH  1158
             IEMGRKA WG     G E  EGQ+SDND +N+K+ G LG+ SP+IR  VDE G+R  + H
Sbjct  339   IEMGRKATWGGEFGPGLEPGEGQVSDNDILNIKD-GRLGQSSPDIRGHVDEIGERGGL-H  396

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMG  1257
             PRRSSWGR+SG+WEMSPEVLALA+RVG  N  G
Sbjct  397   PRRSSWGRQSGNWEMSPEVLALAARVGGSNNTG  429



>ref|XP_010502648.1| PREDICTED: probable protein S-acyltransferase 7 [Camelina sativa]
Length=443

 Score =   525 bits (1353),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/336 (77%), Positives = 296/336 (88%), Gaps = 5/336 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVE+NG+T KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVELNGVTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I D+E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITDSEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC+SIPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSSIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             GKA +DIEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SP+IRTTVDE   
Sbjct  331   GKANDDIEMGRKAVWADMGPTMSDHDDGKHGNNERLHVKD-GELGELSPDIRTTVDEQSD  389

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                 HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPGVHPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>ref|XP_010425430.1| PREDICTED: probable protein S-acyltransferase 7 [Camelina sativa]
Length=443

 Score =   525 bits (1353),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 263/337 (78%), Positives = 299/337 (89%), Gaps = 7/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVE+NG+T KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVELNGVTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I D+E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITDSEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC+SIPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSSIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA +DIEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SP+IRTTVDE  D
Sbjct  331   GKANDDIEMGRKAVWADMGPTMSDHGDGKHGNNERLHVKD-GELGELSPDIRTTVDEQSD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R  M HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPGM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>ref|XP_004515995.1| PREDICTED: probable S-acyltransferase At3g26935-like isoform 
X1 [Cicer arietinum]
Length=440

 Score =   524 bits (1350),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 267/343 (78%), Positives = 289/343 (84%), Gaps = 7/343 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE--GGGQTPQLRLPRIKEVEVNGITVKV  426
             ++VLLL TSGRDPGI+PRNAHPPE    +GN++  G GQTP LRLPRIKEV VNGI VKV
Sbjct  92    IIVLLLSTSGRDPGIIPRNAHPPELDGLEGNLDVVGTGQTPPLRLPRIKEVLVNGIAVKV  151

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV
Sbjct  152   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  211

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F FCWVYIRRIM +EETTIWKAMIK+P S+VLI YTFI +WFVGGLTAFHLYLISTNQTT
Sbjct  212   FAFCWVYIRRIMKSEETTIWKAMIKSPVSIVLIIYTFICMWFVGGLTAFHLYLISTNQTT  271

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSP  966
             YENFRYRYDRR NPYNKGV  NF EIF TSIP SKN+FRAKVP +P L  R   GGF+SP
Sbjct  272   YENFRYRYDRRDNPYNKGVFNNFKEIFFTSIPASKNNFRAKVPMEPVLPTRSVGGGFMSP  331

Query  967   NMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             +MGKAV+DIEMGRKAVWGD+  G +H EGQL+    +   + G  GE+SPEIR TVDE  
Sbjct  332   SMGKAVDDIEMGRKAVWGDIDTGMDHSEGQLNHRAAI---KDGEFGELSPEIRMTVDETS  388

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
                  HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR GG SS
Sbjct  389   DRVGIHPRRSSWGRKSGSWEMSPEVLALAARVGEQNRTGGGSS  431



>gb|KHG28749.1| hypothetical protein F383_11399 [Gossypium arboreum]
Length=443

 Score =   524 bits (1349),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 269/339 (79%), Positives = 295/339 (87%), Gaps = 7/339 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDGN + G GQTP LRLPRIKEVEVNGI+VK+KYCDTCML
Sbjct  101   TSGRDPGIIPRNAHPPEPESFDGNADVGAGQTPPLRLPRIKEVEVNGISVKIKYCDTCML  160

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF F WVYI
Sbjct  161   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFSWVYI  220

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM +E+TTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  221   SRIMASEDTTIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  280

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVV+NF EIFC+SIP SKN+FRAKVPR+P L  R  A GF+SPNMGKA +D
Sbjct  281   DRRANPYNKGVVDNFKEIFCSSIPSSKNNFRAKVPREPVLPTR--ASGFMSPNMGKATDD  338

Query  991   IEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             IEMGRK VW D GA  +  EGQ + ++ VN+KE G LGE+SP+ R+TVD     A  HPR
Sbjct  339   IEMGRKTVWVDNGATTDDCEGQFT-SERVNVKE-GELGELSPDFRSTVDGTGEHASIHPR  396

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             RSSWGR+SG WEMSPEVLALA+RVGE NR+ GSSSG  N
Sbjct  397   RSSWGRRSGQWEMSPEVLALAARVGEPNRVIGSSSGRNN  435



>ref|XP_010528151.1| PREDICTED: probable protein S-acyltransferase 7 [Tarenaya hassleriana]
Length=442

 Score =   523 bits (1348),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/338 (78%), Positives = 300/338 (89%), Gaps = 7/338 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL TSGRDPGI+PRNAHPPEP+  DGN +   GQTPQLRLPR+KEV+VNG T KVKY
Sbjct  91    LILLLFTSGRDPGIIPRNAHPPEPEGLDGNTDTVAGQTPQLRLPRMKEVQVNGFTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E  +IWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKIMESEHISIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NP+NKGVVENF EIFC+ IP SKNDFR+KVPR+P L +R  AGGF+SPNM
Sbjct  271   NFRYRYDRRTNPHNKGVVENFKEIFCSPIPSSKNDFRSKVPREPPLPSRPVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD-EGD  1140
             GKA +DIEMGRKAVW D+G    +H +G+L +N+ +++K+ G LGE+SP+IRTTVD  GD
Sbjct  331   GKANDDIEMGRKAVWADMGPAMGDHDDGKLGNNERLHVKD-GELGELSPDIRTTVDGPGD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             R  M HPRRSSWGRKSGSW+MSPEV+ALA+R+GE N++
Sbjct  390   RMGM-HPRRSSWGRKSGSWDMSPEVMALAARLGEQNQV  426



>ref|XP_006291141.1| hypothetical protein CARUB_v10017257mg [Capsella rubella]
 gb|EOA24039.1| hypothetical protein CARUB_v10017257mg [Capsella rubella]
Length=443

 Score =   522 bits (1345),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 261/337 (77%), Positives = 298/337 (88%), Gaps = 7/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEV++NG+T KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVQLNGVTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I D+E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITDSEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRNNPHNKGVVNNFKETFCSTIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA +DIEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SP+IRTTVDE  D
Sbjct  331   GKANDDIEMGRKAVWADMGPAMSDHGDGKHGNNERLHVKD-GELGELSPDIRTTVDEQSD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R  M HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPGM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>gb|KFK33610.1| hypothetical protein AALP_AA5G036400 [Arabis alpina]
Length=443

 Score =   520 bits (1338),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 261/332 (79%), Positives = 296/332 (89%), Gaps = 7/332 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP   DGN++ G GQTPQLRLPRIKEVEVNGIT KVKY
Sbjct  90    LILLLLTSGRDPGIIPRNAHPPEPDGLDGNMDAGAGQTPQLRLPRIKEVEVNGITFKVKY  149

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI+VF 
Sbjct  150   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIFVFA  209

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  210   FCWVYIRKIMESEHTTIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  269

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGV+ NF E FC++IP SKNDFRA + R+P L  R  AGGF+SPNM
Sbjct  270   NFRYRYDRRSNPHNKGVINNFKETFCSAIPASKNDFRAMIQREPPLPPRSVAGGFMSPNM  329

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA +DIEMGRKAVW D+G   +EH +G+  +N+ +++K+ G LGE+SP+IRTTVDE  D
Sbjct  330   GKANDDIEMGRKAVWADMGPAMSEHGDGKNGNNERLHVKD-GELGELSPDIRTTVDEQSD  388

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRV  1236
             R  M HPRRSSWGRKSGSW+MSPEV+ALA+RV
Sbjct  389   RPGM-HPRRSSWGRKSGSWDMSPEVMALAARV  419



>ref|XP_003549008.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Glycine 
max]
 gb|KHM99247.1| Putative S-acyltransferase [Glycine soja]
Length=434

 Score =   519 bits (1336),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 267/334 (80%), Positives = 291/334 (87%), Gaps = 8/334 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPR KEVEVNGI +KVKYCDTCML
Sbjct  98    TSGRDPGIIPRNAHPPEPEGLDSNLDVGAGQTPQLRLPRFKEVEVNGIPIKVKYCDTCML  157

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  158   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  217

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  218   VRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  277

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGV+ NF EIFC SI PSKN+FRA VPR+PAL  R   GGF++ N+GKA ED
Sbjct  278   DRRANPYNKGVLNNFKEIFCISISPSKNNFRAMVPREPALPTRSVGGGFMNQNIGKAGED  337

Query  991   IEMGRKAVWGDVGAEHQE-GQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrr  1167
             IEMGRK VW D+GA   + G   ++D V +K+    GE+SPEIRTTVD+ DRA M HPRR
Sbjct  338   IEMGRKTVW-DMGAGMDDNGAPINDDRVTIKD----GELSPEIRTTVDDSDRAGM-HPRR  391

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             SSWGRKSGSWEMSPEVLALA+RVGE NR+GG SS
Sbjct  392   SSWGRKSGSWEMSPEVLALAARVGEPNRVGGGSS  425



>ref|NP_850638.1| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q0WQK2.1|ZDHC9_ARATH RecName: Full=Probable protein S-acyltransferase 7; AltName: 
Full=Probable palmitoyltransferase At3g26935; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g26935 [Arabidopsis 
thaliana]
 dbj|BAF00597.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77247.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   519 bits (1336),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 299/337 (89%), Gaps = 7/337 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEV++NGIT KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPETLDGNMDAGAGQTPQLRLPRIKEVQLNGITFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKIMESEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E F ++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFFSTIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA ++IEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SP+IR TVDE  D
Sbjct  331   GKANDEIEMGRKAVWADMGPAMSDHGDGKHGNNERLHVKD-GELGELSPDIRATVDEQSD  389

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R +M HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  390   RPSM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  425



>ref|XP_007161696.1| hypothetical protein PHAVU_001G090700g [Phaseolus vulgaris]
 gb|ESW33690.1| hypothetical protein PHAVU_001G090700g [Phaseolus vulgaris]
Length=435

 Score =   517 bits (1331),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 266/337 (79%), Positives = 288/337 (85%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+  D N++   GQTPQLRLPR KEVEVNGI +KVKYCDTCML
Sbjct  98    TSGRDPGIIPRNAHPPEPEGLDSNLDVSAGQTPQLRLPRFKEVEVNGIPIKVKYCDTCML  157

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  158   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  217

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM AEETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  218   IRIMAAEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  277

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGV+ NF EIFC SIP SKN FRA VP++PAL  R   G +++ NMGK  ED
Sbjct  278   DRRANPYNKGVLNNFKEIFCISIPLSKNKFRATVPKEPALPTRSVGGSYMNQNMGKVGED  337

Query  991   IEMGRKAVWG-DVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrr  1167
             IEMGRK VW    G +  E  LS ND VN+K+    GE+SPE+RTTVD+ DRA M HPRR
Sbjct  338   IEMGRKTVWEMGAGIDDSEAGLS-NDRVNVKD----GELSPEMRTTVDDTDRAGM-HPRR  391

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             SSWGRKSGSWEMSPEVLALA+RVGE NR+GG+SS  L
Sbjct  392   SSWGRKSGSWEMSPEVLALAARVGEPNRVGGNSSSSL  428



>ref|XP_010556303.1| PREDICTED: probable protein S-acyltransferase 7 [Tarenaya hassleriana]
Length=446

 Score =   516 bits (1330),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 255/339 (75%), Positives = 294/339 (87%), Gaps = 7/339 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPG++PRN HPPEP+  DGN + G GQTPQLRLPRIKEVEVNG+T KVKY
Sbjct  91    LILLLLTSGRDPGVIPRNVHPPEPESIDGNTDTGAGQTPQLRLPRIKEVEVNGVTFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I  +E T+IWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITVSEHTSIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+R NP+NKGV ENF EIFC+ IPPSKN+FRAKV R+  L +R   GGF+SPNM
Sbjct  271   NFRYRYDQRTNPHNKGVAENFKEIFCSPIPPSKNNFRAKVQRETPLPSRPVGGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG--  1137
             GKA +DIEMGRKAVW D+G    EH +G+L +N+ +++K+ G LGE+SP+IR TV +G  
Sbjct  331   GKANDDIEMGRKAVWADMGPAMGEHGDGKLGNNERLHVKD-GELGELSPDIRNTVTDGPS  389

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             DR  + HPRRSSWGR S SW+MSPEV ALA+R+G+ N++
Sbjct  390   DRTGIMHPRRSSWGRNSRSWDMSPEVTALAARIGDQNQV  428



>ref|XP_004492999.1| PREDICTED: probable S-acyltransferase At3g26935-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   514 bits (1325),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 268/342 (78%), Positives = 293/342 (86%), Gaps = 16/342 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FD N + G GQTPQLRLPRIKEVEVNG+ VKVKY
Sbjct  92    LVLLLLTSGRDPGIIPRNAHPPEPEGFDSNADVGSGQTPQLRLPRIKEVEVNGVAVKVKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPW       RNYRFFFMFVFSTT+LC+YVF 
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPW-------RNYRFFFMFVFSTTVLCVYVFA  204

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  205   FCWVYIRRIMGSEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  264

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVV NF EIFC SIP SKNDFRA VP +PAL AR   GGF++  +
Sbjct  265   NFRYRYDRRANPYNKGVVNNFKEIFCISIPSSKNDFRAMVPNEPALPARSVGGGFMNQTL  324

Query  973   GKAVEDIEMGRKAVWG-DVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG-DRA  1146
             GK  +DIEMGRKAVW  + G +  + QL +ND V++K+    GE+SPEIRTTVD+  DRA
Sbjct  325   GKPTDDIEMGRKAVWEMNAGMDDSDNQL-NNDRVSIKD----GELSPEIRTTVDDTVDRA  379

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG-GSSS  1269
              MHHPRRSSWGRKSGSWEMSPEVLALA+RVGE NR G G+SS
Sbjct  380   GMHHPRRSSWGRKSGSWEMSPEVLALAARVGEANRAGEGNSS  421



>ref|XP_006604174.1| PREDICTED: probable protein S-acyltransferase 7-like isoform 
X2 [Glycine max]
Length=368

 Score =   509 bits (1312),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 264/330 (80%), Positives = 288/330 (87%), Gaps = 10/330 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPR KEVEVNGI VKVKYCDTCML
Sbjct  30    TSGRDPGIIPRNAHPPEPEGLDSNLDVGAGQTPQLRLPRFKEVEVNGIPVKVKYCDTCML  89

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  90    YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  149

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  150   VRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  209

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYN+GV+ NF EIFC SIP SKN+FRA VPR+PAL  R   GGF++ NM KA ED
Sbjct  210   DRRANPYNEGVLNNFKEIFCISIPLSKNNFRAMVPREPALPTRSVGGGFMNQNMRKAGED  269

Query  991   IEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             IEMGRK VW D+GA  +  E Q+ +N+ V +K+    GE+SPEIRTTVD+ DRA M HPR
Sbjct  270   IEMGRKTVW-DMGAGIDDTEAQI-NNERVTIKD----GELSPEIRTTVDDSDRAGM-HPR  322

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRM  1254
             RSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  323   RSSWGRKSGSWEMSPEVLALAARVGEPNRV  352



>emb|CDY34198.1| BnaA02g28420D [Brassica napus]
Length=445

 Score =   512 bits (1319),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 258/333 (77%), Positives = 296/333 (89%), Gaps = 8/333 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFD-GNIEGG-GQTPQLRLPRIKEVEVNGITVKVK  429
             L+LLLLTSGRDPGI+PRNAHPPEP+  D  N++ G GQTPQLRLPRIKEVEV+G+T KVK
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEPLDNSNVDAGAGQTPQLRLPRIKEVEVDGVTFKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIG RNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGRRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIR+I ++E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRKITESEHTTIWKAMLKTPASIVLILYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPN
Sbjct  271   ENFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRAMVHREPPLPPRSVAGGFMSPN  330

Query  970   MGKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-G  1137
             MGKA +DIEMGRKAVW D+G   +EH +G+  +N+ +++K+ G LGE+SP++RTTVDE  
Sbjct  331   MGKASDDIEMGRKAVWADMGSAMSEHGDGKDGNNERLHVKD-GELGELSPDVRTTVDEQS  389

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRV  1236
             DR +M HPRRSSWGRKSGSW+MSPEV+ALA+RV
Sbjct  390   DRPSM-HPRRSSWGRKSGSWDMSPEVMALAARV  421



>ref|XP_002877006.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53265.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   512 bits (1318),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/336 (76%), Positives = 295/336 (88%), Gaps = 6/336 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVE+NGIT KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVELNGITFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLLCIYVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E TT WKAM+KTPAS+VLI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  211   FCWVYIRKIMESEHTTTWKAMLKTPASIVLIIYTFISMWFVGGLTVFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E F ++IPPSKN+FRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFFSTIPPSKNNFRAMVQREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDR  1143
             GKA ++IEMGRKAVW D+G   ++H +G+   N+ +++K+ G LGE+SP+IRTTVDE   
Sbjct  331   GKANDEIEMGRKAVWADMGPAMSDHGDGK-HGNERLHVKD-GELGELSPDIRTTVDEQSD  388

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                 HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  389   RPGIHPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  424



>emb|CDY52410.1| BnaC07g49090D [Brassica napus]
Length=439

 Score =   510 bits (1314),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 256/329 (78%), Positives = 288/329 (88%), Gaps = 3/329 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL+TSG+DPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEVEVNGIT KVKY
Sbjct  90    LILLLVTSGKDPGIIPRNAHPPEPEALDGNMDAGAGQTPQLRLPRIKEVEVNGITFKVKY  149

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  
Sbjct  150   CDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHA  209

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I D+E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  210   FCWVYIRKITDSEHTTIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  269

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  270   NFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRALVHREPPLPPRSVAGGFMSPNM  329

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIEMGRKAVW D+G    E   ++N+ +++K+ G LGE+SP +RTTVDE      
Sbjct  330   GKANDDIEMGRKAVWADMGPAMSE-HGTNNERLHVKD-GELGELSPVVRTTVDEQSDRPG  387

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVG  1239
              HPRRSSWGRKSGSW+MSPEV+ALA RVG
Sbjct  388   VHPRRSSWGRKSGSWDMSPEVMALAGRVG  416



>ref|XP_003553969.1| PREDICTED: probable protein S-acyltransferase 7-like isoform 
X1 [Glycine max]
Length=436

 Score =   510 bits (1313),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 264/330 (80%), Positives = 288/330 (87%), Gaps = 10/330 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPR KEVEVNGI VKVKYCDTCML
Sbjct  98    TSGRDPGIIPRNAHPPEPEGLDSNLDVGAGQTPQLRLPRFKEVEVNGIPVKVKYCDTCML  157

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  158   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  217

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  218   VRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  277

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYN+GV+ NF EIFC SIP SKN+FRA VPR+PAL  R   GGF++ NM KA ED
Sbjct  278   DRRANPYNEGVLNNFKEIFCISIPLSKNNFRAMVPREPALPTRSVGGGFMNQNMRKAGED  337

Query  991   IEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             IEMGRK VW D+GA  +  E Q+ +N+ V +K+    GE+SPEIRTTVD+ DRA M HPR
Sbjct  338   IEMGRKTVW-DMGAGIDDTEAQI-NNERVTIKD----GELSPEIRTTVDDSDRAGM-HPR  390

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRM  1254
             RSSWGRKSGSWEMSPEVLALA+RVGE NR+
Sbjct  391   RSSWGRKSGSWEMSPEVLALAARVGEPNRV  420



>emb|CDY13668.1| BnaA06g32550D [Brassica napus]
Length=439

 Score =   509 bits (1311),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 289/329 (88%), Gaps = 4/329 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL+TSG+DPGI+PRNAHPPEP+ F+GN++ G GQTPQLRLPRIKEVEVNGIT KVKY
Sbjct  91    LILLLVTSGKDPGIIPRNAHPPEPEAFEGNMDAGAGQTPQLRLPRIKEVEVNGITFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I ++E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITESEHTTIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRALVHREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIEMGRKAVW D+G    E    +N+ +++K+ G LGE+SP++RTTVDE      
Sbjct  331   GKANDDIEMGRKAVWADMGPAMSEH--GNNERLHVKD-GELGELSPDVRTTVDEQRDRPG  387

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVG  1239
              HPRRSSWGRKSGSW+MSPEV+ALA RVG
Sbjct  388   VHPRRSSWGRKSGSWDMSPEVMALAGRVG  416



>ref|XP_009152005.1| PREDICTED: probable protein S-acyltransferase 7 [Brassica rapa]
Length=439

 Score =   509 bits (1311),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 289/329 (88%), Gaps = 4/329 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL+TSG+DPGI+PRNAHPPEP+ F+GN++ G GQTPQLRLPRIKEVEVNGIT KVKY
Sbjct  91    LILLLVTSGKDPGIIPRNAHPPEPEAFEGNMDAGAGQTPQLRLPRIKEVEVNGITFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+I ++E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKITESEHTTIWKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRALVHREPPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIEMGRKAVW D+G    E    +N+ +++K+ G LGE+SP++RTTVDE      
Sbjct  331   GKANDDIEMGRKAVWADMGPAMSEH--GNNERLHVKD-GELGELSPDVRTTVDEQRDRPG  387

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVG  1239
              HPRRSSWGRKSGSW+MSPEV+ALA RVG
Sbjct  388   VHPRRSSWGRKSGSWDMSPEVMALAGRVG  416



>ref|XP_010250598.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Nelumbo 
nucifera]
Length=426

 Score =   508 bits (1308),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 257/336 (76%), Positives = 289/336 (86%), Gaps = 6/336 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ +D + E GGGQTPQLRLPR+K+V VNGITVK+KYCDTCML
Sbjct  75    TSGRDPGIIPRNAHPPEPEGYDASAEVGGGQTPQLRLPRMKDVVVNGITVKIKYCDTCML  134

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRP RCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI
Sbjct  135   YRPTRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  194

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMDAE T+IWKAM KTPAS+VLI YTF+SVWFVGGLT FHLYLISTNQTTYENFRYRY
Sbjct  195   KRIMDAENTSIWKAMSKTPASIVLIIYTFVSVWFVGGLTVFHLYLISTNQTTYENFRYRY  254

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVVENF EIFCTSIPPSKN FRA+VP++P L  R   GGF+SPNMGKAV D
Sbjct  255   DRRANPYNKGVVENFKEIFCTSIPPSKNKFRARVPQEPCLPPRSVGGGFISPNMGKAVGD  314

Query  991   IEMGRKAVWGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRAAMHH  1158
             IEMGRKA W +  VG    EG LS++D +++K+   LG++SP++ T +  +  D  A  +
Sbjct  315   IEMGRKATWAESGVGIGDFEGPLSNDDALDIKD-RELGDISPDLSTAIPAESMDSRAGTN  373

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
              RRSSWGRKSGSWE+SPEVLALA+ VGE NR+G  S
Sbjct  374   NRRSSWGRKSGSWEISPEVLALAAGVGESNRVGNDS  409



>ref|XP_009129462.1| PREDICTED: probable protein S-acyltransferase 7 [Brassica rapa]
Length=446

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/334 (77%), Positives = 294/334 (88%), Gaps = 9/334 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFD-GNIEGG-GQTPQLRLPRIKEVEVNGITVKVK  429
             L+LLLLTSGRDPGI+PRNAHPPEP+  D  N++ G GQTPQLRLPRIKEVEV+G+T KVK
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEPLDNSNVDAGAGQTPQLRLPRIKEVEVDGVTFKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIG RNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGRRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIR+I ++E TTIWKAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRKITESEHTTIWKAMLKTPASIVLILYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  AGGF+SPN
Sbjct  271   ENFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRAMVHREPPLPPRSVAGGFMSPN  330

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQE----GQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-  1134
             MGKA +DIEMGRKAVW D+G+   E    G+  +N+ +++K+ G LGE+SP++RTTVDE 
Sbjct  331   MGKASDDIEMGRKAVWADMGSAMSEHGGDGKDGNNERLHVKD-GELGELSPDVRTTVDEQ  389

Query  1135  GDRAAMHHPrrsswgrksgswEMSPEVLALASRV  1236
              DR +M HPRRSSWGRKSGSW+MSPEV+ALA+RV
Sbjct  390   SDRPSM-HPRRSSWGRKSGSWDMSPEVMALAARV  422



>ref|XP_010250597.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   507 bits (1306),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 257/336 (76%), Positives = 289/336 (86%), Gaps = 6/336 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ +D + E GGGQTPQLRLPR+K+V VNGITVK+KYCDTCML
Sbjct  105   TSGRDPGIIPRNAHPPEPEGYDASAEVGGGQTPQLRLPRMKDVVVNGITVKIKYCDTCML  164

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRP RCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI
Sbjct  165   YRPTRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  224

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMDAE T+IWKAM KTPAS+VLI YTF+SVWFVGGLT FHLYLISTNQTTYENFRYRY
Sbjct  225   KRIMDAENTSIWKAMSKTPASIVLIIYTFVSVWFVGGLTVFHLYLISTNQTTYENFRYRY  284

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYNKGVVENF EIFCTSIPPSKN FRA+VP++P L  R   GGF+SPNMGKAV D
Sbjct  285   DRRANPYNKGVVENFKEIFCTSIPPSKNKFRARVPQEPCLPPRSVGGGFISPNMGKAVGD  344

Query  991   IEMGRKAVWGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRAAMHH  1158
             IEMGRKA W +  VG    EG LS++D +++K+   LG++SP++ T +  +  D  A  +
Sbjct  345   IEMGRKATWAESGVGIGDFEGPLSNDDALDIKD-RELGDISPDLSTAIPAESMDSRAGTN  403

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
              RRSSWGRKSGSWE+SPEVLALA+ VGE NR+G  S
Sbjct  404   NRRSSWGRKSGSWEISPEVLALAAGVGESNRVGNDS  439



>ref|XP_004515996.1| PREDICTED: probable S-acyltransferase At3g26935-like isoform 
X2 [Cicer arietinum]
Length=433

 Score =   503 bits (1294),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 282/344 (82%), Gaps = 14/344 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE--GGGQTPQLRLPRIKEVEVNGITVKV  426
             ++VLLL TSGRDPGI+PRNAHPPE    +GN++  G GQTP LRLPRIKEV VNGI VKV
Sbjct  92    IIVLLLSTSGRDPGIIPRNAHPPELDGLEGNLDVVGTGQTPPLRLPRIKEVLVNGIAVKV  151

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPW       RNYRFFFMFVFSTTLLCIYV
Sbjct  152   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPW-------RNYRFFFMFVFSTTLLCIYV  204

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F FCWVYIRRIM +EETTIWKAMIK+P S+VLI YTFI +WFVGGLTAFHLYLISTNQTT
Sbjct  205   FAFCWVYIRRIMKSEETTIWKAMIKSPVSIVLIIYTFICMWFVGGLTAFHLYLISTNQTT  264

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSP  966
             YENFRYRYDRR NPYNKGV  NF EIF TSIP SKN+FRAKVP +P L  R   GGF+SP
Sbjct  265   YENFRYRYDRRDNPYNKGVFNNFKEIFFTSIPASKNNFRAKVPMEPVLPTRSVGGGFMSP  324

Query  967   NMGKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             +MGKAV+DIEMGRKAVWGD+  G +H EGQL+    +   + G  GE+SPEIR TVDE  
Sbjct  325   SMGKAVDDIEMGRKAVWGDIDTGMDHSEGQLNHRAAI---KDGEFGELSPEIRMTVDETS  381

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
                  HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR GG SS 
Sbjct  382   DRVGIHPRRSSWGRKSGSWEMSPEVLALAARVGEQNRTGGGSSS  425



>ref|XP_009111543.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Brassica 
rapa]
Length=438

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 291/334 (87%), Gaps = 6/334 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             ++LLLLTSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPRIKEVE+NG+  KVKY
Sbjct  91    IILLLLTSGRDPGIIPRNAHPPEPEPLDINMDAGAGQTPQLRLPRIKEVELNGVIFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMF+FSTTLLC+YVF 
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFIFSTTLLCVYVFA  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E TTIWKAM+KTPAS+VLI YTFI++WFV GLTAFHLYLISTNQTTYE
Sbjct  211   FCWVYIRKIMESEHTTIWKAMLKTPASIVLIVYTFIAMWFVAGLTAFHLYLISTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF+E F ++IPPSKNDFRA V R+  L  R  AGGF+SPNM
Sbjct  271   NFRYRYDRRSNPHNKGVVNNFIETFSSAIPPSKNDFRAMVHREGPLPPRSVAGGFMSPNM  330

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRAA  1149
             GKA +DIEMGRKAVW D+G+EH + +  +++ +++++ G LGE+SP++RTTVDE  DR  
Sbjct  331   GKANDDIEMGRKAVWADMGSEHGDAKNGNDERLHVRD-GELGELSPDVRTTVDEQSDRPG  389

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                   SSWGRKSGSW+MSPEV+ALA+RV E N+
Sbjct  390   TRR---SSWGRKSGSWDMSPEVMALAARVVEQNQ  420



>ref|XP_009111542.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Brassica 
rapa]
Length=446

 Score =   503 bits (1294),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 291/334 (87%), Gaps = 6/334 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             ++LLLLTSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPRIKEVE+NG+  KVKY
Sbjct  99    IILLLLTSGRDPGIIPRNAHPPEPEPLDINMDAGAGQTPQLRLPRIKEVELNGVIFKVKY  158

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMF+FSTTLLC+YVF 
Sbjct  159   CDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFIFSTTLLCVYVFA  218

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IM++E TTIWKAM+KTPAS+VLI YTFI++WFV GLTAFHLYLISTNQTTYE
Sbjct  219   FCWVYIRKIMESEHTTIWKAMLKTPASIVLIVYTFIAMWFVAGLTAFHLYLISTNQTTYE  278

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR+NP+NKGVV NF+E F ++IPPSKNDFRA V R+  L  R  AGGF+SPNM
Sbjct  279   NFRYRYDRRSNPHNKGVVNNFIETFSSAIPPSKNDFRAMVHREGPLPPRSVAGGFMSPNM  338

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRAA  1149
             GKA +DIEMGRKAVW D+G+EH + +  +++ +++++ G LGE+SP++RTTVDE  DR  
Sbjct  339   GKANDDIEMGRKAVWADMGSEHGDAKNGNDERLHVRD-GELGELSPDVRTTVDEQSDRPG  397

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                   SSWGRKSGSW+MSPEV+ALA+RV E N+
Sbjct  398   TRR---SSWGRKSGSWDMSPEVMALAARVVEQNQ  428



>emb|CDY28510.1| BnaC02g36500D [Brassica napus]
Length=447

 Score =   499 bits (1286),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 256/336 (76%), Positives = 293/336 (87%), Gaps = 10/336 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDG-NIEGG-GQTPQLRLPRIKEVEVNGITVKVK  429
             L+LLLLTSGRDPGI+PRNAHPPEP+  D  N++ G GQTPQLRLPRIKEVEV+G+T KVK
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPEPLDSSNVDAGAGQTPQLRLPRIKEVEVDGVTFKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIG RNYRFFFMFVFSTTLLCIYVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGRRNYRFFFMFVFSTTLLCIYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIR+I ++E  TI KAM+KTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRKITESEHITILKAMLKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTA-GGFVSP  966
             ENFRYRYDRR+NP+NKGVV NF E FC++IPPSKNDFRA V R+P L  R  A GGF+SP
Sbjct  271   ENFRYRYDRRSNPHNKGVVNNFKETFCSAIPPSKNDFRAMVHREPPLPPRSVAGGGFMSP  330

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQE----GQLSDNDGVNMKEGGGLGEMSPEIRTTVDE  1134
             NMGKA +DIEMGRKAVW D+G+   E    G+  +N+ +++K+ G LGE+SP++RTTVDE
Sbjct  331   NMGKASDDIEMGRKAVWADMGSAMSEHGGDGKDGNNERLHVKD-GELGELSPDVRTTVDE  389

Query  1135  -GDRAAMHHPrrsswgrksgswEMSPEVLALASRVG  1239
               DR +M HPRRSSWGRKSGSW+MSPEV+ALA+RVG
Sbjct  390   QSDRPSM-HPRRSSWGRKSGSWDMSPEVMALAARVG  424



>emb|CDY12251.1| BnaA09g24510D [Brassica napus]
Length=430

 Score =   499 bits (1284),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 291/335 (87%), Gaps = 7/335 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDG-NIEGG-GQTPQLRLPRIKEVEVNGITVKVK  429
             ++LLLLTSGRDPGI+PRNAHPPEP+  D  N++ G GQTPQLRLPRIKEVE+NG+  KVK
Sbjct  82    IILLLLTSGRDPGIIPRNAHPPEPEPLDSSNMDAGAGQTPQLRLPRIKEVELNGVIFKVK  141

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMF+FSTTLLC+YVF
Sbjct  142   YCDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFIFSTTLLCVYVF  201

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIR+IM++E TTIWKAM+KTPAS+VLI YTFI++WFV GLTAFHLYLISTNQTTY
Sbjct  202   AFCWVYIRKIMESEHTTIWKAMLKTPASIVLIVYTFIAMWFVAGLTAFHLYLISTNQTTY  261

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR+NP+NKGVV NF+E F ++IPPSKNDFRA V R+  L  R  AGGF+SPN
Sbjct  262   ENFRYRYDRRSNPHNKGVVNNFIETFSSAIPPSKNDFRAMVHREGPLPPRSVAGGFMSPN  321

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRA  1146
             MGKA +DIEMGRKAVW D+G+EH + +  +++ +++++ G LGE+SP++RTTVDE  DR 
Sbjct  322   MGKANDDIEMGRKAVWADMGSEHGDAKNGNDERLHVRD-GELGELSPDVRTTVDEQSDRP  380

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                    SSWGRKSGSW+MSPEV+ALA+RV E N+
Sbjct  381   GTRR---SSWGRKSGSWDMSPEVMALAARVVEQNQ  412



>gb|KHN28546.1| Putative S-acyltransferase [Glycine soja]
Length=426

 Score =   498 bits (1283),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 256/325 (79%), Positives = 279/325 (86%), Gaps = 8/325 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+  D N++ G GQTPQLRLPR KEVEVNGI VKVKYCDTCML
Sbjct  98    TSGRDPGIIPRNAHPPEPEGLDSNLDVGAGQTPQLRLPRFKEVEVNGIPVKVKYCDTCML  157

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWVYI
Sbjct  158   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWVYI  217

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRYRY
Sbjct  218   VRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRY  277

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYN+GV+ NF EIFC SIP SKN+FRA VPR+PAL  R   GGF++ NMGKA ED
Sbjct  278   DRRANPYNEGVLNNFKEIFCISIPLSKNNFRAMVPREPALPTRSVGGGFMNQNMGKAGED  337

Query  991   IEMGRKAVWGDVGAEHQE-GQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrr  1167
             IEMGRK VW D+GA   + G   ++D V +K+    GE+SPEIRTTVD+ D A M HP +
Sbjct  338   IEMGRKTVW-DMGAGMDDNGAPINDDRVTIKD----GELSPEIRTTVDDSDHAGM-HPTQ  391

Query  1168  sswgrksgswEMSPEVLALASRVGE  1242
             SSWGRKSGSWEMS EVLAL +RVG 
Sbjct  392   SSWGRKSGSWEMSLEVLALIARVGN  416



>emb|CDY00176.1| BnaC09g01250D [Brassica napus]
Length=439

 Score =   498 bits (1283),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 247/335 (74%), Positives = 289/335 (86%), Gaps = 7/335 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDG-NIEGG-GQTPQLRLPRIKEVEVNGITVKVK  429
             ++LLLLTSGRDPGI+PRNAHPPEP+  D  N++ G GQTPQLRLPRIKEVEVNG+  KVK
Sbjct  91    IILLLLTSGRDPGIIPRNAHPPEPEPLDSSNMDAGAGQTPQLRLPRIKEVEVNGVIFKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMF+FSTTLLC+YVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFIFSTTLLCVYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYIR+IM++E TTIWKAM+KTPAS+VLI YTFI++WFV GLTAFHLYLISTNQTTY
Sbjct  211   AFCWVYIRKIMESEHTTIWKAMLKTPASIVLIVYTFIAMWFVAGLTAFHLYLISTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDRR+NP+NKGVV NF E F ++IPPSKNDFRA V R+  L  R  AGGF+SPN
Sbjct  271   ENFRYRYDRRSNPHNKGVVNNFRETFTSAIPPSKNDFRAMVHREGPLPPRSVAGGFMSPN  330

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRA  1146
             MGKA +DIEMGRKAVW D+G+EH + +   ++ +++++ G LGE+SP++RTTVDE  DR 
Sbjct  331   MGKANDDIEMGRKAVWADMGSEHGDAKNGTDERLHVRD-GELGELSPDVRTTVDEQSDRL  389

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
                    SSWGRKSGSW+MSPEV+ALA+RV E N+
Sbjct  390   GTRR---SSWGRKSGSWDMSPEVMALAARVVEQNQ  421



>ref|XP_010249127.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Nelumbo 
nucifera]
Length=429

 Score =   493 bits (1270),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 261/336 (78%), Positives = 283/336 (84%), Gaps = 6/336 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRNAHPPEP+ +DG+ E GGQTPQLRLPR+K+V VNGITVK+KYCDTCMLY
Sbjct  78    TSGRDPGIIPRNAHPPEPEGYDGSSEVGGQTPQLRLPRMKDVVVNGITVKIKYCDTCMLY  137

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI 
Sbjct  138   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIT  197

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMDAEETTIWKAM KTPAS+VLI YTFISVWFVGGLT FHLYLISTNQTTYENFRYRYD
Sbjct  198   RIMDAEETTIWKAMTKTPASIVLIIYTFISVWFVGGLTVFHLYLISTNQTTYENFRYRYD  257

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPYNKGV ENF EIFCTSIP SKN FRA+V R+P L  R   GGF+SPNMGKAV DI
Sbjct  258   RRANPYNKGVAENFKEIFCTSIPLSKNKFRARVQREPVLPPRTVGGGFISPNMGKAVGDI  317

Query  994   EMGRKAVWGDVGAEHQ--EGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDRA-AMHHP  1161
             EMGRK  WG+ GAE    EGQ S ND     + GG  + SP++ R    +G +  A  HP
Sbjct  318   EMGRKPTWGEAGAESGDFEGQHS-NDDGGDNKDGGFDDASPDLSRAYPADGTKGRAGVHP  376

Query  1162  rrsswgrksgswEMSP-EVLALASRVGEGNRMGGSS  1266
             RRSSWGRKSGSWE+SP EVLA+A+ VGE NR+G  S
Sbjct  377   RRSSWGRKSGSWEISPEEVLAMAAGVGESNRVGSGS  412



>ref|XP_010249126.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Nelumbo 
nucifera]
Length=455

 Score =   493 bits (1269),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 261/336 (78%), Positives = 283/336 (84%), Gaps = 6/336 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRNAHPPEP+ +DG+ E GGQTPQLRLPR+K+V VNGITVK+KYCDTCMLY
Sbjct  104   TSGRDPGIIPRNAHPPEPEGYDGSSEVGGQTPQLRLPRMKDVVVNGITVKIKYCDTCMLY  163

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI 
Sbjct  164   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIT  223

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMDAEETTIWKAM KTPAS+VLI YTFISVWFVGGLT FHLYLISTNQTTYENFRYRYD
Sbjct  224   RIMDAEETTIWKAMTKTPASIVLIIYTFISVWFVGGLTVFHLYLISTNQTTYENFRYRYD  283

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPYNKGV ENF EIFCTSIP SKN FRA+V R+P L  R   GGF+SPNMGKAV DI
Sbjct  284   RRANPYNKGVAENFKEIFCTSIPLSKNKFRARVQREPVLPPRTVGGGFISPNMGKAVGDI  343

Query  994   EMGRKAVWGDVGAEHQ--EGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDRA-AMHHP  1161
             EMGRK  WG+ GAE    EGQ S ND     + GG  + SP++ R    +G +  A  HP
Sbjct  344   EMGRKPTWGEAGAESGDFEGQHS-NDDGGDNKDGGFDDASPDLSRAYPADGTKGRAGVHP  402

Query  1162  rrsswgrksgswEMSP-EVLALASRVGEGNRMGGSS  1266
             RRSSWGRKSGSWE+SP EVLA+A+ VGE NR+G  S
Sbjct  403   RRSSWGRKSGSWEISPEEVLAMAAGVGESNRVGSGS  438



>emb|CAN81512.1| hypothetical protein VITISV_001671 [Vitis vinifera]
Length=500

 Score =   493 bits (1269),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 253/344 (74%), Positives = 286/344 (83%), Gaps = 8/344 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +LVLLLLTSGRDPGI+PRNAHPPEP+ +DG   G GQTPQLRLPR K+V VNGITVKVKY
Sbjct  149   ILVLLLLTSGRDPGIIPRNAHPPEPEGYDGTEVGAGQTPQLRLPRTKDVVVNGITVKVKY  208

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YVFG
Sbjct  209   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCVYVFG  268

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI RIMD +ETTIWKAM KTPAS+VLI YTF++VWFVGGL+ FHLYLISTNQ+TYE
Sbjct  269   FCWVYIMRIMDGKETTIWKAMAKTPASIVLIVYTFVAVWFVGGLSVFHLYLISTNQSTYE  328

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGV+ENFMEIFCTSIP SKN+FRAKVP++P + AR   GGFVSP +
Sbjct  329   NFRYRYDRRANPYNKGVIENFMEIFCTSIPSSKNNFRAKVPKEPEIPARTVGGGFVSPIL  388

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEG--QLSDNDGVNMKEGGGLGEMSP-EIRTTVDEGDR  1143
             GK   DIEMGRK  W +  AE  E   QLS++DGV+  + G   ++SP   R    EG  
Sbjct  389   GKDAADIEMGRKPFWDEAAAEAGEYERQLSNDDGVD--KDGEFTDVSPYSSRALHAEGTE  446

Query  1144  --AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
                A+HH RRSSWGR SGSW++SPEV+A+ + VG  NR+ G S+
Sbjct  447   GPGALHH-RRSSWGRASGSWDISPEVIAMVAEVGSANRVSGGST  489



>ref|XP_007038080.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY22581.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=388

 Score =   488 bits (1257),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 249/346 (72%), Positives = 283/346 (82%), Gaps = 12/346 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +VLLLLTSGRDPGI+PRN+HPPEP+ ++G  E   GQTP LRLPR K+V VNGI+VK+KY
Sbjct  35    IVLLLLTSGRDPGIIPRNSHPPEPEGYEGISEFRPGQTPPLRLPRTKDVVVNGISVKIKY  94

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV G
Sbjct  95    CDTCMLYRPPRCSHCSICNNCVDRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCLYVHG  154

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRIMD EETTIWKAM KTPAS+VL+ YTFISVWFVGGLT FHLYLISTNQ+TYE
Sbjct  155   FCWVYIRRIMDGEETTIWKAMTKTPASIVLLVYTFISVWFVGGLTVFHLYLISTNQSTYE  214

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD R NPYNKGV+ENF EIFCTSIPPSK +FRAK+P++PA++ R  +GGF+SPN 
Sbjct  215   NFRYRYDCRENPYNKGVIENFTEIFCTSIPPSKTNFRAKIPKEPAISPRTVSGGFISPNK  274

Query  973   GKAVEDIEMGRKAVWGDVGAE--HQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD----E  1134
             GKAV DIEMGRK VW +   E    EGQLS   G  M +  GL ++SP++   +     E
Sbjct  275   GKAVGDIEMGRKPVWDEALGEAGDHEGQLS---GDGMDKDSGLPDVSPDLSRILPPESIE  331

Query  1135  GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             G R  M+HPRRSSWGR S  WE+SPE+L L SRVGE  RM G S+ 
Sbjct  332   G-RGVMNHPRRSSWGRNSEKWEISPEILPL-SRVGESKRMNGRSNA  375



>gb|EPS65996.1| hypothetical protein M569_08778, partial [Genlisea aurea]
Length=414

 Score =   484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 245/332 (74%), Positives = 279/332 (84%), Gaps = 19/332 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             LVLLLLTSGRDPGI+PRNAHPPEP+ +DGN+EG  QTPQLRLPRIKEV+VNG TVK+KYC
Sbjct  96    LVLLLLTSGRDPGIIPRNAHPPEPESYDGNVEGA-QTPQLRLPRIKEVDVNGTTVKIKYC  154

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYR+FFMFV STT+LC+YVFGF
Sbjct  155   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRYFFMFVSSTTVLCVYVFGF  214

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYIR++MDA+ T+IWKAMI++PA++VLI YTFISVWFVGGLT FHLYLI TNQTTYEN
Sbjct  215   CWVYIRKVMDADGTSIWKAMIRSPAAIVLIIYTFISVWFVGGLTGFHLYLIGTNQTTYEN  274

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM-  972
             FRYRYDRRANPYN+GV++NF EI C   P SKNDFRAKVP           GGFVSPNM 
Sbjct  275   FRYRYDRRANPYNRGVLDNFKEILCGPTPRSKNDFRAKVP--------GGGGGFVSPNMG  326

Query  973   ---GKAVEDIEMGRKAVWGDVGA--EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEG  1137
                GK++E+IEMGRKAVWGD+ +  +  +GQ+++    N    G    +S EIR+TVDEG
Sbjct  327   GGGGKSMENIEMGRKAVWGDINSVLDLPDGQVNEGGFENKNSSG----ISSEIRSTVDEG  382

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASR  1233
             DR  + H RRSSWGR SG+WEMSPEVLALASR
Sbjct  383   DRIGIIHSRRSSWGRVSGNWEMSPEVLALASR  414



>ref|XP_002284252.1| PREDICTED: probable protein S-acyltransferase 7 [Vitis vinifera]
Length=446

 Score =   481 bits (1239),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 247/337 (73%), Positives = 279/337 (83%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRNAHPPEP+ +DG   G GQTPQLRLPR K+V VNGITVKVKYCDTCMLY
Sbjct  102   TSGRDPGIIPRNAHPPEPEGYDGTEVGAGQTPQLRLPRTKDVVVNGITVKVKYCDTCMLY  161

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YVFGFCWVYI 
Sbjct  162   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCVYVFGFCWVYIM  221

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMD +ETTIWKAM KTPAS+VLI YTF++VWFVGGL+ FHLYLISTNQ+TYENFRYRYD
Sbjct  222   RIMDGKETTIWKAMAKTPASIVLIVYTFVAVWFVGGLSVFHLYLISTNQSTYENFRYRYD  281

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPYNKGV+ENFMEIFCTSIP SKN+FRAKVP++P + AR   GGFVSP +GK   DI
Sbjct  282   RRANPYNKGVIENFMEIFCTSIPSSKNNFRAKVPKEPEIPARTVGGGFVSPILGKDAADI  341

Query  994   EMGRKAVWGDVGAEHQEG--QLSDNDGVNMKEGGGLGEMSP-EIRTTVDEGDR--AAMHH  1158
             EMGRK  W +  AE  E   QLS++DGV+  + G   ++SP   R    EG     A+HH
Sbjct  342   EMGRKPFWDEAAAEAGEYERQLSNDDGVD--KDGEFTDVSPYSSRALHAEGTEGPGALHH  399

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
              RRSSWGR SGSW++SPEV+A+ + VG  NR+ G S+
Sbjct  400   -RRSSWGRASGSWDISPEVIAMVAEVGSANRVSGGST  435



>ref|XP_010926776.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Elaeis 
guineensis]
Length=411

 Score =   479 bits (1234),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 251/354 (71%), Positives = 286/354 (81%), Gaps = 13/354 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNAHPPEP+ FDGN E G GQTPQLRLPR K+V VNGITVK+KY
Sbjct  35    ITLLLLTSGRDPGIIPRNAHPPEPEGFDGNTELGDGQTPQLRLPRTKDVVVNGITVKIKY  94

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  95    CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  154

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+YI +I +AE+T+IW+AMIKTPAS+VLI YTF+ VWFVGGL+ FHLYLISTNQTTYE
Sbjct  155   FCWIYIIKIKNAEQTSIWRAMIKTPASIVLIIYTFVCVWFVGGLSVFHLYLISTNQTTYE  214

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYNKGVV NF EIF TSIPPSKN FRA+VP +  L AR  +GGF+SPNM
Sbjct  215   NFRYRYDRRDNPYNKGVVVNFKEIFFTSIPPSKNKFRARVPYEQGLQARSLSGGFISPNM  274

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIRTTVDEG  1137
             GK V D+EMGRK V  D    G +  + Q  LSD + ++ K  G LG++SP++   V   
Sbjct  275   GKLVGDLEMGRKPVTWDEARTGTDVNDLQAGLSDTNILDDKN-GALGDISPDLSREVLPT  333

Query  1138  DR---AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNAMQ  1290
             +R    A  HPRRSSWGR SGSWEMSPEVLA A+  GE N   G+S G ++  +
Sbjct  334   ERFEGRAAFHPRRSSWGRTSGSWEMSPEVLAPAAGDGESN---GASRGSMSVQE  384



>ref|XP_007038079.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY22580.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=457

 Score =   480 bits (1235),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 249/355 (70%), Positives = 283/355 (80%), Gaps = 21/355 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +VLLLLTSGRDPGI+PRN+HPPEP+ ++G  E   GQTP LRLPR K+V VNGI+VK+KY
Sbjct  95    IVLLLLTSGRDPGIIPRNSHPPEPEGYEGISEFRPGQTPPLRLPRTKDVVVNGISVKIKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV G
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVDRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCLYVHG  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN-----  777
             FCWVYIRRIMD EETTIWKAM KTPAS+VL+ YTFISVWFVGGLT FHLYLISTN     
Sbjct  215   FCWVYIRRIMDGEETTIWKAMTKTPASIVLLVYTFISVWFVGGLTVFHLYLISTNQQSFF  274

Query  778   ----QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHT  945
                 Q+TYENFRYRYD R NPYNKGV+ENF EIFCTSIPPSK +FRAK+P++PA++ R  
Sbjct  275   SVLWQSTYENFRYRYDCRENPYNKGVIENFTEIFCTSIPPSKTNFRAKIPKEPAISPRTV  334

Query  946   AGGFVSPNMGKAVEDIEMGRKAVWGDVGAE--HQEGQLSDNDGVNMKEGGGLGEMSPEIR  1119
             +GGF+SPN GKAV DIEMGRK VW +   E    EGQLS   G  M +  GL ++SP++ 
Sbjct  335   SGGFISPNKGKAVGDIEMGRKPVWDEALGEAGDHEGQLS---GDGMDKDSGLPDVSPDLS  391

Query  1120  TTVD----EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
               +     EG R  M+HPRRSSWGR S  WE+SPE+L L SRVGE  RM G S+ 
Sbjct  392   RILPPESIEG-RGVMNHPRRSSWGRNSEKWEISPEILPL-SRVGESKRMNGRSNA  444



>ref|XP_010926775.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Elaeis 
guineensis]
Length=472

 Score =   480 bits (1236),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 251/354 (71%), Positives = 286/354 (81%), Gaps = 13/354 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNAHPPEP+ FDGN E G GQTPQLRLPR K+V VNGITVK+KY
Sbjct  96    ITLLLLTSGRDPGIIPRNAHPPEPEGFDGNTELGDGQTPQLRLPRTKDVVVNGITVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+YI +I +AE+T+IW+AMIKTPAS+VLI YTF+ VWFVGGL+ FHLYLISTNQTTYE
Sbjct  216   FCWIYIIKIKNAEQTSIWRAMIKTPASIVLIIYTFVCVWFVGGLSVFHLYLISTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYNKGVV NF EIF TSIPPSKN FRA+VP +  L AR  +GGF+SPNM
Sbjct  276   NFRYRYDRRDNPYNKGVVVNFKEIFFTSIPPSKNKFRARVPYEQGLQARSLSGGFISPNM  335

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIRTTVDEG  1137
             GK V D+EMGRK V  D    G +  + Q  LSD + ++ K  G LG++SP++   V   
Sbjct  336   GKLVGDLEMGRKPVTWDEARTGTDVNDLQAGLSDTNILDDKN-GALGDISPDLSREVLPT  394

Query  1138  DR---AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNAMQ  1290
             +R    A  HPRRSSWGR SGSWEMSPEVLA A+  GE N   G+S G ++  +
Sbjct  395   ERFEGRAAFHPRRSSWGRTSGSWEMSPEVLAPAAGDGESN---GASRGSMSVQE  445



>ref|XP_009597116.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana tomentosiformis]
Length=441

 Score =   476 bits (1226),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 278/338 (82%), Gaps = 6/338 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN HPPEP++F+G+ + G GQTPQLRLPRIK+V VNGITVK KYCDTCML
Sbjct  102   TSGRDPGIIPRNPHPPEPENFEGSTQAGPGQTPQLRLPRIKDVNVNGITVKSKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV GFCWVYI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHGFCWVYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD+E+T+IWKAM KTPAS+VLI YTFISVWFVGGLT FHLYLI TNQ+TYENFRYRY
Sbjct  222   KRIMDSEQTSIWKAMAKTPASIVLIIYTFISVWFVGGLTVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP+NKGV+ NF+EIFCTSIPPSKN+FRAKV R+P +A R   GGFVSPN+ K + D
Sbjct  282   DRRVNPFNKGVLHNFLEIFCTSIPPSKNNFRAKVAREPGIAPREVGGGFVSPNLEKTMSD  341

Query  991   IEMGRKAVWGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             +E GRK  W +   G    EGQL +++ ++  E   L  +S E+ +     D  ++ HPR
Sbjct  342   LERGRKPAWHEPATGGNEFEGQLRNDNQLDKDE--ELSVISSEL-SGATLADGRSILHPR  398

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             RSSWGR+SG+ E+ P+V+A+AS +G+ NR+ GS+   L
Sbjct  399   RSSWGRRSGTLEIPPDVVAMASEIGDSNRITGSNGAFL  436



>ref|XP_006366904.1| PREDICTED: probable protein S-acyltransferase 7-like [Solanum 
tuberosum]
Length=441

 Score =   476 bits (1224),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 275/336 (82%), Gaps = 6/336 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             +VLLLLTSGRDPGIVPRN HPPEP++F+G+ + G GQTPQLRLPRIK+V VNGITVK KY
Sbjct  96    IVLLLLTSGRDPGIVPRNLHPPEPENFEGSAQAGPGQTPQLRLPRIKDVTVNGITVKTKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV G
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIMD E+T+IWKAM KTPAS+VLI YTFISVWFVGGLT FHLYLI TNQ+TYE
Sbjct  216   FCWVYIKRIMDGEQTSIWKAMAKTPASIVLIIYTFISVWFVGGLTVFHLYLIGTNQSTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NP+NKGV+ NF+EIFCTSIPPSKN+FRAKV R+P +  R   GGFVSPNM
Sbjct  276   NFRYRYDRRVNPFNKGVLHNFLEIFCTSIPPSKNNFRAKVAREPGIPPREVGGGFVSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
              K + D+E GRK  W +   G    EGQ  +++  +  E   L  +S E+        R+
Sbjct  336   EKTMSDLERGRKPSWHEERRGTNEFEGQTRNDNQFDKDE--ELSVISAELNGATLPDGRS  393

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
              + HPRRSSWGR+SG+ E+ P+V+A+AS +G+ NR+
Sbjct  394   IL-HPRRSSWGRRSGTLEIPPDVVAMASEIGDSNRI  428



>ref|XP_009773376.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana sylvestris]
Length=441

 Score =   474 bits (1221),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 235/337 (70%), Positives = 278/337 (82%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN HPPEP++F+G+ + G GQTPQLRLPRIKEV VNGITVKVKYCDTCML
Sbjct  102   TSGRDPGIIPRNPHPPEPENFEGSAQAGPGQTPQLRLPRIKEVNVNGITVKVKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV GFCWVYI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHGFCWVYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIMD E+TT+WKAM KTPAS+VLI YTFISVWFVGGLT FHLYLI TNQ+TYENFRYRY
Sbjct  222   RRIMDGEQTTVWKAMAKTPASIVLIIYTFISVWFVGGLTVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP++KGV+ NF+EIFCTSIPPS N FR+KV ++P + AR  AGGF+SPN+ K + D
Sbjct  282   DRRINPFDKGVLRNFLEIFCTSIPPSMNRFRSKVQKEPEIPAREVAGGFISPNLEKTMSD  341

Query  991   IEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDRAAMHHP  1161
             +EMGRK  W ++  G+   EGQ  ++  ++  E   L   SPE+  +T+ EG   ++ HP
Sbjct  342   LEMGRKPAWREIARGSGDFEGQPRNDSQLDKDE--ELSAASPELSNSTLAEG--RSILHP  397

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             RRSSWGR+SG+  ++P+V+A+AS +GE NR   S S 
Sbjct  398   RRSSWGRRSGTLNITPDVIAMASEIGESNRTTVSDSA  434



>ref|XP_010929605.1| PREDICTED: probable protein S-acyltransferase 7 [Elaeis guineensis]
Length=445

 Score =   474 bits (1220),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 236/348 (68%), Positives = 280/348 (80%), Gaps = 13/348 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LL LTSGRDPGI+PRNAHPPEP+ ++ N E GG QTPQLRLPR ++V +NGITVK+KY
Sbjct  97    LILLFLTSGRDPGIIPRNAHPPEPEVYNENTEVGGSQTPQLRLPRTRDVIINGITVKIKY  156

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG
Sbjct  157   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  216

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI++IMD EE  +WKAM KTPAS+VLI YTF+SVWFVGGL+AFHLYLISTNQTTYE
Sbjct  217   FCWVYIKKIMDDEEANVWKAMTKTPASIVLIIYTFVSVWFVGGLSAFHLYLISTNQTTYE  276

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYN+GVVENF EIF +SIPPSKN  R +VP++ A  AR   GGFVSPNM
Sbjct  277   NFRYRYDRRANPYNRGVVENFKEIFFSSIPPSKNKLRLRVPQEQASQARSVGGGFVSPNM  336

Query  973   GKAVEDIEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD----EG  1137
             GK   D++MGRKA+ W D G    + +   ++ V+  + GG+ +  P I+  +     E 
Sbjct  337   GKG--DLDMGRKAMAWSDAGLGVGDLEAGLDNDVSEDKDGGIADAPPGIQKDLPSEGLEA  394

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
              R+A+H   R S   +SG+WE+SP++LALA+ VGE NR   +++GG N
Sbjct  395   GRSAVHS--RRSSWGRSGNWELSPDILALAAGVGESNR---TTAGGRN  437



>ref|XP_009614913.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana tomentosiformis]
 ref|XP_009614914.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana tomentosiformis]
Length=441

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 276/337 (82%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN HPPEP++F+G+ + G GQTPQLRLPRIKEV VNGITVKVKYCDTCML
Sbjct  102   TSGRDPGIIPRNPHPPEPENFEGSAQAGPGQTPQLRLPRIKEVNVNGITVKVKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV GFCWVYI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHGFCWVYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIMD E+TT+WKAM KTPAS+VLI YTFISVWFVGGLT FHLYLI TNQ+TYENFRYRY
Sbjct  222   RRIMDGEQTTVWKAMAKTPASIVLIIYTFISVWFVGGLTVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP++KGV+ NF+EIFCTSI PS N FRAKV ++P + AR  AGGFVSPN+ K + D
Sbjct  282   DRRINPFDKGVLRNFLEIFCTSISPSMNRFRAKVQKEPEIPAREVAGGFVSPNLEKTMSD  341

Query  991   IEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDRAAMHHP  1161
             +EMGRK  W ++  G+   EGQ  ++  ++  E   L   SPE+  +T+ EG   ++ HP
Sbjct  342   LEMGRKPAWREIARGSGDFEGQPRNDSQLDKDE--ELSAASPELSNSTLAEG--RSILHP  397

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             RRSSWGR+SG+  + P+V+A+AS +GE NR   S S 
Sbjct  398   RRSSWGRRSGTLNIPPDVIAMASEIGESNRTTVSDSA  434



>gb|KHG10229.1| hypothetical protein F383_12963 [Gossypium arboreum]
Length=452

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/347 (68%), Positives = 275/347 (79%), Gaps = 14/347 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLL SGRDPGI+PRN HPPEP+ ++G  E   GQTP LRLPR K+V VNGI+VK+KY
Sbjct  95    ITLLLLASGRDPGIIPRNLHPPEPEGYEGMTEVRPGQTPPLRLPRTKDVIVNGISVKIKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV G
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVDRFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHG  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIRRIM+ EE T+WKAM KTPAS+VLI YTFISVWFVGGLT FHLYLISTNQ+TYE
Sbjct  215   FCWVYIRRIMNGEEATVWKAMTKTPASIVLIIYTFISVWFVGGLTVFHLYLISTNQSTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NPYNKGV+ NF+E+FCTS+PPSK + R KVP++PA+A R  +GGF+SPN 
Sbjct  275   NFRYRYDRHENPYNKGVIRNFLEVFCTSVPPSKINLREKVPKEPAIAPRTVSGGFISPNN  334

Query  973   GKAVEDIEMGRKAVW----GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             GKA+ DIEMGRK VW    GD+    ++  +  +D     +   L ++SP+    +   +
Sbjct  335   GKAIGDIEMGRKPVWDEALGDISDYEEQHSVDYSD-----KDSRLPDVSPDFSRILPPDN  389

Query  1141  ---RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
                R  MHHPRRSSWGR S  WE+SPE+L L SR+GE  RM G S+G
Sbjct  390   TEGRGVMHHPRRSSWGRNSERWEISPEILPL-SRIGESKRMNGKSNG  435



>ref|XP_009768845.1| PREDICTED: probable protein S-acyltransferase 7 [Nicotiana sylvestris]
Length=441

 Score =   471 bits (1212),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 233/333 (70%), Positives = 274/333 (82%), Gaps = 6/333 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN HPPEP++F+G+ + G GQTPQLRLPRIK+V VNGITVK KYCDTCML
Sbjct  102   TSGRDPGIIPRNPHPPEPENFEGSAQAGPGQTPQLRLPRIKDVNVNGITVKSKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV GFCWVYI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHGFCWVYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD E+T+IWKAM KTPAS+VLI YTFISVWFVGGLT FHLYLI TNQ+TYENFRYRY
Sbjct  222   KRIMDGEQTSIWKAMAKTPASIVLIIYTFISVWFVGGLTVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP+NKGV+ NF+EIFCTSIPPSKN+FRAKV R+P +A R   GGFVSPN+ K + D
Sbjct  282   DRRVNPFNKGVLHNFLEIFCTSIPPSKNNFRAKVAREPGIAPREVGGGFVSPNLEKTMSD  341

Query  991   IEMGRKAVWGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPr  1164
             +E GRK  W +   G    EGQ  +++ ++  E   L  +S E+ +     D  ++ HPR
Sbjct  342   LERGRKPAWHEPATGGNEFEGQPRNDNQLDKDE--ELSVISSEL-SGATLADGRSILHPR  398

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGS  1263
             RSSWGR+SG+ E+ P+V+A+AS +G+ NR+ GS
Sbjct  399   RSSWGRRSGTLEIPPDVVAMASEIGDSNRITGS  431



>ref|XP_010318318.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=387

 Score =   468 bits (1205),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 237/340 (70%), Positives = 275/340 (81%), Gaps = 9/340 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGN-IEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +VLLLLTSGRDPGIVPRN HPPEP++F+G+ + G GQTPQLRLPRIK+V VNGITVK KY
Sbjct  45    IVLLLLTSGRDPGIVPRNLHPPEPENFEGSALAGPGQTPQLRLPRIKDVTVNGITVKTKY  104

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV G
Sbjct  105   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHG  164

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIMD E T+IWKAM KTPAS+VLI YTFISVWFVGGL+ FHLYLI TNQ+TYE
Sbjct  165   FCWVYIKRIMDGEHTSIWKAMAKTPASIVLIIYTFISVWFVGGLSVFHLYLIGTNQSTYE  224

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYNKGV+ NF EIFCTSIPPSKN+FRAKV R+P +  R    GFVSPNM
Sbjct  225   NFRYRYDRRVNPYNKGVLHNFSEIFCTSIPPSKNNFRAKVAREPGIPPREVGVGFVSPNM  284

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
              K + D+E GRK  W +   GA   EGQ  +++  + +E     E+S  I       D  
Sbjct  285   EKTMSDLERGRKPSWHEERRGANEFEGQTRNDNQFDKEE-----ELS-VISNGATLPDGR  338

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
             ++ HPRRSSWGR+SG+ E+ P+V+A+AS +G+ NR+  S+
Sbjct  339   SILHPRRSSWGRRSGTLEIPPDVVAMASEIGDSNRITVSN  378



>ref|XP_003624454.1| Palmitoyltransferase ZDHHC9 [Medicago truncatula]
 gb|AES80672.1| DHHC type zinc finger protein [Medicago truncatula]
Length=433

 Score =   470 bits (1209),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 265/341 (78%), Positives = 294/341 (86%), Gaps = 8/341 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FD N + G GQTPQLRLPRIKEVEVNG+ VKVKY
Sbjct  92    LVLLLLTSGRDPGIIPRNAHPPEPEGFDNNADVGAGQTPQLRLPRIKEVEVNGVVVKVKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF+TTLLC+YVF 
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFTTTLLCVYVFA  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+YIR+IMDAEET IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  212   FCWIYIRKIMDAEETNIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGV+ NF EIFC SI PSKN FRA VP +PAL AR  +GG+++ ++
Sbjct  272   NFRYRYDRRANPYNKGVLNNFKEIFCISIAPSKNKFRAMVPNEPALPARSVSGGYMNQSL  331

Query  973   GKAVEDIEMGRKAVWG-DVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             GK+ +DIEMGRKAVW  + G +  + QL +ND   +K+    GE+S EIRTTVDE     
Sbjct  332   GKSGDDIEMGRKAVWEMNAGMDESDSQL-NNDRATIKD----GELSSEIRTTVDEAVDRV  386

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG-GSSS  1269
               HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR G G+SS
Sbjct  387   GVHPRRSSWGRKSGSWEMSPEVLALAARVGEQNRAGEGNSS  427



>ref|XP_004235323.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=438

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 273/336 (81%), Gaps = 9/336 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGN-IEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +VLLLLTSGRDPGIVPRN HPPEP++F+G+ + G GQTPQLRLPRIK+V VNGITVK KY
Sbjct  96    IVLLLLTSGRDPGIVPRNLHPPEPENFEGSALAGPGQTPQLRLPRIKDVTVNGITVKTKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV G
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIMD E T+IWKAM KTPAS+VLI YTFISVWFVGGL+ FHLYLI TNQ+TYE
Sbjct  216   FCWVYIKRIMDGEHTSIWKAMAKTPASIVLIIYTFISVWFVGGLSVFHLYLIGTNQSTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYNKGV+ NF EIFCTSIPPSKN+FRAKV R+P +  R    GFVSPNM
Sbjct  276   NFRYRYDRRVNPYNKGVLHNFSEIFCTSIPPSKNNFRAKVAREPGIPPREVGVGFVSPNM  335

Query  973   GKAVEDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
              K + D+E GRK  W +   GA   EGQ  +++  + +E     E+S  I       D  
Sbjct  336   EKTMSDLERGRKPSWHEERRGANEFEGQTRNDNQFDKEE-----ELS-VISNGATLPDGR  389

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             ++ HPRRSSWGR+SG+ E+ P+V+A+AS +G+ NR+
Sbjct  390   SILHPRRSSWGRRSGTLEIPPDVVAMASEIGDSNRI  425



>emb|CBI15716.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   468 bits (1203),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 239/329 (73%), Positives = 268/329 (81%), Gaps = 19/329 (6%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRNAHPPEP+ +DG   G GQTPQLRLPR K+V VNGITVKVKYCDTCMLY
Sbjct  102   TSGRDPGIIPRNAHPPEPEGYDGTEVGAGQTPQLRLPRTKDVVVNGITVKVKYCDTCMLY  161

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YVFGFCWVYI 
Sbjct  162   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCVYVFGFCWVYIM  221

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMD +ETTIWKAM KTPAS+VLI YTF++VWFVGGL+ FHLYLISTNQ+TYENFRYRYD
Sbjct  222   RIMDGKETTIWKAMAKTPASIVLIVYTFVAVWFVGGLSVFHLYLISTNQSTYENFRYRYD  281

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPYNKGV+ENFMEIFCTSIP SKN+FRAKVP++P + AR   GGFVSP +GK   DI
Sbjct  282   RRANPYNKGVIENFMEIFCTSIPSSKNNFRAKVPKEPEIPARTVGGGFVSPILGKDAADI  341

Query  994   EMGRKAVWGDVGAEHQEG--QLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrr  1167
             EMGRK  W +  AE  E   QLS++D ++ +   G G                A+HH RR
Sbjct  342   EMGRKPFWDEAAAEAGEYERQLSNDDALHAEGTEGPG----------------ALHH-RR  384

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRM  1254
             SSWGR SGSW++SPEV+A+ + VG  NR 
Sbjct  385   SSWGRASGSWDISPEVIAMVAEVGSANRF  413



>ref|XP_011045759.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Populus 
euphratica]
Length=414

 Score =   466 bits (1200),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 248/343 (72%), Positives = 277/343 (81%), Gaps = 35/343 (10%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             LVLLLLTSGRDPGI+PRNAHPPEP+ FDG+ + G GQTPQLRLPR+KEVE NG+TVKVKY
Sbjct  95    LVLLLLTSGRDPGIIPRNAHPPEPEGFDGSADVGSGQTPQLRLPRVKEVEFNGMTVKVKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGL                      
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGL----------------------  192

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
                     IM +E  + WKAM+KTP+S+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYE
Sbjct  193   --------IMGSENISTWKAMMKTPSSIVLIVYTFISMWFVGGLTAFHLYLISTNQTTYE  244

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANP+ KG+VENF EIFC+SIPPSKN+FRAKVPR+PAL  R   GGF+SPNM
Sbjct  245   NFRYRYDRRANPFYKGLVENFKEIFCSSIPPSKNNFRAKVPREPALPTRTLGGGFMSPNM  304

Query  973   GKAVEDIEMGRKAVWGDVGA-EHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GDRA  1146
             GKA  DIEMGRK VWGD+ A    EGQ ++ND +N+K+ G LGE+SP+IRTTVDE GDR 
Sbjct  305   GKAGGDIEMGRKTVWGDMSAMADSEGQPANNDRLNIKD-GELGELSPDIRTTVDEVGDRG  363

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
              + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NR+GG SS G
Sbjct  364   GL-HPRRSSWGRKSGSWEMSPEVLALAARVGESNRVGGGSSVG  405



>ref|XP_010093936.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB54899.1| putative S-acyltransferase [Morus notabilis]
Length=464

 Score =   467 bits (1201),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 278/349 (80%), Gaps = 6/349 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LL+LTSGRDPGI+PR+AHPPEP+D++G+ E G  QTPQLRLPR K+V VNG+TV++KY
Sbjct  107   LILLILTSGRDPGIIPRSAHPPEPEDYEGSTETGANQTPQLRLPRHKDVNVNGVTVRIKY  166

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCVE+FDHHCPWVGQCIGLRNYRFFFMF+   TLLC+YV G
Sbjct  167   CDTCMLYRPPRSSHCSICNNCVEKFDHHCPWVGQCIGLRNYRFFFMFISCGTLLCLYVHG  226

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIM++E TTIWKAMIKTPAS+ LIAYTFI+ WFVGGLT FHLYLISTNQ+TYE
Sbjct  227   FCWVYIKRIMNSENTTIWKAMIKTPASIALIAYTFIAFWFVGGLTFFHLYLISTNQSTYE  286

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANP+NKGV  NF E FC+SIP SKNDFR KVP+DP++  R   GGFVSP M
Sbjct  287   NFRYRYDRRANPFNKGVFANFFETFCSSIPQSKNDFRKKVPKDPSILPRIVGGGFVSPLM  346

Query  973   GKAVEDIEMGRKAVWGDVGAEH---QEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEG  1137
             GKA+ DIEMGRK  W +   +    ++  +S++DG +  +G    ++SP++   +  +  
Sbjct  347   GKAISDIEMGRKPAWDEAAGQDVDFEDEHISNDDGPDKDQGPNDADVSPDLSRNLPTESA  406

Query  1138  DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             +R  + + RRSSWGR+SGS  +SPE+LALA+ VG+  R+     G   A
Sbjct  407   ERRDVLYSRRSSWGRRSGSLNISPEILALAAGVGDSRRVTDGRHGNFPA  455



>ref|XP_008790730.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Phoenix 
dactylifera]
Length=457

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 281/349 (81%), Gaps = 10/349 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI PRNAHPPEP+ +DGN E GG QTP LRLPR+++V VNGITVK+KY
Sbjct  108   IALLLLTSGRDPGITPRNAHPPEPEGYDGNTEVGGSQTPHLRLPRMRDVVVNGITVKIKY  167

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCI+VFG
Sbjct  168   CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIFVFG  227

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+ +IW+A+IKTPAS+VLI YTF+S+WFVGGL+ FHLYL+STNQTTYE
Sbjct  228   FCWVYVIRIKNAEQISIWRALIKTPASIVLIIYTFLSMWFVGGLSVFHLYLMSTNQTTYE  287

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF TSIPPSKN FRA+ P++    +R   GGF+SPNM
Sbjct  288   NFRYRYDRRDNPYNRGVVANFKEIFFTSIPPSKNKFRARAPQEQGFQSRSLGGGFISPNM  347

Query  973   GKAVEDIEMGRK-AVWGD--VGAEHQEGQ-LSDNDGVNMKEGGGLGEMSPEI--RTTVDE  1134
             G  V D+EMGRK   W +  +GA+  + Q LSD   ++ K  GG G+ SP++  +T++ E
Sbjct  348   GIPVGDLEMGRKPGTWDEARIGADVNDLQGLSDTATLDGKN-GGFGDASPDLSRQTSLTE  406

Query  1135  GDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG-GSSSGG  1275
             G +  A  HPRR SWG +S SWEM  EVLALA+  GE N+ G G  S G
Sbjct  407   GLQGHAALHPRRPSWGHRSASWEMPQEVLALAAGAGESNQAGRGKVSAG  455



>ref|XP_010943750.1| PREDICTED: probable protein S-acyltransferase 7 isoform X3 [Elaeis 
guineensis]
 ref|XP_010943752.1| PREDICTED: probable protein S-acyltransferase 7 isoform X3 [Elaeis 
guineensis]
Length=392

 Score =   462 bits (1188),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 275/340 (81%), Gaps = 10/340 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNA PPEP+ +DGN E GG QTPQL LPR+K+V VNGITVK+KY
Sbjct  43    IALLLLTSGRDPGIIPRNARPPEPEGYDGNTEIGGSQTPQLSLPRMKDVVVNGITVKIKY  102

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  103   CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  162

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+T+IW+AMIKTPAS++LI YTF+SVWFVGGL+ FHLYL+STNQTTYE
Sbjct  163   FCWVYVIRIKNAEQTSIWRAMIKTPASIILIIYTFLSVWFVGGLSVFHLYLMSTNQTTYE  222

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF T IPPSKN FR +VPR+    +    G F+SPNM
Sbjct  223   NFRYRYDRRVNPYNRGVVANFKEIFFTCIPPSKNKFRTRVPREQGFQSGSLGGAFISPNM  282

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIR--TTVD  1131
              K V D+EMGRK V  D   +GA+  + Q  LSD D ++ K  G  G+ SP++R  T+  
Sbjct  283   WKPVGDLEMGRKPVLWDEARIGADVNDLQAGLSDTDSLDDKN-GRFGDASPDLRRETSPT  341

Query  1132  EGDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
             EG +  A+ HPRRSSWG +SGSWEM  EVLALA   GE N
Sbjct  342   EGLQGHAVLHPRRSSWGHRSGSWEMPLEVLALADGAGESN  381



>ref|XP_008790729.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Phoenix 
dactylifera]
Length=466

 Score =   464 bits (1195),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 281/349 (81%), Gaps = 10/349 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI PRNAHPPEP+ +DGN E GG QTP LRLPR+++V VNGITVK+KY
Sbjct  117   IALLLLTSGRDPGITPRNAHPPEPEGYDGNTEVGGSQTPHLRLPRMRDVVVNGITVKIKY  176

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCI+VFG
Sbjct  177   CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIFVFG  236

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+ +IW+A+IKTPAS+VLI YTF+S+WFVGGL+ FHLYL+STNQTTYE
Sbjct  237   FCWVYVIRIKNAEQISIWRALIKTPASIVLIIYTFLSMWFVGGLSVFHLYLMSTNQTTYE  296

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF TSIPPSKN FRA+ P++    +R   GGF+SPNM
Sbjct  297   NFRYRYDRRDNPYNRGVVANFKEIFFTSIPPSKNKFRARAPQEQGFQSRSLGGGFISPNM  356

Query  973   GKAVEDIEMGRK-AVWGD--VGAEHQEGQ-LSDNDGVNMKEGGGLGEMSPEI--RTTVDE  1134
             G  V D+EMGRK   W +  +GA+  + Q LSD   ++ K  GG G+ SP++  +T++ E
Sbjct  357   GIPVGDLEMGRKPGTWDEARIGADVNDLQGLSDTATLDGKN-GGFGDASPDLSRQTSLTE  415

Query  1135  GDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG-GSSSGG  1275
             G +  A  HPRR SWG +S SWEM  EVLALA+  GE N+ G G  S G
Sbjct  416   GLQGHAALHPRRPSWGHRSASWEMPQEVLALAAGAGESNQAGRGKVSAG  464



>ref|XP_006347348.1| PREDICTED: probable protein S-acyltransferase 7-like [Solanum 
tuberosum]
Length=441

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 274/337 (81%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TS RDPGI+PRN HPPE ++F+G+I+ G GQTPQLRLPRIK+V VNGITVKVKYCDTCML
Sbjct  102   TSARDPGIIPRNPHPPELENFEGSIQTGPGQTPQLRLPRIKDVNVNGITVKVKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV GFCWVYI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHGFCWVYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             RRIMD E+T IWKAM KTPAS+VLI YTFISVWFVGGL+ FHLYLI TNQ+TYENFRYRY
Sbjct  222   RRIMDGEQTNIWKAMAKTPASIVLIGYTFISVWFVGGLSVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP++KGV+ NF+EIFCTSIPPS+N FR +V R+P + AR  AGGFVSPN+ K + D
Sbjct  282   DRRVNPFDKGVIHNFLEIFCTSIPPSRNKFRERVQREPGIPAREVAGGFVSPNLEKTMSD  341

Query  991   IEMGRKAVWGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDRAAMHHP  1161
             +EMGRK  W +   G +  E Q  +++ ++  E   L   SPE+  TT+ EG   ++ HP
Sbjct  342   LEMGRKPGWHETATGTDDFEEQPRNDNQLDKDE--ELLAASPELSNTTLAEG--RSILHP  397

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             RRSSWGR+SG+  + P+V+A+AS +GE NR   S S 
Sbjct  398   RRSSWGRRSGTLNIPPDVIAMASEIGESNRTTVSDSA  434



>ref|XP_010943753.1| PREDICTED: probable protein S-acyltransferase 7 isoform X4 [Elaeis 
guineensis]
Length=384

 Score =   461 bits (1186),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 275/340 (81%), Gaps = 10/340 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNA PPEP+ +DGN E GG QTPQL LPR+K+V VNGITVK+KY
Sbjct  35    IALLLLTSGRDPGIIPRNARPPEPEGYDGNTEIGGSQTPQLSLPRMKDVVVNGITVKIKY  94

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  95    CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  154

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+T+IW+AMIKTPAS++LI YTF+SVWFVGGL+ FHLYL+STNQTTYE
Sbjct  155   FCWVYVIRIKNAEQTSIWRAMIKTPASIILIIYTFLSVWFVGGLSVFHLYLMSTNQTTYE  214

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF T IPPSKN FR +VPR+    +    G F+SPNM
Sbjct  215   NFRYRYDRRVNPYNRGVVANFKEIFFTCIPPSKNKFRTRVPREQGFQSGSLGGAFISPNM  274

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIR--TTVD  1131
              K V D+EMGRK V  D   +GA+  + Q  LSD D ++ K  G  G+ SP++R  T+  
Sbjct  275   WKPVGDLEMGRKPVLWDEARIGADVNDLQAGLSDTDSLDDKN-GRFGDASPDLRRETSPT  333

Query  1132  EGDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
             EG +  A+ HPRRSSWG +SGSWEM  EVLALA   GE N
Sbjct  334   EGLQGHAVLHPRRSSWGHRSGSWEMPLEVLALADGAGESN  373



>ref|XP_010943749.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Elaeis 
guineensis]
Length=387

 Score =   460 bits (1184),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 275/340 (81%), Gaps = 10/340 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNA PPEP+ +DGN E GG QTPQL LPR+K+V VNGITVK+KY
Sbjct  38    IALLLLTSGRDPGIIPRNARPPEPEGYDGNTEIGGSQTPQLSLPRMKDVVVNGITVKIKY  97

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  98    CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  157

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+T+IW+AMIKTPAS++LI YTF+SVWFVGGL+ FHLYL+STNQTTYE
Sbjct  158   FCWVYVIRIKNAEQTSIWRAMIKTPASIILIIYTFLSVWFVGGLSVFHLYLMSTNQTTYE  217

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF T IPPSKN FR +VPR+    +    G F+SPNM
Sbjct  218   NFRYRYDRRVNPYNRGVVANFKEIFFTCIPPSKNKFRTRVPREQGFQSGSLGGAFISPNM  277

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIR--TTVD  1131
              K V D+EMGRK V  D   +GA+  + Q  LSD D ++ K  G  G+ SP++R  T+  
Sbjct  278   WKPVGDLEMGRKPVLWDEARIGADVNDLQAGLSDTDSLDDKN-GRFGDASPDLRRETSPT  336

Query  1132  EGDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
             EG +  A+ HPRRSSWG +SGSWEM  EVLALA   GE N
Sbjct  337   EGLQGHAVLHPRRSSWGHRSGSWEMPLEVLALADGAGESN  376



>ref|XP_010943748.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Elaeis 
guineensis]
Length=445

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 275/340 (81%), Gaps = 10/340 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LLLLTSGRDPGI+PRNA PPEP+ +DGN E GG QTPQL LPR+K+V VNGITVK+KY
Sbjct  96    IALLLLTSGRDPGIIPRNARPPEPEGYDGNTEIGGSQTPQLSLPRMKDVVVNGITVKIKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCS+CNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLCIYVFG
Sbjct  156   CDTCMLYRPPRCSHCSVCNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCIYVFG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ RI +AE+T+IW+AMIKTPAS++LI YTF+SVWFVGGL+ FHLYL+STNQTTYE
Sbjct  216   FCWVYVIRIKNAEQTSIWRAMIKTPASIILIIYTFLSVWFVGGLSVFHLYLMSTNQTTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRR NPYN+GVV NF EIF T IPPSKN FR +VPR+    +    G F+SPNM
Sbjct  276   NFRYRYDRRVNPYNRGVVANFKEIFFTCIPPSKNKFRTRVPREQGFQSGSLGGAFISPNM  335

Query  973   GKAVEDIEMGRKAVWGD---VGAEHQEGQ--LSDNDGVNMKEGGGLGEMSPEIR--TTVD  1131
              K V D+EMGRK V  D   +GA+  + Q  LSD D ++ K  G  G+ SP++R  T+  
Sbjct  336   WKPVGDLEMGRKPVLWDEARIGADVNDLQAGLSDTDSLDDKN-GRFGDASPDLRRETSPT  394

Query  1132  EGDRA-AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
             EG +  A+ HPRRSSWG +SGSWEM  EVLALA   GE N
Sbjct  395   EGLQGHAVLHPRRSSWGHRSGSWEMPLEVLALADGAGESN  434



>ref|XP_009385498.1| PREDICTED: probable protein S-acyltransferase 7 [Musa acuminata 
subsp. malaccensis]
Length=450

 Score =   461 bits (1186),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 233/335 (70%), Positives = 268/335 (80%), Gaps = 11/335 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGIVPRNAHPPEP+ ++GN E GG QTPQLRLPR K+V VNG+TVKVKYCDTCMLY
Sbjct  104   SGRDPGIVPRNAHPPEPEIYEGNNEVGGVQTPQLRLPRTKDVNVNGVTVKVKYCDTCMLY  163

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFGFCWV I 
Sbjct  164   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFGFCWVCIV  223

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             +I +AE+ +IW+AM KTPAS+VLI YTFISVWFVGGL+ FHLYL+STNQTTYENFRYRYD
Sbjct  224   KIKNAEQISIWRAMTKTPASIVLIIYTFISVWFVGGLSIFHLYLMSTNQTTYENFRYRYD  283

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPYN+GVVENF EIF TSI PSKN FRA+VPR+     R + GGF+SPNMGKAV DI
Sbjct  284   RRANPYNRGVVENFKEIFFTSIAPSKNKFRARVPREQGFQPRSSGGGFMSPNMGKAVGDI  343

Query  994   EMGRKAV-WGDVGAEHQEGQLSD---NDGVNMKEGGGLGEMSPEI-RTTVDEGD---RAA  1149
             EMGRK V W ++ A  Q G L +   N  +   + G LGE+SP++ R  +  G    +A 
Sbjct  344   EMGRKPVTWDELRAVTQVGDLEEGLSNRNIADDKDGELGEVSPDLSREVLASGSVEVQAT  403

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
              HH  R S   +  SWE +PEV A+A+ VGE +RM
Sbjct  404   THH--RLSSWGRGRSWETTPEVQAVAAAVGETSRM  436



>ref|XP_008791097.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
Length=445

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/343 (67%), Positives = 273/343 (80%), Gaps = 11/343 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN HPPEP+ ++ N E GG QTPQLRLPR ++V +NGITVK+KYCDTCML
Sbjct  103   TSGRDPGILPRNVHPPEPEVYNENTEVGGSQTPQLRLPRTRDVIINGITVKIKYCDTCML  162

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFC VYI
Sbjct  163   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCSVYI  222

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             ++IMD ++T +W+AM KTPAS+VL+ YTFISVWFVGGL+AFHLYLISTNQTTYENFRYRY
Sbjct  223   KKIMDDQQTNVWRAMTKTPASIVLLIYTFISVWFVGGLSAFHLYLISTNQTTYENFRYRY  282

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRRANPYN+GVVENF EIF +SIPPSKN FRA+VPR+ A  AR   GGFVSPNMGK   D
Sbjct  283   DRRANPYNQGVVENFKEIFFSSIPPSKNKFRARVPREQASQARSVGGGFVSPNMGKG--D  340

Query  991   IEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD----EGDRAAMH  1155
             +++GRKA+ W + G    + +   ++ V+  + GG+ +  P I   +     E  R+A+H
Sbjct  341   LDVGRKAMAWNEAGLGVGDLEAGLDNDVSEDKDGGIADAPPGIHKDLPSEGLEAGRSAVH  400

Query  1156  HPrrsswgrksgswEMSPEVLALASRVGEGNRM-GGSSSGGLN  1281
                R S   +SG+WE+SP++LALA+ VGE NR   G  SG  N
Sbjct  401   S--RRSSWGRSGNWELSPDILALAAGVGESNRASAGGRSGSTN  441



>ref|XP_004241453.1| PREDICTED: probable protein S-acyltransferase 7 [Solanum lycopersicum]
Length=441

 Score =   458 bits (1178),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 265/334 (79%), Gaps = 2/334 (1%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TS RDPGI+PRN HPPE ++F+G+I+ G GQTPQLRLPR+K+V VNGITVKVKYCDTCML
Sbjct  102   TSARDPGIIPRNPHPPELENFEGSIQSGPGQTPQLRLPRVKDVNVNGITVKVKYCDTCML  161

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC+YV GFCW+YI
Sbjct  162   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCLYVHGFCWIYI  221

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD E+T IWKAM +TPAS+VLI YTFISVWFVGGL+ FHLYLI TNQ+TYENFRYRY
Sbjct  222   KRIMDGEQTNIWKAMARTPASIVLIGYTFISVWFVGGLSVFHLYLIGTNQSTYENFRYRY  281

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DRR NP++KGV+ NF+EIFCTSIPPSKN FR +V R+  + AR  AGGFVSPN+ K + D
Sbjct  282   DRRVNPFDKGVIHNFLEIFCTSIPPSKNRFRERVQREAGIPAREVAGGFVSPNLEKTMSD  341

Query  991   IEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrrs  1170
             +EMGRK  W +      + +    +   + +   L   SPE+  T     R+ + HPRRS
Sbjct  342   LEMGRKPGWHETATGTDDFEEPPRNDNQLDKDEELLSASPELSNTALAEGRSIL-HPRRS  400

Query  1171  swgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             SWGR+SG+  + P+V+A+AS +GE NR   S S 
Sbjct  401   SWGRRSGTLNIPPDVIAMASEIGESNRTTVSDSA  434



>ref|XP_004297510.1| PREDICTED: probable S-acyltransferase At3g26935-like [Fragaria 
vesca subsp. vesca]
Length=443

 Score =   457 bits (1177),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 273/351 (78%), Gaps = 11/351 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VLVLLL+TSGRDPGIVPRN HPPEP D+DG+ + G G+TPQ R PR+KEV +N I VKVK
Sbjct  87    VLVLLLITSGRDPGIVPRNLHPPEPDDYDGSTDTGSGETPQSRFPRMKEVLINRIIVKVK  146

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLCIYV 
Sbjct  147   YCDTCMLYRPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCIYVH  206

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVY++ IM++E+ +IWKA+IKTPAS+ LI Y+F++ WFVGGLT+FHLYLISTNQ+TY
Sbjct  207   GFCWVYVKMIMNSEDISIWKALIKTPASIALIIYSFLASWFVGGLTSFHLYLISTNQSTY  266

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYD RANP+NKGV+ENFME+FCTSIPPS+N+FR KVP +PA         F  P 
Sbjct  267   ENFRYRYDGRANPFNKGVIENFMEVFCTSIPPSQNNFREKVPINPA----QVGNNFDGPV  322

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQE--GQLSDNDGVNMKEGGGLGEMSPEIRTTV----D  1131
             MGKA+ DIEMG+K  W +   E  +  GQ S++DG     G    ++SP++  T+     
Sbjct  323   MGKAISDIEMGKKPGWDETARETGDYGGQFSNDDGEGKDNGFSEADVSPDLSRTLPTEST  382

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             E    A+H  RRSSWGR+SGS  +SPEVLA+A+ VG+  R+    SG   +
Sbjct  383   ESHSTALHPSRRSSWGRRSGSLNISPEVLAMAAGVGDSRRVSDRISGSFTS  433



>ref|XP_006373200.1| hypothetical protein POPTR_0017s09590g [Populus trichocarpa]
 gb|ERP50997.1| hypothetical protein POPTR_0017s09590g [Populus trichocarpa]
Length=297

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/283 (81%), Positives = 250/283 (88%), Gaps = 4/283 (1%)
 Frame = +1

Query  412   ITVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTL  591
             +TVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTL
Sbjct  1     MTVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTL  60

Query  592   LCIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLIS  771
             LCIYVF FCWVYIR+IM +E + IWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLI 
Sbjct  61    LCIYVFSFCWVYIRKIMGSENSLIWKAMIKTPASIVLIVYTFISMWFVGGLTAFHLYLIC  120

Query  772   TNQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAG  951
             TNQTTYENFRYRYDR ANP+ KGVVEN  EIFC+SIPPSKN+FRAKVP +PAL AR    
Sbjct  121   TNQTTYENFRYRYDRHANPFYKGVVENLKEIFCSSIPPSKNNFRAKVPGEPALPARTLGR  180

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAEHQ-EGQLSDNDGVNMKEGGGLGEMSPEIRTTV  1128
             GF+SPNMGKAV D+EMGRK VWGD+ A    EGQL+DND +N+K+ G L E+S +IRTTV
Sbjct  181   GFMSPNMGKAVGDMEMGRKTVWGDMNAMTDGEGQLADNDRLNIKD-GELDELSLDIRTTV  239

Query  1129  DE-GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
             DE GDR  + HPRRSSWGRKSGSWEMSPEVLALA+RVGE NRM
Sbjct  240   DEVGDRGGI-HPRRSSWGRKSGSWEMSPEVLALAARVGESNRM  281



>ref|XP_009396773.1| PREDICTED: probable protein S-acyltransferase 7 [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 245/294 (83%), Gaps = 9/294 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVKY  432
             L LLL+TSGRDPGI+PRN HPPEP+   G+ E GG QTPQLRLPR K+V VNGITVK+KY
Sbjct  98    LSLLLVTSGRDPGIIPRNTHPPEPETNGGDSEVGGVQTPQLRLPRTKDVIVNGITVKIKY  157

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFF+MFVFSTTLLC+YVFG
Sbjct  158   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGIRNYRFFYMFVFSTTLLCLYVFG  217

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI  I DAE+T+IW+AM+KTPAS+VLI YTF+SVWFVGGL+ FHLYL+STNQTTYE
Sbjct  218   FCWVYIISIRDAEQTSIWRAMVKTPASIVLIIYTFLSVWFVGGLSVFHLYLMSTNQTTYE  277

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYNKGVVENF EIF TSIPPSKN+FR +VP++  L  +    GF+SPNM
Sbjct  278   NFRYRYDRRANPYNKGVVENFKEIFFTSIPPSKNNFRGRVPQEQGLQPQPAGQGFLSPNM  337

Query  973   GKAVEDIEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKE-----GGGLGEMSPEI  1116
             GKA+ DIEMGRK + W +  A    G L   +G+N  +      GGLG +SP++
Sbjct  338   GKALGDIEMGRKPISWDEARALAHVGDL--EEGINDTKMLDAMNGGLGVLSPDL  389



>ref|XP_009383864.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score =   442 bits (1136),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 228/339 (67%), Positives = 267/339 (79%), Gaps = 13/339 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL+TSGRDPGIVPRN HPPE + F+ N E GG +T QL LPR K+V VNG+TVKVK+
Sbjct  24    LILLLVTSGRDPGIVPRNPHPPEAEIFEDNSEVGGARTAQLHLPRTKDVNVNGMTVKVKF  83

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTC+LYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  84    CDTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  143

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             F WV I +I +AE+ ++W+AM KTPAS+VLI Y FISVWFVGGL+ FHLYL+STNQTTYE
Sbjct  144   FSWVCIVKIRNAEQISLWRAMTKTPASIVLIIYIFISVWFVGGLSVFHLYLMSTNQTTYE  203

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYN+GVVENF EIF TSIPPSKN FRA+VPR+         GGF+SPNM
Sbjct  204   NFRYRYDRRANPYNRGVVENFKEIFFTSIPPSKNKFRARVPREQEYQQLTIGGGFMSPNM  263

Query  973   GKAVEDIEMGRKAV-WGDVGAEHQ----EGQLSDNDGVNMKEGGGLGEMSPEIR----TT  1125
             G+AV DIEMGRK V W ++ A  Q    EG LS  + V+ K+   LGE+SP++R    +T
Sbjct  264   GRAVGDIEMGRKPVTWDELRAVTQAGDLEGGLSSRNMVDDKD-SELGEVSPDLRREFLST  322

Query  1126  VDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGE  1242
                  +AA+HH  R S   + GSWE  PEV A+AS + E
Sbjct  323   RGVEVQAALHH--RRSSWGRGGSWETMPEVRAVASAMWE  359



>ref|XP_006844579.1| hypothetical protein AMTR_s00016p00200180 [Amborella trichopoda]
 gb|ERN06254.1| hypothetical protein AMTR_s00016p00200180 [Amborella trichopoda]
Length=429

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 242/357 (68%), Positives = 269/357 (75%), Gaps = 38/357 (11%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL LLLLTSGRDPGI+PRNAHPPEP+ FDG+IE GGGQTPQLRLPR+K+V VNGI+VK+K
Sbjct  93    VLSLLLLTSGRDPGIIPRNAHPPEPEGFDGSIEVGGGQTPQLRLPRMKDVVVNGISVKIK  152

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFVFSTTLLCIYVF
Sbjct  153   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVFSTTLLCIYVF  212

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FC +YI+RIMD E T++WKA+IKTPAS+VLI YTFISVWFVGGLT FHLYLISTNQTTY
Sbjct  213   AFCCLYIKRIMDFENTSVWKALIKTPASIVLIIYTFISVWFVGGLTVFHLYLISTNQTTY  272

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALA------ARHTAG  951
             ENFRYRYDRRANPYN GVV NF EIF + + PSKN FRA+VP +          AR    
Sbjct  273   ENFRYRYDRRANPYNLGVVNNFKEIFFSEMTPSKNKFRARVPEEEGSTGLGLGQARVGPA  332

Query  952   GFVSPNMGKAV--EDIEMGRKAVWGDVGAEHQ--EGQLS-----DNDGVNMKEGGGLGEM  1104
             GFVSPNMG+A    D+EMG KA W D+G      EG+LS     + DG    EG G+   
Sbjct  333   GFVSPNMGRATVGGDLEMGAKASWRDMGGNMADFEGRLSSEPQEEKDGAEGLEGRGV---  389

Query  1105  SPEIRTTVDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
                              HPRRSSWGRKSGSWE+SPEVL +    GE  R   S++ G
Sbjct  390   ----------------MHPRRSSWGRKSGSWEISPEVLGMP---GESERNSSSATQG  427



>gb|ABK25142.1| unknown [Picea sitchensis]
Length=449

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 235/351 (67%), Positives = 264/351 (75%), Gaps = 20/351 (6%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKD-FDGNI----EGGGQTPQLRLPRIKEVEVNGIT  417
             VLVLLLLTSGRDPGI+PRNAHPPEP++ +D         GGQTP  RLPR K+V VNGI+
Sbjct  96    VLVLLLLTSGRDPGIIPRNAHPPEPEEGYDVASLTPESIGGQTPHPRLPRTKDVFVNGIS  155

Query  418   VKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  597
             VK+KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC
Sbjct  156   VKIKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  215

Query  598   IYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN  777
             IYVF FCWVYI++IM A++ T+WKAM KTPAS+VLI YTF SVWFVGGLT FHLYLISTN
Sbjct  216   IYVFSFCWVYIKKIMVADDVTVWKAMSKTPASIVLILYTFFSVWFVGGLTVFHLYLISTN  275

Query  778   QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL--AARHTAG  951
             QTTYENFRYRYDRRANPYNKGV+ NF EIF +SIPPSKN FRAK+  D  L   +    G
Sbjct  276   QTTYENFRYRYDRRANPYNKGVIHNFKEIFFSSIPPSKNSFRAKLQHDSTLQDTSADPGG  335

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAE--------HQEGQLSDNDGVNMKEGGGLGEMS  1107
              F+SPNMGK   D+E+G K  W  VGAE           G L + DG        L    
Sbjct  336   NFLSPNMGKGGIDLEIGNKPSWPTVGAEALADFDEHESNGGLENKDGYEDSFAHALSRTL  395

Query  1108  PEIRTTVDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGG  1260
             P     V+  +     HPRRSSWGRKSGSWE++P++LALA+ V E NR+ G
Sbjct  396   P-----VESAEGRGGIHPRRSSWGRKSGSWEITPDILALAAGVNEANRVSG  441



>ref|XP_008239524.1| PREDICTED: probable protein S-acyltransferase 7 [Prunus mume]
Length=444

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 262/339 (77%), Gaps = 5/339 (1%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGIVPRN HPPEP+D+D +IEGG  +T Q R PR+KEV +NGI VK+KYCDTCMLY
Sbjct  99    SGRDPGIVPRNVHPPEPEDYDASIEGGSNETQQSRFPRMKEVVINGIIVKIKYCDTCMLY  158

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCV RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV GFCWVY+ 
Sbjct  159   RPPRCSHCSICNNCVLRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCVYVQGFCWVYVV  218

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM +E+ +IWKA+IKTPAS+ LI Y+FI+ WFVGGLT FH YLISTNQ+TYENFRYRYD
Sbjct  219   RIMHSEDISIWKALIKTPASIALIIYSFIAFWFVGGLTMFHSYLISTNQSTYENFRYRYD  278

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
              R NP+N+G ++NFMEIFCT IPPS+N+FR KVP+DP +        FV+P MGKA+ DI
Sbjct  279   GRDNPFNRGTIKNFMEIFCTKIPPSRNNFREKVPKDPPVLPTPIGANFVNPVMGKAMSDI  338

Query  994   EMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRAAMHHPrr  1167
             EMGRK +W +  A  + G  S++DGVN        + S ++  T+  +  +R    HPRR
Sbjct  339   EMGRKPLWNE--ASEELGDYSNDDGVNKDPRSSEADASQDLSGTLPTESTERHVTSHPRR  396

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             SSWGR+SGS ++SPEVLA+++ VG+  R+    SG    
Sbjct  397   SSWGRRSGSLDISPEVLAMSAGVGDSRRVTDGISGNFTT  435



>ref|XP_007209138.1| hypothetical protein PRUPE_ppa005782mg [Prunus persica]
 gb|EMJ10337.1| hypothetical protein PRUPE_ppa005782mg [Prunus persica]
Length=444

 Score =   442 bits (1138),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 262/337 (78%), Gaps = 5/337 (1%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             S RDPGIVPRN HPPEP+D+D +IEGG  +T Q R PR+KEV +NGI VK+KYCDTCMLY
Sbjct  99    SVRDPGIVPRNVHPPEPEDYDASIEGGSNETQQSRFPRMKEVVINGIIVKIKYCDTCMLY  158

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV GFCWVY+ 
Sbjct  159   RPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCVYVQGFCWVYVV  218

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM +E+ +IWKA+IKTPAS+ LI Y+FI+ WFVGGLT FH YLISTNQ+TYENFRYRYD
Sbjct  219   RIMHSEDISIWKALIKTPASIALIIYSFIAFWFVGGLTMFHSYLISTNQSTYENFRYRYD  278

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
              R NP+N+G +ENFMEIFCT IPPS+N+FR K+P+DP +        FV+P MGKA+ DI
Sbjct  279   GRDNPFNRGTIENFMEIFCTKIPPSRNNFREKIPKDPPVLPTPIDANFVNPVMGKAMSDI  338

Query  994   EMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRAAMHHPrr  1167
             EMGRK +W +  AE   G  S++DGVN        + S ++  T+  +  +R    HPRR
Sbjct  339   EMGRKPLWNEASAE--LGDYSNDDGVNKDPRSSEADASQDLSGTLPTESTERHVASHPRR  396

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             SSWGR+SGS ++SPEVLA+A+ VG+  R+    +G  
Sbjct  397   SSWGRRSGSLDISPEVLAMAAGVGDSRRVTDGINGNF  433



>ref|XP_009411802.1| PREDICTED: probable protein S-acyltransferase 7 [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/344 (67%), Positives = 266/344 (77%), Gaps = 12/344 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGIVPRNAHPPEP+ F+GN E GG +TPQLRLPR K+V VNGI VKVKYCDTCMLY
Sbjct  103   SGRDPGIVPRNAHPPEPEIFEGNTEIGGVRTPQLRLPRTKDVNVNGIIVKVKYCDTCMLY  162

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFGFCWVYI 
Sbjct  163   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFGFCWVYIV  222

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             +I +AE+ +IW+AM KT AS+VLI YTF+SVWFVGGL+ FHLYL+STNQTTYENFRYRYD
Sbjct  223   KIRNAEQISIWRAMTKTLASIVLIVYTFLSVWFVGGLSVFHLYLMSTNQTTYENFRYRYD  282

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             RRANPY++GVV+NF EIF TSIPPSKN FRA+VP++     R T GGF+SPNMGKAV DI
Sbjct  283   RRANPYDRGVVKNFKEIFFTSIPPSKNKFRARVPQEQRFQPRSTGGGFMSPNMGKAVSDI  342

Query  994   EMGRKAV-WGDVGAEHQEGQLSD---NDGVNMKEGGGLGE----MSPEIRTTVDEGDRAA  1149
             EMGRK V W ++ A  Q G L +   N  +   +   LGE    +S E  +T     +AA
Sbjct  343   EMGRKPVTWDELRAITQIGDLEEGLHNANIEDDKVRELGEASTDLSREAVSTRSMEVQAA  402

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             +H   R S   + GSWE + E+  + +  GE NRM  S +G  N
Sbjct  403   LHD--RRSSWGRGGSWERTYELQPVEAARGETNRM-ASGNGSSN  443



>gb|ACJ85439.1| unknown [Medicago truncatula]
Length=264

 Score =   434 bits (1117),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 229/258 (89%), Gaps = 6/258 (2%)
 Frame = +1

Query  328   KDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLYRPPRCSHCSICNNCVER  504
             K  +G +E G GQTPQLRLPRIKEVEVNGI+VKVKYCDTCMLYRPPRCSHCSICNNCVER
Sbjct  8     KGVEGGLEVGSGQTPQLRLPRIKEVEVNGISVKVKYCDTCMLYRPPRCSHCSICNNCVER  67

Query  505   FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIRRIMDAEETTIWKAMIKT  684
             FDHHCPWVGQCIGLRNYRFFFMFVFS TLLCIYVF FCWVYIRRIM AEETTIWKAMIK+
Sbjct  68    FDHHCPWVGQCIGLRNYRFFFMFVFSATLLCIYVFAFCWVYIRRIMKAEETTIWKAMIKS  127

Query  685   PASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYDRRANPYNKGVVENFMEI  864
             PAS+VLI YTFI +WFVGGLTAFHLYLISTNQTTYENFRYRYDRRA+PYNKGV +NF EI
Sbjct  128   PASIVLIIYTFICMWFVGGLTAFHLYLISTNQTTYENFRYRYDRRASPYNKGVFDNFKEI  187

Query  865   FCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDIEMGRKAVW-GDVGA--E  1035
             F TSIPPSKN+FRAKVP +P L AR   GGF+SP+MGKAV+DIEMGRK VW GD+G+  +
Sbjct  188   FFTSIPPSKNNFRAKVPVEPVLPARSVGGGFMSPSMGKAVDDIEMGRKTVWAGDMGSSID  247

Query  1036  HQEGQLSDNDGVNMKEGG  1089
             H EGQL++   +  K+GG
Sbjct  248   HCEGQLNNRGAI--KDGG  263



>ref|XP_009347836.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   441 bits (1135),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 265/341 (78%), Gaps = 11/341 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVK  429
             VLV L+LTSGRDPGIVPRN  PPEP+D+D ++E G  ++ Q R PR +EV +NGITVK+K
Sbjct  94    VLVFLMLTSGRDPGIVPRNLCPPEPEDYDASMESGSSESQQPRFPRTREVVINGITVKIK  153

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFV S TLLC+YV 
Sbjct  154   YCDTCMLYRPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVSSATLLCLYVQ  213

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVY+ RIM  E+ +IWKA++KTPAS+ LI Y+FI+ WFVGGLT FH YLIS NQ+TY
Sbjct  214   GFCWVYVVRIMHGEDISIWKALVKTPASIALIIYSFIAFWFVGGLTVFHSYLISMNQSTY  273

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYD R NP+NKG ++NFME+FCTSI PSKN+FRAKVP+DP L A      FVSP 
Sbjct  274   ENFRYRYDGRENPFNKGTIKNFMEVFCTSISPSKNNFRAKVPKDPVLPA-PVGANFVSPV  332

Query  970   MGKAVEDIEMGRKAVWGDVGAE--HQEGQLSDNDGVN----MKEGGGLGEMSPEIRTTVD  1131
             MG+A+ DIEMGRK  W D   E    EGQ S NDGVN    + E     ++S  +RT  +
Sbjct  333   MGRAMSDIEMGRKPFWNDASGEVGDYEGQFS-NDGVNKDPRVSEADRSQDLSRSLRT--E  389

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
               +R    HPRRSSWGR+SGS +++PEVLA A+ VG+  R+
Sbjct  390   STERHVASHPRRSSWGRRSGSIDIAPEVLAFAAGVGDSKRV  430



>ref|XP_009383862.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009383863.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=450

 Score =   441 bits (1135),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/339 (67%), Positives = 267/339 (79%), Gaps = 13/339 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLL+TSGRDPGIVPRN HPPE + F+ N E GG +T QL LPR K+V VNG+TVKVK+
Sbjct  97    LILLLVTSGRDPGIVPRNPHPPEAEIFEDNSEVGGARTAQLHLPRTKDVNVNGMTVKVKF  156

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTC+LYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  157   CDTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  216

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             F WV I +I +AE+ ++W+AM KTPAS+VLI Y FISVWFVGGL+ FHLYL+STNQTTYE
Sbjct  217   FSWVCIVKIRNAEQISLWRAMTKTPASIVLIIYIFISVWFVGGLSVFHLYLMSTNQTTYE  276

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDRRANPYN+GVVENF EIF TSIPPSKN FRA+VPR+         GGF+SPNM
Sbjct  277   NFRYRYDRRANPYNRGVVENFKEIFFTSIPPSKNKFRARVPREQEYQQLTIGGGFMSPNM  336

Query  973   GKAVEDIEMGRKAV-WGDVGAEHQ----EGQLSDNDGVNMKEGGGLGEMSPEIR----TT  1125
             G+AV DIEMGRK V W ++ A  Q    EG LS  + V+ K+   LGE+SP++R    +T
Sbjct  337   GRAVGDIEMGRKPVTWDELRAVTQAGDLEGGLSSRNMVDDKD-SELGEVSPDLRREFLST  395

Query  1126  VDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGE  1242
                  +AA+HH  R S   + GSWE  PEV A+AS + E
Sbjct  396   RGVEVQAALHH--RRSSWGRGGSWETMPEVRAVASAMWE  432



>ref|XP_010450570.1| PREDICTED: probable protein S-acyltransferase 6 [Camelina sativa]
Length=410

 Score =   439 bits (1130),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 257/329 (78%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             ++LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEVNG   KVKY
Sbjct  91    IILLMLTSGRDPGIIPRNSHPPEPEVLDGNTGSGTSQTP--RLPRVKEVEVNGKVFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYIR+I  +E+ +I KAM+KTPAS+ LI YT I  +FVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIRKIKKSEDISILKAMLKTPASIALIIYTSICTFFVGGLTCFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDRR+NP+NKGVV+NF EIF + IPPSKN+FRA VPR+  + +R   GGF+SPNM
Sbjct  269   NFRYSYDRRSNPHNKGVVDNFKEIFFSLIPPSKNNFRALVPRENPMPSRSVVGGFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIE+GRK VW    AEH  G+  DN+         L E+SP++RT VD G++   
Sbjct  329   GKANDDIEIGRKGVWA--MAEHGGGKNDDNNERFHVNDNELNELSPDMRTIVDSGEQVDR  386

Query  1153  --HHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       +S +WEMSPEV+AL++R
Sbjct  387   PNNHP-------RSSNWEMSPEVMALSAR  408



>ref|XP_010436045.1| PREDICTED: probable protein S-acyltransferase 6 [Camelina sativa]
Length=407

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 258/329 (78%), Gaps = 17/329 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             ++LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEVNG   KVKY
Sbjct  91    IILLMLTSGRDPGIIPRNSHPPEPEVLDGNTGSGTSQTP--RLPRVKEVEVNGKVFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYIR+I  +E+ +I KAM+KTPAS+ LI YT IS +FVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIRKIKKSEDISILKAMLKTPASIALIIYTSISTFFVGGLTCFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDRR+NP+NKGVV+NF EIF + IPPSKN+FRA VPR+  + +R   GGF+SPNM
Sbjct  269   NFRYSYDRRSNPHNKGVVDNFKEIFFSLIPPSKNNFRAMVPRENPMPSRSVVGGFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIEMGRK VW    AEH  G+  DN   N +      E+SP++RT VD G++   
Sbjct  329   GKANDDIEMGRKGVWA--MAEHGGGKNDDN---NERFHVNDNELSPDMRTIVDSGEQIDR  383

Query  1153  --HHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       ++ +WEMSPEV+AL++R
Sbjct  384   PNNHP-------RNSNWEMSPEVMALSAR  405



>ref|XP_010441268.1| PREDICTED: probable protein S-acyltransferase 6 [Camelina sativa]
Length=410

 Score =   439 bits (1129),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 257/329 (78%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             ++LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEV G   KVKY
Sbjct  91    IILLMLTSGRDPGIIPRNSHPPEPEVLDGNTGSGTSQTP--RLPRVKEVEVKGKVFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYIR+I  +E+ +I KAM+KTPAS+ LI YT IS +FVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIRKIKKSEDISILKAMLKTPASIALIIYTSISTFFVGGLTCFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDRR+NP+NKGVV+NF EIF + IPPSKN+FRA VPR+ ++ +R   GGF+SPNM
Sbjct  269   NFRYSYDRRSNPHNKGVVDNFKEIFFSLIPPSKNNFRAMVPRENSMPSRSVVGGFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA ++IEMGRK VW    AEH   +  DN+         L E+SP++RT VD G++   
Sbjct  329   GKANDEIEMGRKGVWA--MAEHGGAKNDDNNERFHVNDNELNELSPDMRTIVDSGEQVDR  386

Query  1153  --HHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       +S +WEMSPEV+AL++R
Sbjct  387   PNNHP-------RSSNWEMSPEVMALSAR  408



>ref|XP_006405397.1| hypothetical protein EUTSA_v10027785mg [Eutrema salsugineum]
 gb|ESQ46850.1| hypothetical protein EUTSA_v10027785mg [Eutrema salsugineum]
Length=412

 Score =   439 bits (1129),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 255/329 (78%), Gaps = 12/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQ-TPQLRLPRIKEVEVNGITVKVKY  432
             L+LL+LTS RDPGI+PRN+HPPEP+  DGN   G   TP  RLPR+KEVEVNGI  KVKY
Sbjct  91    LILLMLTSARDPGIIPRNSHPPEPEVLDGNTNSGTSLTP--RLPRVKEVEVNGIIFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV  
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVLA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYIR+I ++E  TIWKAM+KTPAS+ LI YTFIS+WFVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIRKIKESENVTIWKAMLKTPASIALIIYTFISMWFVGGLTGFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDP--ALAARHTAGGFVSP  966
             NFRY YDRR+NP+NKGVV+NF EIF ++IPPSKN+FRA VPR+    + +R   GGF+SP
Sbjct  269   NFRYSYDRRSNPHNKGVVDNFKEIFYSAIPPSKNNFRAMVPREAPVMMPSRSAVGGFMSP  328

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
             NMG+A ++IEMGRK VW    AEH + +  +N+         LGE+S  +RT VD+  R 
Sbjct  329   NMGRANDEIEMGRKGVWA--MAEHGDDKNGNNNERFHVNEHELGELSSGVRTEVDDDART  386

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASR  1233
                +        +  SWEMSPEV+ALA+R
Sbjct  387   DRPN-----IPPRHASWEMSPEVMALAAR  410



>emb|CDY46404.1| BnaC04g33230D [Brassica napus]
Length=406

 Score =   439 bits (1128),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 221/331 (67%), Positives = 255/331 (77%), Gaps = 21/331 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             ++LL+LTSGRDPGI+PRN+HPPEP+  DGN  G  QTP  RLPR+KEVEVNG   KVKYC
Sbjct  91    IILLMLTSGRDPGIIPRNSHPPEPEAIDGN-SGASQTP--RLPRVKEVEVNGNIFKVKYC  147

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV  F
Sbjct  148   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVLAF  207

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             C VYIR+I ++E+TTIWKAM+KTPAS+ LI YTFI +WFVGGLT FHLYLISTNQTTYEN
Sbjct  208   CCVYIRKIKESEDTTIWKAMLKTPASIALIIYTFICMWFVGGLTCFHLYLISTNQTTYEN  267

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARH-TAGGFVSPNM  972
             FRY YDRR+NP+NKGVV+NF EIFC++IPPSKN FRA VPR+  + +R    GGF+SPNM
Sbjct  268   FRYSYDRRSNPHNKGVVDNFKEIFCSAIPPSKNSFRAMVPREAPMPSRSAVGGGFMSPNM  327

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE----GD  1140
             G+  ++IEMGRK VW    AEH + +   N+         LG    +IRTT D+    G 
Sbjct  328   GRGNDEIEMGRKGVWA--MAEHGDDKNVGNNERFHVNDDELG----DIRTTTDDDEQSGS  381

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASR  1233
             R    HP       +  SWEMSPEV+ALASR
Sbjct  382   RPTNIHP-------RHSSWEMSPEVMALASR  405



>ref|XP_006283837.1| hypothetical protein CARUB_v10004938mg [Capsella rubella]
 gb|EOA16735.1| hypothetical protein CARUB_v10004938mg [Capsella rubella]
Length=410

 Score =   438 bits (1127),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 259/329 (79%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEVNG   KVKY
Sbjct  91    LILLMLTSGRDPGIIPRNSHPPEPEVLDGNTGSGTSQTP--RLPRVKEVEVNGKVFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYIR+I ++E+ TI KAM+KTPAS+ LI YT I  +FVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIRKIKESEDITILKAMLKTPASIALIIYTSICTFFVGGLTCFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDR +NP+NKGVV+NF EIF + IPPSKN+FRA V R+  + +R   GGF+SPNM
Sbjct  269   NFRYSYDRHSNPHNKGVVDNFKEIFFSLIPPSKNNFRAMVLRENPMPSRSVVGGFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             GKA +DIEMGRK VW    AEH +G+  +N+         L E+SP++RT VD G+++ +
Sbjct  329   GKANDDIEMGRKGVWA--MAEHGDGKDDNNNERFHVNDNELNELSPDMRTIVDGGEQSDI  386

Query  1153  --HHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       +S +WEMSPEV+AL++R
Sbjct  387   RNNHP-------RSSNWEMSPEVMALSAR  408



>ref|XP_009342210.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
 ref|XP_009342211.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   439 bits (1130),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 224/350 (64%), Positives = 268/350 (77%), Gaps = 13/350 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVK  429
             VLV L+LTSGRDPGIVPRN  PPEP+D+D ++E G  ++ Q R PR +EV +N ITVK+K
Sbjct  94    VLVFLMLTSGRDPGIVPRNLCPPEPEDYDASMESGSSESQQPRFPRTREVVINDITVKIK  153

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFV S TLLC+YV 
Sbjct  154   YCDTCMLYRPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVSSATLLCLYVQ  213

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVY+ RIM  E+ +IWKA++KTPAS+ LI Y+FI+ WFVGGLT FH YLIS NQ+TY
Sbjct  214   GFCWVYVVRIMHGEDISIWKALVKTPASIALIIYSFIAFWFVGGLTVFHSYLISMNQSTY  273

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYD R NP+NKG ++NFME+FCTSI PSKN+FRAKVP+DP L A      FVSP 
Sbjct  274   ENFRYRYDGRENPFNKGTIKNFMEVFCTSISPSKNNFRAKVPKDPVLPA-PVGANFVSPV  332

Query  970   MGKAVEDIEMGRKAVWGDVGAE--HQEGQLSDNDGVN----MKEGGGLGEMSPEIRTTVD  1131
             MG+A+ DIEMGRK  W D   E    EGQ S NDGVN    + E     ++S  +RT  +
Sbjct  333   MGRAMSDIEMGRKPFWNDASGEVGDYEGQFS-NDGVNKDPRVSEADRSQDLSRSLRT--E  389

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
               +R    HPRRSSWGR+SGS +++PEVLA A+ VG+  R+  +   G+N
Sbjct  390   STERHVASHPRRSSWGRRSGSIDIAPEVLAFAAGVGDSKRV--TDGNGIN  437



>ref|XP_002870656.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46915.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 258/329 (78%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LL+LTSGRDPGI+PRN+HPPEP+  DG I G G +   RL R+KEVEVNG   KVKYC
Sbjct  91    LILLMLTSGRDPGIIPRNSHPPEPEVLDG-ITGSGTSQTPRLHRVKEVEVNGKIFKVKYC  149

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLCIYVF F
Sbjct  150   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCIYVFAF  209

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             C VYIR+I ++E+ TI KAM+KTPAS+ LI YTFIS +FVGGLT FHLYLISTNQTTYEN
Sbjct  210   CCVYIRKIKESEDITILKAMLKTPASIALILYTFISTFFVGGLTCFHLYLISTNQTTYEN  269

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRY YDR +NP+NKGVV+NF EIF + IPPSKN+FRA VPR+  +  R   GGF+SPNMG
Sbjct  270   FRYSYDRLSNPHNKGVVDNFKEIFFSPIPPSKNNFRAMVPRENPMPPRSVVGGFMSPNMG  329

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD---EGDRA  1146
             KA +DIEMGRK VW    AEH +G+  +N+         L E+SP++RT VD   + DR 
Sbjct  330   KANDDIEMGRKGVWA--MAEHGDGKNGNNNERFHVNDNELNELSPDMRTIVDGDEQIDRP  387

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASR  1233
             + +HP       ++ +WEMSPEV+AL++R
Sbjct  388   S-NHP-------RNANWEMSPEVMALSAR  408



>ref|NP_001078687.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 gb|AED94632.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=395

 Score =   436 bits (1121),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 256/329 (78%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEVNG   KVKY
Sbjct  76    LILLMLTSGRDPGIIPRNSHPPEPEVVDGNTGSGTSQTP--RLPRVKEVEVNGKVFKVKY  133

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  134   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  193

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYI++I ++E+ +I KAM+KTPAS+ LI YTFIS +FVGGLT FHLYLISTNQTTYE
Sbjct  194   FCCVYIKKIKESEDISILKAMLKTPASIALILYTFISTFFVGGLTCFHLYLISTNQTTYE  253

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDR +NP+NKGVV+NF EIF + IPPSKN+FRA VPR+  + +R   GGF+SPNM
Sbjct  254   NFRYSYDRHSNPHNKGVVDNFKEIFFSPIPPSKNNFRAMVPRENPMPSRSVVGGFMSPNM  313

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRA  1146
             GKA +DIEMGRK VW    AEH +G+  +N+         L E+SP++   V  DE    
Sbjct  314   GKANDDIEMGRKGVWA--MAEHGDGKDGNNNERFHVNDNELNELSPDMGNIVNGDEQINR  371

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       ++ +WEMSPEV+AL++R
Sbjct  372   PNNHP-------RNANWEMSPEVMALSAR  393



>ref|XP_009125172.1| PREDICTED: probable protein S-acyltransferase 6 [Brassica rapa]
Length=317

 Score =   432 bits (1112),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 219/331 (66%), Positives = 252/331 (76%), Gaps = 21/331 (6%)
 Frame = +1

Query  247   TQVLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKV  426
             +Q L+LL+LTSGRDPGIVPRN+HPPEP+  DG      QTP  RLPR+KEVEVNG   KV
Sbjct  4     SQDLILLMLTSGRDPGIVPRNSHPPEPEVLDGT----SQTP--RLPRVKEVEVNGNIFKV  57

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV
Sbjct  58    KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYV  117

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
               FC VYIR+I ++E+ TIWKAM+KTPAS+ LI YTFI +WFVGGLT FHLYLISTNQTT
Sbjct  118   LAFCCVYIRKIKESEDITIWKAMLKTPASIALIIYTFICMWFVGGLTCFHLYLISTNQTT  177

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSP  966
             YENFRY YDR +N +NKGVV+NF EIFC++IPPSKNDFRA V R+  + +R   GGFVSP
Sbjct  178   YENFRYSYDRHSNQHNKGVVDNFKEIFCSAIPPSKNDFRAMVTREAPMPSRSAVGGFVSP  237

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRA  1146
             NMG+  ++IEMGRK VW    AEH   +   ND         LG    +IRTT D+ +R+
Sbjct  238   NMGRGNDEIEMGRKGVWA--MAEHGGDKNGGNDERFHVNDDELG----DIRTTTDDDERS  291

Query  1147  AMH--HPrrsswgrksgswEMSPEVLALASR  1233
                  HP       +  SWEMSPEV+ALA+R
Sbjct  292   GRPNIHP-------RHSSWEMSPEVVALAAR  315



>ref|NP_198922.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q9FLM3.1|ZDH23_ARATH RecName: Full=Probable protein S-acyltransferase 6; AltName: 
Full=Probable palmitoyltransferase At5g41060; AltName: Full=Zinc 
finger DHHC domain-containing protein At5g41060 [Arabidopsis 
thaliana]
 dbj|BAB09708.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK76652.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85057.1| unknown protein [Arabidopsis thaliana]
 gb|AED94631.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=410

 Score =   435 bits (1118),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 256/329 (78%), Gaps = 14/329 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI-EGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LL+LTSGRDPGI+PRN+HPPEP+  DGN   G  QTP  RLPR+KEVEVNG   KVKY
Sbjct  91    LILLMLTSGRDPGIIPRNSHPPEPEVVDGNTGSGTSQTP--RLPRVKEVEVNGKVFKVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FC VYI++I ++E+ +I KAM+KTPAS+ LI YTFIS +FVGGLT FHLYLISTNQTTYE
Sbjct  209   FCCVYIKKIKESEDISILKAMLKTPASIALILYTFISTFFVGGLTCFHLYLISTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRY YDR +NP+NKGVV+NF EIF + IPPSKN+FRA VPR+  + +R   GGF+SPNM
Sbjct  269   NFRYSYDRHSNPHNKGVVDNFKEIFFSPIPPSKNNFRAMVPRENPMPSRSVVGGFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV--DEGDRA  1146
             GKA +DIEMGRK VW    AEH +G+  +N+         L E+SP++   V  DE    
Sbjct  329   GKANDDIEMGRKGVWA--MAEHGDGKDGNNNERFHVNDNELNELSPDMGNIVNGDEQINR  386

Query  1147  AMHHPrrsswgrksgswEMSPEVLALASR  1233
               +HP       ++ +WEMSPEV+AL++R
Sbjct  387   PNNHP-------RNANWEMSPEVMALSAR  408



>ref|XP_009140064.1| PREDICTED: probable protein S-acyltransferase 6 [Brassica rapa]
 emb|CDY48960.1| BnaA04g10800D [Brassica napus]
Length=407

 Score =   434 bits (1117),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/331 (66%), Positives = 256/331 (77%), Gaps = 21/331 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             ++LL+LTSGRDPGI+PRN+HPPEP+  DGN  G  QTP  RLPR+KEVEVNG   KVKYC
Sbjct  91    IILLMLTSGRDPGIIPRNSHPPEPEVLDGN-SGTSQTP--RLPRVKEVEVNGNIFKVKYC  147

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV  F
Sbjct  148   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVLAF  207

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             C VYIR+I ++E+ TIWKAM+KTPAS+ LI YTFI +WFVGGLT FHLYLISTNQTTYEN
Sbjct  208   CCVYIRKIKESEDITIWKAMLKTPASIALIIYTFICMWFVGGLTGFHLYLISTNQTTYEN  267

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTA--GGFVSPN  969
             FRY YDRR+NP+NKGVV+NF EIFC++IPPSKN FRA VPR+ A     +A  GGF+SPN
Sbjct  268   FRYSYDRRSNPHNKGVVDNFKEIFCSAIPPSKNSFRAMVPREAAPMPSRSAVGGGFMSPN  327

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             MG+  ++IEMGRK VW    AEH +    D +G N +      +   +IRTT D+ +++ 
Sbjct  328   MGRGNDEIEMGRKGVWA--MAEHGD----DKNGSNNERFHVNDDELGDIRTTTDDDEQSG  381

Query  1150  MH---HPrrsswgrksgswEMSPEVLALASR  1233
                  HP       +  SWEMSPEV+ALASR
Sbjct  382   SRPNIHP-------RHSSWEMSPEVMALASR  405



>emb|CDX67485.1| BnaA07g15250D [Brassica napus]
Length=334

 Score =   432 bits (1110),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/328 (66%), Positives = 251/328 (77%), Gaps = 21/328 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LL+LTSGRDPGIVPRN+HPPEP+  DG      QTP  RLPR+KEV+VNG   KVKYC
Sbjct  24    LILLMLTSGRDPGIVPRNSHPPEPEVLDGT----SQTP--RLPRVKEVKVNGNIFKVKYC  77

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV  F
Sbjct  78    DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVLAF  137

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             C VYIR+I ++E+ TIWKAM+KTPAS+ LI YTFI +WFVGGLT FHLYLISTNQTTYEN
Sbjct  138   CCVYIRKIKESEDITIWKAMLKTPASIALIIYTFICMWFVGGLTGFHLYLISTNQTTYEN  197

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRY YDRR+NP+NKG+V+NF EIFC++IPPSKNDFRA V R+    +R   GGFVSPNMG
Sbjct  198   FRYSYDRRSNPHNKGIVDNFKEIFCSAIPPSKNDFRAMVTREAPTPSRSAVGGFVSPNMG  257

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             +  ++IEM RK VW    AEH + +   ND         LG    +IRTT D+ +R+   
Sbjct  258   RGNDEIEMRRKGVWA--MAEHGDDKNGGNDERFHVNDDELG----DIRTTTDDDERSGRP  311

Query  1156  --HPrrsswgrksgswEMSPEVLALASR  1233
               HP       +  SWEMSPEV+ALA+R
Sbjct  312   NIHP-------RHSSWEMSPEVVALAAR  332



>gb|KDP22570.1| hypothetical protein JCGZ_26401 [Jatropha curcas]
Length=456

 Score =   435 bits (1118),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 223/333 (67%), Positives = 264/333 (79%), Gaps = 6/333 (2%)
 Frame = +1

Query  280   GRDPGIVPRNAHPPEPKDFDGNIEG-GGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLYR  456
             GRDPGI+PRN  PPEP+ ++G+ E   GQTP  RLPR K+V +NGI VK KYCDTCMLYR
Sbjct  112   GRDPGIIPRNTQPPEPEGYEGHTEATNGQTPPFRLPRTKDVIINGIIVKTKYCDTCMLYR  171

Query  457   PPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIRR  636
             PPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFF FVF  T+LC+YV GFCWVYI+R
Sbjct  172   PPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFSFVFLATILCLYVHGFCWVYIKR  231

Query  637   IMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYDR  816
             IM++EETTIWKAM KTPAS+ L+ YTFISVWFVGGL+ FHLYLIS NQ+TYENFRYRYD 
Sbjct  232   IMNSEETTIWKAMAKTPASIALLVYTFISVWFVGGLSVFHLYLISKNQSTYENFRYRYDG  291

Query  817   RANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDIE  996
              ANP++KG+ ENF EIFC+SIPPSKN+FRA V ++P +  R T G FVS NM KAV DIE
Sbjct  292   LANPFDKGLFENFREIFCSSIPPSKNNFRAIVRKEPQIPPR-TVGTFVSSNMEKAVGDIE  350

Query  997   MGRKAVWGDVGAEHQE-GQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG-DRAAMHHPrr  1167
             MGRK VW D   E  + G+   ND  N+ E G L ++SP++ R    +G +  ++ H RR
Sbjct  351   MGRKPVWDDTAREVDDYGRTVRNDD-NLDEDGALADVSPDLSRILPPQGLEGRSVLHSRR  409

Query  1168  sswgrksgswEMSPEVLALASRVGEGNRMGGSS  1266
             SS GRKSGSWE+SP+VLALA+ VGE  R+ GS+
Sbjct  410   SSMGRKSGSWEISPDVLALAAGVGESKRVTGSN  442



>ref|XP_011023929.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Populus 
euphratica]
Length=459

 Score =   435 bits (1118),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/340 (64%), Positives = 266/340 (78%), Gaps = 6/340 (2%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGI+PRNAHPPE + ++GN     GQTP LRLPR K+V +NGITVK KYCDTCMLY
Sbjct  111   SGRDPGIIPRNAHPPELEGYEGNTPLTPGQTPPLRLPRTKDVVINGITVKTKYCDTCMLY  170

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF++T++C+YV  FCWVYI+
Sbjct  171   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFTSTIICLYVHAFCWVYIK  230

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM++EET+IWKAM KTPAS+ L+ YTFISVWFVGGLT FH YLIS NQ+TYENFRYRYD
Sbjct  231   RIMNSEETSIWKAMSKTPASVALVIYTFISVWFVGGLTLFHSYLISKNQSTYENFRYRYD  290

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
               ANP+++G++ENF EIFC+SIPPSKN FRAKVP++PA+  R  A  FVS ++ K+  DI
Sbjct  291   GLANPFDRGLIENFKEIFCSSIPPSKNSFRAKVPKEPAIPPRMVATSFVSSSVEKSAGDI  350

Query  994   EMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAAMHHPr  1164
             EMGRK VW +   +      + ND  ++ E   L ++SP++ R    +G   R+ MH  R
Sbjct  351   EMGRKPVWDEASGDDDYNGTARNDD-SLHEDSRLTDVSPDLSRILPPQGMEGRSVMHS-R  408

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             RSS GRKSGSW++SP+VLA+A+ +GE  RM   S   L +
Sbjct  409   RSSLGRKSGSWDISPDVLAVAAGIGESKRMASGSGDNLTS  448



>ref|XP_002321733.1| hypothetical protein POPTR_0015s11400g [Populus trichocarpa]
 gb|EEF05860.1| hypothetical protein POPTR_0015s11400g [Populus trichocarpa]
Length=450

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 271/347 (78%), Gaps = 6/347 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L  LLLTSGRDPGI+PRNAHPPEP+ ++GN     GQTP  RLPR K+V +NGITVK KY
Sbjct  95    LTFLLLTSGRDPGIIPRNAHPPEPEGYEGNTPLTPGQTPPFRLPRTKDVIINGITVKTKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF++T++C+YV  
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFTSTIICLYVHA  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI+RIM++EET+IWKAM KTPAS+ L+ YTFISVWFVGGLT FH YLIS NQ+TYE
Sbjct  215   FCWVYIKRIMNSEETSIWKAMSKTPASIALVIYTFISVWFVGGLTLFHSYLISKNQSTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD  ANP+++G++ENF EIFC+SIPPSKN FRAKVP++PA+  R  A  FVS ++
Sbjct  275   NFRYRYDGLANPFDRGLIENFKEIFCSSIPPSKNSFRAKVPKEPAIPPRMVASSFVSSSV  334

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DR  1143
              K+  DIEMGRK VW +   +      + ND  ++ E  GL ++SP++ R    +G   R
Sbjct  335   EKSAGDIEMGRKPVWDEASGDDDYNGTARNDD-SLHEDRGLPDVSPDLSRILPPQGMEGR  393

Query  1144  AAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             + MH  RRSS GRKSGSW++SP+VLALA+  GE  RM   S   L +
Sbjct  394   SVMHS-RRSSLGRKSGSWDISPDVLALAAGTGESKRMASGSGDNLTS  439



>ref|XP_008392726.1| PREDICTED: probable protein S-acyltransferase 7 [Malus domestica]
 ref|XP_008367458.1| PREDICTED: probable protein S-acyltransferase 7 [Malus domestica]
Length=452

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/334 (65%), Positives = 259/334 (78%), Gaps = 9/334 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGIVPRN +PPEP+D+D +IEGG  ++ Q R PR+KEV +NGI VK+K+CDTCML
Sbjct  100   TSGRDPGIVPRNLNPPEPEDYDASIEGGSSESQQPRFPRMKEVVINGIIVKIKFCDTCML  159

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV GFCWVY+
Sbjct  160   YRPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCLYVQGFCWVYV  219

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM  E+ +IWKA+IKTPAS+ LI Y+FI+ WFVGGLT FH YLISTNQ+TYENFRYRY
Sbjct  220   VRIMHGEDISIWKALIKTPASIGLIIYSFIAFWFVGGLTMFHSYLISTNQSTYENFRYRY  279

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             D R NP+NKG ++NFME+FCT I PSKN+ RAKVPRDP +        FVSP +GK + D
Sbjct  280   DGRENPFNKGTIKNFMEVFCTRISPSKNNXRAKVPRDPEVLPXPVGANFVSPXIGKXMSD  339

Query  991   IEMGRKAVWGDVGAEHQ--EGQLSDNDGVN----MKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             IEMGRK +  D   E +  EGQ S++DGVN    + E     ++S  +RT   E  R   
Sbjct  340   IEMGRKPLXNDASGEMRDYEGQFSNDDGVNKDPQVSEADRSQDLSRSLRTESTE--RHVA  397

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRM  1254
               PRRSSWGR+SGS +++PEVLA A+ VG+  R+
Sbjct  398   SQPRRSSWGRRSGSLDIAPEVLAFAAGVGDSRRV  431



>emb|CDY11734.1| BnaC06g13420D [Brassica napus]
Length=457

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/328 (66%), Positives = 251/328 (77%), Gaps = 21/328 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LL+LTSGRDPGIVPRN+HPP+P+  DG      QTP  RLPR+KEVEVNG   KVKYC
Sbjct  147   LILLMLTSGRDPGIVPRNSHPPQPEVLDGT----SQTP--RLPRVKEVEVNGNIFKVKYC  200

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFSTTLLC+YV  F
Sbjct  201   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVLAF  260

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             C VYI++I ++E+ TIWKAM+KTPAS+ LI YTFI +WFVGGLT FHLYLISTNQTTYEN
Sbjct  261   CCVYIKKIKESEDITIWKAMLKTPASIALIIYTFICMWFVGGLTGFHLYLISTNQTTYEN  320

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRY YDRR+NP+NKGVV+NF EIFC++IPPSKNDFRA V R+  + +R   GGFVSPNMG
Sbjct  321   FRYSYDRRSNPHNKGVVDNFKEIFCSAIPPSKNDFRAMVTREAPMPSRSAVGGFVSPNMG  380

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             +  ++IEM RK VW    AEH   +   ND         LG    +IRTT D+ +R+   
Sbjct  381   RGNDEIEMRRKGVWA--MAEHGADKNGGNDERFHVNDDELG----DIRTTTDDDERSGRP  434

Query  1156  --HPrrsswgrksgswEMSPEVLALASR  1233
               HP       +  SWEMSPEV+ALA+R
Sbjct  435   NIHP-------RHSSWEMSPEVVALAAR  455



>ref|XP_004957301.1| PREDICTED: probable S-acyltransferase At3g26935-like [Setaria 
italica]
Length=444

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 248/309 (80%), Gaps = 10/309 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  92    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMNNDAGNGQTPQQLRLPRTKDVFVNGVLVKVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  152   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE+++IWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  212   GFCWVYIVKIRDAEQSSIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYN+G+V NFMEIFCT++PPSKN+FRA+VP +  L  +R  A GF+SP
Sbjct  272   ENFRYRYDRRANPYNRGIVNNFMEIFCTAVPPSKNNFRARVPVEQGLQQSRAPARGFMSP  331

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDE  1134
             NMGK V D E+GRK V  D     A+ ++ ++     ++ KE G +   SP++ R  + E
Sbjct  332   NMGKPVGDFELGRKPVSWDEPRSAADIRDLEVGLGGLLDEKE-GRIAHASPDLSREALPE  390

Query  1135  --GDRAAMH  1155
                 RA MH
Sbjct  391   FTEGRAGMH  399



>gb|KFK33034.1| hypothetical protein AALP_AA6G322100 [Arabis alpina]
Length=408

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 253/325 (78%), Gaps = 10/325 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LL+LTS RDPGI+PRN HPPEP+  DGN + G QTP  RLPR+KEVEVNG   K KYC
Sbjct  91    LILLMLTSARDPGIIPRNLHPPEPQVLDGNTDSG-QTP--RLPRLKEVEVNGKIFKAKYC  147

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCI  RNYRFFFMFVFS TLLC+YV  F
Sbjct  148   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIAQRNYRFFFMFVFSRTLLCVYVCAF  207

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYI +I ++E+ +IWKAM+KTPAS+ LI Y+ I ++FVGGLT+FHLYLISTNQTTYEN
Sbjct  208   CWVYIIKIKNSEDISIWKAMLKTPASIALIIYSSICMFFVGGLTSFHLYLISTNQTTYEN  267

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRY YD  +NP+NKGV++NF EIF ++IP SKN+FRA VPR+  L +R   GGFVSPNMG
Sbjct  268   FRYSYDWHSNPHNKGVIDNFKEIFFSAIPASKNNFRAMVPRETPLPSRSVGGGFVSPNMG  327

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             +A ++IEMGRK VW    AE+ + +  +ND     +   L E+S ++R TVD+G+R    
Sbjct  328   RANDEIEMGRKGVWA--MAENGDDKNGNNDERFHVKDNELDELSSDVRITVDDGERTGRS  385

Query  1156  HPrrsswgrksgswEMSPEVLALAS  1230
             +        ++ SWEMSPEV+ALA+
Sbjct  386   N-----VNTRNSSWEMSPEVMALAA  405



>ref|XP_006645261.1| PREDICTED: probable protein S-acyltransferase 7-like [Oryza brachyantha]
Length=391

 Score =   427 bits (1097),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/284 (74%), Positives = 232/284 (82%), Gaps = 15/284 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+  DGN E G  QTP  RLPR+K+V VNGITVK KY
Sbjct  70    LSLLLLTSGRDPGIIPRNAHPPEPEGLDGNAEVGSNQTPPTRLPRVKDVVVNGITVKTKY  129

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  130   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  189

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I + E+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  190   FCWVYIIKIRNTEQITIWKAMAKTPASIALLIYTFIAVWFVGGLSVFHLYLMSTNQTTYE  249

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV--PRDPALAARHTAGGFVSP  966
             NFRYRYD+RANPYN+GVVEN  EIF ++IP SKN+FRAKV  P+D  L  R T  GF+SP
Sbjct  250   NFRYRYDQRANPYNRGVVENIKEIFFSAIPASKNNFRAKVPIPQDQGLRPRPT-NGFMSP  308

Query  967   NMGKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDG  1068
             NMG+AV DIEMGRK V W         GD+GA      L D DG
Sbjct  309   NMGRAVGDIEMGRKPVAWDEPRMAAEIGDLGA-GLSNLLEDKDG  351



>gb|EEC84857.1| hypothetical protein OsI_31977 [Oryza sativa Indica Group]
Length=441

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 261/347 (75%), Gaps = 14/347 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  DG  + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  93    LTLLLLTSGRDPGIVPRNTHPPEPESIDGGSDMGNGQTPQQLRLPRTKDVFVNGVIVKVK  152

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFSTTLLC+YVF
Sbjct  153   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGRRNYRFFYMFVFSTTLLCLYVF  212

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE +TIWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  213   GFCWVYIVKIRDAENSTIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  272

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHT-AGGFVSP  966
             ENFRYRYDRRANPYN+G+V NF+EIFCT+IPPSKN+FRA+VP D  L    T A GF+SP
Sbjct  273   ENFRYRYDRRANPYNRGMVNNFLEIFCTAIPPSKNNFRARVPVDQGLQQTRTPARGFMSP  332

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT--TVD  1131
             NMGK V D+E+GRK V  D     A+ ++ ++     ++ KE G +   SP++     + 
Sbjct  333   NMGKPVGDLELGRKPVSWDEPRSAADIRDLEVGLGGLLDEKE-GRIAHASPDLSLPGELV  391

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             EG RA MH  R S   R   S  M     ++A ++G     G  SSG
Sbjct  392   EG-RAGMHSRRSSWGHRSGTSESMD----SIAVQMGTEANWGSISSG  433



>ref|XP_009337538.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=452

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/344 (63%), Positives = 264/344 (77%), Gaps = 11/344 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQL-RLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGIVPRN +PPEP+D+D +IE G    Q  R PR+KEV +NGITVK+K+CDTCML
Sbjct  100   TSGRDPGIVPRNLNPPEPEDYDASIESGSSESQQSRFPRMKEVVINGITVKIKFCDTCML  159

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCV+RFDHHCPWVGQCIGLRNYRFFFMFVFS TLLC+YV GFCWVY+
Sbjct  160   YRPPRCSHCSICNNCVQRFDHHCPWVGQCIGLRNYRFFFMFVFSATLLCLYVQGFCWVYV  219

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM  E+ +IWKA+IKTPAS+ LI Y+FI+ WFVGGL+ FH YLISTNQ+TYENFRYRY
Sbjct  220   VRIMHGEDISIWKALIKTPASIGLIIYSFIAFWFVGGLSMFHSYLISTNQSTYENFRYRY  279

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             D R NP+NKG ++NFME+FCT I PSKN+FRAKVP+DP +        FVSP +GKA+ D
Sbjct  280   DGRENPFNKGTIKNFMEVFCTRISPSKNNFRAKVPKDPEVLPTPVGANFVSPVIGKAMSD  339

Query  991   IEMGRKAVWGDVGAEHQ--EGQLSDNDGVN----MKEGGGLGEMSPEIRTTVDEGDRAAM  1152
             IEMGRK +W D   E    EGQ S++DGVN    + E     ++S  +RT  +  +R   
Sbjct  340   IEMGRKPLWNDASGEMHDYEGQFSNDDGVNKDAAVSEADRSQDLSRSLRT--ESTERHVA  397

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
               PRRSSWGR+SGS +++PEVLA A+ VG+  R+  +   G+N 
Sbjct  398   SQPRRSSWGRRSGSLDIAPEVLAFAAGVGDSRRV--TDGNGING  439



>ref|XP_003564978.1| PREDICTED: probable protein S-acyltransferase 7 [Brachypodium 
distachyon]
Length=408

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 223/257 (87%), Gaps = 2/257 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ F+GN E G  QTP LRLPRIK+V VNGITVK KY
Sbjct  90    LSLLLLTSGRDPGIIPRNAHPPEPEGFEGNAEVGANQTPPLRLPRIKDVVVNGITVKTKY  149

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  150   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  209

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  210   FCWVYIVKIRNAEQITIWKAMAKTPASIALVVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  269

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+GVVEN  EIF T IP S+N+F  +VP+D  L  R T  GF+SPNM
Sbjct  270   NFRYRYDQRANPYNRGVVENIKEIFFTPIPQSRNNFGGRVPQDQGLRPRPTT-GFMSPNM  328

Query  973   GKAVEDIEMGRKAVWGD  1023
             G+AV DIEMGRK V  D
Sbjct  329   GRAVGDIEMGRKPVAWD  345



>ref|NP_001063622.1| Os09g0508300 [Oryza sativa Japonica Group]
 dbj|BAF25536.1| Os09g0508300 [Oryza sativa Japonica Group]
 dbj|BAH00669.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE70020.1| hypothetical protein OsJ_29957 [Oryza sativa Japonica Group]
Length=441

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 261/347 (75%), Gaps = 14/347 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  DG  + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  93    LTLLLLTSGRDPGIVPRNTHPPEPESIDGGSDMGNGQTPQQLRLPRTKDVFVNGVIVKVK  152

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFSTTLLC+YVF
Sbjct  153   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGRRNYRFFYMFVFSTTLLCLYVF  212

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE +TIWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  213   GFCWVYIVKIRDAENSTIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  272

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHT-AGGFVSP  966
             ENFRYRYDRRANPYN+G+V NF+EIFCT+IPPSKN+FRA+VP D  L    T A GF+SP
Sbjct  273   ENFRYRYDRRANPYNRGMVNNFLEIFCTAIPPSKNNFRARVPVDQGLQQTRTPARGFMSP  332

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT--TVD  1131
             NMGK V D+E+GRK V  D     A+ ++ ++     ++ KE G +   SP++     + 
Sbjct  333   NMGKPVGDLELGRKPVSWDEPRSAADIRDLEVGLGGLLDEKE-GRIAHASPDLSLPGELV  391

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
             EG RA MH  R S   R   S  M     ++A ++G     G  SSG
Sbjct  392   EG-RAGMHSRRSSWGHRSGTSESMD----SIAVQMGTEANWGSISSG  433



>dbj|BAK03564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=419

 Score =   426 bits (1096),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 200/257 (78%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LL LTSGRDPGI+PRNAHPPEP+ F+GN E G  QTP LRLPR+K+V VNGITVK KY
Sbjct  101   LSLLFLTSGRDPGIIPRNAHPPEPEGFEGNAEVGANQTPPLRLPRVKDVVVNGITVKTKY  160

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  161   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  220

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             F WVYI +I DAE+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  221   FSWVYIIKIRDAEQITIWKAMAKTPASIALVVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  280

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+GVVEN  EIF T IP S+NDF A+VP++  L  R T  GF+SPNM
Sbjct  281   NFRYRYDQRANPYNRGVVENIKEIFFTPIPASRNDFGARVPQEQGLRPRST-NGFMSPNM  339

Query  973   GKAVEDIEMGRKAVWGD  1023
             G+AV DIEMGRK V  D
Sbjct  340   GRAVGDIEMGRKPVAWD  356



>ref|XP_002462643.1| hypothetical protein SORBIDRAFT_02g029440 [Sorghum bicolor]
 gb|EER99164.1| hypothetical protein SORBIDRAFT_02g029440 [Sorghum bicolor]
Length=443

 Score =   427 bits (1098),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 264/347 (76%), Gaps = 14/347 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDG-NIEGGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D  N  G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  92    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMINDAGNGQTPQQLRLPRTKDVIVNGVIVKVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  152   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE+++IWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  212   GFCWVYIVKIRDAEQSSIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHT-AGGFVSP  966
             ENFRYRYDRRANPYN+G+V NFMEIFCT++PPSKN+FRA+VP +  L   H  A GF+SP
Sbjct  272   ENFRYRYDRRANPYNRGIVNNFMEIFCTAVPPSKNNFRARVPVEQGLQQSHAPARGFMSP  331

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDE  1134
             NMGK V ++E+GRK +  D     A+ ++ ++     ++ KE G +   SP++ R T+ E
Sbjct  332   NMGKPVGELELGRKPISWDEPRSAADIRDLEVGLGGLLDEKE-GRVAHASPDLSRETLPE  390

Query  1135  --GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
                 RA +H  R S   R   S  M     ++A ++G G+   GS S
Sbjct  391   LVEGRAGVHSRRSSWGHRSGTSESMD----SVAVQMGTGDSHWGSIS  433



>emb|CDM85836.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/257 (77%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LL LTSGRDPGI+PRNAHPPEP+ F+GN E G  QTP LRLPR+K+V VNGITVK KY
Sbjct  88    LSLLFLTSGRDPGIIPRNAHPPEPEGFEGNAEVGANQTPPLRLPRVKDVVVNGITVKTKY  147

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  148   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  207

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             F WVYI +I DAE+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  208   FSWVYIIKIRDAEQITIWKAMAKTPASIALVVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  267

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+GVVEN  EIF T IP S+N+F A+VP++  L  R T  GF+SPNM
Sbjct  268   NFRYRYDQRANPYNRGVVENIKEIFFTPIPASRNNFGARVPQEQGLRPRST-NGFMSPNM  326

Query  973   GKAVEDIEMGRKAVWGD  1023
             G+AV DIEMGRK V  D
Sbjct  327   GRAVGDIEMGRKPVAWD  343



>ref|NP_001130802.1| palmitoyltransferase ZDHHC9 [Zea mays]
 gb|ACF79112.1| unknown [Zea mays]
 gb|ACF79159.1| unknown [Zea mays]
 gb|ACG37282.1| palmitoyltransferase ZDHHC9 [Zea mays]
 gb|ACN34328.1| unknown [Zea mays]
 gb|AFW84093.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=406

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/311 (68%), Positives = 242/311 (78%), Gaps = 13/311 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ FDGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  86    LSLLLLTSGRDPGIIPRNAHPPEPEGFDGNAEVGANQTPPVRLPRVKDVVVNGITVKTKY  145

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  146   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  205

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV+I +I +AE+ TIWKAM KTPAS+ LI YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  206   FCWVFIIKIRNAEQITIWKAMTKTPASIALIIYTFIAVWFVGGLSVFHLYLMSTNQTTYE  265

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+R NPYNKGV+EN  EIF T+IPPSKN+F  +V ++  L  R T  GF+SPNM
Sbjct  266   NFRYRYDQRDNPYNKGVMENIKEIFFTTIPPSKNNFCGRVEQEHGLRPRPT-NGFMSPNM  324

Query  973   GKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT  1122
             G+AV DIEMGRK V W         GD+GA      L D DG        L   +  +  
Sbjct  325   GRAVGDIEMGRKPVAWDEPRMAAEIGDLGA-GLSNLLEDKDGRFRTTSPDLSRDALAVGG  383

Query  1123  TVDEGDRAAMH  1155
              ++E   +AM+
Sbjct  384   GLEEHGSSAMN  394



>gb|EEC72069.1| hypothetical protein OsI_05001 [Oryza sativa Indica Group]
Length=412

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/287 (71%), Positives = 234/287 (82%), Gaps = 15/287 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+  DGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  91    LSLLLLTSGRDPGIIPRNAHPPEPEGLDGNAEVGSNQTPPMRLPRVKDVVVNGITVKTKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  210

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I ++E+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  211   FCWVYIVKIRNSEQVTIWKAMAKTPASIALLVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  270

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVSP  966
             NFRYRYD+RANPYN+GVVEN  EIF ++IP SKN+FRA+  VP++  L  R T  GF+SP
Sbjct  271   NFRYRYDQRANPYNRGVVENIKEIFFSAIPASKNNFRARVPVPQEQGLRPRPT-NGFMSP  329

Query  967   NMGKAVEDIEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKEGGGLGEM  1104
             NMG+AV DIEMGRK V W +     + G L          G GLG +
Sbjct  330   NMGRAVGDIEMGRKPVAWDEPRMAAEIGDL----------GAGLGNL  366



>gb|EMT02705.1| Putative S-acyltransferase [Aegilops tauschii]
Length=429

 Score =   424 bits (1091),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/257 (77%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LL LTSGRDPGI+PRNAHPPEP+ F+GN E G  QTP LRLPR+K+V VNGITVK KY
Sbjct  111   LSLLFLTSGRDPGIIPRNAHPPEPEGFEGNAEVGANQTPPLRLPRVKDVVVNGITVKTKY  170

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  171   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  230

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             F WVYI +I DAE+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  231   FSWVYIIKIRDAEQITIWKAMAKTPASIALVVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  290

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+GVVEN  EIF T IP S+N+F A+VP++  L  R T  GF+SPNM
Sbjct  291   NFRYRYDQRANPYNRGVVENIKEIFFTPIPASRNNFGARVPQEQGLRPRST-NGFMSPNM  349

Query  973   GKAVEDIEMGRKAVWGD  1023
             G+AV DIEMGRK V  D
Sbjct  350   GRAVGDIEMGRKPVAWD  366



>ref|XP_004971123.1| PREDICTED: probable S-acyltransferase At3g26935-like [Setaria 
italica]
Length=417

 Score =   424 bits (1090),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 238/305 (78%), Gaps = 13/305 (4%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRNAHPPEP+ FDGN E G  QTP LRLPR+K+V VNGITVK KYCDTCML
Sbjct  103   TSGRDPGIIPRNAHPPEPEGFDGNAEVGANQTPPLRLPRVKDVVVNGITVKTKYCDTCML  162

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFGFCWV+I
Sbjct  163   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFGFCWVFI  222

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              +I +AE+ TIWKAM KTPAS+ LI YTFI+VWFVGGL+ FHLYL+STNQTTYENFRYRY
Sbjct  223   VKIRNAEQITIWKAMAKTPASIALIIYTFIAVWFVGGLSVFHLYLMSTNQTTYENFRYRY  282

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             D+RANPYN+GVVEN  EIF T IPPSKN+FR +V ++  L  R T  GF+SPNMG+AV D
Sbjct  283   DQRANPYNRGVVENIKEIFFTPIPPSKNNFRGRVLQEHGLRPRAT-NGFMSPNMGRAVGD  341

Query  991   IEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGD  1140
             IEMGRK V W         GD+GA      L D DG        L   +  +   ++E  
Sbjct  342   IEMGRKPVAWDEPRMAAEIGDLGA-GLSNLLEDKDGRFRSASPDLSRDALAVGGGLEEQG  400

Query  1141  RAAMH  1155
              +AM+
Sbjct  401   SSAMN  405



>ref|XP_006660819.1| PREDICTED: probable protein S-acyltransferase 7-like [Oryza brachyantha]
Length=440

 Score =   424 bits (1091),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 223/350 (64%), Positives = 261/350 (75%), Gaps = 17/350 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  DG  + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  89    LTLLLLTSGRDPGIVPRNTHPPEPESIDGGSDMGNGQTPQQLRLPRTKDVFVNGVIVKVK  148

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFSTTLLC+YVF
Sbjct  149   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGRRNYRFFYMFVFSTTLLCLYVF  208

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE ++IWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  209   GFCWVYIVKIRDAEHSSIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  268

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAA-RHTAGGFVSP  966
             ENFRYRYD+RANPYN+G+V NF+EIFCT+IPPSKN+FRA+VP D  L   R  A GF+SP
Sbjct  269   ENFRYRYDQRANPYNRGMVNNFLEIFCTAIPPSKNNFRARVPVDQGLQQIRTPARGFMSP  328

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIR-----T  1122
             NMGK V D+E+GRK V  D     A+ ++ ++     ++ KE G +   SP++       
Sbjct  329   NMGKPVGDLELGRKPVSWDEPRSAADIRDLEVGLGGLLDEKE-GRIAHASPDLSRGHLPA  387

Query  1123  TVDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
              + EG RA MH  R S   R   S  M     ++A ++G     G  SSG
Sbjct  388   ELVEG-RAGMHSRRSSWGHRSGTSESMD----SIAVQMGTEANWGSMSSG  432



>gb|ACU18488.1| unknown [Glycine max]
Length=279

 Score =   418 bits (1075),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 239/276 (87%), Gaps = 7/276 (3%)
 Frame = +1

Query  445   MLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWV  624
             MLYRP RCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF FCWV
Sbjct  1     MLYRPSRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFAFCWV  60

Query  625   YIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRY  804
             YI RIM +EETTIWKAMIKTPAS+VLI YTFIS+WFVGGLTAFHLYLISTNQTTYENFRY
Sbjct  61    YIVRIMASEETTIWKAMIKTPASIVLIIYTFISMWFVGGLTAFHLYLISTNQTTYENFRY  120

Query  805   RYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAV  984
             RYDRRANPYNKGV+ NF EIFC SI PSKN+FRA VPR+PAL  R   GGF++ N+GKA 
Sbjct  121   RYDRRANPYNKGVLNNFKEIFCISISPSKNNFRAMVPREPALPTRSVGGGFMNQNIGKAG  180

Query  985   EDIEMGRKAVWGDVGAEHQE-GQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHP  1161
             EDIEMGRK VW D+GA   + G   ++D V +K+    GE+SPEIRTTVD+ DRA M HP
Sbjct  181   EDIEMGRKTVW-DMGAGMDDNGAPINDDRVTIKD----GELSPEIRTTVDDSDRAGM-HP  234

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             RRSSWGRKSGSWEMSPEVLALA+RVGE NR+GG SS
Sbjct  235   RRSSWGRKSGSWEMSPEVLALAARVGEPNRVGGGSS  270



>ref|XP_011023928.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Populus 
euphratica]
Length=477

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 218/358 (61%), Positives = 267/358 (75%), Gaps = 24/358 (7%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGI+PRNAHPPE + ++GN     GQTP LRLPR K+V +NGITVK KYCDTCMLY
Sbjct  111   SGRDPGIIPRNAHPPELEGYEGNTPLTPGQTPPLRLPRTKDVVINGITVKTKYCDTCMLY  170

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF++T++C+YV  FCWVYI+
Sbjct  171   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFTSTIICLYVHAFCWVYIK  230

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM++EET+IWKAM KTPAS+ L+ YTFISVWFVGGLT FH YLIS NQ+TYENFRYRYD
Sbjct  231   RIMNSEETSIWKAMSKTPASVALVIYTFISVWFVGGLTLFHSYLISKNQSTYENFRYRYD  290

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAV---  984
               ANP+++G++ENF EIFC+SIPPSKN FRAKVP++PA+  R  A  FVS ++ K+    
Sbjct  291   GLANPFDRGLIENFKEIFCSSIPPSKNSFRAKVPKEPAIPPRMVATSFVSSSVEKSAGDI  350

Query  985   ---------------EDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-  1116
                            +DIEMGRK VW +   +      + ND  ++ E   L ++SP++ 
Sbjct  351   EMGRKPVCNVEKSAGDDIEMGRKPVWDEASGDDDYNGTARNDD-SLHEDSRLTDVSPDLS  409

Query  1117  RTTVDEG--DRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
             R    +G   R+ MH  RRSS GRKSGSW++SP+VLA+A+ +GE  RM   S   L +
Sbjct  410   RILPPQGMEGRSVMHS-RRSSLGRKSGSWDISPDVLAVAAGIGESKRMASGSGDNLTS  466



>tpg|DAA40497.1| TPA: hypothetical protein ZEAMMB73_230015 [Zea mays]
Length=351

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 256/343 (75%), Gaps = 14/343 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG  VKVK
Sbjct  12    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMNNDAGNGQTPQQLRLPRTKDVIVNGTIVKVK  71

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  72    YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  131

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFC+VYI +I DAE++T WKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  132   GFCFVYIVKIKDAEQSTFWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  191

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRR NPYN+G V NFMEIFCTS+ PSKN+FRA+VP +  L  AR  A GF+SP
Sbjct  192   ENFRYRYDRRDNPYNRGTVNNFMEIFCTSVAPSKNNFRARVPAEQGLQQARAPARGFMSP  251

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEG---GGLGEMSPEIRTTV  1128
             NMGK + ++E+GRK +  D     A+ ++ ++     ++ KEG       ++S E    +
Sbjct  252   NMGKPIGELELGRKPISWDEPRSAADIRDLEVGLGSLLDEKEGRVAHASPDLSREALPEL  311

Query  1129  DEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG  1257
              EG RA  H  R S   R   S  M     +LA+++G    MG
Sbjct  312   VEG-RAGTHSRRSSWGHRSGTSASMD----SLAAQMGTAESMG  349



>ref|NP_001045255.1| Os01g0925300 [Oryza sativa Japonica Group]
 dbj|BAD88041.1| putative zisp [Oryza sativa Japonica Group]
 dbj|BAD88184.1| putative zisp [Oryza sativa Japonica Group]
 dbj|BAF07169.1| Os01g0925300 [Oryza sativa Japonica Group]
Length=413

 Score =   422 bits (1085),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 234/284 (82%), Gaps = 15/284 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+  DGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  92    LSLLLLTSGRDPGIIPRNAHPPEPEGLDGNAEVGSNQTPPMRLPRVKDVVVNGITVKTKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I ++E+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  212   FCWVYIVKIRNSEQITIWKAMAKTPASIALLVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVSP  966
             NFRYRYD+RANPYN+GV+EN  +IF ++IP SKN+FRA+  VP++  L  R T  GF+SP
Sbjct  272   NFRYRYDQRANPYNRGVMENIKDIFFSAIPASKNNFRARVPVPQEQGLRPRPT-NGFMSP  330

Query  967   NMGKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDG  1068
             NMG+AV DIEMGRK V W         GD+GA      L D DG
Sbjct  331   NMGRAVGDIEMGRKPVAWDEPRMAADIGDLGAGLGN-LLEDKDG  373



>gb|EAZ14683.1| hypothetical protein OsJ_04607 [Oryza sativa Japonica Group]
Length=432

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 234/284 (82%), Gaps = 15/284 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+  DGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  111   LSLLLLTSGRDPGIIPRNAHPPEPEGLDGNAEVGSNQTPPMRLPRVKDVVVNGITVKTKY  170

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  171   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  230

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I ++E+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  231   FCWVYIVKIRNSEQITIWKAMAKTPASIALLVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  290

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVSP  966
             NFRYRYD+RANPYN+GV+EN  +IF ++IP SKN+FRA+  VP++  L  R T  GF+SP
Sbjct  291   NFRYRYDQRANPYNRGVMENIKDIFFSAIPASKNNFRARVPVPQEQGLRPRPT-NGFMSP  349

Query  967   NMGKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDG  1068
             NMG+AV DIEMGRK V W         GD+GA      L D DG
Sbjct  350   NMGRAVGDIEMGRKPVAWDEPRMAADIGDLGAGLGN-LLEDKDG  392



>dbj|BAB89658.1| P0482D04.5 [Oryza sativa Japonica Group]
Length=408

 Score =   422 bits (1084),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 234/284 (82%), Gaps = 15/284 (5%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+  DGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  87    LSLLLLTSGRDPGIIPRNAHPPEPEGLDGNAEVGSNQTPPMRLPRVKDVVVNGITVKTKY  146

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  147   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  206

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I ++E+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  207   FCWVYIVKIRNSEQITIWKAMAKTPASIALLVYTFIAVWFVGGLSVFHLYLMSTNQTTYE  266

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVSP  966
             NFRYRYD+RANPYN+GV+EN  +IF ++IP SKN+FRA+  VP++  L  R T  GF+SP
Sbjct  267   NFRYRYDQRANPYNRGVMENIKDIFFSAIPASKNNFRARVPVPQEQGLRPRPT-NGFMSP  325

Query  967   NMGKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDG  1068
             NMG+AV DIEMGRK V W         GD+GA      L D DG
Sbjct  326   NMGRAVGDIEMGRKPVAWDEPRMAADIGDLGAGLGN-LLEDKDG  368



>emb|CDP14989.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   422 bits (1085),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 225/336 (67%), Positives = 268/336 (80%), Gaps = 7/336 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGN-IEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +V+LLLTSGRDPGIVPR+A PPEP+ ++G+ +   GQTPQLRL RIK+V VNG+ VKVKY
Sbjct  96    VVILLLTSGRDPGIVPRSARPPEPEAYEGSPVMEPGQTPQLRLRRIKDVYVNGVVVKVKY  155

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTT+LC+YV G
Sbjct  156   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTILCLYVHG  215

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYIR+IMD+E+TTIWKAM KTPAS+VLI YTF+ VWFVGGL+ FHLYLISTN++TYE
Sbjct  216   FCWVYIRKIMDSEKTTIWKAMSKTPASIVLIVYTFVCVWFVGGLSVFHLYLISTNRSTYE  275

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD RANP+NKG+ +NFME+FCT IPPSK  FRAKV R+P L  R    GF    +
Sbjct  276   NFRYRYDGRANPFNKGISKNFMEVFCTRIPPSKFKFRAKVQREPELPPRVVGDGFSVSKV  335

Query  973   GKAVEDIEMGRKAVW--GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEGDR  1143
             GK + D+EMGRK VW  G   A   E Q   +DG++  + G L  +SPE+ R T+ E   
Sbjct  336   GKPLGDLEMGRKPVWDEGTTNANEFERQYGHDDGLD--KSGELPIVSPELSRITLTESTE  393

Query  1144  A-AMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
               ++ H RRSSW R SGS +M  E++A+ASR+G+ N
Sbjct  394   GRSILHSRRSSWARTSGSLDMPAEIVAMASRMGDSN  429



>ref|XP_008674635.1| PREDICTED: probable protein S-acyltransferase 7 isoform X3 [Zea 
mays]
Length=384

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/311 (66%), Positives = 241/311 (77%), Gaps = 13/311 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ FD N E G  QTP +RLPR+K+V VNGITVK+KY
Sbjct  64    LSLLLLTSGRDPGIIPRNAHPPEPEGFDDNAEVGANQTPPVRLPRVKDVVVNGITVKIKY  123

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  124   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  183

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV++ +I +AE+ TIWKAM KTPAS+ LI YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  184   FCWVFVVKIRNAEQITIWKAMTKTPASVALIIYTFIAVWFVGGLSVFHLYLMSTNQTTYE  243

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+G++ N  +I  T+IPPSKN+F  +V ++  L  R T  GF+SPNM
Sbjct  244   NFRYRYDQRANPYNRGIMVNIKQILFTTIPPSKNNFCGRVQQEHGLRPRPT-NGFMSPNM  302

Query  973   GKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT  1122
             G+AV DIEMGRK V W         GD+GA      L D DG        L   +  +  
Sbjct  303   GRAVGDIEMGRKPVAWDEPRMAAEIGDLGA-GLSNLLEDKDGRFRSASPDLSRDALAVGG  361

Query  1123  TVDEGDRAAMH  1155
              ++E   +AM+
Sbjct  362   GLEEEGSSAMN  372



>ref|XP_008674634.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Zea 
mays]
 tpg|DAA56052.1| TPA: hypothetical protein ZEAMMB73_443551 [Zea mays]
Length=412

 Score =   419 bits (1077),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/311 (66%), Positives = 241/311 (77%), Gaps = 13/311 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ FD N E G  QTP +RLPR+K+V VNGITVK+KY
Sbjct  92    LSLLLLTSGRDPGIIPRNAHPPEPEGFDDNAEVGANQTPPVRLPRVKDVVVNGITVKIKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  152   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV++ +I +AE+ TIWKAM KTPAS+ LI YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  212   FCWVFVVKIRNAEQITIWKAMTKTPASVALIIYTFIAVWFVGGLSVFHLYLMSTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+G++ N  +I  T+IPPSKN+F  +V ++  L  R T  GF+SPNM
Sbjct  272   NFRYRYDQRANPYNRGIMVNIKQILFTTIPPSKNNFCGRVQQEHGLRPRPT-NGFMSPNM  330

Query  973   GKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT  1122
             G+AV DIEMGRK V W         GD+GA      L D DG        L   +  +  
Sbjct  331   GRAVGDIEMGRKPVAWDEPRMAAEIGDLGAGLSN-LLEDKDGRFRSASPDLSRDALAVGG  389

Query  1123  TVDEGDRAAMH  1155
              ++E   +AM+
Sbjct  390   GLEEEGSSAMN  400



>tpg|DAA40499.1| TPA: hypothetical protein ZEAMMB73_230015 [Zea mays]
Length=430

 Score =   419 bits (1077),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 256/343 (75%), Gaps = 14/343 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG  VKVK
Sbjct  91    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMNNDAGNGQTPQQLRLPRTKDVIVNGTIVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFC+VYI +I DAE++T WKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  211   GFCFVYIVKIKDAEQSTFWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRR NPYN+G V NFMEIFCTS+ PSKN+FRA+VP +  L  AR  A GF+SP
Sbjct  271   ENFRYRYDRRDNPYNRGTVNNFMEIFCTSVAPSKNNFRARVPAEQGLQQARAPARGFMSP  330

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEG---GGLGEMSPEIRTTV  1128
             NMGK + ++E+GRK +  D     A+ ++ ++     ++ KEG       ++S E    +
Sbjct  331   NMGKPIGELELGRKPISWDEPRSAADIRDLEVGLGSLLDEKEGRVAHASPDLSREALPEL  390

Query  1129  DEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG  1257
              EG RA  H  R S   R   S  M     +LA+++G    MG
Sbjct  391   VEG-RAGTHSRRSSWGHRSGTSASMD----SLAAQMGTAESMG  428



>ref|XP_008668041.1| PREDICTED: palmitoyltransferase ZDHHC9 isoform X1 [Zea mays]
 gb|ACN28484.1| unknown [Zea mays]
 gb|ACN34793.1| unknown [Zea mays]
 tpg|DAA40500.1| TPA: palmitoyltransferase ZDHHC9 [Zea mays]
Length=431

 Score =   419 bits (1077),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 256/343 (75%), Gaps = 14/343 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG  VKVK
Sbjct  92    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMNNDAGNGQTPQQLRLPRTKDVIVNGTIVKVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  152   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFC+VYI +I DAE++T WKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  212   GFCFVYIVKIKDAEQSTFWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRR NPYN+G V NFMEIFCTS+ PSKN+FRA+VP +  L  AR  A GF+SP
Sbjct  272   ENFRYRYDRRDNPYNRGTVNNFMEIFCTSVAPSKNNFRARVPAEQGLQQARAPARGFMSP  331

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEG---GGLGEMSPEIRTTV  1128
             NMGK + ++E+GRK +  D     A+ ++ ++     ++ KEG       ++S E    +
Sbjct  332   NMGKPIGELELGRKPISWDEPRSAADIRDLEVGLGSLLDEKEGRVAHASPDLSREALPEL  391

Query  1129  DEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMG  1257
              EG RA  H  R S   R   S  M     +LA+++G    MG
Sbjct  392   VEG-RAGTHSRRSSWGHRSGTSASMD----SLAAQMGTAESMG  429



>ref|XP_002511124.1| Palmitoyltransferase ZDHHC9, putative [Ricinus communis]
 gb|EEF51726.1| Palmitoyltransferase ZDHHC9, putative [Ricinus communis]
Length=456

 Score =   420 bits (1079),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 266/332 (80%), Gaps = 6/332 (2%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             SGRDPGI+PRNA PPEP+ ++G  E   GQTP  RLPR K+V VNGI +K KYCDTCMLY
Sbjct  111   SGRDPGIIPRNAQPPEPEGYEGQAEVTNGQTPPFRLPRTKDVMVNGIIMKTKYCDTCMLY  170

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVF  T+LC+YV GFCWVYI+
Sbjct  171   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFFATILCLYVHGFCWVYIK  230

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM++EETTIWKAM KTPAS+VL+ YTFISVWFVGGL+ FHLYLIS NQ+TYENFRYRYD
Sbjct  231   RIMNSEETTIWKAMAKTPASIVLVIYTFISVWFVGGLSMFHLYLISRNQSTYENFRYRYD  290

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
               ANP+N+G+ ENFMEIFC+ IPPSKN+FRA+V ++P +  R  + GFVS N+ K+V DI
Sbjct  291   GLANPFNRGIFENFMEIFCSRIPPSKNNFRAQVQKEPEIPHRMVS-GFVSTNIEKSVGDI  349

Query  994   EMGRKAVWGDVGAE-HQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG-DRAAMHHPr  1164
             EMGRK VW D   E    G+   ND  ++ E G L ++SP++ R    +G +  ++ H R
Sbjct  350   EMGRKPVWDDAAREVDSYGRAVRNDD-SLDEDGALTDISPDLSRILPPQGLEGRSVLHSR  408

Query  1165  rsswgrksgswEMSPEVLALASRVGEGNRMGG  1260
             RSS GR+SGSWE+SP+VLALA+ VGE  R+GG
Sbjct  409   RSSLGRRSGSWEISPDVLALAAGVGESKRLGG  440



>ref|NP_001062355.1| Os08g0535400 [Oryza sativa Japonica Group]
 dbj|BAD01220.1| putative DHHC-type zinc finger domain-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAD13105.1| putative DHHC-type zinc finger domain-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF24269.1| Os08g0535400 [Oryza sativa Japonica Group]
 dbj|BAG92543.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEP20521.1| DHHC-type zinc finger domain-containing protein [Oryza sativa 
Japonica Group]
Length=416

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 237/292 (81%), Gaps = 6/292 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRN HPPEP+ FDG+ + G QTPQ LRLPR K+V VNGI+V++KY
Sbjct  93    LTLLLLTSGRDPGIIPRNTHPPEPEGFDGSNDSGVQTPQQLRLPRTKDVIVNGISVRIKY  152

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  153   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  212

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE  ++WKAM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYE
Sbjct  213   FCWVYIIKIRNAESLSVWKAMLKTPASIVLIIYCFLCVWFVGGLSVFHCYLMSTNQTTYE  272

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAG-GFVSPN  969
             NFRYRYDRRANPYN+GV+ NF+EIFC+ IPPSKN+FRA+V  +  L     A  GF+SPN
Sbjct  273   NFRYRYDRRANPYNRGVLNNFLEIFCSRIPPSKNNFRARVTVEQGLQQTRVASRGFMSPN  332

Query  970   MGKAVEDIEMGRKAV-WGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI  1116
             MGK V D+EMGRK V W +    A+ ++ +      ++ KE G L   SP++
Sbjct  333   MGKPVGDLEMGRKPVPWDEPRTAADIRDLEAGLGGFLDEKE-GRLTHASPDL  383



>ref|XP_008674633.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Zea 
mays]
Length=419

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/311 (66%), Positives = 241/311 (77%), Gaps = 13/311 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ FD N E G  QTP +RLPR+K+V VNGITVK+KY
Sbjct  99    LSLLLLTSGRDPGIIPRNAHPPEPEGFDDNAEVGANQTPPVRLPRVKDVVVNGITVKIKY  158

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  159   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  218

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV++ +I +AE+ TIWKAM KTPAS+ LI YTFI+VWFVGGL+ FHLYL+STNQTTYE
Sbjct  219   FCWVFVVKIRNAEQITIWKAMTKTPASVALIIYTFIAVWFVGGLSVFHLYLMSTNQTTYE  278

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYD+RANPYN+G++ N  +I  T+IPPSKN+F  +V ++  L  R T  GF+SPNM
Sbjct  279   NFRYRYDQRANPYNRGIMVNIKQILFTTIPPSKNNFCGRVQQEHGLRPRPT-NGFMSPNM  337

Query  973   GKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT  1122
             G+AV DIEMGRK V W         GD+GA      L D DG        L   +  +  
Sbjct  338   GRAVGDIEMGRKPVAWDEPRMAAEIGDLGAGLSN-LLEDKDGRFRSASPDLSRDALAVGG  396

Query  1123  TVDEGDRAAMH  1155
              ++E   +AM+
Sbjct  397   GLEEEGSSAMN  407



>ref|NP_001149898.1| palmitoyltransferase ZDHHC9 [Zea mays]
 gb|ACG37136.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=443

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 237/293 (81%), Gaps = 7/293 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG  VKVK
Sbjct  92    LTLLLLTSGRDPGIVPRNTHPPEPEAIDMNNDAGNGQTPQQLRLPRTKDVIVNGTIVKVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  152   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFC+VYI +I DAE++T WKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  212   GFCFVYIVKIKDAEQSTFWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRR NPYN+G V NFMEIFCTS+ PSKN+FRA+VP +  L  AR  A GF+SP
Sbjct  272   ENFRYRYDRRDNPYNRGTVNNFMEIFCTSVAPSKNNFRARVPAEQGLQQARAPARGFMSP  331

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI  1116
             NMGK + ++E+GRK +  D     A+ ++ ++     ++ KE G +   SP++
Sbjct  332   NMGKPIGELELGRKPISWDEPRSAADIRDLEVGLGSLLDEKE-GRVAHASPDL  383



>gb|EEE69067.1| hypothetical protein OsJ_28081 [Oryza sativa Japonica Group]
Length=435

 Score =   417 bits (1072),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 237/292 (81%), Gaps = 6/292 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRN HPPEP+ FDG+ + G QTPQ LRLPR K+V VNGI+V++KY
Sbjct  112   LTLLLLTSGRDPGIIPRNTHPPEPEGFDGSNDSGVQTPQQLRLPRTKDVIVNGISVRIKY  171

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  172   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  231

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE  ++WKAM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYE
Sbjct  232   FCWVYIIKIRNAESLSVWKAMLKTPASIVLIIYCFLCVWFVGGLSVFHCYLMSTNQTTYE  291

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAG-GFVSPN  969
             NFRYRYDRRANPYN+GV+ NF+EIFC+ IPPSKN+FRA+V  +  L     A  GF+SPN
Sbjct  292   NFRYRYDRRANPYNRGVLNNFLEIFCSRIPPSKNNFRARVTVEQGLQQTRVASRGFMSPN  351

Query  970   MGKAVEDIEMGRKAV-WGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI  1116
             MGK V D+EMGRK V W +    A+ ++ +      ++ KE G L   SP++
Sbjct  352   MGKPVGDLEMGRKPVPWDEPRTAADIRDLEAGLGGFLDEKE-GRLTHASPDL  402



>ref|XP_006659633.1| PREDICTED: probable protein S-acyltransferase 7-like [Oryza brachyantha]
Length=422

 Score =   416 bits (1070),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 239/292 (82%), Gaps = 6/292 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRN HPPEP+ FDG+ + G QTPQ LRLPR K+V VNGI+V++KY
Sbjct  70    LTLLLLTSGRDPGIIPRNTHPPEPEGFDGSNDNGVQTPQQLRLPRTKDVMVNGISVRIKY  129

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  130   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  189

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE  ++WKAM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYE
Sbjct  190   FCWVYIIKIRNAENLSVWKAMLKTPASIVLIIYCFLCVWFVGGLSVFHCYLMSTNQTTYE  249

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRRANPYN+GV+ NF+EIFCT IPPSKN+FRA+V  +  L   R  + GF+SPN
Sbjct  250   NFRYRYDRRANPYNRGVLNNFLEIFCTRIPPSKNNFRARVIVEQGLQQTRVPSRGFMSPN  309

Query  970   MGKAVEDIEMGRKAV-WGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI  1116
             MGK V D+E+GRK V W +    A+ ++ ++     ++ KE G L   SP++
Sbjct  310   MGKPVGDLEIGRKPVPWDEPRTAADIRDLEVGLGGFLDEKE-GRLTHASPDL  360



>gb|EEC83946.1| hypothetical protein OsI_30037 [Oryza sativa Indica Group]
Length=455

 Score =   417 bits (1071),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/292 (68%), Positives = 237/292 (81%), Gaps = 6/292 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRN HPPEP+ FDG+ + G QTPQ LRLPR K+V VNGI+V++KY
Sbjct  112   LTLLLLTSGRDPGIIPRNTHPPEPEGFDGSNDSGVQTPQQLRLPRTKDVIVNGISVRIKY  171

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVE+FDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  172   CDTCMLYRPPRCSHCSICNNCVEQFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  231

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE  ++WKAM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYE
Sbjct  232   FCWVYIIKIRNAESLSVWKAMLKTPASIVLIIYCFLCVWFVGGLSVFHCYLMSTNQTTYE  291

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAG-GFVSPN  969
             NFRYRYDRRANPYN+GV+ NF+EIFC+ IPPSKN+FRA+V  +  L     A  GF+SPN
Sbjct  292   NFRYRYDRRANPYNRGVLNNFLEIFCSRIPPSKNNFRARVTVEQGLQQTRVASRGFMSPN  351

Query  970   MGKAVEDIEMGRKAV-WGD--VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI  1116
             MGK V D+EMGRK V W +    A+ ++ +      ++ KE G L   SP++
Sbjct  352   MGKPVGDLEMGRKPVPWDEPRTAADIRDLEAGLGGFLDEKE-GRLTHASPDL  402



>ref|NP_001151207.1| palmitoyltransferase ZDHHC9 [Zea mays]
 gb|ACG41976.1| palmitoyltransferase ZDHHC9 [Zea mays]
 tpg|DAA62148.1| TPA: palmitoyltransferase ZDHHC9 [Zea mays]
Length=443

 Score =   415 bits (1066),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 256/349 (73%), Gaps = 14/349 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPE    + N + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  92    LTLLLLTSGRDPGIVPRNTHPPETDAIEMNNDAGNGQTPQQLRLPRTKDVIVNGVIVKVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  152   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE+++IWKAM+KTPAS+VLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  212   GFCWVYIIKIRDAEQSSIWKAMLKTPASIVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYN G++ NFMEIFCT++PPSKN+FRA+VP +  L  +R  A GF+S 
Sbjct  272   ENFRYRYDRRANPYNIGILNNFMEIFCTAVPPSKNNFRARVPVEQGLQQSRAPARGFMSL  331

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDE  1134
             NM K V D E+ RK V  D     A+ ++ ++     ++ KE G +   SP++ R  + E
Sbjct  332   NMDKPVGDFELSRKPVSWDEPRSAADIRDLEVGLGGLLDEKE-GRIAHASPDLSRDALPE  390

Query  1135  --GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
                 RA MH    S           S  V ++A ++G G+   GS S  
Sbjct  391   LVEGRAGMH----SRRSSWGHRSGTSESVDSIAVQMGTGDSHWGSISSA  435



>ref|XP_004974018.1| PREDICTED: probable S-acyltransferase At3g26935-like [Setaria 
italica]
Length=439

 Score =   414 bits (1064),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 237/310 (76%), Gaps = 12/310 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLL TSGRDPGI+PRN HPPEP+  DG  E GGQTPQ  RLPR +EV VNGI+V+VKY
Sbjct  95    LTLLLCTSGRDPGIIPRNTHPPEPESIDGVNESGGQTPQQFRLPRTREVIVNGISVRVKY  154

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  155   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  214

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ +I +AE  +IWKA+ KTPAS+VLI Y F+ VWFVGGL+ FHLYL+STNQTTYE
Sbjct  215   FCWVYVIKIRNAEHLSIWKALAKTPASIVLIIYCFLCVWFVGGLSVFHLYLMSTNQTTYE  274

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRR NPYN+G++ NF+EIFCT+IPPSKN+FRA+V  +  L   R  + GF+SPN
Sbjct  275   NFRYRYDRRDNPYNRGILNNFLEIFCTAIPPSKNNFRARVTVEQGLQQTRSQSRGFMSPN  334

Query  970   MGKAVEDIEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSPEIRTTVDE---  1134
             MGK + D+EMGRK V W +         L    G   +E  G +   SP++  + DE   
Sbjct  335   MGKPIGDLEMGRKPVPWDEPRTAADIRDLEAGLGGMFEEKEGRIAHASPDM--SRDELPV  392

Query  1135  ---GDRAAMH  1155
                  RA MH
Sbjct  393   EFVDGRAGMH  402



>ref|XP_002444687.1| hypothetical protein SORBIDRAFT_07g026030 [Sorghum bicolor]
 gb|EES14182.1| hypothetical protein SORBIDRAFT_07g026030 [Sorghum bicolor]
Length=434

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 220/255 (86%), Gaps = 2/255 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             LVLLL TSGRDPGI+PRN HPPEP+  DG  + G QTPQ  RLPR KEV VNGI+V+VKY
Sbjct  88    LVLLLCTSGRDPGIIPRNTHPPEPESIDGINDMGVQTPQQFRLPRTKEVVVNGISVRVKY  147

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  148   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  207

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ +I DAE+ ++WKA++KTPAS+VLI Y F+ VWFVGGL+ FHLYL+STNQTTYE
Sbjct  208   FCWVYVIKIRDAEQLSLWKALLKTPASIVLIIYCFLCVWFVGGLSVFHLYLMSTNQTTYE  267

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRR NPYN+G++ NF+EIFCT+IPPSKN+FRA+V  +  L   R  + GF+SP+
Sbjct  268   NFRYRYDRRDNPYNRGILNNFLEIFCTAIPPSKNNFRARVTVEQGLHQTRSQSRGFMSPS  327

Query  970   MGKAVEDIEMGRKAV  1014
             MGK + D+EMGRK V
Sbjct  328   MGKPIGDLEMGRKPV  342



>dbj|BAJ85153.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 238/304 (78%), Gaps = 9/304 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L+LL+LTSGRDPGI+PRN HPPEP+  DG+    GQTP LRLPR K+V VNGI+VKVKYC
Sbjct  88    LMLLILTSGRDPGIIPRNTHPPEPESIDGSNYIRGQTP-LRLPRTKDVVVNGISVKVKYC  146

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTC+LYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFST L+C+YVF F
Sbjct  147   DTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFYMFVFSTMLICLYVFAF  206

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYI +I DAE  +IW+AM++TPAS+VLI Y F+ VWFVGGL+ FHLYL+STNQTTYEN
Sbjct  207   CWVYIIKISDAEHLSIWRAMLRTPASVVLIVYCFLCVWFVGGLSVFHLYLMSTNQTTYEN  266

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPNM  972
             FRYRYDRRANPYN+G++ N +EIFC+SIPPSKN+FRA+V  +  +  AR ++ GF+SP M
Sbjct  267   FRYRYDRRANPYNRGILNNILEIFCSSIPPSKNNFRARVTVEQGVEQARSSSRGFMSPKM  326

Query  973   GKAVEDIEMGRKAV-WGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSPEIRTTVDEGDRA  1146
             GKAV D+EMG+K V W +       G L    G  + E  G +   SP++      GD  
Sbjct  327   GKAVGDLEMGKKPVPWDEPRTTANIGDLEVGLGGMLDEKEGRVAHASPDV-----SGDEL  381

Query  1147  AMHH  1158
             ++ H
Sbjct  382   SLEH  385



>ref|XP_002318154.2| hypothetical protein POPTR_0012s10510g [Populus trichocarpa]
 gb|EEE96374.2| hypothetical protein POPTR_0012s10510g [Populus trichocarpa]
Length=460

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 259/342 (76%), Gaps = 10/342 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             S RDPGI+PRNAHPPEP+ +D       GQTP  RLPR K+V +NG+TVK KYCDTCMLY
Sbjct  112   SARDPGIIPRNAHPPEPEGYDWQTPLTPGQTPPFRLPRTKDVIINGMTVKTKYCDTCMLY  171

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF MFVF+ T+LCIYV  FCWVYI 
Sbjct  172   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFVMFVFTETILCIYVHAFCWVYIT  231

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIM++EET+IWKAM K PAS+ L+ YTFISVWFVGGLT FH YLIS NQ+TYENFRYRYD
Sbjct  232   RIMNSEETSIWKAMSKAPASIALVVYTFISVWFVGGLTVFHSYLISKNQSTYENFRYRYD  291

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
               ANP++KG++ENFMEIFC+SI PSKN+FRAKVP++  +  R  A  FVS  +GK+  D+
Sbjct  292   GLANPFDKGLIENFMEIFCSSIHPSKNNFRAKVPKENTIPPRMVASSFVSSGVGKSAGDV  351

Query  994   EMGRKAVWGDVG--AEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAAMHH  1158
             EMGRK VW +    A+  +G + ++D  ++ E  GL ++SP++ R    +G   R+ MH 
Sbjct  352   EMGRKPVWDEAAGDADDYDGTIRNDD--SLHEDRGLTDVSPDLSRILPPQGMEGRSVMHS  409

Query  1159  PrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLNA  1284
              RR S GRKSGSW++SP+ LA A+ +GE  R    +   L +
Sbjct  410   -RRPSLGRKSGSWDISPD-LASAAGMGESERTACGTGDNLTS  449



>gb|KDO64487.1| hypothetical protein CISIN_1g013191mg [Citrus sinensis]
Length=378

 Score =   410 bits (1053),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 262/339 (77%), Gaps = 9/339 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLYR  456
             SGRDPG++ RNA+PPE + ++G   G GQTPQL LPR K+V VNG+ VK+KYCDTCM YR
Sbjct  31    SGRDPGVIARNANPPELEGYEGTEVGPGQTPQLCLPRTKDVVVNGVVVKIKYCDTCMHYR  90

Query  457   PPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIRR  636
             PPRCSHCSICNNCV++FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  FCW+ IR+
Sbjct  91    PPRCSHCSICNNCVQKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHAFCWIRIRK  150

Query  637   IMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYDR  816
             IM+ E  +IWKAM K+PAS+ LI YTFISVWFVGGLT FH YLIS NQ+TYENFR RYD 
Sbjct  151   IMNGENVSIWKAMTKSPASIALIIYTFISVWFVGGLTVFHSYLISRNQSTYENFRNRYDE  210

Query  817   RANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDIE  996
               NPYNKGV++NFME+FCTSIP SKN+FRAK+P++PA+ +R  +GGF SPN+ K V DIE
Sbjct  211   HVNPYNKGVIKNFMEVFCTSIPTSKNNFRAKIPKEPAITSRRISGGFTSPNIRKPVSDIE  270

Query  997   MGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAAMHHP  1161
             MGRK  WG+    A+  EG+ +++D V+ K GG    ++ ++ R    EG   R+  HH 
Sbjct  271   MGRKLAWGEAVREADGSEGRTNNDDNVD-KLGGSADHVTADLSRILPPEGMEGRSISHH-  328

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             RRSSWG KSGSW++S E  A A  V    ++ GSS+G L
Sbjct  329   RRSSWGIKSGSWDISSETFASA--VEASKQVPGSSNGNL  365



>ref|XP_006436902.1| hypothetical protein CICLE_v10031377mg [Citrus clementina]
 gb|ESR50142.1| hypothetical protein CICLE_v10031377mg [Citrus clementina]
Length=482

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 217/339 (64%), Positives = 263/339 (78%), Gaps = 9/339 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLYR  456
             SGRDPG++ RNA+PPE + ++G   G GQTPQL LPR K+V VNG+ VK+KYCDTCM YR
Sbjct  135   SGRDPGVIARNANPPELEGYEGTEVGPGQTPQLCLPRTKDVVVNGVVVKIKYCDTCMHYR  194

Query  457   PPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIRR  636
             PPRCSHCSICNNCV++FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  FCW+ IR+
Sbjct  195   PPRCSHCSICNNCVQKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHAFCWIRIRK  254

Query  637   IMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYDR  816
             IM+ E  +IWKAM K+PAS+ LI YTFISVWFVGGLT FH YLIS NQ+TYENFR RYD 
Sbjct  255   IMNGENVSIWKAMTKSPASIALIIYTFISVWFVGGLTVFHSYLISRNQSTYENFRNRYDE  314

Query  817   RANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDIE  996
               NPYNKGV++NFME+FCTSIPPSKN+FRAK+P++PA+ +R  +GGF SPN+ K V DIE
Sbjct  315   HVNPYNKGVIKNFMEVFCTSIPPSKNNFRAKIPKEPAITSRRISGGFTSPNIRKPVSDIE  374

Query  997   MGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAAMHHP  1161
             MGRK  WG+    A+  EG+ +++D V+ K GG    ++ ++ R    EG   R+  HH 
Sbjct  375   MGRKLAWGEAVREADGSEGRTNNDDNVD-KLGGSADHVTADLSRILPPEGMEGRSISHH-  432

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             RRSSWG KSGSW++S E    AS V    ++ GSS+G L
Sbjct  433   RRSSWGIKSGSWDISSE--TFASAVEASKQVPGSSNGNL  469



>ref|XP_003578399.1| PREDICTED: probable protein S-acyltransferase 7 [Brachypodium 
distachyon]
Length=442

 Score =   412 bits (1058),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 241/309 (78%), Gaps = 9/309 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D N + G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  90    LTLLLLTSGRDPGIVPRNTHPPEPESIDANNDVGNGQTPQQLRLPRTKDVFVNGVVVKVK  149

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  150   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  209

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE  +IWKAM+KTP SMVLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  210   GFCWVYIIKIRDAENLSIWKAMLKTPPSMVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  269

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYNKGVV NF+EIFCT++P SKN FRA+VP +  L  AR  A GF+SP
Sbjct  270   ENFRYRYDRRANPYNKGVVNNFLEIFCTAVPASKNKFRARVPAEQGLQQARAPARGFMSP  329

Query  967   NMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEG---GGLGEMSPEIRTTV  1128
             NMGK V D+E+GRK +  D     A+ ++ ++     ++ KEG       ++S E R   
Sbjct  330   NMGKPVGDLELGRKPISWDEPRSAADIRDLEVGLGGMLDEKEGRIAHASPDLSREARPVE  389

Query  1129  DEGDRAAMH  1155
                 RA MH
Sbjct  390   LMEGRAGMH  398



>ref|NP_001149872.1| LOC100283500 [Zea mays]
 gb|ACG37057.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=434

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 236/309 (76%), Gaps = 10/309 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLL TSGRDPGI+PRN+HPPEP+  DG  + G QTPQ  RLPR KEV VNGI+V+VKY
Sbjct  89    LTLLLCTSGRDPGIIPRNSHPPEPESIDGINDTGVQTPQQFRLPRTKEVIVNGISVRVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ +I  AE++++WKA++KTPAS+ LI Y F+ VWFVGGL+ FHLYL+STNQTTYE
Sbjct  209   FCWVYVIKIRAAEQSSVWKALLKTPASVALIIYCFLCVWFVGGLSVFHLYLMSTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRR NPYNKGV+ NF+EIFCT+IPPSKN+FRA+V     L   R  + GF+SP+
Sbjct  269   NFRYRYDRRDNPYNKGVLNNFLEIFCTAIPPSKNNFRARVTAGQGLQQTRSQSRGFMSPS  328

Query  970   MGKAVEDIEMGRKAV--WGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSPEIRTTVD---  1131
             MGK + D+EM RK V  W +         L    GV   E  G +   SP++   +    
Sbjct  329   MGKPIGDLEMDRKPVAPWDEPRTAADIRDLEAGLGVMFDEKEGRVAHASPDLSRDLPAEF  388

Query  1132  -EGDRAAMH  1155
              EG R+ MH
Sbjct  389   VEG-RSGMH  396



>gb|ACL53585.1| unknown [Zea mays]
 gb|AFW61611.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=434

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 236/309 (76%), Gaps = 10/309 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLL TSGRDPGI+PRN+HPPEP+  DG  + G QTPQ  RLPR KEV VNGI+V+VKY
Sbjct  89    LTLLLCTSGRDPGIIPRNSHPPEPESIDGINDTGVQTPQQFRLPRTKEVLVNGISVRVKY  148

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF 
Sbjct  149   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFA  208

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ +I  AE++++WKA++KTPAS+ LI Y F+ VWFVGGL+ FHLYL+STNQTTYE
Sbjct  209   FCWVYVIKIRAAEQSSVWKALLKTPASVALIIYCFLCVWFVGGLSVFHLYLMSTNQTTYE  268

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRR NPYNKGV+ NF+EIFCT+IPPSKN+FRA+V     L   R  + GF+SP+
Sbjct  269   NFRYRYDRRDNPYNKGVLNNFLEIFCTAIPPSKNNFRARVTAGQGLQQTRSQSRGFMSPS  328

Query  970   MGKAVEDIEMGRKAV--WGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSPEIRTTVD---  1131
             MGK + D+EM RK V  W +         L    GV   E  G +   SP++   +    
Sbjct  329   MGKPIGDLEMDRKPVAPWDEPRTAADIRDLEAGLGVMFDEKEGRVAHASPDLSRDLPAEF  388

Query  1132  -EGDRAAMH  1155
              EG R+ MH
Sbjct  389   VEG-RSGMH  396



>ref|XP_003574837.1| PREDICTED: probable protein S-acyltransferase 6 [Brachypodium 
distachyon]
Length=441

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 231/291 (79%), Gaps = 4/291 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRN +PPEP+  DG+    GQTPQ  RLPR K+V VNGI+VKVKY
Sbjct  92    LILLLLTSGRDPGIIPRNTYPPEPESVDGSNYSRGQTPQQFRLPRTKDVIVNGISVKVKY  151

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTC+LYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFSTTL+C+YVF 
Sbjct  152   CDTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFYMFVFSTTLICLYVFA  211

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI +I +AE+ +IWKAM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYE
Sbjct  212   FCWVYIIKIREAEQLSIWKAMLKTPASIVLIIYCFLCVWFVGGLSVFHFYLMSTNQTTYE  271

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALA-ARHTAGGFVSPN  969
             NFRYRYDRR NPYN+GV+ N +EIF + IPPSKN+FRA+V  +  +  AR ++ GF+SPN
Sbjct  272   NFRYRYDRRTNPYNRGVLSNILEIFSSRIPPSKNNFRARVTVEQGVQEARSSSRGFMSPN  331

Query  970   MGKAVEDIEMGRK-AVWGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSPEI  1116
             MGK V D+EMGRK   W +       G L    G +M E  G L   SP++
Sbjct  332   MGKPVGDLEMGRKPGSWDEPRTAAHIGDLEVGLGGSMDEKEGRLTHASPDV  382



>ref|XP_006493254.1| PREDICTED: probable protein S-acyltransferase 5-like [Citrus 
sinensis]
 gb|KDO64486.1| hypothetical protein CISIN_1g013191mg [Citrus sinensis]
Length=448

 Score =   410 bits (1054),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 262/339 (77%), Gaps = 9/339 (3%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLYR  456
             SGRDPG++ RNA+PPE + ++G   G GQTPQL LPR K+V VNG+ VK+KYCDTCM YR
Sbjct  101   SGRDPGVIARNANPPELEGYEGTEVGPGQTPQLCLPRTKDVVVNGVVVKIKYCDTCMHYR  160

Query  457   PPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIRR  636
             PPRCSHCSICNNCV++FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  FCW+ IR+
Sbjct  161   PPRCSHCSICNNCVQKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHAFCWIRIRK  220

Query  637   IMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYDR  816
             IM+ E  +IWKAM K+PAS+ LI YTFISVWFVGGLT FH YLIS NQ+TYENFR RYD 
Sbjct  221   IMNGENVSIWKAMTKSPASIALIIYTFISVWFVGGLTVFHSYLISRNQSTYENFRNRYDE  280

Query  817   RANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDIE  996
               NPYNKGV++NFME+FCTSIP SKN+FRAK+P++PA+ +R  +GGF SPN+ K V DIE
Sbjct  281   HVNPYNKGVIKNFMEVFCTSIPTSKNNFRAKIPKEPAITSRRISGGFTSPNIRKPVSDIE  340

Query  997   MGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAAMHHP  1161
             MGRK  WG+    A+  EG+ +++D V+ K GG    ++ ++ R    EG   R+  HH 
Sbjct  341   MGRKLAWGEAVREADGSEGRTNNDDNVD-KLGGSADHVTADLSRILPPEGMEGRSISHH-  398

Query  1162  rrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
             RRSSWG KSGSW++S E    AS V    ++ GSS+G L
Sbjct  399   RRSSWGIKSGSWDISSE--TFASAVEASKQVPGSSNGNL  435



>gb|EMT31641.1| Putative S-acyltransferase [Aegilops tauschii]
Length=440

 Score =   404 bits (1037),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 235/308 (76%), Gaps = 10/308 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             L LLLLTSGRDPGI+PRN HPP P+   G+    GQTP LRLPR ++V VNGI VKVKYC
Sbjct  83    LTLLLLTSGRDPGIIPRNTHPPTPESIYGSNYIRGQTP-LRLPRTRDVVVNGINVKVKYC  141

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTC+LYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF+MFVFST L+C+YVF F
Sbjct  142   DTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFYMFVFSTMLICLYVFAF  201

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CWVYI +I DAE+ +I +AM+KTPAS+VLI Y F+ VWFVGGL+ FH YL+STNQTTYEN
Sbjct  202   CWVYIIKISDAEQLSIGRAMLKTPASVVLIVYCFLCVWFVGGLSVFHFYLMSTNQTTYEN  261

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPNM  972
             FRYRYDRRANPYN+G++ N +EIFC+SIPPSKN+FRA+V  +  +  AR ++  F+SPNM
Sbjct  262   FRYRYDRRANPYNRGILNNILEIFCSSIPPSKNNFRARVTVEQGVEQARSSSRDFMSPNM  321

Query  973   GKAVEDIEMGRK-AVWGDVGAEHQEGQLSDNDGVNMKEGGG-LGEMSP-----EIRTTVD  1131
             GKAV D+EMG+K A W +       G L    G  + E  G L   SP     E+   + 
Sbjct  322   GKAVADLEMGKKPAPWDEPRTTADVGDLEVGLGGMLDEKEGRLTHASPDVSRDELSLELV  381

Query  1132  EGDRAAMH  1155
             EG RA MH
Sbjct  382   EG-RAGMH  388



>dbj|BAK07653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   402 bits (1034),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/348 (64%), Positives = 259/348 (74%), Gaps = 13/348 (4%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFD-GNIEGGGQTPQ-LRLPRIKEVEVNGITVKVK  429
             L LLLLTSGRDPGIVPRN HPPEP+  D  N  G GQTPQ LRLPR K+V VNG+ VKVK
Sbjct  91    LTLLLLTSGRDPGIVPRNTHPPEPEAHDVNNDTGNGQTPQQLRLPRTKDVYVNGVVVKVK  150

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVF
Sbjct  151   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVF  210

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI +I DAE+++IW+AM+KTPASMVLI Y FI VWFVGGL+ FH YL+STNQTTY
Sbjct  211   GFCWVYIIKIRDAEDSSIWRAMLKTPASMVLIIYCFICVWFVGGLSVFHFYLMSTNQTTY  270

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSP  966
             ENFRYRYDRRANPYN GVV NF+EIFCT++P SKN+FRA+VP + +L  +R    GF+SP
Sbjct  271   ENFRYRYDRRANPYNVGVVNNFLEIFCTAVPASKNNFRARVPVEQSLQQSRPPTRGFMSP  330

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIR-----TTVD  1131
             NMGK V D+E+GRK V  D      + +  +  G+  ++ G +   SP++        + 
Sbjct  331   NMGKPVGDLELGRKPVSWDEPRSGADIRDLEVGGMLDEKEGRITHASPDLSREALPVELM  390

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGG  1275
             EG RA MH  R S   R   S  M     ++A ++G G    GS S G
Sbjct  391   EG-RAGMHSRRSSWGHRSGTSESMD----SIAVQMGGGETNWGSVSSG  433



>ref|XP_004501727.1| PREDICTED: probable S-acyltransferase At3g26935-like [Cicer arietinum]
Length=450

 Score =   399 bits (1024),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 247/346 (71%), Gaps = 12/346 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQ-TPQLRLPRIKEVEVNGITVKVK  429
             VL+ L+LTSGRDPGIVPRN++PP   D DG++   G+  P   LPR KEV VNG TVKVK
Sbjct  98    VLIALVLTSGRDPGIVPRNSYPPVVDDCDGSVNVNGELNPPQHLPRFKEVIVNGTTVKVK  157

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV 
Sbjct  158   YCDTCMLYRPPRCSHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVH  217

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI++I ++EE TIWKAMIKTPAS+ LI Y+FISVWFVGGLTAFH YLISTNQ+TY
Sbjct  218   GFCWVYIKKIQNSEEITIWKAMIKTPASIALIIYSFISVWFVGGLTAFHTYLISTNQSTY  277

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDR+ NPYNKGV+ENF EIFC+SIP SKN+FR+KVP     +      G  +  
Sbjct  278   ENFRYRYDRQVNPYNKGVIENFKEIFCSSIPRSKNNFRSKVPIPKESSESSRRQGVDTLM  337

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKE----GGGLGEMSPEIRTTV--D  1131
             + K   D+E+G ++       E  E +    DG  + E    G  L + S ++   +  +
Sbjct  338   IRKTAGDLELGSQSY-----NEVDEAEKYYKDGFVIDEEYGKGSDLSDTSVDLSRMLHTE  392

Query  1132  EGDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSS  1269
             +G R  +   R+S W R S   +++PEVL      GE  ++ G SS
Sbjct  393   QGQRQLVSFVRQSMWERSSRKEDITPEVLDQIHEAGESKQITGDSS  438



>ref|XP_010519475.1| PREDICTED: probable protein S-acyltransferase 5 [Tarenaya hassleriana]
Length=485

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 219/267 (82%), Gaps = 3/267 (1%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN +PPEP++++G+ E    +TP LRLPR K++ VNGITVK+KYCDTCML
Sbjct  109   TSGRDPGIIPRNLYPPEPENYEGDGEPRISRTPPLRLPRTKDMVVNGITVKIKYCDTCML  168

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCV++FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  FCW+Y+
Sbjct  169   YRPPRASHCSICNNCVQKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYV  228

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD E+TTIWKA+IKTPAS+ LI YTFISVWFVGGLT FHLYLISTNQ+TYENFRYRY
Sbjct  229   KRIMDGEKTTIWKALIKTPASIALIIYTFISVWFVGGLTGFHLYLISTNQSTYENFRYRY  288

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAAR-HTAGGFVSPNMGKAVE  987
             DR  NP+NKG++ NF+E+FC+S+ PS+N+FR K  ++P +  R    GG  SP++ K V 
Sbjct  289   DRHENPFNKGILLNFLEVFCSSVSPSRNNFREKTQKEPVIPPRIVNGGGLSSPSLEKVVH  348

Query  988   DIEMGRKAVWGDVGAEHQEGQLSDNDG  1068
             DIEMGRK VW +   E + G   D DG
Sbjct  349   DIEMGRKPVWHET-VEEELGVFDDKDG  374



>ref|NP_001141947.1| uncharacterized protein LOC100274096 [Zea mays]
 gb|ACF87360.1| unknown [Zea mays]
 tpg|DAA48251.1| TPA: hypothetical protein ZEAMMB73_448859 [Zea mays]
Length=435

 Score =   397 bits (1019),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/256 (72%), Positives = 214/256 (84%), Gaps = 3/256 (1%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQ-LRLPRIKEVEVNGITVKVKY  432
             L LLL TSGRDPGI+PRN HPPEP+  DG  + G QTPQ  RLPR KEV VNGI+V+VKY
Sbjct  88    LTLLLCTSGRDPGIIPRNTHPPEPESIDGINDTGVQTPQQFRLPRTKEVVVNGISVRVKY  147

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFV STTLLC+YVF 
Sbjct  148   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVSSTTLLCLYVFA  207

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVY+ +I  AE  +IWKA++KTPAS+VLI Y F+ VWFVGGL+ FHLYL+ TNQTTYE
Sbjct  208   FCWVYVIKIRAAEHLSIWKALLKTPASIVLIIYCFLCVWFVGGLSVFHLYLMGTNQTTYE  267

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL-AARHTAGGFVSPN  969
             NFRYRYDRR NPYN+G + NF+EIFCT+IPPSKN+FRA+V  +  L   R  + GF+SP+
Sbjct  268   NFRYRYDRRDNPYNRGTLNNFLEIFCTAIPPSKNNFRARVTVEQGLQQTRSQSRGFMSPS  327

Query  970   MGK-AVEDIEMGRKAV  1014
             MGK  + ++EMGRK V
Sbjct  328   MGKPTIGELEMGRKPV  343



>gb|AFK39395.1| unknown [Lotus japonicus]
Length=418

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 242/344 (70%), Gaps = 25/344 (7%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL+ LLLTSGRDPGIVPRNAHPP+P D D       G +P+ RLPR K+V VNGITVK+K
Sbjct  94    VLIALLLTSGRDPGIVPRNAHPPQPDDHDAAANINNGLSPRGRLPRTKDVIVNGITVKIK  153

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRP RCSHCS+C+NCVERFDHHCPWVGQCIGLRNYRF+++FVFS TLLC+Y+ 
Sbjct  154   YCDTCMLYRPLRCSHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYIFVFSATLLCLYIH  213

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI RI ++EE +IWKAM KTPAS+VLI Y+F+ VWFVGGLTAFH YLISTNQ+TY
Sbjct  214   GFCWVYITRIKNSEEISIWKAMTKTPASIVLIIYSFVCVWFVGGLTAFHTYLISTNQSTY  273

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDR+ NPYN+G+V NF E+FCT IPPSKN FR+K+P++   A++      +SP 
Sbjct  274   ENFRYRYDRQVNPYNRGIVNNFKEVFCTRIPPSKNKFRSKIPKELPDASQGVGARTLSPL  333

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             M K+  ++E+  + V+ D        + +D+D  ++         S E  ++ D G+R  
Sbjct  334   MRKSTGNMELVGRRVYID--------EPNDDDTRDV--------FSNEEHSSKDSGERQD  377

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGLN  1281
             + +             ++ PEV      VGE N     SS G N
Sbjct  378   IWY--------FHQKSDIIPEVHDRVHEVGESNCAASESSSGPN  413



>ref|XP_009150177.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
5 [Brassica rapa]
Length=464

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 221/302 (73%), Gaps = 19/302 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             LV L +TSGRDPGI+PRN +PPEP+  +G         Q RLPR KE+ VNGITVK+KYC
Sbjct  101   LVFLFITSGRDPGIIPRNLYPPEPES-NGEPRLAHTPTQTRLPRTKEMLVNGITVKIKYC  159

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPR SHCSIC+NCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIYV  F
Sbjct  160   DTCMLYRPPRASHCSICDNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYVHVF  219

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CW+Y++RIMD E+ +IWKA+IKTPAS+ LI Y+F+SVWFVGGLT FHLYLI TNQ+TYEN
Sbjct  220   CWIYVKRIMDGEKISIWKALIKTPASIALILYSFVSVWFVGGLTGFHLYLIGTNQSTYEN  279

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRYRYDR  NP+NKG+V NFME+FCT +P SKN FRAKVP++PA+  R   G   SP++ 
Sbjct  280   FRYRYDRHENPFNKGIVGNFMEVFCTKVPLSKNSFRAKVPKEPAIPPRIVNGAMSSPSLQ  339

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             K   DIEMGRK VW +   E                   LG++  ++ TTV   D + M 
Sbjct  340   KVSHDIEMGRKPVWHETVEEE------------------LGDLEKDMETTVTSRDLSRML  381

Query  1156  HP  1161
              P
Sbjct  382   PP  383



>ref|NP_001288988.1| probable protein S-acyltransferase 5 [Brassica rapa]
 gb|ADK63397.1| DHHC type zinc finger protein [Brassica rapa]
Length=441

 Score =   395 bits (1016),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 221/302 (73%), Gaps = 19/302 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             LV L +TSGRDPGI+PRN +PPEP+  +G         Q RLPR KE+ VNGITVK+KYC
Sbjct  101   LVFLFITSGRDPGIIPRNLYPPEPES-NGEPRLAHTPTQTRLPRTKEMLVNGITVKIKYC  159

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPR SHCSIC+NCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIYV  F
Sbjct  160   DTCMLYRPPRASHCSICDNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYVHVF  219

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CW+Y++RIMD E+ +IWKA+IKTPAS+ LI Y+F+SVWFVGGLT FHLYLI TNQ+TYEN
Sbjct  220   CWIYVKRIMDGEKISIWKALIKTPASIALILYSFVSVWFVGGLTGFHLYLIGTNQSTYEN  279

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRYRYDR  NP+NKG+V NFME+FCT +P SKN FRAKVP++PA+  R   G   SP++ 
Sbjct  280   FRYRYDRHENPFNKGIVGNFMEVFCTKVPLSKNSFRAKVPKEPAIPPRIVNGAMSSPSLQ  339

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             K   DIEMGRK VW +   E                   LG++  ++ TTV   D + M 
Sbjct  340   KVSHDIEMGRKPVWHETVEEE------------------LGDLEKDMETTVTSRDLSRML  381

Query  1156  HP  1161
              P
Sbjct  382   PP  383



>emb|CDY37914.1| BnaA06g19030D [Brassica napus]
Length=441

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 221/302 (73%), Gaps = 19/302 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYC  435
             LV L +TSGRDPGI+PRN +PPEP+  +G         Q RLPR KE+ VNGITVK+KYC
Sbjct  101   LVFLFITSGRDPGIIPRNLYPPEPES-NGEPRLAHTPTQTRLPRTKEMLVNGITVKIKYC  159

Query  436   DTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGF  615
             DTCMLYRPPR SHCSIC+NCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIYV  F
Sbjct  160   DTCMLYRPPRASHCSICDNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYVHVF  219

Query  616   CWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYEN  795
             CW+Y++RIMD E+ +IWKA+IKTPAS+ LI Y+F+SVWFVGGLT FHLYLI TNQ+TYEN
Sbjct  220   CWIYVKRIMDGEKISIWKALIKTPASIALILYSFVSVWFVGGLTGFHLYLIGTNQSTYEN  279

Query  796   FRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMG  975
             FRYRYDR  NP+NKG+V NFME+FCT +P SKN FRAKVP++PA+  R   G   SP++ 
Sbjct  280   FRYRYDRHENPFNKGIVGNFMEVFCTKVPLSKNSFRAKVPKEPAIPPRIVNGAMSSPSLQ  339

Query  976   KAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMH  1155
             K   DIEMGRK VW +   E                   LG++  ++ TTV   D + M 
Sbjct  340   KVSHDIEMGRKPVWHETVEEE------------------LGDLEKDMETTVTSRDLSRML  381

Query  1156  HP  1161
              P
Sbjct  382   PP  383



>emb|CAB87904.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 232/337 (69%), Gaps = 19/337 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             LV LLLTS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KY
Sbjct  94    LVFLLLTSARDPGIIPRNLYPPEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKY  153

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  
Sbjct  154   CDTCMLYRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHV  213

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+Y++RIMD+E   IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYE
Sbjct  214   FCWIYVKRIMDSENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYE  273

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NP+NKG+V NFME+FCT++  S+N FR KV ++PA+  R   GG  SP++
Sbjct  274   NFRYRYDRHENPFNKGIVGNFMEVFCTNVAVSQNSFREKVSKEPAIPPRTVNGGMSSPSL  333

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
              K   DIEMGRK VW +   E                   LG++  ++   V   D + M
Sbjct  334   QKVSNDIEMGRKPVWHETVEEE------------------LGDIEKDMEAGVASRDLSRM  375

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGS  1263
               P  S       S E S     + SR     R GGS
Sbjct  376   LPPEESEGRGIMHSRESSRGRGIMHSRESSRGRRGGS  412



>ref|XP_010503518.1| PREDICTED: probable protein S-acyltransferase 5 [Camelina sativa]
Length=473

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 233/337 (69%), Gaps = 19/337 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+ LL+TS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KY
Sbjct  98    LIFLLVTSARDPGIIPRNLYPPEPEVNEGNGEPRLAHTPQSRLPRTKDLIVNGITVKIKY  157

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCV++FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  
Sbjct  158   CDTCMLYRPPRASHCSICNNCVDKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHA  217

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+Y+ RIM++E   IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYE
Sbjct  218   FCWIYVVRIMNSENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYE  277

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NP+NKG++ NFME+FCT++  S+N FRAKV ++PA+  R   GG  SP++
Sbjct  278   NFRYRYDRHENPFNKGIIGNFMEVFCTNVAISQNSFRAKVSKEPAIPPRTVNGGMSSPSL  337

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
              K   DIEMGRK VW +   E                   LG+M  ++ T V   D + M
Sbjct  338   QKVSNDIEMGRKPVWHETVEEE------------------LGDMDKDMETAVTSRDLSRM  379

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGS  1263
               P  S       S E S     + SR     R GGS
Sbjct  380   LPPEESEGRGIMHSRESSRGRGIMHSRESSRGRRGGS  416



>gb|ABK25091.1| unknown [Picea sitchensis]
Length=429

 Score =   392 bits (1008),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 254/350 (73%), Gaps = 29/350 (8%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE----GGGQTPQLRLPRIKEVEVNGITV  420
             L LLLLTSGRDPGI+PRN +PPE + D+D +I     GGGQ  +LRLPR K+  VNG+ V
Sbjct  97    LFLLLLTSGRDPGIIPRNENPPEQEEDYDTSISPAEWGGGQISRLRLPRTKDTMVNGVAV  156

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             K+KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYR+FFMFVFSTTLLCI
Sbjct  157   KIKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRYFFMFVFSTTLLCI  216

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             Y+F FCWVYI+ IM+A +  +W+AM+KTPAS+VLI YTFI+VWFVGGLTAFH+YLISTNQ
Sbjct  217   YIFAFCWVYIKIIMEAHQINVWRAMLKTPASIVLIIYTFIAVWFVGGLTAFHIYLISTNQ  276

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPR---DPALAARHTAG  951
             TTYENFRYRYD + NPY++G+V+NF+EIF T   PSKN+FRAKV     D          
Sbjct  277   TTYENFRYRYDNKENPYHRGLVQNFIEIFFTKTSPSKNNFRAKVTHESPDYKFFCSRLET  336

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD  1131
               +  NMGK   D+E+G K  W  +G E  E                    S +++    
Sbjct  337   DTLDTNMGKGGGDLEIGGKPSWPSLGIETSED-------------------SEDLQGDAL  377

Query  1132  EG-DRAAMHHPrrsswgrksgswEMSPEVLALASRV-GEGNRMGGSSSGG  1275
             EG D  +  HPRRSSWGRKSGSWE++P+++ALA+ V GE +R  G ++ G
Sbjct  378   EGIDTRSGIHPRRSSWGRKSGSWEITPDIIALAAGVGGEVSRANGVNTPG  427



>ref|XP_003528095.1| PREDICTED: probable protein S-acyltransferase 5-like [Glycine 
max]
Length=419

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 214/253 (85%), Gaps = 3/253 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL+ L+LTSGRDPGIVPRN++PP   +++GN      QTPQ  LPR KE+ VNG++VK+K
Sbjct  95    VLITLVLTSGRDPGIVPRNSNPPILVEYEGNANINNEQTPQPHLPRAKEIIVNGVSVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV 
Sbjct  155   YCDTCMLYRPPRCSHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVH  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI+RIMD+EE +IWKAMIKTPAS+ LI Y+FISVWFVGGLT FH YLIS NQ+TY
Sbjct  215   GFCWVYIKRIMDSEEISIWKAMIKTPASIALIIYSFISVWFVGGLTVFHTYLISKNQSTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVS  963
             ENFRYRYD++ANPY+KGV  NF EIFC+SIPPSKN+FR+K  +P++P+ ++R      +S
Sbjct  275   ENFRYRYDQQANPYDKGVAANFREIFCSSIPPSKNNFRSKILIPKEPSESSRRRTVESLS  334

Query  964   PNMGKAVEDIEMG  1002
             P M K   D+E+G
Sbjct  335   PMMRKTAGDLELG  347



>gb|KHN23960.1| Putative S-acyltransferase [Glycine soja]
Length=419

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 214/253 (85%), Gaps = 3/253 (1%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL+ L+LTSGRDPGIVPRN++PP   +++GN      QTPQ  LPR KE+ VNG++VK+K
Sbjct  95    VLITLVLTSGRDPGIVPRNSNPPILVEYEGNANINNEQTPQPHLPRAKEIIVNGVSVKIK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV 
Sbjct  155   YCDTCMLYRPPRCSHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVH  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
             GFCWVYI+RIMD+EE +IWKAMIKTPAS+ LI Y+FISVWFVGGLT FH YLIS NQ+TY
Sbjct  215   GFCWVYIKRIMDSEEISIWKAMIKTPASIALIIYSFISVWFVGGLTVFHTYLISKNQSTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAK--VPRDPALAARHTAGGFVS  963
             ENFRYRYD++ANPY+KGV  NF EIFC+SIPPSKN+FR+K  +P++P+ ++R      +S
Sbjct  275   ENFRYRYDQQANPYDKGVAANFREIFCSSIPPSKNNFRSKILIPKEPSESSRRRTVESLS  334

Query  964   PNMGKAVEDIEMG  1002
             P M K   D+E+G
Sbjct  335   PMMRKTAGDLELG  347



>emb|CDX87017.1| BnaC03g52870D [Brassica napus]
Length=443

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 223/304 (73%), Gaps = 20/304 (7%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTP-QLRLPRIKEVEVNGITVKVK  429
             LV L LTSGRDPGI+PRN +PPE +  + N E     TP Q RLPR KE+ VNGITVK+K
Sbjct  100   LVFLSLTSGRDPGIIPRNLYPPEAESIESNGEPRLAHTPTQTRLPRTKEMIVNGITVKIK  159

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPR SHCS+C+NCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIY+ 
Sbjct  160   YCDTCMLYRPPRASHCSMCDNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYIH  219

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCW+Y++RIMD E+ +IWK++IKTPAS+ LI Y+F+SVWFVGGLT FHLYLISTNQ+TY
Sbjct  220   VFCWIYVKRIMDGEKISIWKSLIKTPASIALILYSFVSVWFVGGLTGFHLYLISTNQSTY  279

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDR  NP+NKG+V NFME+FCT +P SKN FR KVP++PA+  R   G   SP+
Sbjct  280   ENFRYRYDRHENPFNKGIVGNFMEVFCTKVPLSKNSFREKVPKEPAIPPRIVNGPMSSPS  339

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             + K   DIEMGRK VW +   E                   LG++  ++ TTV   D + 
Sbjct  340   LQKVSHDIEMGRKPVWHETVEEE------------------LGDLEKDMETTVTSRDLSR  381

Query  1150  MHHP  1161
             M  P
Sbjct  382   MLPP  385



>ref|XP_010515201.1| PREDICTED: probable protein S-acyltransferase 5 [Camelina sativa]
Length=473

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 233/337 (69%), Gaps = 19/337 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+ LL+TS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KY
Sbjct  97    LIFLLVTSARDPGIIPRNLYPPEPEVSEGNGEPRLAHTPQSRLPRTKDLIVNGITVKIKY  156

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCV++FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  
Sbjct  157   CDTCMLYRPPRASHCSICNNCVDKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHV  216

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+Y+ RIM++E   IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYE
Sbjct  217   FCWIYVVRIMNSENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYE  276

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NP+NKG++ NFME+FCT++  S+N FRAKV ++PA+  R   GG  SP++
Sbjct  277   NFRYRYDRHENPFNKGIIGNFMEVFCTNVAISQNSFRAKVSKEPAIPPRTVNGGMSSPSL  336

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
              K   DIEMGRK VW +   E                   LG+M  ++ + V   D + M
Sbjct  337   QKVSNDIEMGRKPVWHETVEEE------------------LGDMDKDMESAVTSRDLSRM  378

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGS  1263
               P  S       S E S     + SR     R GGS
Sbjct  379   LPPEESEGRGIMHSRESSRGRGIMHSRESSRGRRGGS  415



>emb|CDY05871.1| BnaC08g20480D [Brassica napus]
Length=451

 Score =   391 bits (1004),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 235/349 (67%), Gaps = 24/349 (7%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPK--DFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVK  429
             L+ LL+TSGRDPGI+PRN +PPEP+  +  G         Q RLPR K++ VNGITVK+K
Sbjct  99    LIFLLVTSGRDPGIIPRNLYPPEPEGIEISGEPRLAHTPTQSRLPRTKDMIVNGITVKIK  158

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMF+  + LLC+YV 
Sbjct  159   YCDTCMLYRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFILCSALLCVYVH  218

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCW+Y++RIMD E+ +IWK++IKTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TY
Sbjct  219   VFCWIYVKRIMDGEKISIWKSLIKTPASIALIIYTFICVWFVGGLTGFHLYLMSTNQSTY  278

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDR  NP+NKG++ NFM++FCT++  SKN FRAKV ++P +  R   G   SP+
Sbjct  279   ENFRYRYDRHENPFNKGIIRNFMQVFCTTVASSKNSFRAKVSKEPVIPPRIVNGAMSSPS  338

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             + K   DIEMGRK VW +   E                   LG+M  ++ T+V   D + 
Sbjct  339   LQKVSHDIEMGRKPVWHETVDEE------------------LGDMDKDMETSVTSRDLSR  380

Query  1150  MHHPrrsswgrksgswEMSP----EVLALASRVGEGNRMGGSSSGGLNA  1284
             M  P  +       S E S         L+ RV E  R     S G++A
Sbjct  381   MLPPEETEGRGIMHSRESSRGRRGGSWELSGRVNEDLRTRDDESSGIDA  429



>ref|XP_011083425.1| PREDICTED: probable protein S-acyltransferase 7 [Sesamum indicum]
Length=371

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 210/248 (85%), Gaps = 5/248 (2%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRNAHPPEP+  +    G GQTP  RLPR K+V +NGITVKVKYCDTCMLY
Sbjct  100   TSGRDPGIIPRNAHPPEPEHDNSMEFGPGQTP--RLPRTKDVVINGITVKVKYCDTCMLY  157

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPRCSHCSIC+NCVERFDHHCPW+GQCIGLRNYRFFFMFVFSTTLLC+YV GFCWVYI+
Sbjct  158   RPPRCSHCSICDNCVERFDHHCPWIGQCIGLRNYRFFFMFVFSTTLLCLYVHGFCWVYIK  217

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMD+E+++IWKAM KTPAS+VL+AYTF+++WFVGGL+ FHLYLISTNQ+TYENFRY+Y 
Sbjct  218   RIMDSEKSSIWKAMTKTPASIVLLAYTFLALWFVGGLSVFHLYLISTNQSTYENFRYQYS  277

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
              R+NPYNKG+V NFME+F  SIP SKN+FRAKV +   + +   +  F+S N+G A  + 
Sbjct  278   MRSNPYNKGIVGNFMEVFWRSIPASKNNFRAKVQKKSVIPSHSMSASFISTNVGTAKGEQ  337

Query  994   EMGRKAVW  1017
             E   KA+W
Sbjct  338   E---KAMW  342



>ref|XP_010426373.1| PREDICTED: probable protein S-acyltransferase 5 [Camelina sativa]
Length=473

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 232/337 (69%), Gaps = 19/337 (6%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+ LL+TS RDPGI+PRN +PPEP+  +G+ E     TPQ RLPR K++ VNGITVK+KY
Sbjct  97    LIFLLVTSARDPGIIPRNLYPPEPEVTEGSGEPRLAHTPQSRLPRTKDLIVNGITVKIKY  156

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCV++FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  
Sbjct  157   CDTCMLYRPPRASHCSICNNCVDKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHV  216

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+Y+ RIM++E   IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYE
Sbjct  217   FCWIYVVRIMNSENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYE  276

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NP+NKG++ NFME+FCT++  S+N FRAKV ++PA+  R   GG  SP++
Sbjct  277   NFRYRYDRHENPFNKGIIGNFMEVFCTNVAISQNSFRAKVSKEPAIPPRTVNGGMSSPSL  336

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
              K   DIEMGRK VW +   E                   LG+M  ++   V   D + M
Sbjct  337   QKVSNDIEMGRKPVWHETVEEE------------------LGDMDKDMEAAVTSRDLSRM  378

Query  1153  HHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGS  1263
               P  S       S E S     + SR     R GGS
Sbjct  379   LPPEESEGRGIMHSRESSRGQGIMHSRESSRGRRGGS  415



>ref|XP_002875924.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52183.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=476

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 228/331 (69%), Gaps = 19/331 (6%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KYCDTCML
Sbjct  106   TSARDPGIIPRNLYPPEPEGNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCML  165

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  FCW+Y+
Sbjct  166   YRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYV  225

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD+E   IWK+ IKTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYENFRYRY
Sbjct  226   KRIMDSENINIWKSFIKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYENFRYRY  285

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DR  NP+NKG+V NFME+FCT++  S+N FRAKV ++PA+  R   GG  SP++ K   D
Sbjct  286   DRHENPFNKGIVGNFMEVFCTNVAISQNSFRAKVSKEPAIPPRTVNGGMSSPSLQKVSHD  345

Query  991   IEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrrs  1170
             IEMGRK VW +   E                   LG+M  ++   V   D + M  P  S
Sbjct  346   IEMGRKPVWHETVEEE------------------LGDMEKDMEAGVASRDLSRMLPPEES  387

Query  1171  swgrksgswEMSPEVLALASRVGEGNRMGGS  1263
                    S E S     + SR     R GGS
Sbjct  388   EGRGIMHSRESSRGRGIMHSRESSRGRRGGS  418



>ref|XP_006291034.1| hypothetical protein CARUB_v10017146mg [Capsella rubella]
 gb|EOA23932.1| hypothetical protein CARUB_v10017146mg [Capsella rubella]
Length=475

 Score =   390 bits (1002),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 227/331 (69%), Gaps = 19/331 (6%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KYCDTCML
Sbjct  104   TSARDPGIIPRNLYPPEPEGNEGNAEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCML  163

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  FCW+Y+
Sbjct  164   YRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYV  223

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
              RIM  E+  IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYENFRYRY
Sbjct  224   MRIMHGEDINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYENFRYRY  283

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DR  NP+NKG+V NFME+FCT++  S+N FRAKV ++PA+  R   GG  SP++ K   D
Sbjct  284   DRHENPFNKGIVGNFMEVFCTNVAISQNSFRAKVSKEPAIPPRTVNGGMSSPSLQKVSHD  343

Query  991   IEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrrs  1170
             IEMGRK VW +   E                   LG+M  ++ T V   D + M  P  S
Sbjct  344   IEMGRKPVWHETVEEE------------------LGDMDKDMETAVTSRDLSRMLPPEDS  385

Query  1171  swgrksgswEMSPEVLALASRVGEGNRMGGS  1263
                    S E S     + SR     R GGS
Sbjct  386   EGRDIMHSRESSRGRGIMHSRESSRGRRGGS  416



>ref|XP_006404219.1| hypothetical protein EUTSA_v10010352mg [Eutrema salsugineum]
 gb|ESQ45672.1| hypothetical protein EUTSA_v10010352mg [Eutrema salsugineum]
Length=464

 Score =   388 bits (997),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 219/298 (73%), Gaps = 20/298 (7%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KYCDTCML
Sbjct  105   TSGRDPGIIPRNLYPPEPEGNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCML  164

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIYV  FCW+Y+
Sbjct  165   YRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYVHVFCWIYV  224

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD E+  IWK+++KTPAS+ LI YTFISVWFVGGLT FHLYLISTNQ+TYENFRYRY
Sbjct  225   KRIMDGEKINIWKSLLKTPASIALILYTFISVWFVGGLTGFHLYLISTNQSTYENFRYRY  284

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARH-TAGGFVSPNMGKAVE  987
             DR  NP+NKG+  NFME+FCTS+  S+N FRAKV ++PA+  R    GG  SP++ K   
Sbjct  285   DRNENPFNKGITGNFMEVFCTSVALSQNSFRAKVLKEPAIPPRTVNGGGMSSPSLQKVSH  344

Query  988   DIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHP  1161
             DIEMGRK VW +   E                   LG+M  ++  +V   D + M  P
Sbjct  345   DIEMGRKPVWHETVEEE------------------LGDMDKDMEASVTSRDLSRMLPP  384



>ref|XP_010550747.1| PREDICTED: probable protein S-acyltransferase 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550748.1| PREDICTED: probable protein S-acyltransferase 5 isoform X2 [Tarenaya 
hassleriana]
Length=444

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/279 (63%), Positives = 216/279 (77%), Gaps = 9/279 (3%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKYCDTCMLY  453
             TSGRDPGI+PRN +PPE ++ +  +    +TP  RLPR K++ VNG+TVK+KYCDTCMLY
Sbjct  110   TSGRDPGIIPRNLYPPEGEEGEPRM---SRTPPFRLPRTKDMVVNGVTVKIKYCDTCMLY  166

Query  454   RPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYIR  633
             RPPR SHCSICNNCV++FDHHCPW+GQC+GLRNYRF+FMFV  +TLLCIYV  FCW+Y++
Sbjct  167   RPPRASHCSICNNCVQKFDHHCPWLGQCVGLRNYRFYFMFVLCSTLLCIYVHVFCWIYVK  226

Query  634   RIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRYD  813
             RIMD E TTIWKA+IKTPAS+ LI YTF+SVWFVGGLT FHLYLISTNQ+TYENFRYRYD
Sbjct  227   RIMDGERTTIWKALIKTPASIALILYTFVSVWFVGGLTGFHLYLISTNQSTYENFRYRYD  286

Query  814   RRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVEDI  993
             R+ NP+NKG++ NF+E+FC+S+PP KN+FRAK+  +P    R   G   SP+  KAV DI
Sbjct  287   RQENPFNKGILRNFLEVFCSSVPPRKNNFRAKITNEP----RTMNGALSSPSFEKAVHDI  342

Query  994   EMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSP  1110
             EMGRK VW +   E  E  + + DG       G   + P
Sbjct  343   EMGRKPVWHETVEE--ELDIPNKDGETAVVSQGFSRIIP  379



>ref|NP_190445.2| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q9M306.2|ZDH10_ARATH RecName: Full=Probable protein S-acyltransferase 5; AltName: 
Full=Probable palmitoyltransferase At3g48760; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g48760 [Arabidopsis 
thaliana]
 gb|AEE78453.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=476

 Score =   387 bits (995),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 227/331 (69%), Gaps = 19/331 (6%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TS RDPGI+PRN +PPEP+  +GN E     TPQ RLPR K++ VNGITVK+KYCDTCML
Sbjct  106   TSARDPGIIPRNLYPPEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCML  165

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  +TLLCIYV  FCW+Y+
Sbjct  166   YRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYV  225

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIMD+E   IWK+ +KTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYENFRYRY
Sbjct  226   KRIMDSENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYENFRYRY  285

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DR  NP+NKG+V NFME+FCT++  S+N FR KV ++PA+  R   GG  SP++ K   D
Sbjct  286   DRHENPFNKGIVGNFMEVFCTNVAVSQNSFREKVSKEPAIPPRTVNGGMSSPSLQKVSND  345

Query  991   IEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHPrrs  1170
             IEMGRK VW +   E                   LG++  ++   V   D + M  P  S
Sbjct  346   IEMGRKPVWHETVEEE------------------LGDIEKDMEAGVASRDLSRMLPPEES  387

Query  1171  swgrksgswEMSPEVLALASRVGEGNRMGGS  1263
                    S E S     + SR     R GGS
Sbjct  388   EGRGIMHSRESSRGRGIMHSRESSRGRRGGS  418



>ref|XP_009149794.1| PREDICTED: probable protein S-acyltransferase 5 [Brassica rapa]
 emb|CDY64963.1| BnaAnng19880D [Brassica napus]
Length=451

 Score =   386 bits (991),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 237/348 (68%), Gaps = 32/348 (9%)
 Frame = +1

Query  271   LTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQ-----TP-QLRLPRIKEVEVNGITVKVKY  432
             +TSGRDPGI+PRN +PPEP+     IE GG+     TP Q RLPR K++ VNGITVK+KY
Sbjct  104   VTSGRDPGIIPRNLYPPEPE----GIEIGGEPRLAHTPTQSRLPRTKDMIVNGITVKIKY  159

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMF+  + LLC+YV  
Sbjct  160   CDTCMLYRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFILCSALLCVYVHV  219

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCW+Y++RIMD E+ +IWK++IKTPAS+ LI YTFI VWFVGGLT FHLYL+STNQ+TYE
Sbjct  220   FCWIYVKRIMDGEKISIWKSLIKTPASIALIIYTFICVWFVGGLTGFHLYLMSTNQSTYE  279

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NFRYRYDR  NP+NKG++ NFME+FCTS+  SKN FRAKV ++P +  R   G   SP++
Sbjct  280   NFRYRYDRHENPFNKGILGNFMEVFCTSVASSKNSFRAKVSKEPVIPPRIVNGAMSSPSL  339

Query  973   GKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAM  1152
              K  +DIEMGRK VW +   E                   LG+M  ++ T+V   D + M
Sbjct  340   QKVSQDIEMGRKPVWHETVDEE------------------LGDMDKDMETSVTSRDLSRM  381

Query  1153  HHPrrsswgrksgswEMSP----EVLALASRVGEGNRMGGSSSGGLNA  1284
               P  +       S E S         L+ RV E  R     S G++A
Sbjct  382   LPPEETEGRGIMHSRESSRGRRGGSWELSGRVNEDLRTRDVESSGIDA  429



>gb|KFK34176.1| hypothetical protein AALP_AA5G110400 [Arabis alpina]
Length=466

 Score =   385 bits (989),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 216/297 (73%), Gaps = 19/297 (6%)
 Frame = +1

Query  274   TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
             TSGRDPGI+PRN +PPEP+  + N E     TPQ RLPR K++ VNGITVK+KYCDTCML
Sbjct  106   TSGRDPGIIPRNLYPPEPEASESNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCML  165

Query  451   YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
             YRPPR SHCSICNNCVE+FDHHCPW+GQCIGLRNYRF+FMFV  + LLCIYV  FCW+Y+
Sbjct  166   YRPPRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSALLCIYVHVFCWIYV  225

Query  631   RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
             +RIM  E   IW+++IKTPAS+ LI YTFIS+WFVGGLT FHLYL+STNQ+TYENFRYRY
Sbjct  226   KRIMHGENINIWRSLIKTPASIALIIYTFISIWFVGGLTGFHLYLMSTNQSTYENFRYRY  285

Query  811   DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAVED  990
             DR  NP+NKG++ NFME+FCTS+  S+N FRAKV ++PA+  R   G   SP++ K   D
Sbjct  286   DRHENPFNKGIIGNFMEVFCTSVAISQNSFRAKVSKEPAIPPRTVNGAMSSPSLQKVSND  345

Query  991   IEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAAMHHP  1161
             IEMGRK VW +   E                   LG+M  ++  +V   D + M  P
Sbjct  346   IEMGRKPVWHETVEEE------------------LGDMDKDMEASVTSRDLSRMLPP  384



>gb|AES73022.2| DHHC type zinc finger protein [Medicago truncatula]
Length=426

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 236/341 (69%), Gaps = 18/341 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGG-QTPQLRLPRIKEVEVNGITVKVK  429
             VL+ L+LTSGRDPGIVPRN++PP P ++DG+      Q P   LPR KEV VNGI V+VK
Sbjct  92    VLIALILTSGRDPGIVPRNSYPPLPDNYDGSDSNNSEQNPPPHLPRSKEVIVNGIAVRVK  151

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRPPRCSHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS T+LC+YV 
Sbjct  152   YCDTCMLYRPPRCSHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATMLCLYVH  211

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYI RI ++EE +IWKAMIKTPAS+ LI Y+FI+VWFVGGLT FH YLISTNQ+TY
Sbjct  212   AFCWVYIVRIKNSEEISIWKAMIKTPASIALIIYSFIAVWFVGGLTCFHTYLISTNQSTY  271

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYDR+ NPYNKGV+ENF E+FC+SIP SKN FR+KVPR+P  ++R      +   
Sbjct  272   ENFRYRYDRQVNPYNKGVIENFKEVFCSSIPISKNSFRSKVPREPTESSRRRGVDTLMMP  331

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDEGDRAA  1149
             +    +++E   K        + + G+ SD    ++  G  L           + G R  
Sbjct  332   VYNEADEVEKDYK--------DEEYGKSSDLSDTSVDLGSMLH---------TERGQRQV  374

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSG  1272
                 R+S W + S  WE + +VL      GE  R+   SS 
Sbjct  375   ASFLRQSLWEQSSRKWETASDVLDEVHEDGESKRITSDSSN  415



>ref|XP_001759162.1| predicted protein [Physcomitrella patens]
 gb|EDQ75846.1| predicted protein [Physcomitrella patens]
Length=430

 Score =   373 bits (957),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 239/337 (71%), Gaps = 9/337 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNI---EGGGQTPQLRLPRIKEVEVNGITV  420
             VLVLLLLTSGRDPGI+PRN HPPEP+ DFD +    + GGQTP+LRLPR K+V VNG+ V
Sbjct  86    VLVLLLLTSGRDPGIIPRNTHPPEPEEDFDPSTSPADWGGQTPRLRLPRTKDVTVNGVVV  145

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             K KYCDTCMLYRPPRCSHCSICNNCV RFDHHCPWVGQCIG RNYRFFFMFV ST+LLC+
Sbjct  146   KTKYCDTCMLYRPPRCSHCSICNNCVLRFDHHCPWVGQCIGQRNYRFFFMFVSSTSLLCV  205

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF  C +YI+ +MD    T+ KA+ K+PAS+VL+AYTFI VWFVGGLT FHLYLI TNQ
Sbjct  206   YVFAMCALYIKILMDEGGRTVLKALSKSPASIVLMAYTFICVWFVGGLTVFHLYLIGTNQ  265

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV----PRDPALAARHTA  948
             TTYENFRYRY+ + NPYN+G + NF EIFC  IPPSKN FR++V    P    +  +   
Sbjct  266   TTYENFRYRYESKENPYNRGCLLNFNEIFCFKIPPSKNRFRSRVQEVTPGSMGITQQSRD  325

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLG-EMSPEIRTT  1125
              G +  +      D+E G K  W        EG   +  G  +  G   G EM       
Sbjct  326   MGEMHGSSAGKAPDVEQGYKPTWPHAEDMVGEGGELEMAGGRVSTGSECGMEMKDSFDPR  385

Query  1126  VDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRV  1236
               E  R A+ HPRRSSWGRKSGSWE+SP++LA+++ V
Sbjct  386   PFEQGRPAVAHPRRSSWGRKSGSWEISPDILAMSTGV  422



>dbj|BAB01189.1| unnamed protein product [Arabidopsis thaliana]
Length=391

 Score =   369 bits (946),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 243/337 (72%), Gaps = 59/337 (18%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKY  432
             L+LLLLTSGRDPGI+PRNAHPPEP+  DGN++ G GQTPQLRLPRIKEV++NGIT KVKY
Sbjct  91    LILLLLTSGRDPGIIPRNAHPPEPETLDGNMDAGAGQTPQLRLPRIKEVQLNGITFKVKY  150

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFFMFVFSTTLL      
Sbjct  151   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLL------  204

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
                            T + A I++P S+                                
Sbjct  205   -------------SRTRYVATIQSPPSLK-------------------------------  220

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
                 RYDRR+NP+NKGVV NF E F ++IPPSKNDFRA V R+P L  R  AGGF+SPNM
Sbjct  221   --ESRYDRRSNPHNKGVVNNFKETFFSTIPPSKNDFRAMVQREPPLPPRSVAGGFMSPNM  278

Query  973   GKAVEDIEMGRKAVWGDVG---AEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVDE-GD  1140
             GKA ++IEMGRKAVW D+G   ++H +G+  +N+ +++K+ G LGE+SP+IR TVDE  D
Sbjct  279   GKANDEIEMGRKAVWADMGPAMSDHGDGKHGNNERLHVKD-GELGELSPDIRATVDEQSD  337

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGNR  1251
             R +M HPRRSSWGRKSGSW+MSPEV+ALA+RVGE N+
Sbjct  338   RPSM-HPRRSSWGRKSGSWDMSPEVMALAARVGEQNQ  373



>ref|XP_001757201.1| predicted protein [Physcomitrella patens]
 gb|EDQ78060.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 239/338 (71%), Gaps = 16/338 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNI---EGGGQTPQLRLPRIKEVEVNGITV  420
             VLVLLLLTSGRDPGI+PRN HPPEP+ DF  N    E G QTP+ RLPR K+V VNG+ V
Sbjct  75    VLVLLLLTSGRDPGIIPRNLHPPEPEEDFVSNNSPGEWGAQTPRSRLPRTKDVIVNGVAV  134

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             K KYCDTCMLYRPPRCSHCSICNNCV RFDHHCPWVGQCIG RNYRFFFMFV ST LLC+
Sbjct  135   KTKYCDTCMLYRPPRCSHCSICNNCVLRFDHHCPWVGQCIGQRNYRFFFMFVSSTLLLCV  194

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF  C +YI+ ++D  + T+WKA+ K+PAS+VL+ YTFI VWFVGGLT FHLYLI TNQ
Sbjct  195   YVFAMCAMYIKILVDEGDRTVWKALSKSPASIVLMVYTFICVWFVGGLTVFHLYLIGTNQ  254

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV----PRDPALAARHTA  948
             TTYENFRYRYD + NPYN+G V NF EIFC++IP SKN FR++V    PR      +   
Sbjct  255   TTYENFRYRYDNKVNPYNRGCVSNFNEIFCSTIPASKNQFRSRVQEVIPRQMGRVQQTRD  314

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV  1128
              G    +      D+E G KA W +      EG   +  G  +  G  LG    E++ T 
Sbjct  315   MGEAHGSSAAKESDLEQGYKATWPNAEDMVGEGGELEMAGGRVSTGSELGM---EMKDTF  371

Query  1129  D----EGDRAAMHHPrrsswgrksgswEMSPEVLALAS  1230
             D    E  R A+ + RR+S GR+SGSWE++P++LA++S
Sbjct  372   DPRPIEQGRPAVAN-RRTSRGRQSGSWEITPDILAMSS  408



>ref|XP_003574851.1| PREDICTED: probable protein S-acyltransferase 7 [Brachypodium 
distachyon]
Length=423

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/269 (66%), Positives = 205/269 (76%), Gaps = 9/269 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             +LVLLLLTSGRDPGIVPRNAHPPEP+D     N+ G  GGQ     LP  K+V VNG++V
Sbjct  97    ILVLLLLTSGRDPGIVPRNAHPPEPEDIGESSNLSGWQGGQHGLAGLPLTKDVLVNGVSV  156

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFF MFV S TLLCI
Sbjct  157   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFLMFVSSATLLCI  216

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV IR+IM+  E  + +A++K+P S +L+ YTF SVWFVGGLT+FHLYLISTNQ
Sbjct  217   YVFAFCWVNIRKIMNTHECNLGRAILKSPISAILMLYTFASVWFVGGLTSFHLYLISTNQ  276

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRD-PALAARHTAGGF  957
             TTYENFRYRYDRR NPYN+GV +NF+EI C+ IP S+N+FRAK   D  A  +  + G  
Sbjct  277   TTYENFRYRYDRRTNPYNRGVAQNFIEILCSRIPNSRNNFRAKAKEDSAAFTSSLSVGRV  336

Query  958   VSPNMGKAVEDIEMGRKAVWGDVGAEHQE  1044
             ++P   K   D+E G K     VGAE  E
Sbjct  337   LTP--PKLSVDLESGMKR--QTVGAEEME  361



>ref|XP_010910250.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Elaeis 
guineensis]
Length=425

 Score =   365 bits (938),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 219/313 (70%), Gaps = 19/313 (6%)
 Frame = +1

Query  247   TQVLVLLLLTSGRDPGIVPRNAHPPEPKDF----DGNIEG-GGQTPQLRLPRIKEVEVNG  411
                L LLLLTSGRDPGI+PRNAHPPEP+D     + +++  G Q     LP  K+V VNG
Sbjct  98    VHTLFLLLLTSGRDPGIIPRNAHPPEPEDVGEASNSSVDWPGSQHGAPSLPPTKDVLVNG  157

Query  412   ITVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTL  591
             I VKVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV S T 
Sbjct  158   IIVKVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSATF  217

Query  592   LCIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLIS  771
             LC+YVFGFCWV +++IM+A E  +WKA++K+P S +LI YTFI VWFVGGLTAFHLYLI 
Sbjct  218   LCLYVFGFCWVNLKKIMEAYECNLWKALLKSPVSGILILYTFIVVWFVGGLTAFHLYLIC  277

Query  772   TNQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDP-ALAARHTA  948
             TNQTTYENFRYRYD++ NPYN G V+N  EIF + IP SKNDFRAK+  D  A  +  + 
Sbjct  278   TNQTTYENFRYRYDKKNNPYNHGWVQNIKEIFFSKIPSSKNDFRAKIKEDSIAFTSSRSM  337

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQE---GQLSDNDGV--------NMKEGGGL  1095
             G  +SP+M K   D+EMG K    +V AE  E    Q+    G+        +    G  
Sbjct  338   GRPLSPDMPKTSLDLEMGGKR--QNVAAEELEDLQNQIGSISGLERCGTEPPHSSRDGYK  395

Query  1096  GEMSPEIRTTVDE  1134
             GE++P++     E
Sbjct  396   GEITPDLEALAAE  408



>ref|XP_003524474.1| PREDICTED: probable protein S-acyltransferase 5-like [Glycine 
max]
Length=433

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 227/336 (68%), Gaps = 14/336 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFD-GNIEGGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL+ L++TS RDPGIVPRNA PPE  D+   +    GQ    R PR K+V VNGIT+KVK
Sbjct  95    VLITLVVTSARDPGIVPRNAQPPETDDYHWTDNSNNGQISLSRFPRTKDVIVNGITLKVK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRP R SHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV 
Sbjct  155   YCDTCMLYRPLRASHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVH  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVY  +I D+EE +IWKAM KT AS+VLI YTFI  WFVGGLT FH YLISTNQ+TY
Sbjct  215   AFCWVYTVKIKDSEEISIWKAMSKTIASIVLIVYTFICFWFVGGLTVFHSYLISTNQSTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENF+YRYD + NPYN+G+V NF E+FCT IPPSKN+FR+KV R+P  + + T    +SP 
Sbjct  275   ENFKYRYDPQTNPYNRGMVNNFKEVFCTRIPPSKNNFRSKVLREPLDSHQRTGIRPISPM  334

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLG---EMSPEIRTTVDEGD  1140
             M +    +E+   +V+ +   E    +   ++    K+ G      ++S  + T   EG 
Sbjct  335   MKRRPRSMELVGNSVYNEQDEEESNYRDEIDNEARSKDSGLTDKSLDLSRILHTEGVEGQ  394

Query  1141  RAAMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
              +++ H            WE +PEV    +  GE N
Sbjct  395   ESSLRH----------HLWEATPEVQDSITEFGESN  420



>ref|XP_008812135.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
 ref|XP_008812136.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
 ref|XP_008812137.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
 ref|XP_008812138.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
Length=427

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 218/313 (70%), Gaps = 19/313 (6%)
 Frame = +1

Query  247   TQVLVLLLLTSGRDPGIVPRNAHPPEPKDF----DGNIEG-GGQTPQLRLPRIKEVEVNG  411
                L LLLLTSGRDPGI+PRNAHPPEP+D     + +++  G Q     LP  K+V VNG
Sbjct  98    VHTLFLLLLTSGRDPGIMPRNAHPPEPEDVGEASNSSVDWPGSQHGNPSLPPTKDVLVNG  157

Query  412   ITVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTL  591
              TVKVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV S T 
Sbjct  158   FTVKVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSATF  217

Query  592   LCIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLIS  771
             LC+YV  FCWV +++IM+A E  +WKA++K+P S +LI YTF+ VWFVGGLTAFHLYLI 
Sbjct  218   LCLYVLAFCWVNLKKIMEAYECNLWKALLKSPVSGILILYTFVVVWFVGGLTAFHLYLIC  277

Query  772   TNQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDP-ALAARHTA  948
             TNQTTYENFRYRYD++ NPYN+G V+N  EIF + IP SKNDFRAKV  D  A  +  + 
Sbjct  278   TNQTTYENFRYRYDKKNNPYNRGWVQNIREIFFSRIPSSKNDFRAKVKEDSIAFTSSRSM  337

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQE---GQLSDNDGVN--------MKEGGGL  1095
             G  +SP+M K   D+EMG K    +V AE  E    Q+    G+            GG  
Sbjct  338   GRPLSPDMPKTSLDLEMGGKR--QNVAAEELEDLQNQIGSISGLERCGTEPPYSSRGGYK  395

Query  1096  GEMSPEIRTTVDE  1134
             GE++P++     E
Sbjct  396   GEITPDLEALAAE  408



>ref|XP_007159990.1| hypothetical protein PHAVU_002G283700g [Phaseolus vulgaris]
 gb|ESW31984.1| hypothetical protein PHAVU_002G283700g [Phaseolus vulgaris]
Length=437

 Score =   362 bits (930),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/273 (61%), Positives = 205/273 (75%), Gaps = 6/273 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFD-GNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L+ LL+TSGRDPGIVPRNAHPPEP D+        GQ    R PR ++V VNGITVKVKY
Sbjct  93    LITLLVTSGRDPGIVPRNAHPPEPDDYHLTENSNNGQISTSRFPRTRDVIVNGITVKVKY  152

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRP R SHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV  
Sbjct  153   CDTCMLYRPVRASHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVHA  212

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWVYI RI D E+ +IW+AM KT AS  L+ Y+F+ VWFVGGL  FH YLISTNQ+TYE
Sbjct  213   FCWVYIVRIKDFEKISIWRAMSKTIASTALVIYSFVCVWFVGGLAVFHTYLISTNQSTYE  272

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
             NF+YRYD ++NPYN+G++ NF E+FC+ IPPSKN+FR+KVP +P  + R T    + P M
Sbjct  273   NFKYRYDPQSNPYNRGILNNFKEVFCSRIPPSKNNFRSKVPLEPLDSYRRTDNTPLGPMM  332

Query  973   GKAVEDIE-MGRKAVWGDVGAEHQEGQLSDNDG  1068
              +    +E +G  +V+     EH++ +    DG
Sbjct  333   KRTTRQMELLGGNSVYN----EHEDEESHHRDG  361



>ref|NP_001142294.1| uncharacterized protein LOC100274463 [Zea mays]
 gb|ACF88116.1| unknown [Zea mays]
 gb|AFW64979.1| hypothetical protein ZEAMMB73_813450 [Zea mays]
Length=420

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 222/309 (72%), Gaps = 18/309 (6%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFD--GNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             +L++LL+TSGRDPGIVPRN HPPEP+D D   N+    GGQ     LP  ++V VNG++V
Sbjct  94    ILIVLLITSGRDPGIVPRNTHPPEPEDIDESSNLPDCPGGQQGSTGLPPTRDVLVNGVSV  153

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+LCI
Sbjct  154   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTVLCI  213

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +RRIMD  +  I +A++K+P S +LI YTFI+VWFVGGLT+FH+YLISTNQ
Sbjct  214   YVFAFCWVNLRRIMDTHQCKIGRALLKSPISGLLILYTFIAVWFVGGLTSFHIYLISTNQ  273

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDRR NPYN GV +NF+++  + IP SK+DFRAKV  D +  A+  + G  
Sbjct  274   TTYENFRYRYDRRTNPYNLGVGQNFIDVLFSRIPSSKHDFRAKVKADSSTFASSLSMGRV  333

Query  958   VSPNMGKAVEDIEMG--RKAVWGDVGAEHQEGQLSDNDGV--------NMKEGGGLGEMS  1107
             +SP   K   D+EMG  R+AV  +   E    Q+    G+        +     G  EMS
Sbjct  334   LSPP--KTSVDLEMGMKRQAVAAE-DFEDLHSQIGSAMGLERCGTEPPHFVGRKGCSEMS  390

Query  1108  PEIRTTVDE  1134
             P+I    +E
Sbjct  391   PDIEAFAEE  399



>gb|EMT31104.1| Putative S-acyltransferase [Aegilops tauschii]
Length=571

 Score =   365 bits (937),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/270 (66%), Positives = 207/270 (77%), Gaps = 9/270 (3%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGIT  417
             Q+LVLLLLTSGRDPGIVPRN+HPPEP+D     N+    GGQ     LP  K+V VNG+ 
Sbjct  244   QILVLLLLTSGRDPGIVPRNSHPPEPEDIGESSNLSDWPGGQHGSAGLPLTKDVLVNGVL  303

Query  418   VKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  597
             VKVKYC TCMLYRPPRCSHCSICNNC+ERFDHHCPWVGQCIG RNYRFF MFV S T+LC
Sbjct  304   VKVKYCHTCMLYRPPRCSHCSICNNCIERFDHHCPWVGQCIGKRNYRFFLMFVSSATVLC  363

Query  598   IYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN  777
             IYVF FCWV I + MD  E T  +A++K+P S +L+ YTF++VWFVGGLT+FHLYLISTN
Sbjct  364   IYVFTFCWVNIGKTMDTHECTFGRAILKSPISAILMLYTFVAVWFVGGLTSFHLYLISTN  423

Query  778   QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDP-ALAARHTAGG  954
             QTTYENFRYRYDRR+NPYN+G+V+NF+EI C+ IP S+N+FRAK   D  A A+  + G 
Sbjct  424   QTTYENFRYRYDRRSNPYNRGLVQNFIEILCSRIPSSRNNFRAKANEDSAAFASTLSMGR  483

Query  955   FVSPNMGKAVEDIEMGRKAVWGDVGAEHQE  1044
              +SP   K   D+EMG K     VGAE  E
Sbjct  484   VLSPP--KMSVDLEMGTKR--QAVGAEDME  509



>ref|XP_008778432.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
Length=422

 Score =   359 bits (922),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/253 (68%), Positives = 194/253 (77%), Gaps = 4/253 (2%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             + LL LTSGRDPGI+PRNAHPPEP+D DG  + GGGQ     LP  K++ VN I VKVKY
Sbjct  98    IFLLFLTSGRDPGIIPRNAHPPEPEDDDGVSDWGGGQGGVSTLPPTKDIIVNNIVVKVKY  157

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             C TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+LC+YVF 
Sbjct  158   CHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTVLCLYVFA  217

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV + +IM+  E  +W A+IK+P S VLI YTFI+ WFVGGLTAFHLYLI TNQTTYE
Sbjct  218   FCWVNLTKIMEVYECNLWNAVIKSPVSGVLIIYTFIAAWFVGGLTAFHLYLICTNQTTYE  277

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGFVSPN  969
             NFRYRYDR  NPYN+G   N  EIF + IP SKNDFRAKV  D A   + H+ G  +SP 
Sbjct  278   NFRYRYDRNKNPYNRGCARNVFEIFFSRIPESKNDFRAKVKEDSATFTSSHSLGRMMSP-  336

Query  970   MGKAVEDIEMGRK  1008
               K   D+EMG K
Sbjct  337   -AKMSFDLEMGGK  348



>ref|XP_006359052.1| PREDICTED: protein S-acyltransferase 8-like [Solanum tuberosum]
Length=422

 Score =   359 bits (921),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 212/307 (69%), Gaps = 12/307 (4%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIEGGGQTPQLRLPRIKEVEVNGITV  420
              VLVLLLLTS RDPGIVPRN+HPPE +   +F  ++EGG QTP L+ PR KEV VNG+ V
Sbjct  75    HVLVLLLLTSARDPGIVPRNSHPPEEEFRHEFSASVEGGRQTPSLQFPRTKEVIVNGMPV  134

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFF FV S  LLCI
Sbjct  135   RVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFCFVCSAMLLCI  194

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF  C +YI+ +MD  ++T+ KA+ ++PAS+VL+AY FIS+WFVGGLT FHLYLISTNQ
Sbjct  195   YVFAICALYIKVLMDNNQSTVLKALKESPASVVLMAYCFISLWFVGGLTGFHLYLISTNQ  254

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV----PRDPALAARHTA  948
             TTYENFRY+ + R N Y+ G V NFME+FCT + PS+N+FRA V    PR P    R   
Sbjct  255   TTYENFRYKAENRINVYDLGCVNNFMEVFCTKVKPSRNNFRANVQEEEPRPPLPTTREAE  314

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTV  1128
                   +  K  +D+E G     GD+    Q   + D +      G  +   +     +V
Sbjct  315   VDMGEDHRAKVEDDLEFG-----GDLLKISQRHNIEDIEAEIRSRGSDVHHHNSSEADSV  369

Query  1129  DEGDRAA  1149
                DR A
Sbjct  370   LGSDRRA  376



>ref|XP_003532462.1| PREDICTED: probable protein S-acyltransferase 5-like isoform 
1 [Glycine max]
 gb|KHN16867.1| Putative S-acyltransferase [Glycine soja]
Length=435

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 228/338 (67%), Gaps = 16/338 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQL-RLPRIKEVEVNGITVKVK  429
             VL+ L++TS RDPGIVPRNA PP+P D  G      +   L R PR K+V +NGIT+KVK
Sbjct  95    VLITLVVTSARDPGIVPRNAQPPQPDDHHGTDNSNNRQISLSRFPRTKDVILNGITLKVK  154

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YCDTCMLYRP R SHCS+C+NCVERFDHHCPWVGQCIGLRNYRF++MFVFS TLLC+YV 
Sbjct  155   YCDTCMLYRPLRASHCSVCDNCVERFDHHCPWVGQCIGLRNYRFYYMFVFSATLLCLYVH  214

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYI +I D+E  +IWKAM KT AS+VLI YTF+  WFVGGLT FH YLISTNQ+TY
Sbjct  215   AFCWVYIVKIKDSEAISIWKAMSKTIASIVLIVYTFLCSWFVGGLTIFHTYLISTNQSTY  274

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENF+ RYD + NPYN+G+V NF E+FCT IPPSKN+FR+KVPR+P  + + T    +SP 
Sbjct  275   ENFKNRYDPQTNPYNRGMVNNFKEVFCTRIPPSKNNFRSKVPREPLESYQRTGIRPLSPM  334

Query  970   MGK--AVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLG---EMSPEIRTTVDE  1134
             M +      +E+   AV+ +   E    +   ++    K+ G      ++S  + T   E
Sbjct  335   MKRRTRTRSMELVGNAVYNEQDEEESNYRDGFDNEARSKDSGLTDKSLDLSRILHTEGVE  394

Query  1135  GDRAAMHHPrrsswgrksgswEMSPEVLALASRVGEGN  1248
             G+ +++ H            WE + EV    + VGE N
Sbjct  395   GEESSIRH----------HQWEGTTEVQDSITEVGESN  422



>gb|EAZ07812.1| hypothetical protein OsI_30070 [Oryza sativa Indica Group]
Length=424

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 201/257 (78%), Gaps = 7/257 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             ++VLLLLTSGRDPGI+PRNAHPPEP+D     N+    GGQ     LP  K+V VNG+ V
Sbjct  98    IIVLLLLTSGRDPGIIPRNAHPPEPEDVGESSNLSEWPGGQHGSTALPLTKDVLVNGVLV  157

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STTLLC+
Sbjct  158   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTLLCV  217

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +R IMD     + +A++K+P S +LI YTFI+VWFVGGLT+FHLYLISTNQ
Sbjct  218   YVFAFCWVDLRIIMDTHRCKLGRAIMKSPVSGILILYTFIAVWFVGGLTSFHLYLISTNQ  277

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDR+ NP+N+G+V+NF+EI C+ IP S+N+FRAKV  D A   +    G  
Sbjct  278   TTYENFRYRYDRKTNPHNRGLVQNFIEILCSRIPSSRNNFRAKVKEDSATFPSSLGMGRA  337

Query  958   VSPNMGKAVEDIEMGRK  1008
             +SP   K   D+EMG K
Sbjct  338   LSPP--KMSVDLEMGMK  352



>ref|XP_002987463.1| hypothetical protein SELMODRAFT_235280 [Selaginella moellendorffii]
 gb|EFJ11550.1| hypothetical protein SELMODRAFT_235280 [Selaginella moellendorffii]
Length=431

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 246/355 (69%), Gaps = 22/355 (6%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +LVLLLLTSGRDPGI+PRNAHPPEP++     +    TP+ R  R K+V VNG+ VK+KY
Sbjct  75    ILVLLLLTSGRDPGIIPRNAHPPEPEE-----DAEDWTPR-RPARTKDVIVNGVAVKIKY  128

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV S TL+C+YVF 
Sbjct  129   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFFMFVSSATLMCVYVFA  188

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
              C + I+ +MD  +++ WKAM K+PAS+ L+AYTF++VWFVGGLT FHLYLI TNQTTYE
Sbjct  189   MCALEIKFVMDDHQSSAWKAMRKSPASIALMAYTFVAVWFVGGLTLFHLYLIGTNQTTYE  248

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA----LAARHTAGGFV  960
             NFRYRYD + NPYN GVV+NF EIF + I PSKN FR KV  + +     A +  A    
Sbjct  249   NFRYRYDNKVNPYNLGVVDNFREIFFSKIAPSKNHFRGKVTTESSGQGQGARQQMAVTPT  308

Query  961   SPNMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGL------GEMSPE  1113
             + ++  A  D+E G K  W +   +   +  G++S +D   +  GG +      G  S  
Sbjct  309   ATSLKSAGSDLEGGVKPAWPERVALPTSNSGGEVSSDDPGRVSNGGDIGLDIKNGTFSRA  368

Query  1114  IRTTVDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVG---EGNRMGGSSS  1269
                       ++  HPRRSSWGRKSGSWE++P+++ALA+ VG   E  R  G++S
Sbjct  369   PPAPAPAVAGSSALHPRRSSWGRKSGSWEITPDIMALAAGVGGRDEEGRANGAAS  423



>ref|NP_001062374.1| Os08g0539100 [Oryza sativa Japonica Group]
 dbj|BAD33142.1| putative DHHC-type zinc finger domain-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF24288.1| Os08g0539100 [Oryza sativa Japonica Group]
 dbj|BAG93575.1| unnamed protein product [Oryza sativa Japonica Group]
Length=424

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 201/257 (78%), Gaps = 7/257 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             ++VLLLLTSGRDPGI+PRNAHPPEP+D     N+    GGQ     LP  K+V VNG+ V
Sbjct  98    IIVLLLLTSGRDPGIIPRNAHPPEPEDVGESSNLSEWPGGQHGSTGLPLTKDVLVNGVLV  157

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STTLLC+
Sbjct  158   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTLLCV  217

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +R IMD     + +A++K+P S +LI YTFI+VWFVGGLT+FHLYLISTNQ
Sbjct  218   YVFAFCWVDLRIIMDTHRCKLGRAIMKSPVSGILILYTFIAVWFVGGLTSFHLYLISTNQ  277

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDR+ NP+N+G+V+NF+EI C+ IP S+N+FRAKV  D A   +    G  
Sbjct  278   TTYENFRYRYDRKTNPHNRGLVQNFIEILCSRIPSSRNNFRAKVKEDSATFPSSLGMGRA  337

Query  958   VSPNMGKAVEDIEMGRK  1008
             +SP   K   D+EMG K
Sbjct  338   LSPP--KMSVDLEMGMK  352



>ref|XP_002980068.1| hypothetical protein SELMODRAFT_153626 [Selaginella moellendorffii]
 gb|EFJ18938.1| hypothetical protein SELMODRAFT_153626 [Selaginella moellendorffii]
Length=431

 Score =   357 bits (917),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 246/355 (69%), Gaps = 22/355 (6%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVKY  432
             +LVLLLLTSGRDPGI+PRNAHPPEP++     +    TP+ R  R K+V VNG+ VK+KY
Sbjct  75    ILVLLLLTSGRDPGIIPRNAHPPEPEE-----DAEDWTPR-RPARTKDVIVNGVAVKIKY  128

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV S TL+C+YVF 
Sbjct  129   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFFMFVSSATLMCVYVFA  188

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
              C + I+ +MD  +++ WKAM K+PAS+ L+AYTF+++WFVGGLT FHLYLI TNQTTYE
Sbjct  189   MCALEIKFVMDDHQSSAWKAMRKSPASIALMAYTFVALWFVGGLTLFHLYLIGTNQTTYE  248

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAA----RHTAGGFV  960
             NFRYRYD + NPYN GVV+NF EIF + I PSKN FR KV ++ +       +  A    
Sbjct  249   NFRYRYDNKVNPYNLGVVDNFREIFFSKIAPSKNHFRGKVTKESSGQGQGVRQQMAVTPT  308

Query  961   SPNMGKAVEDIEMGRKAVWGD---VGAEHQEGQLSDNDGVNMKEGGGL------GEMSPE  1113
             + ++  A  D+E G K  W +   +   +  G++S +D   +  GG +      G  S  
Sbjct  309   ATSLKSAGSDLEGGVKPAWPERVALPTSNSGGEVSSDDPGRVSNGGDIGLDIKNGTFSRA  368

Query  1114  IRTTVDEGDRAAMHHPrrsswgrksgswEMSPEVLALASRVG---EGNRMGGSSS  1269
                       ++  HPRRSSWGRKSGSWE++P+++ALA+ VG   E  R  G++S
Sbjct  369   PPAPAPAVAGSSALHPRRSSWGRKSGSWEITPDIMALAAGVGGRDEEGRANGAAS  423



>ref|XP_010665161.1| PREDICTED: protein S-acyltransferase 8-like [Vitis vinifera]
 emb|CBI18231.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   357 bits (915),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 195/348 (56%), Positives = 241/348 (69%), Gaps = 24/348 (7%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIEGGGQ-TPQLRLPRIKEVEVNGITVKV  426
             VL+LL LTS RDPGI+PRN+HPPE +  +D ++E GG+ TP L+ PR KEV VNGI VKV
Sbjct  76    VLLLLFLTSARDPGIIPRNSHPPEGEIRYDSSVEAGGRHTPSLQFPRTKEVMVNGIAVKV  135

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYC+TCM+YRPPRCSHCSICNNCVERFDHHCPWVGQC+GLRNYRFFFMFV S+TLLCIYV
Sbjct  136   KYCETCMIYRPPRCSHCSICNNCVERFDHHCPWVGQCVGLRNYRFFFMFVSSSTLLCIYV  195

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F     YI+ +MD +  T+WKAM ++PAS++L+ Y FIS+WFVGGLT FHLYLISTNQTT
Sbjct  196   FAMSAFYIKVLMDNQNDTVWKAMKESPASVILMVYCFISLWFVGGLTGFHLYLISTNQTT  255

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRD---PALAARHTAGGF  957
             YENFRYR D R N Y++G V NF+E+FC+ I PSKN FRA V  +   P LA+ H A   
Sbjct  256   YENFRYRADNRINVYDRGCVNNFLEVFCSKIKPSKNKFRAYVEEEVQRPPLASTHQAAAA  315

Query  958   ------VSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGG-GLGEMSPEI  1116
                   ++ +  + VED ++G   +  D+    Q   + + DG     G  G    S E+
Sbjct  316   AAEEEDLNADTREKVED-DLG---IGEDLLKISQRRNIEEIDGELCDRGSNGPHHNSSEV  371

Query  1117  RTTVDEGDR-----AAMHHPrrsswgrksgswEMSPEVLALASRVGEG  1245
              + +D   R     A   HP   SWGR+S SWE++PEV A  SRV E 
Sbjct  372   DSVLDSDFRSLTIQAETRHP---SWGRRSSSWEIAPEVPATNSRVTES  416



>gb|EAZ43494.1| hypothetical protein OsJ_28110 [Oryza sativa Japonica Group]
Length=469

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 201/257 (78%), Gaps = 7/257 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             ++VLLLLTSGRDPGI+PRNAHPPEP+D     N+    GGQ     LP  K+V VNG+ V
Sbjct  98    IIVLLLLTSGRDPGIIPRNAHPPEPEDVGESSNLSEWPGGQHGSTGLPLTKDVLVNGVLV  157

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STTLLC+
Sbjct  158   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTLLCV  217

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +R IMD     + +A++K+P S +LI YTFI+VWFVGGLT+FHLYLISTNQ
Sbjct  218   YVFAFCWVDLRIIMDTHRCKLGRAIMKSPVSGILILYTFIAVWFVGGLTSFHLYLISTNQ  277

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDR+ NP+N+G+V+NF+EI C+ IP S+N+FRAKV  D A   +    G  
Sbjct  278   TTYENFRYRYDRKTNPHNRGLVQNFIEILCSRIPSSRNNFRAKVKEDSATFPSSLGMGRA  337

Query  958   VSPNMGKAVEDIEMGRK  1008
             +SP   K   D+EMG K
Sbjct  338   LSPP--KMSVDLEMGMK  352



>ref|XP_001776677.1| predicted protein [Physcomitrella patens]
 gb|EDQ58513.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 206/350 (59%), Positives = 246/350 (70%), Gaps = 21/350 (6%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNI----EGGGQTPQLRLPRIKEVEVNGITV  420
             VLVLLLLTSGRDPGI+PRN HPPEP++         E GGQTP+LRLPR K+V VNG+ V
Sbjct  75    VLVLLLLTSGRDPGIIPRNTHPPEPEEEFEPNTSPGEWGGQTPRLRLPRTKDVMVNGVVV  134

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             K KYCDTCMLYRPPRCSHCSICNNCV RFDHHCPWVGQCIG RNYRFFFMFV ST+LLC+
Sbjct  135   KTKYCDTCMLYRPPRCSHCSICNNCVLRFDHHCPWVGQCIGQRNYRFFFMFVSSTSLLCV  194

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF  C +YI+ +MD  + T+WKA+ K+PAS+VL+AYTFI VWFVGGLT FHLYLI TNQ
Sbjct  195   YVFAMCALYIKILMDEGDRTVWKALSKSPASIVLMAYTFICVWFVGGLTVFHLYLIGTNQ  254

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPR---DPALAARHTAG  951
             TTYENFRYRYD + NPYN+G   NF EIFC+ IP SKN FR++VP        A +HT  
Sbjct  255   TTYENFRYRYDNKVNPYNQGCPLNFNEIFCSKIPASKNQFRSRVPEAVPGQMGAVQHTR-  313

Query  952   GFVSPNMGKAV-----EDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLG-EMSPE  1113
                  +MG+A       D+E G KA W +      EG   +  G  +  G  LG EM   
Sbjct  314   -----DMGEAHGAPKGPDLEQGYKATWPNAEDMVGEGGELEMAGGRVSTGSELGLEMKDS  368

Query  1114  IRTTVDEGDRAAMHHPrrsswgrksgswEMSPEVLALAS-RVGEGNRMGG  1260
                   E  R A+ + RR+S GR+SGSWE++ ++LAL+S   GEG+ + G
Sbjct  369   FDPRPLEQGRPAVSN-RRTSRGRQSGSWEITSDILALSSGEGGEGHNIPG  417



>ref|XP_010037361.1| PREDICTED: probable protein S-acyltransferase 7 [Eucalyptus grandis]
 gb|KCW49069.1| hypothetical protein EUGRSUZ_K02669 [Eucalyptus grandis]
Length=435

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 206/275 (75%), Gaps = 12/275 (4%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVK  429
              VL+ LLL S RDPGIVPR+ HPP+    +   EG          RIKEV +NGI VKVK
Sbjct  96    SVLIFLLLVSARDPGIVPRSTHPPDEISQN---EGHDS-------RIKEVMINGIPVKVK  145

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YC TCML+RPPR SHCS CNNCVERFDHHCPWVGQCIGLRNYRFF MFVFS TLLC+Y+F
Sbjct  146   YCGTCMLFRPPRSSHCSTCNNCVERFDHHCPWVGQCIGLRNYRFFLMFVFSATLLCLYIF  205

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
              FCWVYI RIMD +  ++W+A+IK+PAS+VLI Y F+SVWFVGGLT FHLYLISTNQTTY
Sbjct  206   SFCWVYIARIMDDKHVSVWRALIKSPASIVLIIYCFLSVWFVGGLTVFHLYLISTNQTTY  265

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPN  969
             ENFRYRYD + NP+NKGV+ NF E+  + IPPS+N+FRAK+P++P   +R   GGF   N
Sbjct  266   ENFRYRYDGQDNPFNKGVLGNFKEVLFSPIPPSRNNFRAKIPKEPQFPSRRMNGGFAGQN  325

Query  970   MGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVN  1074
              G   E + + R+ ++ +   EH  G +S+++ V+
Sbjct  326   -GSLKEFVNVDRE-IYINYRTEHGGGSISESERVS  358



>ref|XP_002444667.1| hypothetical protein SORBIDRAFT_07g025730 [Sorghum bicolor]
 gb|EES14162.1| hypothetical protein SORBIDRAFT_07g025730 [Sorghum bicolor]
Length=420

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 217/307 (71%), Gaps = 14/307 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFD--GNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             +LV+LLLTSGRDPGIVPRN HPPEP+D D   N+    GGQ     LP  ++V VNG++V
Sbjct  94    ILVVLLLTSGRDPGIVPRNTHPPEPEDIDESSNLPDWPGGQQGLTGLPLTRDVLVNGVSV  153

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STTLLCI
Sbjct  154   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTLLCI  213

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +RRIMD+ +  I +A++K+P S +LI YTFI+VWFVGGLT+FHLYLISTNQ
Sbjct  214   YVFAFCWVNLRRIMDSHQCKIGRALLKSPISGLLILYTFIAVWFVGGLTSFHLYLISTNQ  273

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDRR NPYN GV +NF+++  + +P SK++FRAKV  D +   +  + G  
Sbjct  274   TTYENFRYRYDRRTNPYNLGVGQNFIDVLFSRVPSSKHNFRAKVKDDSSTFTSSLSMGRV  333

Query  958   VSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGV--------NMKEGGGLGEMSPE  1113
             +SP       +  M R+AV  +   E    Q+    G+        +     G  EMS +
Sbjct  334   LSPPKMSVDLEKGMKRQAVAAE-DLEDLHSQIGSAMGLERCGTEPPHFVGRKGCSEMSSD  392

Query  1114  IRTTVDE  1134
             I    +E
Sbjct  393   IEAFAEE  399



>ref|XP_010250452.1| PREDICTED: probable protein S-acyltransferase 7 [Nelumbo nucifera]
Length=431

 Score =   355 bits (912),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 218/329 (66%), Gaps = 31/329 (9%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDFD------GNIEGGGQTPQLRLPRIKEVEVNGI  414
             +++LL LTSGRDPGI+PRN HPPEP D         +   G Q     LP +K+V VNG+
Sbjct  101   IIILLFLTSGRDPGIIPRNPHPPEPDDESEVASTVSSSWTGSQGGVPSLPPVKDVIVNGM  160

Query  415   TVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLL  594
              VKVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+L
Sbjct  161   IVKVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTML  220

Query  595   CIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLIST  774
             C YVF FCWV I++IMDAE   +WKA++++P S +LI YTF++VWFVGGLTAFHLYLI T
Sbjct  221   CFYVFVFCWVNIKKIMDAEYCNVWKALLRSPLSGILILYTFLAVWFVGGLTAFHLYLICT  280

Query  775   NQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRD--PALAARHTA  948
             NQTTYENFRYRYDRR NPYN G   N  EI  + IP SKN+FRA++  D   A A   + 
Sbjct  281   NQTTYENFRYRYDRRTNPYNLGWARNIREILFSKIPSSKNNFRARIKEDSSSAFAPSLSL  340

Query  949   GGFVSPNMGKAVEDIEMG--RKAVWGDVGAEHQEGQLSDNDGVNMKEGG-----------  1089
             G  +SP M K   DIEMG  R+AV   V  E ++ Q       +++  G           
Sbjct  341   GHVMSPEMPKTSFDIEMGGKRQAV---VAEEFEDIQSQIGSVASLERCGTQPRHTNVGEK  397

Query  1090  GLGEMSPEIRTTVDE-------GDRAAMH  1155
             G  E++P+I     E        DR  +H
Sbjct  398   GNWEITPDINALAAEFGTQQGLSDREKIH  426



>ref|XP_010320113.1| PREDICTED: protein S-acyltransferase 8 [Solanum lycopersicum]
Length=422

 Score =   354 bits (909),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 211/307 (69%), Gaps = 13/307 (4%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIEGGGQTPQLRLPRIKEVEVNGITV  420
              VLVLLLLTS RDPGIVPRN+HPPE +   +   ++EGG QTP L+ PR KEV VNG+ V
Sbjct  75    HVLVLLLLTSARDPGIVPRNSHPPEEEFRHELSASVEGGRQTPSLQFPRTKEVIVNGMPV  134

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFF FV S  LLCI
Sbjct  135   RVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFCFVSSAMLLCI  194

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF  C +YI+ +MD  ++T+ KA+ ++PAS+VL+AY FIS+WFVGGLT FHLYLISTNQ
Sbjct  195   YVFAICALYIKVLMDNNQSTVLKALKESPASVVLMAYCFISLWFVGGLTGFHLYLISTNQ  254

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV----PRDPALAARHTA  948
             TTYENFRY+ + R N Y+ G V NFME+FCT + PS+N+FRA V    PR P    R   
Sbjct  255   TTYENFRYKAENRINVYDLGCVNNFMEVFCTKVKPSRNNFRANVQEEEPRPPLPTTREAE  314

Query  949   GGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDG-VNMKEGGGLGEMSPEIRTT  1125
                      K  +D+E G     GD+    Q   + D +  +  +E       S E  + 
Sbjct  315   VEMGEDQRVKVEDDLEFG-----GDLLKISQRHNIEDIEAEIRSRESDVHHHNSSEADSV  369

Query  1126  VDEGDRA  1146
             +    RA
Sbjct  370   LGSDRRA  376



>ref|XP_004974049.1| PREDICTED: probable S-acyltransferase At3g26935-like [Setaria 
italica]
Length=420

 Score =   354 bits (908),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 171/257 (67%), Positives = 200/257 (78%), Gaps = 7/257 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             +LV+L LTSGRDPGI+PRNAHPPEP+D     N+    GGQ     LP  ++V VNGI+V
Sbjct  94    ILVVLFLTSGRDPGIIPRNAHPPEPEDIGESSNLPDWPGGQHGSTGLPLTRDVLVNGISV  153

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+LC+
Sbjct  154   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTILCL  213

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF F WV +RRIMD  E  I +A++K+P S +LI YTFI+VWFVGGLT+FHLYLISTNQ
Sbjct  214   YVFAFSWVNLRRIMDMHECKIGRALLKSPISGLLILYTFIAVWFVGGLTSFHLYLISTNQ  273

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAGGF  957
             TTYENFRYRYDR+ NPYN GV +NF+++  + IP SKN+FRAKV  D A   +  + G  
Sbjct  274   TTYENFRYRYDRKTNPYNLGVGQNFIDVLFSRIPSSKNNFRAKVKEDSATFTSSLSMGRV  333

Query  958   VSPNMGKAVEDIEMGRK  1008
             +SP   K   D+EMG K
Sbjct  334   LSPP--KMSMDLEMGMK  348



>ref|XP_010912021.1| PREDICTED: protein S-acyltransferase 8-like [Elaeis guineensis]
Length=409

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/340 (53%), Positives = 227/340 (67%), Gaps = 14/340 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIEGGGQTPQLRLPRIKEVEVNGITVKVK  429
             VL+LLL+TS RDPGIVPR +HPPE +  +D +  GG  TP L+ PRIKEV V+GI VKVK
Sbjct  66    VLLLLLVTSARDPGIVPRASHPPEEEFSYDTSEIGGRHTPSLQFPRIKEVMVHGIPVKVK  125

Query  430   YCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVF  609
             YC+TCM+YRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYR+FF+FV S+TLLCIYVF
Sbjct  126   YCETCMVYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRYFFLFVSSSTLLCIYVF  185

Query  610   GFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTY  789
               C +YI+ +MD + TT+WKA+ K+PAS++L+ Y FIS+WFVGGLT FHLYLI TNQTTY
Sbjct  186   AMCALYIKFLMDEDHTTVWKAIKKSPASVILMIYCFISLWFVGGLTGFHLYLIGTNQTTY  245

Query  790   ENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALA-ARHTAGG  954
             ENFRYR D R+N YN+G + NF+E+FCT I PS+N FRA    +V R P ++ AR     
Sbjct  246   ENFRYRADSRSNVYNRGCLNNFLEVFCTKIKPSRNKFRAYVREEVARPPTISRAREVEDE  305

Query  955   FVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDND-GVNMKEGGGLGEMSPEIRTTVD  1131
                    K  +D+E+G     GD+    Q     + D  +  +   G+  +  E    +D
Sbjct  306   PAGGPRAKVEDDLELG-----GDLLKISQRRNYEEVDEEMGGRNSNGIHSVLSESELVID  360

Query  1132  EGDRAAMHHPrrsswgrksgsw--EMSPEVLALASRVGEG  1245
                +  +             S   ++ PEVLA +S   EG
Sbjct  361   PDTQVPVIRSEVRDSSLGRTSRNWDILPEVLATSSSATEG  400



>gb|KDO64488.1| hypothetical protein CISIN_1g013191mg [Citrus sinensis]
Length=292

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 217/283 (77%), Gaps = 9/283 (3%)
 Frame = +1

Query  445   MLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWV  624
             M YRPPRCSHCSICNNCV++FDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  FCW+
Sbjct  1     MHYRPPRCSHCSICNNCVQKFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVHAFCWI  60

Query  625   YIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRY  804
              IR+IM+ E  +IWKAM K+PAS+ LI YTFISVWFVGGLT FH YLIS NQ+TYENFR 
Sbjct  61    RIRKIMNGENVSIWKAMTKSPASIALIIYTFISVWFVGGLTVFHSYLISRNQSTYENFRN  120

Query  805   RYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNMGKAV  984
             RYD   NPYNKGV++NFME+FCTSIP SKN+FRAK+P++PA+ +R  +GGF SPN+ K V
Sbjct  121   RYDEHVNPYNKGVIKNFMEVFCTSIPTSKNNFRAKIPKEPAITSRRISGGFTSPNIRKPV  180

Query  985   EDIEMGRKAVWGDV--GAEHQEGQLSDNDGVNMKEGGGLGEMSPEI-RTTVDEG--DRAA  1149
              DIEMGRK  WG+    A+  EG+ +++D V+ K GG    ++ ++ R    EG   R+ 
Sbjct  181   SDIEMGRKLAWGEAVREADGSEGRTNNDDNVD-KLGGSADHVTADLSRILPPEGMEGRSI  239

Query  1150  MHHPrrsswgrksgswEMSPEVLALASRVGEGNRMGGSSSGGL  1278
              HH RRSSWG KSGSW++S E  A A  V    ++ GSS+G L
Sbjct  240   SHH-RRSSWGIKSGSWDISSETFASA--VEASKQVPGSSNGNL  279



>ref|XP_002524314.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38054.1| zinc finger protein, putative [Ricinus communis]
Length=414

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 230/335 (69%), Gaps = 17/335 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIE-GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPGI+PRN+HPPE +   D   ++E GG QTP L+ PR KE+ VNGI V
Sbjct  67    VLVLLFLTSARDPGIIPRNSHPPEEEFRYDSSMSVEVGGRQTPSLQFPRTKEIMVNGIPV  126

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYR+FFMFV S+TLLCI
Sbjct  127   RVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCI  186

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    VYI+ +MD  ++T+WKAM ++PAS++L+AY FIS+WFVGGLT FHLYLI TNQ
Sbjct  187   YVFSMSAVYIKVLMDDYQSTVWKAMKESPASVILMAYCFISLWFVGGLTGFHLYLIGTNQ  246

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAARHTA  948
             TTYENFRYR D R N YN G + NF+E+F T + PSKN+FRA    +VPR P  + R   
Sbjct  247   TTYENFRYRADNRINVYNLGCIHNFLEVFFTKVKPSKNNFRAFVQEEVPRPPLPSTREVE  306

Query  949   GGFVSPNMGKAVE-DIEMGRKAVWGDVGAEHQEGQLSDND-GVNMKEGGGLGEMSPEIRT  1122
                +  +    VE D+E+G      D+    Q   + + D  +  +   G    + E+ +
Sbjct  307   AEDLGGDPRSKVEDDLEIGE-----DLLKISQRRNIEEIDEDIRSRGSNGPPHNTSEVDS  361

Query  1123  TVDEGDRAAMHHPrrsswg--rksgswEMSPEVLA  1221
              +    RA             R+SGSWE++PEVLA
Sbjct  362   VLSSDHRAPTIRSDTRHSSWGRRSGSWEIAPEVLA  396



>ref|XP_009803969.1| PREDICTED: protein S-acyltransferase 8 [Nicotiana sylvestris]
Length=423

 Score =   350 bits (897),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 212/308 (69%), Gaps = 13/308 (4%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIE-GGGQTPQLRLPRIKEVEVNGIT  417
              VLVLLLLTS RDPGIVPRN+HPPE +   D   ++E  G QTP L+ PR KEV VNG+ 
Sbjct  75    HVLVLLLLTSARDPGIVPRNSHPPEEEFRYDTSASVEIVGRQTPSLQFPRTKEVTVNGMP  134

Query  418   VKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  597
             V+VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFF FV S  LLC
Sbjct  135   VRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFCFVSSAMLLC  194

Query  598   IYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN  777
             IYVF  C +YI+ +M+ ++ T+WKAM ++PAS++L+AY FIS+WFVGGLT FHLYLISTN
Sbjct  195   IYVFAICALYIKVLMNNDQGTVWKAMKESPASVILMAYCFISLWFVGGLTGFHLYLISTN  254

Query  778   QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKV----PRDPALAARHT  945
             QTTYENFRYR + R N Y+ G + NFME+FCT + PS+N+FRA V    PR P    R  
Sbjct  255   QTTYENFRYRAENRINVYDLGCLNNFMEVFCTKVKPSRNNFRAYVQEEEPRPPLPTTREA  314

Query  946   AGGFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTT  1125
                    +  K  +D+++G     GD+    Q   + D +      G  +   +     +
Sbjct  315   EVEMGEDHRVKVEDDLDIG-----GDLLKISQRHNIEDIEADIRSRGSDVPYHNSSEADS  369

Query  1126  VDEGDRAA  1149
             V   DR A
Sbjct  370   VHGSDRRA  377



>ref|XP_008463061.1| PREDICTED: protein S-acyltransferase 8-like [Cucumis melo]
Length=424

 Score =   349 bits (895),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 200/260 (77%), Gaps = 10/260 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE---GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPGI+PRN+HPPE +  FD ++    GG QTP L+ PR KEV VNG+ V
Sbjct  76    VLVLLFLTSARDPGIIPRNSHPPEDEIRFDTSVSVDVGGRQTPSLQFPRTKEVIVNGLPV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVE FDHHCPWVGQCIGLRNYR+FFMFV S+TLLC+
Sbjct  136   RVKYCDTCMLYRPPRCSHCSICNNCVEHFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCM  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +MD  E+T+WKAM ++PAS++L+AY F+S+WFVGGLT FHLYLI TNQ
Sbjct  196   YVFAMSALYIKVLMDQYESTVWKAMKESPASVILMAYCFVSLWFVGGLTGFHLYLIGTNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAA--RH  942
             TTYENFRYR D R N +N+G V NF+E+FC+ + PS+N+FRA    +VPR   L    R 
Sbjct  256   TTYENFRYRADNRINVFNRGCVNNFLEVFCSKVEPSRNNFRAFIQEEVPRPQVLPELPRA  315

Query  943   TAGGFVSPNMGKAVEDIEMG  1002
              A    S    K  +D+++G
Sbjct  316   AADDLASHPRSKVEDDLDIG  335



>ref|XP_004162173.1| PREDICTED: probable S-acyltransferase At4g24630-like, partial 
[Cucumis sativus]
Length=417

 Score =   348 bits (894),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE---GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPGI+PRN+HPPE +  FD ++    GG QTP L+ PR KEV VNG+ V
Sbjct  69    VLVLLFLTSARDPGIIPRNSHPPEDEIRFDSSVSVDVGGRQTPSLQFPRTKEVIVNGLPV  128

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVE FDHHCPWVGQCIGLRNYR+FFMFV S+TLLC+
Sbjct  129   RVKYCDTCMLYRPPRCSHCSICNNCVEHFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCM  188

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +MD  E+T+WKAM ++PAS++L+AY F+S+WFVGGLT FHLYLI TNQ
Sbjct  189   YVFAMSALYIKVLMDQYESTVWKAMKESPASVILMAYCFVSLWFVGGLTGFHLYLIGTNQ  248

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAA--RH  942
             TTYENFRYR D R N +N+G   NF+E+FC+ + PS+N+FRA    +VPR   L    R 
Sbjct  249   TTYENFRYRADNRINVFNRGCANNFLEVFCSKVKPSRNNFRAFIQEEVPRPQVLPQLPRA  308

Query  943   TAGGFVSPNMGKAVEDIEMG  1002
              A    S    K  +D+++G
Sbjct  309   AADDLASHPRSKVEDDLDIG  328



>ref|XP_009404189.1| PREDICTED: probable protein S-acyltransferase 7 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404190.1| PREDICTED: probable protein S-acyltransferase 7 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 193/259 (75%), Gaps = 9/259 (3%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-------GGGQTPQLRLPRIKEVEVNGI  414
             ++LL LTS RDPGIVPRNAHPPEP D +GNI         G       LP  K+V VNGI
Sbjct  97    IILLFLTSSRDPGIVPRNAHPPEPTD-NGNISPSLCADWQGSHGGSSSLPPTKDVFVNGI  155

Query  415   TVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLL  594
              +KVKYC+TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNY  FFMFVFSTT+L
Sbjct  156   IIKVKYCNTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGRRNYHLFFMFVFSTTIL  215

Query  595   CIYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLIST  774
             C+YVF FCWV +++IM+A E  +W A++K+P S +L+ YTFI+ WFVGGLTAFHLYLI T
Sbjct  216   CLYVFAFCWVNLKKIMEAYECNLWAAVLKSPVSGILVIYTFIATWFVGGLTAFHLYLICT  275

Query  775   NQTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA-LAARHTAG  951
             NQTTYENFRYRYD + NPYN G + N  E+  +S+P S N+FRAKV  D A   +  + G
Sbjct  276   NQTTYENFRYRYDGKMNPYNHGCIHNVKEVLFSSVPKSMNNFRAKVKEDSAGFTSSRSLG  335

Query  952   GFVSPNMGKAVEDIEMGRK  1008
               VSP+M K   D+E G K
Sbjct  336   RVVSPDMPKTSFDLESGGK  354



>ref|XP_004138367.1| PREDICTED: probable S-acyltransferase At4g24630-like [Cucumis 
sativus]
 gb|KGN45888.1| hypothetical protein Csa_6G017040 [Cucumis sativus]
Length=424

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE---GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPGI+PRN+HPPE +  FD ++    GG QTP L+ PR KEV VNG+ V
Sbjct  76    VLVLLFLTSARDPGIIPRNSHPPEDEIRFDSSVSVDVGGRQTPSLQFPRTKEVIVNGLPV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVE FDHHCPWVGQCIGLRNYR+FFMFV S+TLLC+
Sbjct  136   RVKYCDTCMLYRPPRCSHCSICNNCVEHFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCM  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +MD  E+T+WKAM ++PAS++L+AY F+S+WFVGGLT FHLYLI TNQ
Sbjct  196   YVFAMSALYIKVLMDQYESTVWKAMKESPASVILMAYCFVSLWFVGGLTGFHLYLIGTNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAA--RH  942
             TTYENFRYR D R N +N+G   NF+E+FC+ + PS+N+FRA    +VPR   L    R 
Sbjct  256   TTYENFRYRADNRINVFNRGCANNFLEVFCSKVKPSRNNFRAFIQEEVPRPQVLPQLPRA  315

Query  943   TAGGFVSPNMGKAVEDIEMG  1002
              A    S    K  +D+++G
Sbjct  316   AADDLASHPRSKVEDDLDIG  335



>ref|XP_002459011.1| hypothetical protein SORBIDRAFT_03g044420 [Sorghum bicolor]
 gb|EES04131.1| hypothetical protein SORBIDRAFT_03g044420 [Sorghum bicolor]
Length=391

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 209/311 (67%), Gaps = 36/311 (12%)
 Frame = +1

Query  256   LVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKVKY  432
             L LLLLTSGRDPGI+PRNAHPPEP+ FDGN E G  QTP +RLPR+K+V VNGITVK KY
Sbjct  94    LSLLLLTSGRDPGIIPRNAHPPEPEGFDGNAEVGANQTPPVRLPRVKDVVVNGITVKTKY  153

Query  433   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFG  612
             CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFF+MFVFSTTLLC+YVFG
Sbjct  154   CDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFYMFVFSTTLLCLYVFG  213

Query  613   FCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYE  792
             FCWV I +I +AE+ TIWKAM KTPAS+ L+ YTFI+VWFVGGL+ FHLYL+STNQ T +
Sbjct  214   FCWVLIVKIRNAEQITIWKAMAKTPASIALVIYTFIAVWFVGGLSVFHLYLMSTNQKTSK  273

Query  793   NFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGFVSPNM  972
               R    +   P    VV +                        A +   +  GF+SPNM
Sbjct  274   --RSSLQQSLLPRTTSVVGS----------------------TGAWSEASSTNGFMSPNM  309

Query  973   GKAVEDIEMGRKAV-W---------GDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRT  1122
             G+AV DIEMGRK V W         GD+GA      L D DG        L   +  +  
Sbjct  310   GRAVGDIEMGRKPVAWDEPRMAAEIGDLGAGLSN-LLEDKDGRFRSASPDLSRDALAVGG  368

Query  1123  TVDEGDRAAMH  1155
              ++E   +AM+
Sbjct  369   GLEEQGSSAMN  379



>ref|XP_006659644.1| PREDICTED: probable protein S-acyltransferase 7-like [Oryza brachyantha]
Length=422

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 199/257 (77%), Gaps = 7/257 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPKDF--DGNIEG--GGQTPQLRLPRIKEVEVNGITV  420
             ++VLLL+TSGRDPGIVPRNAHPPEP+D     N+    GGQ     LP  K+V VNG+ V
Sbjct  98    IVVLLLVTSGRDPGIVPRNAHPPEPEDVGESSNLSEWPGGQHGSAGLPLTKDVLVNGVLV  157

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYC TCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+LCI
Sbjct  158   KVKYCHTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTVLCI  217

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF FCWV +R+IMD       +A++++P + +L+ YTFI++WFVGGLT+FHLYLI TNQ
Sbjct  218   YVFAFCWVDLRKIMDTHGCKFGRAIMRSPIAGILVLYTFIAMWFVGGLTSFHLYLICTNQ  277

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRD-PALAARHTAGGF  957
             TTYENFRYRYDR+ NP+N+G+++NF+EI C+ IP SKN+FRAK   D  A  +    G  
Sbjct  278   TTYENFRYRYDRKTNPHNRGLLQNFIEILCSRIPRSKNNFRAKAKEDSAAFTSSLGMGRA  337

Query  958   VSPNMGKAVEDIEMGRK  1008
             +SP   K   D+EMG K
Sbjct  338   LSPP--KRSVDLEMGMK  352



>gb|ABK24698.1| unknown [Picea sitchensis]
Length=442

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 197/268 (74%), Gaps = 10/268 (4%)
 Frame = +1

Query  277   SGRDPGIVPRNAHPPEPKD-FDGNIE----GGGQTPQLRLPRIKEVEVNGITVKVKYCDT  441
             S RDPGIVPR  HPPEP+D FD         GGQTP++RLPR K+V VN +TVKVKYCDT
Sbjct  84    SARDPGIVPRAPHPPEPEDIFDSANSPAEWAGGQTPRIRLPRTKDVTVNDVTVKVKYCDT  143

Query  442   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCW  621
             CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV S TLLCIY+F    
Sbjct  144   CMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRFFFMFVSSCTLLCIYIFAMSA  203

Query  622   VYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFR  801
             +YI+ +MD ++ TIW+AM  TPAS+VL+ YTFI+VWFVGGLT FHLYLIS NQTTYENFR
Sbjct  204   LYIKFLMDDDKHTIWQAMRHTPASIVLMIYTFITVWFVGGLTLFHLYLISINQTTYENFR  263

Query  802   YRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAAR-----HTAGGFVSP  966
             YR D + NPYN+G++ NF  IFCT+I PS+N+FRAKV ++ ++  R           +  
Sbjct  264   YRCDNKVNPYNEGIITNFSAIFCTNIKPSQNNFRAKVQQEASVQTRVIPQSTDTRDVIGD  323

Query  967   NMGKAVEDIEMGRKAVWGDVGAEHQEGQ  1050
                K   D+E GRKA   D     +EG 
Sbjct  324   LAAKVSIDLEAGRKAAMRDEFDPEREGH  351



>ref|XP_011073108.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Sesamum 
indicum]
Length=314

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 184/220 (84%), Gaps = 3/220 (1%)
 Frame = +1

Query  274  TSGRDPGIVPRNAHPPEPKDFDGNIEGG-GQTPQLRLPRIKEVEVNGITVKVKYCDTCML  450
            TSGRDPGI+PRN  PP P++   N+E G GQT  L  PR K+V VNG+T+KVKYC+TCML
Sbjct  95   TSGRDPGIIPRNTRPPAPENLGANVEPGPGQTASL--PRTKDVVVNGVTMKVKYCETCML  152

Query  451  YRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYVFGFCWVYI  630
            YRPPR SHCSICNNCVERFDHHCPW+GQCIGLRNYRFFFMFVFS TLLC+Y  GFCWVYI
Sbjct  153  YRPPRSSHCSICNNCVERFDHHCPWLGQCIGLRNYRFFFMFVFSATLLCLYGHGFCWVYI  212

Query  631  RRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTTYENFRYRY  810
            R+IMD+E+T+IWKAM KTPAS+ LI Y+F+++WFVGGL+ FH YLI  NQ+TYE FRY Y
Sbjct  213  RKIMDSEKTSIWKAMRKTPASIALIVYSFLALWFVGGLSVFHPYLICVNQSTYEKFRYHY  272

Query  811  DRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPAL  930
             R  NP+NKG+V+NFME+FC+SIP SK +FRAK+ +   +
Sbjct  273  SRHTNPFNKGIVKNFMEVFCSSIPKSKINFRAKLQKKSVM  312



>gb|KDP36577.1| hypothetical protein JCGZ_08344 [Jatropha curcas]
Length=429

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 236/341 (69%), Gaps = 23/341 (7%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE---GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPG++PRN+HPPE +  +D ++    GG QTP L+ PR KEV VNGI V
Sbjct  76    VLVLLFLTSARDPGVIPRNSHPPEEEFRYDTSMSAEIGGRQTPSLQFPRTKEVMVNGIPV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYR+FFMFV S+TLLCI
Sbjct  136   RVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCI  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +MD  ++T+W+AM ++PAS++L+AY FIS+WFVGGLT FHLYLI +NQ
Sbjct  196   YVFAMSALYIKILMDDYQSTVWRAMKESPASVILMAYCFISLWFVGGLTGFHLYLIGSNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRD--PALAARH  942
             TTYENFRYR D R N YN G V+NF+E+FCT + PSKN+FRA    +VPR   P+     
Sbjct  256   TTYENFRYRADNRINVYNLGCVDNFLEVFCTKVKPSKNNFRAFVQEEVPRPILPSTREAE  315

Query  943   TAGGFVSPNMG-----KAVEDIEMGRKAVWGDVGAEHQEGQLSDND-GVNMKEGGGLGEM  1104
                G  + ++G     K  +D+E+G      D+    Q   + + D  +  +   G    
Sbjct  316   AEAGAGAEDLGGDPRTKVEDDLEIGE-----DLLKISQRRNIEEIDEDIRSRGSNGPPHN  370

Query  1105  SPEIRTTVDEGDRAAMHHPrrsswg--rksgswEMSPEVLA  1221
             + E+ + ++   RA    P        R+SGSWE++PEVLA
Sbjct  371   TSEMDSVLNSDHRAPTIRPDTRHSSWGRRSGSWEIAPEVLA  411



>ref|XP_011044264.1| PREDICTED: protein S-acyltransferase 8-like [Populus euphratica]
Length=424

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE---GGGQTPQLRLPRIKEVEVNGITV  420
             VLVLL LTS RDPGI+PRN HPPE +  +D ++    GG QTP L+ PR KEV VNGI V
Sbjct  76    VLVLLFLTSARDPGIIPRNLHPPEEEFRYDSSVSVEVGGRQTPSLQFPRTKEVMVNGIPV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYR+FFMFV S+TLLCI
Sbjct  136   RVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCI  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +MD   +T+WKAM ++PAS++L+AY+FIS+WFVGGLT FHLYLI TNQ
Sbjct  196   YVFSISALYIKVLMDDYHSTVWKAMKESPASVILMAYSFISLWFVGGLTGFHLYLIGTNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAARHTA  948
             TTYENFRYR D R N YN+G  +NF+E+FCT + PS+N+FRA    +V + P L +    
Sbjct  256   TTYENFRYRADSRINVYNRGCFDNFLEVFCTKVKPSRNNFRAFVEEEVQQRPTLPSTQET  315

Query  949   G--GFVSPNMGKAVEDIEMG  1002
                  V     K  +D+++G
Sbjct  316   DVEDSVGDPRSKVEDDLDIG  335



>ref|XP_002307509.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE94505.1| zinc finger family protein [Populus trichocarpa]
Length=422

 Score =   346 bits (888),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/258 (63%), Positives = 199/258 (77%), Gaps = 8/258 (3%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIE-GGGQTPQLRLPRIKEVEVNGITVKV  426
             VLVLL LTS RDPGI+PRN+HPPE +  +D ++   G QTP L+ PR KEV VNGI V+V
Sbjct  76    VLVLLFLTSARDPGIIPRNSHPPEEEFRYDSSVSVEGRQTPSLQFPRTKEVMVNGIPVRV  135

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYR+FFMFV S+TLLCIYV
Sbjct  136   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCIYV  195

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F    +YI+ +MD   +T+WKAM ++PAS++L+AY+FIS+WFVGGLT FHLYLI TNQTT
Sbjct  196   FSISALYIKVLMDDYHSTVWKAMKESPASVILMAYSFISLWFVGGLTGFHLYLIGTNQTT  255

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAARHTAG-  951
             YENFRYR D R N YN+G  +NF+E+FCT + PS+N+FRA    +V + P L +      
Sbjct  256   YENFRYRADSRINVYNRGCFDNFLEVFCTKVKPSRNNFRAFVEEEVQQRPTLPSTQETDV  315

Query  952   -GFVSPNMGKAVEDIEMG  1002
                V     K  +D+++G
Sbjct  316   EDSVGDPRSKVEDDLDIG  333



>ref|XP_010063838.1| PREDICTED: protein S-acyltransferase 8 [Eucalyptus grandis]
 gb|KCW71103.1| hypothetical protein EUGRSUZ_F04202 [Eucalyptus grandis]
Length=423

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 208/305 (68%), Gaps = 7/305 (2%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIE-GGGQTPQLRLPRIKEVEVNGITV  420
             VL+LL LTS RDPGIVPRNAHPPE     D   +++ GG QTP L+ PR K+VEVNG++V
Sbjct  76    VLLLLFLTSARDPGIVPRNAHPPEEVFHFDHSASVQIGGRQTPSLQFPRTKDVEVNGVSV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             +VKYCDTCMLYRP RCSHCSIC+NCVERFDHHCPWVGQCIGLRNYRFFFMFV S TLLCI
Sbjct  136   RVKYCDTCMLYRPTRCSHCSICDNCVERFDHHCPWVGQCIGLRNYRFFFMFVSSATLLCI  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF     YI+ +MD    T+WKAM ++PAS++L+AY FIS+WFVGGLT FHLYLI TNQ
Sbjct  196   YVFAMSAFYIKVLMDKHHGTVWKAMKESPASVILMAYCFISLWFVGGLTGFHLYLIGTNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRD---PALAARHTAG  951
             TTYENFRYR + R N Y++G V NF+E+FCT + PS+N+FRA V  +   P L +   A 
Sbjct  256   TTYENFRYRSENRLNAYDRGCVSNFLEVFCTEVKPSRNNFRAFVQEEVHRPVLPSERGAE  315

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTTVD  1131
               +          +E     +  D+    Q   +  +  V  +   G  E S  + + + 
Sbjct  316   SEMEDLGANPRPKVEDDDLDIGEDLLKISQRRNIELDQDVQSRGSNGTPENSMMVDSPMA  375

Query  1132  EGDRA  1146
              G RA
Sbjct  376   SGHRA  380



>ref|XP_011004340.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Populus 
euphratica]
Length=380

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 195/280 (70%), Gaps = 7/280 (3%)
 Frame = +1

Query  247   TQVLVLLLLTSGRDPGIVPRNAHPPEPKDFDGNIEG---GGQTPQLRLPRIKEVEVNGIT  417
               V++LL LTS RDPGI+PRN HPPE  D   +I     G Q     LP  K+V VNG+ 
Sbjct  56    NNVIILLFLTSARDPGIIPRNLHPPE--DEGSSISADWPGSQVSGPSLPPTKDVTVNGMV  113

Query  418   VKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  597
             VKVKYC TCMLYR PRCSHCSICNNCVERFDHHCPWVGQCIG RNYRFFFMFV STT+LC
Sbjct  114   VKVKYCQTCMLYRSPRCSHCSICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTILC  173

Query  598   IYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN  777
             +YV  FCWV IR+IMD +   IW+A +K+P S +L+ YTFI  WFVGGLTAFHLYLI TN
Sbjct  174   LYVLAFCWVNIRKIMDTDHCDIWRAFLKSPVSGILVLYTFICAWFVGGLTAFHLYLICTN  233

Query  778   QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPA--LAARHTAG  951
             QTTYENFRYRYD + NPYN G V N +E+F T IP SKN FRAKV  D +   AA     
Sbjct  234   QTTYENFRYRYDGKMNPYNLGCVRNVLEVFFTKIPKSKNKFRAKVLVDSSSGYAASMPLS  293

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDNDGV  1071
               +SP + K   DIE+G++    D   E  + Q+    G+
Sbjct  294   HVLSPEVPKRSFDIEVGKRQAVADEDFEDLQSQIDSIGGL  333



>gb|EYU17491.1| hypothetical protein MIMGU_mgv1a007166mg [Erythranthe guttata]
Length=416

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 202/280 (72%), Gaps = 15/280 (5%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIE-GGGQTPQLRLPRIKEVEVNGIT  417
              VLVLLL TS RDPGIVPRN HPPE +   D   ++E GG QTP L+ PR KEV VNG+ 
Sbjct  75    HVLVLLLFTSARDPGIVPRNLHPPEEEFRYDTSASVEVGGRQTPSLQFPRTKEVMVNGLP  134

Query  418   VKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLC  597
             V+VKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYRFFF FV S TLLC
Sbjct  135   VRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFFFVSSATLLC  194

Query  598   IYVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTN  777
             IYVF  C +YI+ +MD    T+WKA+ ++PA++VL+ Y FIS+WFVGGLT FHLYLISTN
Sbjct  195   IYVFSICALYIKILMDDHHGTVWKALKESPAAVVLMVYCFISLWFVGGLTGFHLYLISTN  254

Query  778   QTTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRAKVPRDPALAARHTAGGF  957
             QTTYENFRYR D R N Y++G + NF E+FCT + PSKN+FRA V  +P      T    
Sbjct  255   QTTYENFRYRADNRINVYDRGCLNNFFEVFCTEVKPSKNNFRALVQDEPQRPPMPTTRDS  314

Query  958   VSPNMG------KAVEDIEMGRKAVWGDVGAEHQEGQLSD  1059
              + ++G      K  +D+++G     GD+    Q   + D
Sbjct  315   ETEDVGGDDRRMKVEDDLDIG-----GDLLKISQRHNIED  349



>ref|XP_008785854.1| PREDICTED: protein S-acyltransferase 8-like isoform X2 [Phoenix 
dactylifera]
Length=360

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/341 (51%), Positives = 224/341 (66%), Gaps = 14/341 (4%)
 Frame = +1

Query  250   QVLVLLLLTSGRDPGIVPRNAHPPEPK-DFDGNIEGGGQTPQLRLPRIKEVEVNGITVKV  426
              +L+LLL+TS RDPGIVPR +HPPE +  +D +  GG  TP L+ PRIKEV V+G  VKV
Sbjct  16    HILLLLLVTSARDPGIVPRASHPPEEEFSYDTSEVGGRHTPSLQFPRIKEVMVHGKAVKV  75

Query  427   KYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCIYV  606
             KYCDTCM+YRPPRCSHCSICNNCVERFDHHCPWVGQCIG RNYR+FF FV S+TLLCIYV
Sbjct  76    KYCDTCMVYRPPRCSHCSICNNCVERFDHHCPWVGQCIGQRNYRYFFFFVSSSTLLCIYV  135

Query  607   FGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQTT  786
             F    +YI+ +MD +  T+WKA+ K+PAS++L+ Y FIS+WFVGGLT FHLYLI TNQTT
Sbjct  136   FAMSALYIKFLMDNDYPTVWKAIKKSPASLILMIYCFISLWFVGGLTGFHLYLIGTNQTT  195

Query  787   YENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALA-ARHTAG  951
             YENFRYR D R+N YN G + NF+E+FCT I PS+N+FRA    +V R P ++ AR    
Sbjct  196   YENFRYRADNRSNVYNLGCLNNFLEVFCTKIKPSRNNFRAYVQEEVARPPTISRAREVED  255

Query  952   GFVSPNMGKAVEDIEMGRKAVWGDVGAEHQEGQLSDND-GVNMKEGGGLGEMSPEIRTTV  1128
                     K  +D+E+G     GD+    Q     + D  +  +   G+  +  E    +
Sbjct  256   EPAGGPRAKVEDDLELG-----GDLLKISQRRNYEEVDEEMGGRNSNGIHSVLSESELVI  310

Query  1129  DEGDRAAMHHPrrsswgrksgsw--EMSPEVLALASRVGEG  1245
             D   +A +             S   ++ P+V+A +S   EG
Sbjct  311   DPDTQAPVSRSEVRDSSLGRTSRNWDILPDVMATSSSATEG  351



>ref|XP_010277271.1| PREDICTED: protein S-acyltransferase 8-like [Nelumbo nucifera]
Length=421

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 231/346 (67%), Gaps = 17/346 (5%)
 Frame = +1

Query  253   VLVLLLLTSGRDPGIVPRNAHPPEPK---DFDGNIEGGG-QTPQLRLPRIKEVEVNGITV  420
             VL LL +TS RDPGI+PR +HPPE +   +   ++E GG QTP L+ PR KEV VNG+ V
Sbjct  76    VLGLLFITSARDPGIIPRASHPPEEEFCYESSASVEAGGRQTPSLQFPRTKEVMVNGMPV  135

Query  421   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFMFVFSTTLLCI  600
             KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIG+RNYR+FF+FV S+T+LCI
Sbjct  136   KVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRYFFLFVSSSTILCI  195

Query  601   YVFGFCWVYIRRIMDAEETTIWKAMIKTPASMVLIAYTFISVWFVGGLTAFHLYLISTNQ  780
             YVF    +YI+ +M     T+WKAM ++PAS+VL+AY FIS+WFVGGLT FHLYLI TNQ
Sbjct  196   YVFAMSALYIKILMGDYHGTVWKAMKESPASVVLMAYCFISLWFVGGLTGFHLYLIGTNQ  255

Query  781   TTYENFRYRYDRRANPYNKGVVENFMEIFCTSIPPSKNDFRA----KVPRDPALAARHTA  948
             TTYENFRYR D R N YN+G + NF+E+FCT   PS+N+FRA    +VPR P + AR   
Sbjct  256   TTYENFRYRADSRPNVYNRGCLSNFLEVFCTKTKPSRNNFRAFVQEEVPRPPMVRAREPE  315

Query  949   GGFVSPNMGKAVE-DIEMGRKAVWGDVGAEHQEGQLSDNDGVNMKEGGGLGEMSPEIRTT  1125
                 S +    VE D+E+G     GD+    Q     + + ++ + G      S E    
Sbjct  316   VDESSGDQRAKVEDDLEIG-----GDLLKISQRRNFEEVEDIHSR-GSNEHHDSSEADFV  369

Query  1126  VDEGDRAAMHHPrrsswg--rksgswEMSPEVLALASRVGEGNRMG  1257
             +    +     P        R+SGSWE+SP++LA+ S V E    G
Sbjct  370   LGSDSQVPAARPEARHSSWGRRSGSWEISPDILAMNSGVNESRSFG  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600